National Library of Energy BETA

Sample records for officer fr doc

  1. V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerabilit...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability June 25, 2013 - 12:41am Addthis PROBLEM: ...

  2. DOE/Grand Junction Office Bluewater LTSP July 1997 Doc. No. S00012AA...

    Office of Legacy Management (LM)

    DOEGrand Junction Office Bluewater LTSP July 1997 Doc. No. S00012AA, Page iii Contents Page 1.0 Introduction ......

  3. V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy 5: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability June 25, 2013 - 12:41am Addthis PROBLEM: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability PLATFORM: Apache OpenOffice SDK 3.x ABSTRACT: Apache has acknowledged a vulnerability in Apache OpenOffice SDK REFERENCE LINKS: Apache OpenOffice Secunia Advisory SA53963 Secunia Advisory SA53846 CVE-2013-1571 IMPACT ASSESSMENT:

  4. Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc (160.81 KB) More Documents & Publications Notice of Proposed Rulemaking (August 6, 2009) Notice of Proposed Rulemaking (May 16, 2007) Final Rule (December 4, 2009)

  5. fed_finance_facilities_ee_upgrades_deployment.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc Microsoft Office document icon ...

  6. finance_programs.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    financeprograms.doc financeprograms.doc financeprograms.doc Microsoft Office document icon financeprograms.doc More Documents & Publications Tools for Designing & Implementing ...

  7. OSTIblog Articles in the Adopt-A-Doc Topic | OSTI, US Dept of Energy Office

    Office of Scientific and Technical Information (OSTI)

    of Scientific and Technical Information Adopt-A-Doc Topic OSTI Is Re-Focusing and Re-Balancing Its Operations - And Refreshing Its Home Page - to Advance Public Access by Dr. Jeffrey Salmon 03 Mar, 2014 in Products and Content 16895 STIP_slide.jpg OSTI Is Re-Focusing and Re-Balancing Its Operations - And Refreshing Its Home Page - to Advance Public Access Read more about 16895 Let's call it creative destruction, borrowing from a popular term in economics. The idea is that the very essence of

  8. csep_transcript_arlington.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Office document icon cseptranscriptarlington.doc More Documents & Publications Tools for Designing & Implementing Better Finance Programs financeprograms.doc financeprograms

  9. Microsoft Word - S06654_ESL.doc

    Office of Environmental Management (EM)

    on Smart Grid RFI RedSeal Systems, Inc. 1 October 29, 2010 Office of Electricity Delivery and Energy Reliability US Department of Energy Room 8H033 1000 Independence Avenue, SW Washington, DC 20585 Re: Comments on "Smart Grid RFI: Addressing Policy and Logistical Challenges" 75 FR 57006 [FR Doc. 2010-23251] From: Steve Dauber Vice-President, Marketing RedSeal Systems 2121 South El Camino Real, Suite 300 San Mateo, CA 94403 Ph: 650-645-6209 sdauber@redseal.net www.redseal.net RedSeal

  10. Savannah River Operations Office Interim Managemnet of Nuclear

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    099 Federal Register / Vol. 62, No. 220 / Friday, November 14, 1997 / Notices Barbara A. Carmichael, Alternate Air Force Federal Register Liaison Officer. [FR Doc. 97-29919 Filed 11-13-97; 8:45 am] BILLING CODE 3910-01-P DEPARTMENT OF EDUCATION Notice of Proposed Information Collection Requests AGENCY: Department of Education. ACTION: Proposed collection; comment request. SUMMARY: The Deputy Chief Information Officer, Office of the Chief Information Officer, invites comments on the proposed

  11. Microsoft Word - DOETTQuestions.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    DOETTQuestions.doc Microsoft Word - DOETTQuestions.doc Microsoft Word - DOETTQuestions.doc (48.9 KB) More Documents & Publications Microsoft Word - 73FR72036_UC signed 1� Microsoft Word - SRNL Fed Register Response.doc Subcontractor Rights Under CRADAs and WFO Agreements

  12. Office of Electricity Delivery and Energy Reliability

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Comments of Cisco Systems to Office of Electricity Delivery and Energy Reliability Department of Energy in Response to Request for Information: Addressing Policy and Logistical Challenges to Smart Grid Implementation Issued September 13, 2010 FR Doc. 2010-23251 November 30, 2010 Cisco Systems provides these Comments in response to the Request for Information ("RFI") issued by the Office of Electricity Delivery and Energy Reliability of the Department of Energy ("DOE") on

  13. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    22.62 KB) More Documents & Publications Microsoft Word - FOA cover sheet.doc Recovery Act, Office of the Biomass Program,Funding Opportunity Announcements Special Notice Microsoft Word - FOA cover sheet.doc

  14. Office

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    2 Prepared by: Office of Regulation and International Engagement Division of Natural Gas Regulation Natural Gas Imports and Exports First Quarter Report 2016 LNG Trinidad and Tobago Mexico LNG Brazil United Kingdom Barbados India United Arab Emirates Canada NATURAL GAS IMPORTS AND EXPORTS FIRST QUARTER REPORT 2016 Division of Natural Gas Regulation Office of Regulation and International Engagement Office of Oil & Natural Gas Office of Fossil Energy U.S. Department of Energy 202-586-7991

  15. Microsoft Word - 2011_SER.doc

    Office of Legacy Management (LM)

    Fernald Preserve U.S. Department of Energy Office of Legacy Management Issued May 2012 ... U.S. Department of Energy Fernald Preserve 2011 Site Environmental Report May 2012 Doc. ...

  16. Office

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Legacy Management LM-1 Office of the Director Thomas Pauling Acting Director and Deputy Director Environmental Justice Public and Intergovernmental Engagement Team Tony Carter Team Leader Human Resource Management Team Patricia Poole-Shirriel Team Leader LM-20 Office of Site Operations Tania Smith Taylor Director Safety and Health LM-10 Office of Business Operations David Shafer Director Quality Assurance LM-10.2 Archives and Information Management Team Edwin Parks Team Leader LM-10.4

  17. raising_investment_funds_for_clean_energy_programs.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc Microsoft ...

  18. webinar_innovation_net_metering_interconnection.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    netmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc webinarinnovationnetmeteringinterconnec...

  19. howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc (117.5 KB) More Documents & Publications How to Design and Market Energy Efficiency Programs to Specific Neighborhoods Using Social Media to Engage the Community in Energy Efficiency

  20. highperformanceleasingstrategiesforstateandlocalgovernments.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc (93 KB) More Documents & Publications High Performance Leasing Strategies for State and Local Governments Leveraging Portfolio Manager for Disclosure and Green Leasing Practices

  1. OSTIblog Articles in the FR Topic | OSTI, US Dept of Energy Office of

    Office of Scientific and Technical Information (OSTI)

    Scientific and Technical Information FR

  2. webinar_innovation_organizing_strategizing.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    organizingstrategizing.doc webinarinnovationorganizingstrategizing.doc webinarinnovationorganizingstrategizing.doc webinarinnovationorganizingstrategizing.doc (71 KB) ...

  3. Doc...~En.

    Office of Legacy Management (LM)

    ... ..,,..,.... - .. I&i3:scD .::-:, TO-340 .":: ..' . - ' - -. ' . .." ,.. .;.. Very traly yours;, -' .X :, Doc...En. ' Br.:Re&ng ';;a' : , Div. Reading File ., ,, ., ,.-...

  4. Doc.~:Ru.

    Office of Legacy Management (LM)

    .' , .' c,j .c; Distriblition: ;. <; ..,:L.D.i&%.ay,FiN-OR00 Doc.:Ru. ,.,. 75. ' Br..Reading 'ire' ,lliv. Read&q File ,: '. ,, .-' . ...: - SURNAME.....

  5. exploringpowerpurchaseagreementsthebasicspart1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc (112.5 KB) More Documents & Publications Exploring Power Purchase Agreements - The Basics Part 1

  6. O:\IM-20\E-Government Program Office\FDMS\FDMS database\DOE\2012\Document List 03-02-2012 10-10-11-600\Document List 03-02-2012 10-10-11-600_docs\DOE-HQ-2012-0004-DRAFT-0005.html

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5.html[2/3/2012 12:41:43 PM] PUBLIC SUBMISSION As of: February 03, 2012 Received: January 17, 2012 Status: Pending_Post Tracking No. 80f99189 Comments Due: January 20, 2012 Submission Type: Web Docket: DOE-HQ-2012-0004 U.S. Department of Energy Audit Guidance: For-Profit Recipients Comment On: DOE-HQ-2012-0004-0001 Audit Guidance: For-Profit Recipients Document: DOE-HQ-2012-0004-DRAFT-0005 Comment on FR Doc # 2011-32622 Submitter Information Name: Carol Hellmann Address: US Dept of Energy 1617

  7. O:\IM-20\E-Government Program Office\FDMS\FDMS database\DOE\2012\Document List 03-02-2012 10-10-11-600\Document List 03-02-2012 10-10-11-600_docs\Robin Hindel_ Comment -DRAFT-0003.html

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Robin%20Hindel_%20Comment%20-DRAFT-0003.html[2/3/2012 12:39:35 PM] PUBLIC SUBMISSION As of: February 03, 2012 Received: January 11, 2012 Status: Pending_Post Tracking No. 80f93029 Comments Due: January 20, 2012 Submission Type: Web Docket: DOE-HQ-2012-0004 U.S. Department of Energy Audit Guidance: For-Profit Recipients Comment On: DOE-HQ-2012-0004-0001 Audit Guidance: For-Profit Recipients Document: DOE-HQ-2012-0004-DRAFT-0003 Comment on FR Doc # 2011-32622 Submitter Information Name: Robin

  8. The Office of Environmental Management (EM) Defense Environmental...

    Office of Environmental Management (EM)

    The Office of Environmental Management (EM) Defense Environmental Cleanup The Office of Environmental Management (EM) Defense Environmental Cleanup Microsoft Word - 271C2C7B.doc ...

  9. Microsoft Word - Corp Impl 10-05-06.final.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Corp Impl 10-05-06.final.doc Microsoft Word - Corp Impl 10-05-06.final.doc Microsoft Word - Corp Impl 10-05-06.final.doc (422.79 KB) More Documents & Publications ESTABLISHMENT OF MANAGEMENT DECISIONS ON OFFICE OF INSPECTOR GENERAL REPORTS, DOE O 221.3 Microsoft Word - AL2007-01.doc DOE Systems Engineering Methodology (SEM): Stage Exit V

  10. Microsoft Word - 08021395 DocProd.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy ...

  11. Microsoft Word - 08031475_DocProd.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy ...

  12. webinar_innovation_permitting_inspections.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    permittinginspections.doc webinarinnovationpermittinginspections.doc webinarinnovationpermittinginspections.doc webinarinnovationpermittinginspections.doc (70.5 KB) More ...

  13. webinar_innovation_planning_zoning.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    planningzoning.doc webinarinnovationplanningzoning.doc webinarinnovationplanningzoning.doc webinarinnovationplanningzoning.doc (65.5 KB) More Documents & Publications ...

  14. webinar_innovation_financing.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    financing.doc webinarinnovationfinancing.doc webinarinnovationfinancing.doc webinarinnovationfinancing.doc (77 KB) More Documents & Publications webinarinnovationplanningz...

  15. Microsoft Word - 2007 waste return memoGS.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    2005 FOIA ANNUAL REPORT.doc Microsoft Word - 2005 FOIA ANNUAL REPORT.doc report2005.pdf Microsoft Word - 2005 FOIA ANNUAL REPORT.doc (45.24 KB) More Documents & Publications U.S. Department of Energy 2008 Annual FOIA Report Office of Information Resources (MA-90) ANNUAL FOIA REPORT FOR 2009

    14, 2008 Generators: In the last year there have been several changes in how we handle waste verification failures. A recent memorandum (Policy on compliance of Radioactive Waste Acceptance

  16. Microsoft Word - S0131700_NOV04.doc

    Office of Legacy Management (LM)

    S0131700 DOE-LM/GJ757-2004 Office of Legacy Management Monument Valley Ground Water Remediation: Pilot Study Work Plan November 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy, Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Monument Valley GW Remediation Pilot Study Work Plan November 2004 Doc. No. S0131700 Page 3 Signature Page Authors: J. Waugh, S.

  17. Microsoft Word - U0194500July2005.doc

    Office of Legacy Management (LM)

    4500 GJO-2004-579-TAC Office of Legacy Management Refinement of Conceptual Model and Recommendations for Improving Remediation Efficiency at the Shiprock, New Mexico, Site July 2005 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Conceptual Model Refinement and Efficiency Recommendations July 2005 Doc. No.

  18. Microsoft Word - 07121310 DocProd.doc

    Office of Legacy Management (LM)

    613 2008 - - U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE AM01 07LM00060 - - December 2007 Groundwater Sampling at the Monument Valley, Arizona, Processing Site March 2008 This page intentionally left blank U.S. Department of Energy DVP-December 2007, Monument Valley, Arizona, Processing Site March

  19. Microsoft Word - ContractManagementPlanningDRIVERS.doc | Department...

    Energy.gov (indexed) [DOE]

    ContractManagementPlanningDRIVERS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS.doc Microsoft Word - ARRAMOModelMod.doc...

  20. HABadv-121.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Manager Department of Energy, Richland Operations P.O. 550 (A7-50) Richland, WA 99352 Harry Boston, Manager Department of Energy, Office of River Protection 2440 Stevens...

  1. 2B-01.doc

    Energy Savers

    ... performed under DOE contract number DE-AC01-02GJ79491 by the S.M. Stoller Corporation for the U.S. Department of Energy, Office of Legacy Man- agement, Grand Junction, Colorado. ...

  2. U0004500.DOC

    Office of Legacy Management (LM)

    155 Environmental Assessment of Ground-Water Compliance Activities at the Uranium Mill Tailings Site, Spook, Wyoming February 1997 DOE/EA-1155 Uranium Mill Tailing Remedial Action Project Environmental Assessment of Ground-Water Compliance Activities At the Uranium Mill Tailings Site Spook, Wyoming February 1997 Prepared by U.S. Department of Energy Albuquerque Operations Office Grand Junction Office Environmental Assessment of Ground-Water Compliance Activities at the Uranium Mill Tailings Site

  3. Category:NEPA Doc | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    NEPA Doc Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Category: NEPA Documents Collections Add.png Add a new NEPA Document Collection Pages in category "NEPA Doc"...

  4. spurring_local_economic_development_clean_energy_programs.doc...

    Energy.gov (indexed) [DOE]

    spurringlocaleconomicdevelopmentcleanenergyprograms.doc spurringlocaleconomicdevelopmentcleanenergyprograms.doc More Documents & Publications Spurring Local Economic...

  5. advanced_biofuels_pathways_webinar_alt_text.doc | Department...

    Energy.gov (indexed) [DOE]

    advancedbiofuelspathwayswebinaralttext.doc advancedbiofuelspathwayswebinaralttext.doc (113 KB) More Documents & Publications Sustainability for the Global Biofuels ...

  6. FIBDLFinal.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    1-0018 - In the Matter of Robert M. Balick FIA-11-0018 - In the Matter of Robert M. Balick On January 12, 2012, the Department of Energy's (DOE) Office of Hearings and Appeals (OHA) denied a Freedom of Information Act (FOIA) Appeal filed by Robert M. Balick (Appellant). The DOE's Office of Information Resources (OIR) denied the Appellant's request for a fee waiver, claiming that the Appellant had not indicated how he would disseminate the information to the public. OHA found that the Appellant

  7. Microsoft Word - AL2006-08.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    8.doc Microsoft Word - AL2006-08.doc PDF icon Microsoft Word - AL2006-08.doc More Documents & Publications AL2007-05.doc&0; Microsoft Word - AL2005-14.doc Microsoft Word - ...

  8. Microsoft Word - AL2005-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5-03.doc Microsoft Word - AL2005-03.doc PDF icon Microsoft Word - AL2005-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - AL2006-08.doc ...

  9. Microsoft Word - AL2002-03.doc | Department of Energy

    Office of Environmental Management (EM)

    2-03.doc Microsoft Word - AL2002-03.doc PDF icon Microsoft Word - AL2002-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - FAL2004-01.doc...

  10. Microsoft Word - FAL2004-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - FAL2004-01.doc PDF icon Microsoft Word - FAL2004-01.doc More Documents & Publications Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-02.doc...

  11. Microsoft Word - 98-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    8-11.doc Microsoft Word - 98-11.doc PDF icon Microsoft Word - 98-11.doc More Documents & Publications Microsoft Word - AL2006-08.doc Microsoft Word - AL2005-01.doc Microsoft Word -...

  12. deepenergyretrofitsandstateapplications.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    deepenergyretrofitsandstateapplications.doc deepenergyretrofitsandstateapplications.doc deepenergyretrofitsandstateapplications.doc deepenergyretrofitsandstateapplications.doc (117.5 KB) More Documents & Publications Deep Energy Retrofits & State Applications Sustainable Energy Resources for Consumers Webinar on Residential Geothermal Heat Pump Retrofit Transcript Interior Lighting Efficiency for Municipalities

  13. Index2.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy _____________________________________________________________________________________________ memorandum Date: October 6, 2004 Reply to Attn of: Department of Energy Headquarters FOIA/Privacy Act Office Subject: Sylvania Corporation, Hicksville, NY and Bayside, NY - Addendum to July 8, 2004 Memo to Reader To: Reader The titles of documents related to the subject matter of this file that are not listed on the July 8, 2004 Memo are listed below. The titles are preceded by the

  14. Tentative Agreement.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Tentative Agreement on Hanford Federal Facility Agreement and Consent Order (HFFACO) Negotiations for the Management of Hanford RCRA and CERCLA Wastes (HFFACO Milestone Series M-091 and M-016) The U.S. Department of Energy, Richland Operations Office (RL), the State of Washington, Department of Ecology, and the U.S. Environmental Protection Agency (EPA), hereinafter referred to as the Parties, have concluded negotiations for the management of Hanford RCRA and CERCLA wastes under HFFACO Milestone

  15. Microsoft Word - 45196.doc

    Office of Legacy Management (LM)

    24 Contaminant Boundary at the Faultless Underground Nuclear Test Prepared by Greg Pohll, Karl Pohlmann, Jeff Daniels, Ahmed Hassan and Jenny Chapman submitted to Nevada Site Office National Nuclear Security Administration U.S. Department of Energy Las Vegas, Nevada APRIL 2003 Publication No. 45196 Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation,

  16. Oct08.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    and Economic Development | Department of Energy Oct. 26 Webinar to Explore Available Financing Mechanisms for Tribal Energy and Economic Development Oct. 26 Webinar to Explore Available Financing Mechanisms for Tribal Energy and Economic Development October 20, 2016 - 5:58pm Addthis The U.S. Department of Energy (DOE) Office of Indian Energy, in partnership with Western Area Power Administration, is hosting a free webinar entitled "Accessing Capital for Tribal Energy and Economic

  17. 2010sr26.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Thursday, September 2, 2010 james-r.giusti@srs.gov SRS Federal Employees Give to Area Food Bank Aiken, SC -- Representatives of the U.S. Department of Energy's Savannah River Operations Office (DOE-SR) at the Savannah River Site delivered the sixth and final truckload of food and non perishables to the Golden Harvest Food Bank today. The 335 federal employees at SRS donated 66,292 pounds of goods in just over 30 days to feed the needy in Georgia and South Carolina. If one does the math, the

  18. Habadv-120.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    20 Subject: Fiscal Year 2002 and 2003 Budgets Adopted: June 8, 2001 Page 1 June 8, 2001 Keith Klein, Manager Department of Energy, Richland Operations P.O. 550 (A7-50) Richland, WA 99352 Harry Boston, Manager Department of Energy, Office of River Protection 2440 Stevens Richland, WA 99352 Re: Fiscal Year 2002 and 2003 Budgets Dear Messrs Klein and Boston, The U.S. Department of Energy (DOE) proposed fiscal year (FY) 2002 and preliminary FY 2003 budgets signal an intent to slow Hanford cleanup

  19. Microsoft Word - S05551_1stqtr report.doc

    Office of Legacy Management (LM)

    09 July 2009 LMS/RFS/S05551 This page intentionally left blank LMS/RFS/S05551 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2009 July 2009 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2009 July 2009 Doc. No. S05551 Page i Contents

  20. Microsoft Word - S06528_1st qtr 2010.doc

    Office of Legacy Management (LM)

    10 July 2010 LMS/RFS/S06528 This page intentionally left blank LMS/RFS/S06528 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2010 July 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2010 July 2010 Doc. No. S06528 Page i Contents

  1. Engaging Financial Institution Partners Transcript.doc | Department...

    Office of Environmental Management (EM)

    Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Microsoft ...

  2. Microsoft Word - SpecialTermsandConditions0506.doc | Department...

    Energy Savers

    Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc More Documents &...

  3. Microsoft Word - FY2005finaliparhandbook.doc | Department of...

    Energy Savers

    Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc More Documents & Publications...

  4. Microsoft Word - ARRAAttachment2.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAAttachment2.doc Microsoft Word - ARRAAttachment2.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment3.rtf Microsoft Word -...

  5. Microsoft Word - ARRAMOModelMod.doc | Department of Energy

    Energy Savers

    ARRAMOModelMod.doc Microsoft Word - ARRAMOModelMod.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS...

  6. Microsoft Word - ARRAModelWAS.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ARRAModelWAS.doc Microsoft Word - ARRAModelWAS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAMOModelMod...

  7. Microsoft Word - CMPTemplate031307.doc | Department of Energy

    Office of Environmental Management (EM)

    CMPTemplate031307.doc Microsoft Word - CMPTemplate031307.doc PDF icon Microsoft Word - CMPTemplate031307.doc More Documents & Publications Chapter 42 - Contract Administration...

  8. Microsoft Word - August06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    August06.doc Microsoft Word - August06.doc PDF icon Microsoft Word - August06.doc More Documents & Publications Microsoft Word - April

  9. Microsoft Word - FY10PropertyBSCContractor.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor.doc PDF icon Microsoft Word - FY10PropertyBSCContractor.doc More Documents & Publications Microsoft Word - ...

  10. Microsoft Word - GJPPGPracticesDraft.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    GJPPGPracticesDraft.doc Microsoft Word - GJPPGPracticesDraft.doc PDF icon Microsoft Word - GJPPGPracticesDraft.doc More Documents & Publications 1 DOE Purchase Card Policy Natural ...

  11. Microsoft Word - Cross Reference Matrix Introduction.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Cross Reference Matrix Introduction.doc Microsoft Word - Cross Reference Matrix Introduction.doc PDF icon Microsoft Word - Cross Reference Matrix Introduction.doc More Documents & ...

  12. Microsoft Word - April06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    April06.doc Microsoft Word - April06.doc PDF icon Microsoft Word - April06.doc More Documents & Publications Secretary Directs FPO to Prepare Strategic Plan Microsoft Word - August

  13. ATS Recertification Final.doc

    Office of Environmental Management (EM)

    Program Onsite Review January 7-17, 2008 U.S. Department of Energy Office of Health, Safety and Security Office of Health and Safety Office of Worker Safety and Health...

  14. Find "Hot Docs" at the Geothermal Technologies Legacy Collection | OSTI, US

    Office of Scientific and Technical Information (OSTI)

    Dept of Energy Office of Scientific and Technical Information "Hot Docs" at the Geothermal Technologies Legacy Collection Back to the OSTI News Listing for 2008 The Legacy Collection Now you can get "Hot Docs" from the Geothermal Technologies Legacy Collection. These are documents that have been searched for and downloaded more than any other documents in the collection during the previous month and each preceding month. "Hot Docs" are highlighted for

  15. Ammendment 2.doc | Department of Energy

    Energy.gov (indexed) [DOE]

    Ammendment 2.doc More Documents & Publications Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&0; RFQ DE-RQ01-04ME90001.doc&0; Attachment 3-Past Performance...

  16. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Doc. No. S06401 June 2010 Page B-2 U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. ...

  17. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page I-3 U n c o n t r o l l e d c o p y Long-Term Surveillance and Maintenance ...

  18. Microsoft Word - AL2005-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    7.doc Microsoft Word - AL2005-07.doc PDF icon Microsoft Word - AL2005-07.doc More Documents & Publications Microsoft Word - AL2006-07.doc OPAM Policy Acquisition Guides Initial ...

  19. Microsoft Word - AL2005-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - AL2005-01.doc PDF icon Microsoft Word - AL2005-01.doc More Documents & Publications Microsoft Word - AL2006-08.doc Acquisition Letter Archive listing ...

  20. Microsoft Word - AL2006-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - AL2006-01.doc PDF icon Microsoft Word - AL2006-01.doc More Documents & Publications Microsoft Word - al2005-06.doc Chapter 19 - Small Business Programs OPAM...

  1. Microsoft Word - Flash2007-43.doc | Department of Energy

    Office of Environmental Management (EM)

    43.doc Microsoft Word - Flash2007-43.doc Microsoft Word - Flash2007-43.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash...

  2. Microsoft Word - AL2005-16.doc | Department of Energy

    Office of Environmental Management (EM)

    6.doc Microsoft Word - AL2005-16.doc PDF icon Microsoft Word - AL2005-16.doc More Documents & Publications Microsoft Word - AL2005-10.doc Audit Report: IG-0860 Microsoft Word -...

  3. Microsoft Word - AL2005-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5-02.doc Microsoft Word - AL2005-02.doc PDF icon Microsoft Word - AL2005-02.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc...

  4. Microsoft Word - AL2006-02.doc | Department of Energy

    Energy Savers

    2.doc Microsoft Word - AL2006-02.doc PDF icon Microsoft Word - AL2006-02.doc More Documents & Publications Microsoft Word - AL2006-03.doc Archived Financial Assistance Letters...

  5. Microsoft Word - AL2006-03.doc | Department of Energy

    Energy Savers

    3.doc Microsoft Word - AL2006-03.doc PDF icon Microsoft Word - AL2006-03.doc More Documents & Publications Microsoft Word - AL2006-02.doc Archived Financial Assistance Letters...

  6. Microsoft Word - al2005-04.doc | Department of Energy

    Energy Savers

    al2005-04.doc Microsoft Word - al2005-04.doc PDF icon Microsoft Word - al2005-04.doc More Documents & Publications AL2005-04ClassDeviation.pdf Microsoft Word - Matrixpart2.doc...

  7. Microsoft Word - AL2005-14.doc | Department of Energy

    Office of Environmental Management (EM)

    4.doc Microsoft Word - AL2005-14.doc PDF icon Microsoft Word - AL2005-14.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc...

  8. al99-06attachment.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    attachment.doc&0; al99-06attachment.doc&0; PDF icon al99-06attachment.doc&0; More Documents & Publications Microsoft Word - AL2000-05Attachment.doc Microsoft Word - NSRC...

  9. Microsoft Word - FWP- Fact Sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FWP- Fact Sheet.doc Microsoft Word - FWP- Fact Sheet.doc PDF icon Microsoft Word - FWP- Fact Sheet.doc More Documents & Publications Microsoft Word - FOA cover sheet.doc Microsoft ...

  10. Microsoft Word - AL2005-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2005-10.doc Microsoft Word - AL2005-10.doc Microsoft Word - AL2005-10.doc (133.11 KB) More Documents & Publications Microsoft Word - AL2005-16.doc Audit Report: IG-0860 Microsoft ...

  11. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    SAR.doc Microsoft Word - PeerReviewSAR.doc Microsoft Word - PeerReviewSAR.doc (13.47 KB) More Documents & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross ...

  12. Index2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Index2.doc Index2.doc Index2.doc (11.46 KB) More Documents & Publications Sylvania Corporation, Hicksville, NY and Bayside, NY - Addendum to July 8, 2004 O:\HOMEPAGE\FOIA\report99.PDF&#0; U.S. Department of Energy 2004 Annual Report

  13. SubcontractingGuidelines.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; (245.71 KB) More Documents & Publications Guidance of the Department of Energy Subcontracting Program Acquisition Guide Chapter 19 Update Chapter 19 - Small Business Programs

  14. Office of the Executive Secretariat

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Executive Secretariat, MA-70 Acting Director Carol A. Matthews Special Projects Security Policy and Analysis Group Programmatic Expertise High-level Review and Analysis Correspondence Management Group Correspondence Control & Assignment Correspondence Support FOIA Management Special Projects Receiving and Delivery Administration and Executive Commitments Group eDOCS Executive Commitments Information Management Budget Personnel Administration Office of History and Heritage Resources

  15. Microsoft Word - Matrixpart1.doc | Department of Energy

    Energy.gov (indexed) [DOE]

    Matrixpart1.doc More Documents & Publications Part 1, Clauses Prescribed in FAR Part 52 Microsoft Word - Matrixpart2.doc...

  16. Microsoft Word - RIN 07081119 DocProd.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy ...

  17. csep_transcript_aspen.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    aspen.doc csep_transcript_aspen.doc csep_transcript_aspen.doc csep_transcript_aspen.doc (45.5 KB) More Documents & Publications highperformanceleasingstrategiesforstateandlocalgovernments.doc Using Social Media to Engage the Community in Energy Efficiency Projects.doc webinar_innovation_permitting_inspections

  18. csep_transcript_minneapolis.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    minneapolis.doc csep_transcript_minneapolis.doc csep_transcript_minneapolis.doc csep_transcript_minneapolis.doc (60.5 KB) More Documents & Publications newguideforcommunityenergystrategicplanning.doc csep_transcript_aspen.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, 2011 (Text Version)

  19. Microsoft Word - AL2007-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    7-01.doc Microsoft Word - AL2007-01.doc Microsoft Word - AL2007-01.doc (151.65 KB) More Documents & Publications Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc Microsoft Word - Corp Impl 10-05-06.final.doc Microsoft Word - AL2006-11.doc

  20. Energy.gov Mini-Doc: Behind the Scenes at the Collegiate Wind Competition |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Energy.gov Mini-Doc: Behind the Scenes at the Collegiate Wind Competition Energy.gov Mini-Doc: Behind the Scenes at the Collegiate Wind Competition July 5, 2016 - 11:15am Addthis Simon Edelman Simon Edelman Chief Creative Officer Paul Lester Paul Lester Digital Content Specialist, Office of Public Affairs In this short documentary, we follow three student teams who participated in the 2016 U.S. Department of Energy Collegiate Wind Competition in New Orleans. The

  1. Microsoft Word - S0195200.doc

    Office of Legacy Management (LM)

    Office of Legacy Management U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 ...

  2. Microsoft Word - S0180700.doc

    Office of Legacy Management (LM)

    Office of Legacy Management DOE MGJ896-2005 -L U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. ...

  3. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Office of Legacy Management DOE M1465 2007 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for ...

  4. Microsoft Word - S03274.DOC

    Office of Legacy Management (LM)

    Office of Legacy Management - - Work Performed Under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management. Approved for public release; ...

  5. Microsoft Word - S0255900.doc

    Office of Legacy Management (LM)

    September 2006 Office of Legacy Management DOE M1301-2006 -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 ...

  6. Microsoft Word - S0244800.doc

    Office of Legacy Management (LM)

    5 Through March 2006 for the Shiprock, New Mexico, Site July 2006 Office of Legacy Management DOE M/GJ1212-2006 -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy DOE-LM/GJ1212-2006 Annual Performance Report April 2005 Through March 2006 for the Shiprock, New

  7. Microsoft Word - S02996.doc

    Office of Legacy Management (LM)

    Report for the Riverton, Wyoming, Processing Site Update for 2006 March 2007 Office of Legacy Management DOE M/1442 2007 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy This page intentionally left blank DOE-LM/1442-2007 Verification Monitoring Report for

  8. The Office of Environmental Management Non-Defense Environmental...

    Energy Savers

    Non-Defense Environmental Cleanup The Office of Environmental Management Non-Defense Environmental Cleanup Microsoft Word - 8E2A4440.doc (100.45 KB) More Documents & Publications ...

  9. The Office of Environmental Management Uranium Enrichment D&D...

    Energy Savers

    Uranium Enrichment D&D The Office of Environmental Management Uranium Enrichment D&D Microsoft Word - B996F741.doc (100.04 KB) More Documents & Publications Microsoft Word - PSRP ...

  10. Partnering Policy for the Office of Environmental Management | Department

    Office of Environmental Management (EM)

    of Energy Policy for the Office of Environmental Management Partnering Policy for the Office of Environmental Management Partnering Policy for the Office of Environmental Management (448.69 KB) More Documents & Publications DOE Project Management Risk Committee (PMRC) SOP Microsoft Word - ADR Revised Policy82508Reformatted.doc OMB and CEQ Joint Memorandum on Environmental Collaboration and Conflict Resolution (CEQ, 2012)

  11. Microsoft Word - BEPA.doc

    National Nuclear Security Administration (NNSA)

    ... or other agreement pursuant to U.S. Fish and Wildlife Service Office of Law ... into cooperative agreements with State fish and wildlife agencies or other appropriate ...

  12. Microsoft Word - Award.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    and Engineering, Inc. has been awarded a five-year contract to provide specialized environmental technical support services to the Carlsbad Field Office, located in...

  13. PIC DOC 01/08/11 ? SOS

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    PIC DOC 010811 - SOS Content Outline 1) Usable Quotes We shouldn't equate public involvement with meetings. Maynard Plahuta Meetings, of many kinds, are probably the most...

  14. Associate Research Physicist (Post Doc, Experimental Research...

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Post Doc, Experimental Research, NSTX-U, Radio Frequency Waves) Department: Research Staff: RM1 Requisition Number: 1500421 The Princeton Plasma Physics Laboratory (PPPL) seeks to...

  15. Microsoft Word - S0162200_VariationHydraulicConductivity-PRB.doc

    Office of Legacy Management (LM)

    DOE-LM/GJ803-2005 ESL-RPT-2005-01 Variation in Hydraulic Conductivity Over Time at the Monticello Permeable Reactive Barrier February 2005 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado U.S. Department of Energy Variation in Hydraulic Conductivity Over Time at the Monticello Permeable Reactive Barrier February 2005 Doc. No. S0162200 Page v Contents Executive

  16. csep_transcript_transportation.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    transportation.doc csep_transcript_transportation.doc csep_transcript_transportation.doc csep_transcript_transportation.doc (48 KB) More Documents & Publications csep_transcript_minneapolis.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, 2011 (Text Version) Transcript: Biomass Clean Cities Webinar - Workforce Development

  17. Microsoft Word - FAL2004-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAL2004-03.doc Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-03.doc (538.96 KB) More Documents & Publications Microsoft Word - FAL2004-01.doc Financial Assistance Letter No. FAL 2006-04 Microsoft Word - FAL2006-04.doc

  18. Microsoft Word - AL2000-05.doc | Department of Energy

    Energy Savers

    .doc Microsoft Word - AL2000-05.doc PDF icon Microsoft Word - AL2000-05.doc More Documents & Publications al99-06.doc&0; Microsoft Word - AL2000-05Attachment.doc AL2004-01r2.pdf...

  19. transcript_pv_mapper.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    transcript_pv_mapper.doc transcript_pv_mapper.doc transcript_pv_mapper.doc transcript_pv_mapper.doc (74.5 KB) More Documents & Publications PVMapper: A Tool for Energy Siting transcript_jedi_model.doc 2009 National Electric Transmission Congestion Study - San Francisco Workshop

  20. Microsoft Word - U0197300.doc

    Office of Legacy Management (LM)

    GJO-2004-591-TAC ESL-RPT-2004-03 ESL-RPT-2004-03 U0197300 Office of Legacy Management ... DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand ...

  1. Property:NEPA TieredDoc | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    TieredDoc Jump to: navigation, search Property Name NEPA TieredDoc Property Type Page This is a property of type Page. Pages using the property "NEPA TieredDoc" Showing 25 pages...

  2. Microsoft Word - al95-14.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    al95-14.doc Microsoft Word - al95-14.doc PDF icon Microsoft Word - al95-14.doc More Documents & Publications Cooperation with the New Independent States of the Former Soviet Union ...

  3. Microsoft Word - AL2006-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    7.doc Microsoft Word - AL2006-07.doc PDF icon Microsoft Word - AL2006-07.doc More Documents & Publications OPAM Policy Acquisition Guides Personal Property Management Certification ...

  4. Microsoft Word - FAC2005-27.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAC2005-27.doc Microsoft Word - FAC2005-27.doc PDF icon Microsoft Word - FAC2005-27.doc More Documents & Publications Policy Flash 2015-07 - FAC 2005-78 Policy Flash Search Listing ...

  5. Microsoft Word - al96-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    6-09.doc Microsoft Word - al96-09.doc PDF icon Microsoft Word - al96-09.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis Chapter...

  6. Microsoft Word - AL2005-08.doc | Department of Energy

    Office of Environmental Management (EM)

    8.doc Microsoft Word - AL2005-08.doc Microsoft Word - AL2005-08.doc More Documents & Publications OPAM Policy Acquisition Guides Attachment FY2011-28 OPAM Microsoft Word -...

  7. Microsoft Word - FAC2005-19.doc | Department of Energy

    Office of Environmental Management (EM)

    FAC2005-19.doc Microsoft Word - FAC2005-19.doc Microsoft Word - FAC2005-19.doc More Documents & Publications Acquisitlon Letter No. AL 2008-06 AL2008-06.pdf fac2001-27.pdf...

  8. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word -...

  9. Microsoft Word - FORM46002.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    2.doc Microsoft Word - FORM46002.doc Microsoft Word - FORM46002.doc More Documents & Publications DOE F 4600.2 ATTACHMENT FLASH 2011-46(6) Attachment FY2011-63 OPAM...

  10. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc More Documents & Publications Microsoft Word - AL 2010-07 Acquistion Letters Remaining...

  11. Microsoft Word - ARRAAttachment12v1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment12v1.doc More Documents & Publications Microsoft Word - DRAFT CRB Interview Guidance.doc Microsoft Word - ARRAGuideAttachment10v1

  12. Microsoft Word - AL2000-01.doc | Department of Energy

    Office of Environmental Management (EM)

    AL2000-01.doc Microsoft Word - AL2000-01.doc PDF icon Microsoft Word - AL2000-01.doc More Documents & Publications ALFAL 99-01 Department of Energy No Microsoft Word -...

  13. Microsoft Word - AL2008-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2008-06.doc Microsoft Word - AL2008-06.doc PDF icon Microsoft Word - AL2008-06.doc More Documents & Publications Chapter 9 - Contracting Qualifications Microsoft Word - PART...

  14. Microsoft Word - 99-04.doc | Department of Energy

    Energy.gov (indexed) [DOE]

    Word - 99-04.doc More Documents & Publications Policy Flash 2014-18 Complex-Wide Strategic Sourcing Microsoft Word - AL2000-01.doc Microsoft Word - AL2005-11.doc...

  15. Microsoft Word - AL2006-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    0.doc Microsoft Word - AL2006-10.doc PDF icon AL2006-10 More Documents & Publications Microsoft Word - Matrixpart2.doc Microsoft Word - AcqGuide70pt52Matrixpart2Redo...

  16. Microsoft Word - AL2004-02.doc | Department of Energy

    Energy.gov (indexed) [DOE]

    Microsoft Word - AL2004-02.doc More Documents & Publications Microsoft Word - AL2005-02.doc Microsoft Word - al2005-04.doc Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all...

  17. Microsoft Word - al95-06.doc | Department of Energy

    Energy Savers

    5-06.doc Microsoft Word - al95-06.doc PDF icon Microsoft Word - al95-06.doc More Documents & Publications ppl970-1.pdf Audit Report: IG-0589 Inspection Report: INS-O-02-01...

  18. Microsoft Word - meritrev.doc | Department of Energy

    Energy Savers

    Microsoft Word - meritrev.doc Microsoft Word - meritrev.doc PDF icon Microsoft Word - meritrev.doc More Documents & Publications Policy Flash 2013-38 Revised Merit Review Guide For...

  19. Operating Guidelines Appendix C D.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Operating Guidelines Appendix C D.DOC&0; Operating Guidelines Appendix C D.DOC&0; PDF icon Operating Guidelines Appendix C D.DOC&0; More Documents & Publications Operating ...

  20. Microsoft Word - AL2006-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2006-11.doc Microsoft Word - AL2006-11.doc PDF icon Microsoft Word - AL2006-11.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis...

  1. Microsoft Word - FAL2006-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAL2006-03.doc Microsoft Word - FAL2006-03.doc PDF icon Microsoft Word - FAL2006-03.doc More Documents & Publications Financial Assistance Letter No. FAL 2006-03 Microsoft Word - ...

  2. Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc |...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Speech 082508 FINAL.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc More Documents & Publications Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc ...

  3. Microsoft Word - 2005 FOIA ANNUAL REPORT.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    2005 FOIA ANNUAL REPORT.doc Microsoft Word - 2005 FOIA ANNUAL REPORT.doc report2005.pdf PDF icon Microsoft Word - 2005 FOIA ANNUAL REPORT.doc More Documents & Publications U.S. ...

  4. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2008-05.doc Microsoft Word - AL2008-05.doc PDF icon Microsoft Word - AL2008-05.doc More Documents & Publications Acquisition Letters Remaining In Effect Acquisition Letters ...

  5. Microsoft Word - Matrixpart2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Matrixpart2.doc Microsoft Word - Matrixpart2.doc PDF icon Microsoft Word - Matrixpart2.doc More Documents & Publications AcqGuide70.52Matrixpart2Redo-OPAM Microsoft Word - ...

  6. Microsoft Word - al2004-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    al2004-03.doc Microsoft Word - al2004-03.doc PDF icon Microsoft Word - al2004-03.doc More Documents & Publications Acquisition Letter: AL2005-08 OPAM Policy Acquisition Guides ...

  7. Microsoft Word - FY09PropertyBSCContractor.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FY09PropertyBSCContractor.doc Microsoft Word - FY09PropertyBSCContractor.doc PDF icon Microsoft Word - FY09PropertyBSCContractor.doc More Documents & Publications FY09 Property ...

  8. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAL2004-05.doc Microsoft Word - FAL2004-05.doc PDF icon Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word - Section ...

  9. Microsoft Word - Brochure_Senior Officials.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    BrochureSenior Officials.doc Microsoft Word - BrochureSenior Officials.doc Microsoft Word - BrochureSenior Officials.doc (29.28 KB) More Documents & Publications Preservation of ...

  10. Microsoft Word - CSATCourseCatalog_02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    CSATCourseCatalog02.doc Microsoft Word - CSATCourseCatalog02.doc classroom-1008856960720.jpg Microsoft Word - CSATCourseCatalog02.doc (554.38 KB) More Documents & Publications ...

  11. Microsoft Word - May2009.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    May2009.doc Microsoft Word - May2009.doc Microsoft Word - May2009.doc (6.77 MB) More Documents & Publications Special Resource StudyEnvironmental Assessment for Manhattan Project ...

  12. Office of Enterprise Assessments Targeted Review of Radiological...

    Energy.gov (indexed) [DOE]

    and Repair Area EA DOE Office of Enterprise Assessments EPD Electronic Pocket Dosimeter ESDH Environment, Safety and Health Division ES&H Environment, Safety and Health FR...

  13. Operating Guidelines Appendix A B.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Operating Guidelines Appendix A B.DOC&#0; Operating Guidelines Appendix A B.DOC&#0; Operating Guidelines Appendix A B.DOC&#0; (73.17 KB) More Documents & Publications Operating Guidelines Appendix C D.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; DOE HR Guidebook 12_15_05.DOC&#0;

  14. AL2007-02.doc

    Energy.gov (indexed) [DOE]

    (FAR) or Department of Energy Acquisition Regulation (DEAR) policy. Contact Rose Johnson at Rosemary.Johnson@hq.doe.gov or (202) 287-1552 in the Office of Contract and...

  15. Microsoft Word - Matrixpart1.doc

    Energy Savers

    or (g) Exempt under regulations of the Secretary of Labor (29 CFR 5.15). 52.222-6 Davis-Bacon Act Jul 2005 A A I 22.407(a)(1) The contracting officer shall insert the...

  16. Microsoft Word - U0195900.doc

    Office of Legacy Management (LM)

    GJO-2004-589-TAC ESL-RPT-2004-02 ESL-RPT-2004-02 U0195900 Office of Legacy Management ... Number U0195900 Contents DOEOffice of Legacy Management Diffusion Multilayer Sampling ...

  17. Microsoft Word - S01409.doc

    Office of Legacy Management (LM)

    GJ - - 724 2004 U.S. Department of Energy Interim Remedial Action Report Monticello Mill ... Corporation for the U.S. Department of Energy Office of Legacy Management, Grand ...

  18. Microsoft Word - LLNLHRPfinal062606.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    HUMAN RELIABILITY PROGRAM AT LAWRENCE LIVERMORE NATIONAL LABORATORY U.S. Department of Energy Office of Inspector General Office of Inspections and Special Inquiries Inspection Report The Human Reliability Program at Lawrence Livermore National Laboratory DOE/IG-0732 June 2006 THE HUMAN RELIABILITY PROGRAM AT LAWRENCE LIVERMORE NATIONAL LABORATORY TABLE OF CONTENTS OVERVIEW Introduction and Objective 1 Observations and Conclusions 2 DETAILS OF FINDINGS Drug and Alcohol Test Random Selection

  19. Microsoft Word - August06.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    August 2006 Office of History and Heritage Resources Volume 2, Number 2 In This Issue * B-Reactor Study for Deputy Secretary * Museum and Visitor Center Conference * National Park Service Manhattan Project Resource Study * DOE Headquarters Museum/Visitor Center * Want to Receive Partners in Preservation? * 2007 DOE Cultural Resources Forum: Hanford, Washington * 2006 DOE Cultural Resources Forum: Oak Ridge, Tennessee * K-25 Racetrack? * FPO Funds Field Office Preservation * Pantex Donates Cold

  20. Microsoft Word - IG-0780.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Inspection Report Work Order Estimate and Cost Issues for Site Support Services at Los Alamos National Laboratory DOE/IG-0780 October 2007 U.S. Department of Energy Office of Inspector General Office of Inspections and Special Inquiries WORK ORDER ESTIMATE AND COST ISSUES FOR SITE SUPPORT SERVICES AT LOS ALAMOS NATIONAL LABORATORY TABLE OF CONTENTS OVERVIEW Introduction and Objectives 1 Observations and Conclusions 2 DETAILS OF FINDINGS Estimated Cost 4 Labor and Material Charges 5 Internal

  1. Microsoft Word - IG-0784.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Inspection Report The Department of Energy's Pandemic Influenza Planning DOE/IG-0784 December 2007 U.S. Department of Energy Office of Inspector General Office of Inspections and Special Inquiries THE DEPARTMENT OF ENERGY'S PANDEMIC INFLUENZA PLANNING TABLE OF CONTENTS OVERVIEW Introduction and Objective 1 Observations and Conclusions 2 Background 3 DETAILS OF FINDINGS Pandemic Plans 4 Coordination of Vaccines and Antivirals 6 Monitoring Team Positions 7 Attendance Process 7 Social Distancing

  2. Microsoft Word - CERFDOE Final Report - 071204.doc | Department...

    Office of Environmental Management (EM)

    Microsoft Word - CERFDOE Final Report - 071204.doc (394.42 KB) More Documents & Publications Integrated Project Team RM DOE EIR FM.doc Independent Oversight Activity Report, ...

  3. DOE EIR FM.doc | Department of Energy

    Office of Environmental Management (EM)

    EIR FM.doc PDF icon DOE EIR FM.doc More Documents & Publications Contractor Statement of Work (SOW) Template (for EIR) External Independent Review (EIR) Standard Operating...

  4. Microsoft Word - ADR-Provisions-FederalAcquisitionReg.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications ADR Provisions in Federal Acquisition Regulation (FAR) Microsoft Word - ACQUISITION LETTER.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc...

  5. Microsoft Word - AL2005-12.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon Microsoft Word - AL2005-12.doc More Documents & Publications Microsoft Word - AL2005-11.doc OPAM Policy Acquisition Guides Chapter 31 - Contract Cost Principles...

  6. expanding_chp_in_your_state.doc | Department of Energy

    Energy.gov (indexed) [DOE]

    expandingchpinyourstate.doc expandingchpinyourstate.doc (130 KB) More Documents & Publications Combined Heat and Power: Expanding CHP in Your State Sustainable Energy ...

  7. Design Potential of Metal Foil Substrates for Optimized DOC Performanc...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Design Potential of Metal Foil Substrates for Optimized DOC Performance Design Potential of Metal Foil Substrates for Optimized DOC Performance Poster presentation at the 2007 ...

  8. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Energy Savers

    & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross Reference Matrix Introduction.doc Assessment of the Effects of Climate Change on Federal Hydropower...

  9. Microsoft Word - RIN 06110582_DocProd.doc

    Office of Legacy Management (LM)

    448 2007 - - U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE-AC01-02GJ79491 December 2006, Monument Valley, Arizona This page intentionally left blank U.S. Department of Energy DVP⎯December 2006, Monument Valley, Arizona March 2007 RIN 06110582 Page iii Contents Sampling Event Summary

  10. n0053200-sitewide.doc

    Office of Legacy Management (LM)

    3200 GJO-PIN 11.6.2 Pinellas Environmental Restoration Project Sitewide Environmental Monitoring Quarterly Progress Report for the Young-Rainey STAR Center April through June 2002 July 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-02GJ79491 Task Order Number ST02-107 Document Number N0053200 Contents DOE/Grand Junction Office Pinellas Environmental Restoration Project July 2002 Page iii Contents Page

  11. Microsoft Word - U0186500.doc

    Office of Legacy Management (LM)

    500 GJO-2003-487-TAC GJO-GWSHP 11.7 UMTRA Ground Water Project Wildlife Management Plan for the Evaporation Pond at the Shiprock, New Mexico, UMTRA Site September 2003 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC-13-02GJ79491 Document Number U0186500 DOE/Grand Junction Office Wildlife Management PlanShiprock Evaporation Pond September 2003 Page 1 1.0 Introduction The Proposed Action in the Environmental

  12. Microsoft Word - Summary.doc

    Office of Environmental Management (EM)

    Letter Report on "Allegations of Retaliation at a Department Site" S10IS013 September 29, 2010 Department of Energy Office of Inspector General This is a summary of Inspection Letter Report S10IS013 dated September 22, 2010, pertaining to a "Review of Allegations Involving Potential Retaliation" at a Department Site. The complete report is not available for public disclosure. Public release is controlled pursuant to the Freedom of Information Act. The Office of Inspector

  13. Microsoft Word - Matrixpart2.doc

    Office of Environmental Management (EM)

    BEFORE THE DEPARTMENT OF ENERGY OFFICE OF ELECTRICITY DELIVERY AND ENERGY RELIABILITY In the Matter of Addressing policy and logistical challenges To Smart Grid implementation. _________________________________________ COMMENTS OF THE MICHIGAN PUBLIC SERVICE COMMISSION STAFF TO REQUEST FOR INFORMATION REGARDING SMART GRID POLICY DOE: Addressing Policy and Logistical Challenges to Smart Grid Implementation The Michigan Public Service Commission Staff (MPSC Staff) commends the Department of Energy

  14. Edwin Parks (Doc) | Department of Energy

    Office of Environmental Management (EM)

    Doc Parks has over 27 years of active-duty military service with the U.S. Air Force (USAF), serving a broad range of command and staff positions in nuclear operations policy, ...

  15. Microsoft Word - Appendix N_Historical.doc

    Office of Legacy Management (LM)

    N Example Historical Marker and Plaque U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page N-3 Weldon Spring Site LTS&M Plan U.S. Department of...

  16. Form:NEPA Doc | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    NEPA Doc Jump to: navigation, search Input the name of a NEPA Document below. If the document already exists, you will be able to edit its information. AddEdit a NEPA Document...

  17. Office of International Affairs | Department of Energy

    U.S. Department of Energy (DOE) - all webpages

    International Affairs Search Search form Search Office of International Affairs Office of International Affairs Services Initiatives Initiatives Home Climate Action Plan Clean Energy Ministerial DOC-DOE Joint Trade Mission to China Energy and Climate Partnership of the Americas International Commitments International Commitments Home Primer Glossary & Acronyms International Energy Agency Turkey Near-Zero Zone U.S.-Africa Energy Ministerial U.S.-Canada Clean Energy Dialogue (CED) U.S.-China

  18. Microsoft Word - Chapter 05 a.doc | Department of Energy

    Office of Environmental Management (EM)

    Microsoft Word - Chapter 05 a.doc Microsoft Word - Chapter 05 a.doc Microsoft Word - Chapter 05 a.doc (7.05 MB) More Documents & Publications Microsoft Word - Chapter 01.doc EIS-0426: Record of Decision EIS-0426: Final Environmental Impact Statement

  19. Microsoft Word - AL2003-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2003-04.doc Microsoft Word - AL2003-04.doc Microsoft Word - AL2003-04.doc (254.1 KB) More Documents & Publications AL2004-01r2.pdf City of Tulare Renewable Biogas Fuel Cell Project Microsoft Word - AL2006-08.doc

  20. Microsoft Word - Chapter 01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Microsoft Word - Chapter 01.doc Microsoft Word - Chapter 01.doc Microsoft Word - Chapter 01.doc (10.76 MB) More Documents & Publications Microsoft Word - Chapter 05 a.doc EIS-0426: Record of Decision EIS-0426: Final Environmental Impact Statement

  1. Microsoft Word - FAL2006-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAL2006-04.doc Microsoft Word - FAL2006-04.doc Microsoft Word - FAL2006-04.doc (74.69 KB) More Documents & Publications Financial Assistance Letter No. FAL 2006-04 Microsoft Word - AL2006-03.doc Microsoft Word - FAL2004-01

  2. Microsoft Word - Federal Register Response _Jan09_.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Federal Register Response _Jan09_.doc Microsoft Word - Federal Register Response _Jan09_.doc Microsoft Word - Federal Register Response _Jan09_.doc (13.88 KB) More Documents & Publications Microsoft Word - Document2 Microsoft Word - Intellectual Property Provisions _NRD-1003_.doc Microsoft Word - ARRAAttachment12v1

  3. Microsoft Word - Final Sample Participant Profile November 2008.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Final Sample Participant Profile November 2008.doc Microsoft Word - Final Sample Participant Profile November 2008.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - DRAFT CRB Interview Guidance

  4. AcqGuide70pt5.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    pt5.doc&#0; AcqGuide70pt5.doc&#0; AcqGuide70pt5.doc&#0; (16.21 KB) More Documents & Publications Chapter 70.3102-05-6: Contractor Compensation - Variable Pay Policy Flash 2016-34 AcqGuide41pt1.doc&#0;

  5. Microsoft Word - PART 970.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PART 970.doc Microsoft Word - PART 970.doc Microsoft Word - PART 970.doc (1.03 MB) More Documents & Publications Searchable Electronic Department of Energy Acquisition Regulation Microsoft Word - Matrixpart2.doc AcqGuide70.52Matrixpart2Redo-OPAM

  6. Microsoft Word - al2005-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    al2005-06.doc Microsoft Word - al2005-06.doc Microsoft Word - al2005-06.doc (139.24 KB) More Documents & Publications Microsoft Word - AL2006-01.doc OPAM Policy Acquisition Guides Acquisition Letter: AL2005-08

  7. DOC-DOE Joint China Mission Statement | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Joint China Mission Statement DOC-DOE Joint China Mission Statement DOC-DOE Joint China Mission Statement DOC-DOE Joint China Mission Statement (109.75 KB) More Documents & Publications DOC-DOE China Mission Announcement Press Release FACT SHEET: U.S.-China Clean Energy Cooperation Announcements US-China Clean Energy Cooperation

  8. RetTrendReport1205.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    RetTrendReport1205.doc&#0; RetTrendReport1205.doc&#0; RetTrendReport1205.doc&#0; (2.58 MB) More Documents & Publications Pension Plans for Contractor Workers April 1-10 comments.doc&#0; POLICY GUIDANCE MEMORANDUM #39 Phased Retirement

  9. Office of Information Resources (MA-90) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Resources (MA-90) Office of Information Resources (MA-90) Freedom of Information 2007 Annual Report Office of Information Resources (MA-90) (220.69 KB) More Documents & Publications ANNUAL FOIA REPORT FOR 2009 U.S. Department of Energy 2008 Annual FOIA Report Microsoft Word - 2005 FOIA ANNUAL REPORT.doc

  10. SR-08-02.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Media Contacts: For Immediate Release Embargoed until August 1, 2008 DOE: Julie Petersen, (803) 952-7697 julie.petersen@srs.gov SRNS: Will Callicott, (803) 952-9583 will.callicott@srs.gov DOE Authorizes New Contractor to Begin Management and Operations of the Savannah River Site Aiken, SC - Yesterday (July 31), the U.S. Department of Energy Savannah River Operations Office (DOE-SR) Manager, Jeffrey M. Allison, and the Savannah River Nuclear Solutions (SRNS) President and Chief Executive

  11. Microsoft Word - U0127400.doc

    Office of Legacy Management (LM)

    12-TAR MAC-GWMON 1.8 Chemistry of Phase I Phytoremediation Soils: Work Plan for the Monument Valley, Arizona, UMTRA Project Site September 2001 This page intentionally left blank UMTRA Ground Water Project Chemistry of Phase I Phytoremediation Soils: Work Plan for the Monument Valley, Arizona, UMTRA Project Site September 2001 Prepared for U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Project Number UGW-511-0015-37-000 Document Number U0127400 Work Performed Under DOE

  12. Microsoft Word - s0070700.doc

    Office of Legacy Management (LM)

    Report Second Five-Year Review Report for Monticello Mill Tailings (U.S. Department of Energy) City of Monticello San Juan County, Utah June 2002 Work Performed Under DOE Contract No. DE-AC13-96GJ87335 for the U.S. Department of Energy Approved forpvbJic release; dislribution is unlimifed. DOE/Grand Junction Office Second Five-Year Report for MMTS June 2002 Page ii Five-Year Review Report Table of Contents List of Acronyms

  13. Microsoft Word - FUSRAPoverview.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    WM '06, Conference, February 26-March 2, 2006, Tucson, AZ Overview of the U.S. Department of Energy Formerly Utilized Sites Remedial Action Program (FUSRAP) C. Clayton, Program Manager, U.S. Department of Energy Office of Legacy Management Washington, DC M. Widdop, Project Manager S.M. Stoller Corporation, Grand Junction, CO 81503 ABSTRACT The U.S. Department of Energy (DOE) initiated the Formerly Utilized Sites Remedial Action Program (FUSRAP) in 1974 to address contamination remaining from

  14. Microsoft Word - IG-0576.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Inspections Inspection Report Inspection of Nuclear Safety At The Ashtabula Environmental Management Project DOE/IG-0576 November 2002 U.S. DEPARTMENT OF ENERGY Washington, DC 20585 November 26, 2002 MEMORANDUM FOR THE SECRETARY FROM: Gregory H. Friedman /s/ Inspector General SUBJECT: INFORMATION: Report on "Inspection of Nuclear Safety at the Ashtabula Environmental Management Project" BACKGROUND The Office of Inspector General, U.S. Department of Energy (DOE), conducted an inspection

  15. Microsoft Word - master.doc

    Gasoline and Diesel Fuel Update

    9 (Released January 8, 1999) Energy Information Administration DOE/EIA-0202(99/1Q) Distribution Category UC-950 Short-Term Energy Outlook January 1999 Energy Information Administration Office of Energy Markets and End Use U.S. Department of Energy Washington, DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the U.S. Department of Energy. The information contained herein should be attributed to the Energy

  16. Microsoft Word - Paper 1.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    April 19-20, 2011 Editors: Joseph H. Eto Lawrence Berkeley National Laboratory Robert J. Thomas Cornell University Proceedings Computational Needs for the Next Generation Electric Grid LBNL-5105E Computational Needs for the Next Generation Electric Grid Proceedings April 19-20, 2011 Editors: Joseph H. Eto, Lawrence Berkeley National Laboratory Robert J. Thomas, Cornell University The work described in this report was funded by the Office of Electricity Delivery and Energy Reliability of the U.S.

  17. Microsoft Word - CQA2003.doc

    Gasoline and Diesel Fuel Update

    3) Distribution Category UC-950 Cost and Quality of Fuels for Electric Plants 2002 and 2003 June 29, 2006 Energy Information Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. Department of Energy Washington DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the Department of Energy. The information contained herein should not be construed as advocating or reflecting any policy position of

  18. Microsoft Word - S0171500.doc

    Office of Legacy Management (LM)

    DOE-LM/GJ850-2005 ESL-RPT-2005-03 Alternatives for Mending a Permeable Reactive Barrier at a Former Uranium Milling Site: Monticello, Utah April 2005 Prepared for U. S. Environmental Protection Agency Region 8, Denver, Colorado Under Interagency Agreement DW89953767018 By U. S. Department of Energy Grand Junction, Colorado Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado

  19. Microsoft Word - S02808.doc

    Office of Legacy Management (LM)

    Sciences Laboratory Environmental Sciences Laboratory Prepared for U.S. Department of Energy Grand Junction, Colorado Third (March 2006) Coring and Analysis of Zero-Valent Iron Permeable Reactive Barrier, Monticello, Utah November 2006 DOE-LM/1379-2006 ESL-RPT-2006-03 Work Performed nder DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. by the S.M. Stoller Corporation u DE AC01 02GJ79491 - - Approved for public release; distribution is unlimited. This page

  20. Microsoft Word - U0197800.doc

    Office of Legacy Management (LM)

    Contaminant Rebound in Ground Water in Extraction Wells at the Tuba City, Arizona, Site April 2004 DOE-LM/GJ625-2004 ESL-RPT-2004-04 ESL-RPT-2004-04 U0197800 Analysis of Contaminant Rebound in Ground Water in Extraction Wells at the Tuba City, Arizona, Site April 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado Signature Page Document Number U0197800 Analysis of

  1. Microsoft Word - TITLE.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    CELLS FOR TRANSPORTATION 2 0 0 1 A N N U A L P R O G R E S S R E P O R T U.S. Department of Energy Energy Efficiency and Renewable Energy Office of Transportation Technologies A C K N O W L E D G E M E N T We would like to express our sincere appreciation to Argonne National Laboratory for its artistic and technical contributions in preparing and publishing this report. In addition, we would like to thank all our program participants for their contributions to the programs and all the authors

  2. Microsoft Word - M008.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    OMB Approval 2700-0042 1. CONTRACT ID CODE PAGE OF PAGES AMENDMENT OF SOLICITATION/MODIFICATION OF CONTRACT 1 63 2. AMENDMENT/MODIFICATION NO. 3. EFFECTIVE DATE 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) M008 See Block 16C N/A 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Richland Operations Office P. O. Box 550, MSIN A7-80 Richland, WA 99352 Same as item 6. 8. NAME AND ADDRESS OF CONTRACTOR (No. Street, county, State and ZIP:

  3. Microsoft Word - M084.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    4 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  4. Microsoft Word - summer.doc

    Gasoline and Diesel Fuel Update

    8, 1998 http://www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 . 7 5 Dollars Per Million BTU N Y M E X S e t t l e m e n t P r ic e H e n r y H u b S p o t N o te : T h e H e n r y H u b s p o t p r ic e is fr o m th e G A S D A I L Y a n d is th e m id p o in t o f th e ir h ig h a n d lo w p r ic e f o r a d a y . 0 . 0 0 M A Y - 9 8 J U N E - 9 8 J U L - 9 8 A U G - 9 8 S E P T - 9 8 T e n - Y e a r A

  5. Microsoft Word - winter.doc

    Gasoline and Diesel Fuel Update

    3, 1998 http://www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 .2 5 1 .5 0 1 .7 5 2 .0 0 2 .2 5 2 .5 0 2 .7 5 Dollars Per Million BTU N Y M E X S e ttle m e n t P ri c e H e n r y H u b S p o t N o t e : T h e H e n r y H u b s p o t p r ic e is fr o m th e G A S D A I L Y a n d is th e m id p o in t o f th e ir h ig h a n d lo w p r ic e fo r a d a y . T h e d a t e s m a r k e d b y v e r t ic a l lin e s a r e th e N Y M E X n e a r - m o n th c o n

  6. Ombuds Office

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Ombuds Office Ombuds Office The mission of the Ombuds Office is to enhance communication and mitigate conflict at the Laboratory. Contact (505) 665-2837 Email Anonymous Helpline (505) 667-9370 Ombuds program is an independent, neutral, impartial, confidential, and informal process The Ombuds Office provides a confidential and impartial alternative for assistance with informal complaint resolution, problem solving, and communication. The Ombuds Office operates in accordance with the standards of

  7. Microsoft Word - Clay Memo PMC Coburn Obama 11_9_06.doc | Department...

    Office of Environmental Management (EM)

    Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc More Documents & Publications...

  8. Microsoft Word - DP_cover_and_front matter_FINAL1.DOC | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FINAL1.DOC Microsoft Word - DPcoverandfront matterFINAL1.DOC PDF icon Microsoft Word - DPcoverandfront matterFINAL1.DOC More Documents & Publications Microsoft Word - ...

  9. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc PDF icon Microsoft Word - TSLCC 200750508 rev 1.doc More Documents & Publications FY 2007 Total System ...

  10. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of...

    Office of Environmental Management (EM)

    TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc More Documents & Publications FY 2007 Total System Life...

  11. Microsoft Word - S0226100June 2006.doc

    Office of Legacy Management (LM)

    5 July 2006 Office of Legacy Management DOE MGJ1213-2006 -L DOE MGJ1213-2006 -L U.S. Department of Energy Office of Legacy Management U.S. Department of Energy Office of Legacy ...

  12. AcqGuide4pt2.doc

    Energy.gov (indexed) [DOE]

    Background The Office of Public Affairs is responsible for collecting and disseminating information about the Department's programs, missions, and activities. The Office of Public ...

  13. Microsoft Word - EA March 05.doc

    Office of Legacy Management (LM)

    by U.S. Department of Energy Office of Legacy Management Grand Junction, Colorado Work ... Page Intentionally Blank DOE Office of Legacy Management EA of Ground Water Compliance ...

  14. Office | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Office Jump to: navigation, search Building Type Office Definition Buildings used for general office space, professional office, or administrative offices. Medical offices are...

  15. Microsoft Word - Appendix D_LegalDescription.doc

    Office of Legacy Management (LM)

    Site LTS&M Plan July 2005 Doc. No. S0079000 Page D-3 Figure D-1. DOE Property Boundary for the Chemical Plant Area Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. ...

  16. AcqGuide39pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon AcqGuide39pt1.doc&0; More Documents & Publications Chapter 39 - Acquisition of Information Technology AcqGuide38pt1.doc&0; Microsoft Word - AcqGuide16pt1...

  17. AcqGuide70pt31.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon AcqGuide70pt31.doc&0; More Documents & Publications Microsoft Word - AcqGuide70pt31A.doc Policy Flash 2014-26 Acquisition Guide Chapter 70.31A - Costs...

  18. AcqGuide47pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AcqGuide47pt1.doc&0; PDF icon AcqGuide47pt1.doc&0; More Documents & Publications Chapter 47 - Transportation TEC Working Group Topic Groups Manual Review Key Documents ...

  19. Microsoft Word - N01747_Bldg 100 SAR.doc

    Office of Legacy Management (LM)

    blank U.S. Department of Energy Building 100 Area Site Assessment Report August 2012 Doc. ... 59 Building 100 Area Site Assessment Report U.S. Department of Energy Doc. No. ...

  20. Microsoft Word - DOENV--FY2007.doc

    National Nuclear Security Administration (NNSA)

    Office Las Vegas, Nevada This page intentionally left blank TABLE OF CONTENTS 1.0 INTRODUCTION......

  1. stat_webinar_070913_transcript.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    stat_webinar_070913_transcript.doc stat_webinar_070913_transcript.doc stat_webinar_070913_transcript.doc stat_webinar_070913_transcript.doc (64.5 KB) More Documents & Publications Final Report -Regulatory and Utility Solutions to Advance SunShot Initiative Goals Connecting-to-the-Grid-Guide-6th-edition.pdf Community Renewables: Model Program Rules

  2. 20130226_sunshot_transcript_lbnl.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc (73.5 KB) More Documents & Publications Why Are Resiential PV Prices in Germany So Much Lower Than in the United States? text_alternative_stat_webinar_2012_7_25.docx An Analysis of Residential PV System Price Differences between the United States and Germany

  3. Microsoft Word - ALonEO13423Last.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ALonEO13423Last.doc Microsoft Word - ALonEO13423Last.doc PDF icon Microsoft Word - ALonEO13423Last.doc More Documents & Publications Microsoft Word - AL2008-05.doc Tri-Party ...

  4. Microsoft Word - ITSI award doc 06-D0008 conformed to P00001...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ITSI award doc 06-D0008 conformed to P00001.doc Microsoft Word - ITSI award doc 06-D0008 conformed to P00001.doc More Documents & Publications Policy Flash 2015-02 Acquisition ...

  5. Microsoft Word - Flash2008-09Attachment.doc | Department of Energy

    Energy.gov (indexed) [DOE]

    9Attachment.doc More Documents & Publications Flash2007-02Attachment.doc&0; Microsoft Word - AL2000-05Attachment.doc Flash2007-03Attachment.doc&0;...

  6. Microsoft Word - Policy Flash 2008-04.doc | Department of Energy

    Office of Environmental Management (EM)

    4.doc Microsoft Word - Policy Flash 2008-04.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  7. Microsoft Word - Policy Flash 2008-06.doc | Department of Energy

    Office of Environmental Management (EM)

    6.doc Microsoft Word - Policy Flash 2008-06.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  8. Microsoft Word - DRAFT CRB Interview Guidance.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    DRAFT CRB Interview Guidance.doc Microsoft Word - DRAFT CRB Interview Guidance.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc Microsoft Word - Document2

  9. Microsoft Word - FY08AnnualReport.doc | Department of Energy

    Office of Environmental Management (EM)

    FY08AnnualReport.doc Microsoft Word - FY08AnnualReport.doc PDF icon Microsoft Word - FY08AnnualReport.doc More Documents & Publications Microsoft Word - FY09AnnualReportv1.doc...

  10. Microsoft Word - AL2005-05Revised.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2005-05Revised.doc Microsoft Word - AL2005-05Revised.doc PDF icon Microsoft Word - AL2005-05Revised.doc More Documents & Publications AL2007-03.doc&0; 2011-31 Attachment...

  11. Microsoft Word - AL2000-05Attachment.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Attachment.doc Microsoft Word - AL2000-05Attachment.doc PDF icon Microsoft Word - AL2000-05Attachment.doc More Documents & Publications al99-06attachment.doc&0; EXHIBIT A: CRADA,...

  12. AL2007-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    7-02.doc&#0; AL2007-02.doc&#0; AL2007-02.doc&#0; (19.72 KB) More Documents & Publications Department of Energy Acquisition Letter 2013-04 on Executive Compensation Acquisition Letter No. AL 2013-04 Acquisition Letter No. AL 2014-07

  13. Microsoft Word - ACQUISITION LETTER.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ACQUISITION LETTER.doc Microsoft Word - ACQUISITION LETTER.doc Microsoft Word - ACQUISITION LETTER.doc (26.03 KB) More Documents & Publications ACQUISITION LETTER DEAR Part 933 Acquisition Guide Chapter 33.214 - Alternative Dispute Resolution OPAM Policy Acquisition Guides

  14. Microsoft Word - AL2005-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - AL2005-11.doc Microsoft Word - AL2005-11.doc (143.52 KB) More Documents & Publications Acquisition Letter No. AL 2012-04 Revisions to FAR Part 17 Special Contracting Methods and Part 35 Research and Development Contracting Audit Report: OAS-L-13-08

  15. Microsoft Word - LibraryofPriorRulemakings.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    LibraryofPriorRulemakings.doc Microsoft Word - LibraryofPriorRulemakings.doc Microsoft Word - LibraryofPriorRulemakings.doc (28.89 KB) More Documents & Publications Solar Background Document 1 Natural Gas Imports and Exports First Quarter Report 2014 Natural Gas Imports and Exports Second Quarter Report 2014

  16. CompleteProject List.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    CompleteProject List.doc&#0; CompleteProject List.doc&#0; CompleteProject List.doc&#0; (9.47 KB) More Documents & Publications Tribal Energy Program February 2012 Award Project Descriptions CX-008525: Categorical Exclusion Determination 2010 Program Review Meeting

  17. AcqGuide41pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1pt1.doc&#0; AcqGuide41pt1.doc&#0; AcqGuide41pt1.doc&#0; (13.23 KB) More Documents & Publications Chapter 41 - Acquisition of Utility Services Policy Flash 2016-31 Chapter 41: Utilities

  18. AcqGuide42pt3.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    2pt3.doc&#0; AcqGuide42pt3.doc&#0; AcqGuide42pt3.doc&#0; (56.38 KB) More Documents & Publications Chapter 42 - Contract Administration Acquisition Guide Chapter 42.1202 - Novation Agreements Chapter 9.2: Performance Guarantees

  19. AcqGuide9pt2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AcqGuide9pt2.doc&#0; AcqGuide9pt2.doc&#0; AcqGuide9pt2.doc&#0; (16.88 KB) More Documents & Publications Chapter 9.2: Performance Guarantees Policy Flash 2016-32 Chapter 9 - Contracting Qualifications

  20. AcqGuide3pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    pt1.doc&0; AcqGuide3pt1.doc&0; PDF icon AcqGuide3pt1.doc&0; More Documents & Publications POLICY FLASH 2016-04 Procurement Integrity PI Brief 6 15 07 final2&0;

  1. Microsoft Word - Political Activity and the Federal Employee.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Political Activity and the Federal Employee.doc Microsoft Word - Political Activity and the Federal Employee.doc Microsoft Word - Political Activity and the Federal Employee.doc (165.92 KB) More Documents & Publications Political Activity at DOE Facilities by DOE Contractors Audit Report: IG-0473 PROCESSING INVITATIONS FOR A PRESIDENTIAL APPOINTEE

  2. Microsoft Word - al2007-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    al2007-11.doc Microsoft Word - al2007-11.doc Microsoft Word - al2007-11.doc (62.82 KB) More Documents & Publications Acquisition Guide Chapter 19 Update Acquisition Letter: AL2005-08 Microsoft Word - al2004-03

  3. Microsoft Word - competitionincontractingguidev2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc (215.28 KB) More Documents & Publications AcqGuide 5.2-OPAM Acquisition Guide, Chapter 6.1, Competition Requirements Microsoft Word - AG Chapter 6 1 Nov 2010

  4. Microsoft Word - fal2004-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    fal2004-04.doc Microsoft Word - fal2004-04.doc Microsoft Word - fal2004-04.doc (132.28 KB) More Documents & Publications U.S. Department of Energy - Guide to Financial Assistance - Audit Requirements for For-Profit Organizations Financial Assistance Guide (2013) Revised Guide for Financial Assistance

  5. Microsoft Word - TR12-14.doc

    Office of Legacy Management (LM)

    of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2006 Office of Legacy Management DOE M/1399 2006 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy U.S. Department of Energy 2006 Annual

  6. Microsoft Word - Policy Flash 2008-07.doc | Department of Energy

    Office of Environmental Management (EM)

    07.doc Microsoft Word - Policy Flash 2008-07.doc More Documents & Publications Microsoft Word - Policy Flash 2008-10...

  7. Microsoft Word - Policy Flash 2008-10.doc | Department of Energy

    Office of Environmental Management (EM)

    10.doc Microsoft Word - Policy Flash 2008-10.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07...

  8. DOE NEPA Compliance Officers

    Energy.gov [DOE]

    NEPA Compliance Officers are listed by program office. Field offices are listed under their primary program office.

  9. Offices | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Offices Offices All Offices Program Offices Advanced Research Projects Agency - Energy Loan Programs Office Office of Electricity Delivery & Energy Reliability Office of Energy Efficiency & Renewable Energy Office of Environmental Management Office of Fossil Energy Office of Indian Energy Policy and Programs Office of Legacy Management Office of Nuclear Energy Office of Science Staff Offices Office of Congressional and Intergovernmental Affairs Office of Economic Impact and Diversity

  10. Office Buildings - Types of Office Buildings

    U.S. Energy Information Administration (EIA) (indexed site)

    administration building Insurance company headquarters building Local insurance agency Social services office Attorney's office Real estate sales office Government office State...

  11. Microsoft Word - AL2008-06.doc

    Energy.gov (indexed) [DOE]

    or (202) 287-1332 in the Office of Procurement and Assistance Policy or for NNSA, Stephen Law at Stephen.law@nnsa.doe.gov or (202) 586-4321 in the Office of Acquisition and...

  12. Microsoft Word - AL2006-09.doc

    Energy.gov (indexed) [DOE]

    Policy, MA-61, (202) 287-1339 or Richard.Langston@hq.doe.gov or for NNSA, Mr. Stephen Law, Office of Acquisition and Supply Management Office, NA-63, (202) 586-4321 or...

  13. Microsoft Word - cover-pi.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    FY04-FY05 WORK PROPOSAL March 2003 Submitted to: Office of Fusion Energy Sciences Office of Energy Research U.S. Department of Energy Germantown, MD 20874 Alcator Project Principal...

  14. Microsoft Word - S04200VMR.doc

    Office of Legacy Management (LM)

    Update for 2007 Office of Legacy Management DOE M1603 2008 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. ...

  15. Microsoft Word - S03347_final.doc

    Office of Legacy Management (LM)

    July 2007 Office of Legacy Management DOE M1495 2007 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 ...

  16. Microsoft Word - S0171800August.doc

    Office of Legacy Management (LM)

    Office of Legacy Management Grand Junction, Colorado, Site Site Environmental Report for Calendar Year 2004 August 2005 Office of Legacy Management DOE MGJ885-2005 -L U.S. ...

  17. Microsoft Word - S0224300 September 2006.doc

    Office of Legacy Management (LM)

    Third Five-Year Review September 2006 Office of Legacy Management DOE MGJ1158-2006 -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy ...

  18. Security Officer

    Energy.gov [DOE]

    This position is located in the Security and Continuity of Operations (NN) organization of the Chief Administrative Office (N), Bonneville Power Administration. The Security and Continuity of...

  19. Fellows' Officers

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Officers Fellows' Officers Current officers and listing of coordinators from 1982 to present. Current and past officers, coordinators 2016-2017 Chuck Farrar, Coordinator Brenda Dingus, Deputy Coordinator David S. Moore, Secretary Past coordinators 2015-2016: Dipen Sinha 2014-2015: Brad Meyer 2013-2014: Toni Taylor 2012-2013: Pat Colestock 2011-2012: Quanxi Jia 2010-2011: Joyce Guzik 2009-2010: Darryl L. Smith 2008-2009: S. Peter Gary 2007-2008: R. S. Hixson 2006-2007: W. C. Priedhorsky

  20. CMTA Office

    High Performance Buildings Database

    Prospect, KY When CMTA outgrew their old office space, the consultant engineering company decided to construct a new building. Not only does the structure provide offices for the firm, it also showcases progressive design elements and allows the firm to test new technologies and demonstrate their effectiveness to clients. The new CMTA office building is located in a live-work development on the outskirts of Louisville, KY. The location was selected to place the office close to where the employees live. 05/15/2015 - 10:34

  1. Microsoft Word - S03736_ FMP010609.doc

    Office of Legacy Management (LM)

    Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 LMS/CNT/S03736 This page intentionally left blank LMS/CNT/S03736 Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 This page intentionally left blank U.S. Department of Energy Fluid Management Plan For CAU 443: CNTA, Subsurface, Nevada January 2009 Doc. No. S0373600 Page i Contents Acronyms and Abbreviations

  2. Microsoft Word - S04019_GSB.doc

    Office of Legacy Management (LM)

    Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 LMS/GSB/S04019 This page intentionally left blank LMS/GSB/S04019 Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 This page intentionally left blank U.S. Department of Energy Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009, Rev. 3 Doc. No. S04019 Page i Contents Abbreviations

  3. Microsoft Word - S05094_VMR.doc

    Office of Legacy Management (LM)

    08 May 2009 LMS/RVT/S05094 This page intentionally left blank LMS/RVT/S05094 Verification Monitoring Report for the Riverton, Wyoming, Processing Site Update for 2008 May 2009 This page intentionally left blank U.S. Department of Energy Riverton, Wyoming, Verification Monitoring Report May 2009 Doc. No. S05094 Page i Contents 1.0 Introduction ........................................................................................................................1-1 2.0 Site Conditions

  4. Microsoft Word - S05575_AP.doc

    Office of Legacy Management (LM)

    8 through March 2009 for the Shiprock, New Mexico, Site December 2009 LMS/SHP/S05575 This page intentionally left blank LMS/SHP/S05575 Annual Performance Report April 2008 through March 2009 for the Shiprock, New Mexico, Site December 2009 This page intentionally left blank U.S. Department of Energy Annual Performance Report, Shiprock, New Mexico December 2009 Doc. No. S05575 Page i Contents

  5. Microsoft Word - S05949_IR.doc

    Office of Legacy Management (LM)

    Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2009 LMS/MNT/S05949 This page intentionally left blank LMS/MNT/S05949 2009 Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2009 This page intentionally left blank U.S. Department of Energy 2009 Annual Inspection-Monticello, Utah December 2009 Doc. No. S05949 Page i Contents Executive

  6. Microsoft Word - S06093_VMR.doc

    Office of Legacy Management (LM)

    09 April 2010 LMS/RVT/S06093 This page intentionally left blank LMS/RVT/S06093 Verification Monitoring Report for the Riverton, Wyoming, Processing Site Update for 2009 April 2010 This page intentionally left blank U.S. Department of Energy Riverton, Wyoming, Verification Monitoring Report April 2010 Doc. No. S06093 Page i Contents 1.0 Introduction ........................................................................................................................1-1 2.0 Site Conditions

  7. Microsoft Word - S06178_MP.doc

    Office of Legacy Management (LM)

    Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited LMS/RUL/S06178 This page intentionally left blank LMS/RUL/S06178 Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited This page intentionally left blank U.S. Department of Energy Rulison Monitoring Plan July 2010 Doc. No. S06178 Page i Contents 1.0

  8. Microsoft Word - S06182_GCAP.doc

    Office of Legacy Management (LM)

    Groundwater Compliance Action Plan for the Lakeview, Oregon, Processing Site June 2010 LMS/LKP/S06182 This page intentionally left blank LMS/LKP/S06182 Groundwater Compliance Action Plan for the Lakeview, Oregon, Processing Site June 2010 This page intentionally left blank U.S. Department of Energy Groundwater Compliance Action Plan for the Lakeview, Oregon, Processing Site June 2010 Doc. No.S06182 Page i Contents

  9. Microsoft Word - S06596_GW.doc

    Office of Legacy Management (LM)

    Annual Groundwater Report May 2009 through April 2010 September 2010 LMS/MNT/S06596 This page intentionally left blank LMS/MNT/S06596 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report May 2009 through April 2010 September 2010 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report May 2009-April 2010 September 2010 Doc. No. S06596 Page i Contents

  10. Microsoft Word - aser_rev0.doc

    Office of Legacy Management (LM)

    Weiss Associates Environmental Science, Engineering and Management ANNUAL SITE ENVIRONMENTAL REPORT CALENDAR YEAR 2007 for the LABORATORY FOR ENERGY-RELATED HEALTH RESEARCH UNIVERSITY OF CALIFORNIA, DAVIS Submitted to: S.M. Stoller Corporation 2597 B ¾ Road Grand Junction, Colorado 81503 Prepared by: Weiss Associates 5801 Christie Avenue, Suite 600 Emeryville, California 94608-1827 September 30, 2008 Rev. 0 J:\DOE_STOLLER\4110\137\ASER 2007\REV. 0\ASER_REV0.DOC WEISS ASSOCIATES Project Number:

  11. Microsoft Word - Exit Brochure.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Records Management Exit Procedures For Departing Department of Energy Federal and Contractor Employees Office of IT Planning, Architecture and E-Government March 2009 Office of the Chief Information Officer 2 Preservation of Federal Records The Federal Records Act requires the Department of Energy (DOE) Records Officer to remind departing Federal and contractor employees that Federal records may not be removed from Government custody nor may they be destroyed without a records disposition

  12. Fermilab | Directorate | Offices

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    (IPPM) Office of Project Support Services (PSS) Office of Partnerships and Technology Transfer (OPTT) Office of Communication Program Planning Office Legal Office Last modified:...

  13. Office of Chief Financial Officer

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Ultra-Deepwater and Unconventional Natural Gas Elk Hills School Lands Fund Clean Coal Technology Advanced Tech. Vehicles Manufacturing Loan Program Title 17 Innovative Tech. Loan Guarantee Program Tribal Indian Energy Loan Guarantee Program Office of Indian Energy Policy and Programs Energy Information Administration February 2015 Office of Chief Financial Officer Volume 3 DOE/CF-0109 Volume 3 Printed with soy ink on recycled paper Department of Energy FY 2016 Congressional Budget Request Energy

  14. Microsoft Word - dec-may07.doc

    Office of Legacy Management (LM)

    December 2006 through May 2007 June 2007 Office of Legacy Management DOE M/1493 2007 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy DOE-LM/1493-2007 Pinellas Environmental Restoration Project Semiannual Progress Report 4.5 Acre Site December 2006 through

  15. Microsoft Word - s00583_January2005.doc

    Office of Legacy Management (LM)

    Lowman, Idaho, (UMTRCA Title I) Disposal Site Long-Term Surveillance Plan for the U.S. Department of Energy Lowman, Idaho, (UMTRCA Title I) Disposal Site January 2005 Office of Legacy Management DOE M/GJ 2005 - -L 771 U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy

  16. Microsoft Word - S0106300-December2004.DOC

    Office of Legacy Management (LM)

    704 U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for Site A/Plot M, Illinois, Decommissioned Reactor December 2004 Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management S0106300 DOE-LM/GJ704-2004 U.S. Department of Energy Office of Legacy Management Long-Term

  17. Microsoft Word - S0217900_April.doc

    Office of Legacy Management (LM)

    Update for 2005 April 2006 Office of Legacy Management DOE M/GJ1127-2006 -L U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management This page intentionally left blank DOE-LM/GJ1127-2006 Verification Monitoring Report for the Riverton, Wyoming, Processing Site Update for

  18. Microsoft Word - S0221000_072606.doc

    Office of Legacy Management (LM)

    Soil and Ground Water Phytoremediation Pilot Studies at Monument Valley, Arizona 2005 Status Report July 2006 Office of Legacy Management DOE M/1254-2006 -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy This page intentionally left blank DOE LM/1254-2006 Soil

  19. Microsoft Word - S02997_mmts 2007.doc

    Office of Legacy Management (LM)

    Third Five-Year Review Report for Monticello Mill Tailings (USDOE) Site City of Monticello San Juan County, Utah June 2007 Office of Legacy Management DOE M/1472 2007 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy U.S. Department of Energy MMTS Third

  20. Microsoft Word - S03729_Dec2007.doc

    Office of Legacy Management (LM)

    of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2007 Office of Legacy Management DOE M/1554 2007 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy DOE-LM/1554-2007 2007 Annual Inspection of the

  1. Microsoft Word - TR01-18.doc

    Office of Legacy Management (LM)

    Report for the Weldon Spring, Missouri, Site January 2007 Office of Legacy Management DOE M/1425 2007 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy U.S. Department of Energy 2006 Annual Inspection - Weldon Spring, Missouri January 2007 Page 1 2006 Annual

  2. Microsoft Word - TR02-23.doc

    Office of Legacy Management (LM)

    Report for the Weldon Spring, Missouri, Site February 2006 Office of Legacy Management DOE M/GJ1137-2006 -L U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy 2005 Annual Inspection - Weldon Spring, Missouri February 2006 Page 1 2005 Annual

  3. Microsoft Word - TR12-30.doc

    Office of Legacy Management (LM)

    of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2005 Office of Legacy Management DOE M/GJ1065-2005 -L U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy 2005 Annual

  4. Microsoft Word - s00799-december-2004.doc

    Office of Legacy Management (LM)

    GJ766-2004 -L U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management Long-Term Surveillance Plan for the U.S. Department of Energy Shirley Basin South (UMTRCA Title II) Disposal Site, Carbon County, Wyoming December 2004 S00799 DOE-LM/GJ766-2004 Office of Legacy

  5. Microsoft Word - S0123800_050107.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Legacy Management CERCLA Sites Quality Assurance Project Plan Office of Legacy Management DOE M/GJ1232-2006 -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy U n c o n t r o l l e d C o p y CERCLA Sites QAPP Summary of Changes May 3, 2007 Page i Summary of

  6. Office of Chief Financial Officer

    Energy.gov (indexed) [DOE]

    Vehicles Manufacturing Loan Program Title 17 Innovative Tech. Loan Guarantee Program Tribal Indian Energy Loan Guarantee Program Office of Indian Energy Policy and Programs Energy ...

  7. Division, NN-43, Office of Arms Control

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    8 10 CFR Ch. III (1-1-10 Edition) § 810.14 Division, NN-43, Office of Arms Control and Nonproliferation. [51 FR 44574, Dec. 10, 1986, as amended at 58 FR 39639, July 16, 1993; 65 FR 16128, Mar. 27, 2000] § 810.14 Additional information. The Department of Energy may at any time require a person engaging in any generally or specifically author- ized activity to submit additional in- formation. § 810.15 Violations. (a) The Atomic Energy Act provides that: (1) Permanent or temporary injunc- tions

  8. WNR Offices

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Offices, Experimental Areas, Buildings, and Contacts Description Contact Name Bldg/Room Phone Pager/Alt. Phone Group Office Julie Quintana 622/220 667-5377 665-5390 User Office Tanya Herrera 622/212 667-6797 MPF-31 Building Manager Kenny Madrid 31/125 665-0944 664-8327 MPF-17 Building Manager Gene Cartelli 6/133 667-2127 664-4234 MPF-7 Building Manager Bruce Wheeler 622/248 667-6715 664-8336 Property Julie Martinez 24/110 665-2058 664-6775 Waste Manager Lance Kloefkorn 6/236 665-3288 664-5972

  9. Project Specific Waiver from the Mississippi State Energy Office |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Project Specific Waiver from the Mississippi State Energy Office Project Specific Waiver from the Mississippi State Energy Office ms_decision (111.07 KB) More Documents & Publications Status of Waivers Issued under the Recovery Act: Public Interest Waivers Microsoft Word - 06-22-09 FINAL ECAT Comments on OMB Recovery Act Guidance.doc Nationwide Limited Public Interest Waiver for LED and HVAC Units

  10. Microsoft Word - Q00336-Sept- 2004.doc

    Office of Legacy Management (LM)

    652 U.S. Department of Energy Remedial Action Report for the Interim Remedial Action Record of Decision Operable Unit III, Surface Water and Ground Water Monticello Mill Tailings (USDOE) Site, Monticello, Utah EPA CERCLIS Identification Number UT 3890090035 September 2004 Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy

  11. Microsoft Word - 12189a.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    2 Conference, February 26 - March 1, 2012, Phoenix, Arizona, USA 1 Overview of the U.S. Department of Energy Formerly Utilized Sites Remedial Action Program - 12189 Christopher Clayton*, Vijendra Kothari**, Ken Starr***, Joey Gillespie****, and Michael Widdop**** * U.S. Department of Energy Office of Legacy Management, Washington, DC ** U.S. Department of Energy Office of Legacy Management, Morgantown, West Virginia *** U.S. Department of Energy Office of Legacy Management, Westminster, Colorado

  12. Microsoft Word - BPA Personal Property.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    U.S. Department of Energy Office of Inspector General Office of Audit Services Audit Report Management Controls over the Bonneville Power Administration's Personal Property Accountability OAS-M-08-01 October 2007 Department of Energy vvasnlngron, UL LUSU:, October 1 , 2007 MEMORANDUM FOR TQ-YADMINISTRATOR, BONNEVILLE POWER ADNIINISTRATION [?L&& < / ( ' F'IIOM. or" Collard / Assistant Inspector General for Performance Audits Office of Inspector General INFORMATION: Audit Report

  13. Microsoft Word - Yucca PCard Report.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AAAAAAAAAAAAAAAAA Inspection Report Yucca Mountain Project Purchase Card Programs INS-O-09-04 August 2009 U.S. Department of Energy Office of Inspector General Office of Inspections MEMORANDUM FOR DIRECTOR, OFFICE OF CILIVIAN RADIOACTIVE WASTE MANAGEMENT FROM: Herbert Richardson Principal Deputy Inspector General SUBJECT: INFORMATION: Inspection Report on "Yucca Mountain Purchase Card Programs" BACKGROUND Yucca Mountain Project (Project) is the Nation's first proposed storage facility

  14. Microsoft Word - 0918rir.doc

    Office of Legacy Management (LM)

    DOE AREAS REMEDIAL INVESTIGATION REPORT for the LABORATORY FOR ENERGY-RELATED HEALTH RESEARCH UNIVERSITY OF CALIFORNIA, DAVIS Prepared for: United States Department of Energy National Nuclear Security Administration Service Center 1301 Clay Street Oakland, California 94612-5208 Prepared by: Weiss Associates 5801 Christie Avenue, Suite 600 Emeryville, California 94608-1827 September 18, 2003 Rev. 0 DOE Oakland Operations Contract DE-AC03-96SF20686 J:\DOE\4007\110\RI_PLAN\0918_REV0\0918RIR.DOC

  15. Microsoft Word - S03273_Rev1.doc

    Office of Legacy Management (LM)

    Surface, Hot Creek Valley, Nevada, for Calendar Year 2007 September 2008 Rev. 1 DOE-LM/1558-2007 This page intentionally left blank DOE-LM/1558-2008 Post-Closure Inspection and Monitoring Report for Corrective Action Unit 417: Central Nevada Test Area Surface, Hot Creek Valley, Nevada for Calendar Year 2007 September 2008 Rev. 1 This page intentionally left blank U.S. Department of Energy CY 2007 Post-Closure Inspection & Monitoring Report for CAU 417 September 2008, Rev. 1 Doc. No. S0327300

  16. Microsoft Word - S05069_ROD.doc

    Office of Legacy Management (LM)

    Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 LMS/LEH/S05069 This page intentionally left blank LMS/LEH/S05069 Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 This page intentionally left blank U.S. Department of Energy ROD for DOE Areas for LEHR September 2009 Doc. No. S05069, Rev. 0 Page i Contents Acronyms and Abbreviations

  17. interiorlightingefficiencyformunicipalities.doc | Department of Energy

    Energy Savers

    Proposed Energy Transport Corridors

    doe.gov/media/Myths_and_Facts.pdf http://www.doe.gov/media/Myths_and_Facts.pdf http://www.doe.gov/media/Myths_and_Facts.pdf (143.91 KB) More Documents & Publications Biofuels & Greenhouse Gas Emissions: Myths versus Facts Microsoft Word - 47C468D4-69BA-281F40.doc Biofuels & Greenhouse Gas Emissions: Myths versus Facts

    of Energy

    energy.gov/media/F...Biofuels_Lower_Gas_Prices.pdf

  18. The Office

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Office of Energy Efficiency and Renewable Energy (EERE) is attending COP22, the United Nations' annual climate change conference, held this year in Morocco. Below are some of our office's top clean energy successes. Sustainable TRANSPORTATION Renewable ENERGY Energy EFFICIENCY Energy Department research has helped reduce production costs of automotive lithium-ion batteries by ~70% since 2008 More than electric charging units 20,000 http://www.afdc.energy.gov/fuels/ stations_counts.html

  19. Microsoft Word - AL2006-01.doc

    Energy.gov (indexed) [DOE]

    in effect until superseded or canceled. What are the Points of Contact? Contact Stephen Zvolensky, Department of Energy (DOE) Office of Procurement and Assistance Policy, at...

  20. AcqGuide70pt5.doc

    Energy Savers

    Variable Pay Programs Variable pay is a lump-sum, non-base building, cash payment. ... Contracting Officers consider the type of contract incentive payment, (award fee, ...

  1. Microsoft Word - 3215504_1.DOC

    Energy Savers

    their affiliated businesses with offices in: Abu Dhabi Alicante Amsterdam Baltimore Beijing Berlin Boulder Brussels Caracas Colorado Springs Denver Dubai Dusseldorf Frankfurt ...

  2. AcqGuide9pt1.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Organizational Conflicts of Interest Reference: FAR 9.5, DEAR 909.5, 952.209-72, ... Guidelines Contracting officers review information in the offeror's proposal likely to ...

  3. AcqGuide9pt3.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    taken by one agency are recognized and effective for all Executive Branch agencies. ... While in many agencies, the debarment and suspension function resides within the Office of ...

  4. Microsoft Word - SEA_MAPAR_2001.doc

    National Nuclear Security Administration (NNSA)

    to the Cerro Grande Fire Mitigation Action Plan Annual Report for 2001 February 20, 2002 Prepared by: Department of Energy Office of Los Alamos Site Operations National ...

  5. Microsoft Word - AL2005-12.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    principles. Second, the contracting officer determines if the costs are reasonable in nature and amount. The Standards for Reimbursement of Contractor Meal Costs The standards for...

  6. Microsoft Word - al93-4.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ... work (including service work) for a DOE facility ... B.The Office of Contractor Human Resource Management shall ... contractor concerning DOE policies, requirements, and ...

  7. Microsoft Word - al2006-12.doc

    Energy.gov (indexed) [DOE]

    AL-2006-12 (092906) 7 III. What Procedures Ensure Effective Audit Management? Some strategies for managing required audit activity include: 1. Contracting officers should...

  8. Greg's Memo to Secretary.doc

    Energy Savers

    GreenBuy Award Winners Listed by Fiscal Year GreenBuy Award Winners Listed by Fiscal Year The Department of Energy's (DOE) Office of Environment, Health, Safety and Security has announced the winners of the Fiscal Year (FY) 2015 GreenBuy Awards.The Office of Sustainability Support (AU-21), in coordination with the Office Management and Administration's Office of Acquisition and Project Management, launched the GreenBuy Awards in FY 2011.The award program recognizes DOE sites for excellence in

  9. AcqGuide70pt4.doc

    Office of Environmental Management (EM)

    Management Controls ; DEAR 970.5232-3, entitled, Accounts, Records and Inspection; Chapter 4 of the Accounting Handbook, ... and the cognizant Chief Financial Officer (CFO) in the ...

  10. Microsoft Word - TOC - ALL.doc

    National Nuclear Security Administration (NNSA)

    ... Test SHPO State Historic Preservation Office SJVUAPCD San Joaquin Valley Unified Air Pollution Control District SMR standardized mortality rate SNF Spent nuclear fuel SNL Sandia ...

  11. Microsoft Word - Report Cover _2_.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Audit Report Management Controls over Small Business Opportunities at Oak Ridge National Laboratory OAS-M-08-08 July 2008 U.S. Department of Energy Office of Inspector General Office of Audit Services Department of Energy Washington, DC 2 0 5 8 5 July 2 , 2 0 0 8 MEMORANDUM FOR T H ~ ~ ~ A N A G E R , OAK RIDGE OFFICE FROM: - ~ s s i s t a n ~ ~ n s ~ e c t o r General for NNSA and Energy Audits Office of Inspector General SUBJECT: INFORMATION: Audit Report on "Management Controls over

  12. Microsoft Word - AL2005-08.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ... that are competitive in terms of market prices, quality, ... Contracting Officers to search the database with results ... prime contractors to enter into Mentor-Protg ...

  13. AcqGuide47pt1.doc

    Energy Savers

    the contracting officer will document the contract file with the appropriate justification. 4. Receive and evaluate offers: After offers are received, an evaluation will be ...

  14. Microsoft Word - 8E2A4440.doc

    Energy.gov (indexed) [DOE]

    48D7DF19-707E-28B27A.doc (126.75 KB) More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - GSP_Charter.doc Department of Energy

    564M_Biomass_Project Descriptions FINAL 120409 (100.66 KB) More Documents & Publications 564M_Biomass_Projects.pdf Microsoft Word - 338M_Geothermal_Project_Descriptions ARRA Projects Chart

    NATIONAL PARKS COMMITTEE ON ENERGY AND NATURAL RESOURCES U.S. SENATE

  15. transcript_jedi_model.doc | Department of Energy

    Energy.gov (indexed) [DOE]

    document icon transcriptjedimodel.doc More Documents & Publications TAP Webcast Transcript July-29, 2009 Scenario Jedi Tools for Designing & Implementing Better Finance Programs

  16. pocforms06a0399.doc | Department of Energy

    Energy.gov (indexed) [DOE]

    More Documents & Publications fleetappforms04f1298.doc&0; OPC Security Whitepaper 3Hardening Guidelines for OPC Hosts Critical Decision 2 (CD-2) Approval Template...

  17. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    A NRC Concurrence with Completion of Remedial Action This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page A-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No.

  18. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    B Real Estate Documentation This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page B-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page

  19. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    NRC Technical Evaluation Report on Revised LTSP This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page D-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page D-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page D-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No.

  20. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    E Agency Notification Agreements This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page E-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008

  1. Enter the Post-Doc: The Untapped Sourcing Pipeline

    SciTech Connect (OSTI)

    Boscow, Ryan B.

    2011-07-30

    This article addresses the potential formulation and utilization of an industry-based Post-Doc program in order to create workforce candidate pipelines with targeted universities.

  2. Effectiveness of a Diesel Oxidation Catalyst (DOC) to control...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion Effectiveness of a ...

  3. Microsoft Word - AL2006-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon Microsoft Word - AL2006-09.doc More Documents & Publications Microsoft PowerPoint - Executive Order13423rbl Sample Contract Language for Construction Using ...

  4. Microsoft Word - FFATA Memo 30 March 2007.doc | Department of...

    Energy.gov (indexed) [DOE]

    FFATA Memo 30 March 2007.doc More Documents & Publications Policy Flash 2014-35 Rescission of American Recovery and Reinvestment Act Reporting Requirements. Flash2008-44attachment....

  5. Doc Cambell's Post Greenhouse Low Temperature Geothermal Facility...

    Open Energy Information (Open El) [EERE & EIA]

    Low Temperature Geothermal Facility Facility Doc Cambell's Post Sector Geothermal energy Type Greenhouse Location Las Cruces, New Mexico Coordinates 32.3123157,...

  6. Microsoft Word - al2006-12.doc | Department of Energy

    Energy.gov (indexed) [DOE]

    Microsoft Word - al2006-12.doc More Documents & Publications Acquisition Letter No. AL 2008-02 Department of Energy Special Report: DOEIG-0934...

  7. Microsoft Word - DOE_Staffing_Study_Cover.doc | Department of...

    Office of Environmental Management (EM)

    Word - DOEStaffingStudyCover.doc More Documents & Publications 2010 DOE Strategic Sustainability Performance Plan - Report to the White House Council on Environmental...

  8. Microsoft Word - U0200600-Semi-Annual Report Sept 03 to March 04.doc

    Office of Legacy Management (LM)

    U0200600 DOE-LM/GJ725-2004 Semiannual Performance Report September 2003 through March 2004 for the Shiprock, New Mexico, Site September 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Semi-Annual Performance Report, Shiprock, New Mexico September 2004 Doc. No. U0200600 Page iii Contents 1.0

  9. Adopt-A-Doc to help make more research available online | OSTI, US Dept of

    Office of Scientific and Technical Information (OSTI)

    Energy Office of Scientific and Technical Information Adopt-A-Doc to help make more research available online Back to the OSTI News Listing for 2009 Scientists need quick access to important research. But there are many DOE technical reports in need of digitization. In fact, most DOE technical reports from the 1940s to 1991 are still only available in hard copy or microfiche. Now citizens can help make this research available online by adopting documents that are not yet in digital format.

  10. Office of Chief Financial Officer

    Directives, Delegations, and Requirements [Office of Management (MA)]

    2001-01-19

    This Order implements the provisions of the Chief Financial Officers Act of 1990 within the Department of Energy. Cancels SEN 34-91. Canceled by DOE O 520.1A.

  11. Building Technologies Office Overview

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Roland Risser Director, Building Technologies Office Building Technologies Office Energy Efficiency Starts Here. 2 Building Technologies Office Integrated Approach: Improving ...

  12. Office of Chief Financial Officer

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1 DOE/CF-0107 Volume 1 National Nuclear Security Administration Federal Salaries and Expenses Weapons Activities Defense Nuclear Nonproliferation Naval Reactors Department of Energy FY 2016 Congressional Budget Request February 2015 Office of Chief Financial Officer Volume 1 DOE/CF-0107 Volume 1 National Nuclear Security Administration Federal Salaries and Expenses Weapons Activities Defense Nuclear Nonproliferation Naval Reactors Printed with soy ink on recycled paper Department of Energy FY

  13. Office of Chief Financial Officer

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    February 2015 Office of Chief Financial Officer Volume 3 DOE/CF-0109 Volume 3 Printed with soy ink on recycled paper Department of Energy FY 2016 Congressional Budget Request Energy Efficiency and Renewable Energy Electricity Delivery and Energy Reliability Nuclear Energy Fossil Energy Research and Development Naval Petroleum and Oil Shale Reserves Strategic Petroleum Reserve Northeast Home Heating Oil Reserve Elk Hills School Lands Fund Clean Coal Technology Advanced Tech. Vehicles

  14. Office Buildings - Full Report

    U.S. Energy Information Administration (EIA) (indexed site)

    administration building Insurance company headquarters building Local insurance agency Social services office Attorney's office Real estate sales office Government office State...

  15. Microsoft Word - AcqGuide71pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1pt1.doc Microsoft Word - AcqGuide71pt1.doc PDF icon Microsoft Word - AcqGuide71pt1.doc More Documents & Publications Chapter 71 - Review and Approval of Contract and Financial ...

  16. Microsoft Word - AcqGuide7pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    pt1.doc Microsoft Word - AcqGuide7pt1.doc ACQUISITION PLANNING PDF icon Microsoft Word - AcqGuide7pt1.doc More Documents & Publications ACQUISITION PLANNING Policy Flash 2015-13 ...

  17. Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc | Department...

    Energy Savers

    ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc More Documents & Publications Microsoft Word -...

  18. Microsoft Word - Flash2009dashxxFAC34.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc More Documents & Publications Federal Acquisition Regulation; Federal...

  19. Microsoft Word - Flash2008-08attachmentFAC22.doc | Department...

    Energy Savers

    Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc More Documents & Publications Policy Flash 2013-75...

  20. Microsoft Word - Flash2007-61FACAttachment.doc | Department of...

    Energy Savers

    Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc More Documents & Publications Microsoft Word -...

  1. Microsoft Word - PolicyFlash2007-10Attch2.doc | Department of...

    Energy Savers

    PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc More Documents & Publications Policy Flash 2013-37 Federal...

  2. Microsoft Word - Policy Flash 2008-02.doc | Department of Energy

    Energy Savers

    Microsoft Word - Policy Flash 2008-02.doc Microsoft Word - Policy Flash 2008-02.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  3. Microsoft Word - Policy Flash 2008-03.doc | Department of Energy

    Energy Savers

    Microsoft Word - Policy Flash 2008-03.doc Microsoft Word - Policy Flash 2008-03.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  4. Microsoft Word - ARRAGuideAttachment10v1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ARRAGuideAttachment10v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - DRAFT CRB Interview Guidance

  5. Microsoft Word - NationalPolicyAssurances5-06.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    NationalPolicyAssurances5-06.doc Microsoft Word - NationalPolicyAssurances5-06.doc PDF icon Microsoft Word - NationalPolicyAssurances5-06.doc More Documents & Publications ...

  6. Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc |...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Press Release RECOMP 2-8-08 REV FINAL.doc Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc PDF icon Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc More ...

  7. Microsoft Word - FY10PropertyBSCFed.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PropertyBSCFed.doc Microsoft Word - FY10PropertyBSCFed.doc PDF icon Microsoft Word - FY10PropertyBSCFed.doc More Documents & Publications Microsoft Word - FY09PropertyBSCContractor...

  8. Microsoft Word - DP_cover_and_front matter_R1_Draft_3.DOC | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    R1Draft3.DOC Microsoft Word - DPcoverandfront matterR1Draft3.DOC PDF icon Microsoft Word - DPcoverandfront matterR1Draft3.DOC More Documents & Publications Microsoft ...

  9. Microsoft Word - FOIA Log FY 2002.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    2 FOIA - Request Log 1 Closed/ Date No. Dated Date Rec'd HQ or Dir. Subject Yes/ 1/30/02 001 12/3/02 12/21/02 Richland Transfer Richland Operation Office search for records they located documents originated by the DOE Carlsbad Field Office that may be responsive to Mr. Hongs request. By transfer of this letter they forwarded Mr. Hong request, along with the documents located at Richland to the Carlsbad FOIA Office. CBFO will respond directly to Mr. Hong with a release determination Yes/ 2/13/02

  10. Microsoft Word - figure_10_2015.doc

    Gasoline and Diesel Fuel Update

    Pipeline Imports LNG Imports * In 2014, 303 million cubic feet of compressed natural gas (CNG) were imported from Canada. Source: Office of Fossil Energy, U.S. Department of ...

  11. Microsoft Word - 09-1690.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    MAG:09-1690:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 September 22, 2009 Mr. Steve Zappe, Project Leader Hazardous Materials...

  12. Microsoft Word - Santa Fe Dec 14.doc

    National Nuclear Security Administration (NNSA)

    I'm with the Department of Energy in Los 21 Alamos, and I'm ... actions which could be 8 office space, library, the ... I have a Ph.D. in 7 medical sciences, pharmacology and ...

  13. Microsoft Word - 12-1568.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    68:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 December 12, 2012 Mr. John E. Kieling, Chief Hazardous Waste Bureau New Mexico...

  14. Microsoft Word - 12-1433.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    have any questions, please contact Mr. Randy Unger, Director of the Office of Quality Assurance at (575) 234-7065. Sincerely, Original Signature on File Jose R. Franco, Manager...

  15. Microsoft Word - S06713_SER.doc

    Office of Legacy Management (LM)

    August 2010 LMSWELS06713 LMSWELS06713 ENERGY Legacy Management U.S. DEPARTMENT OF U.S. Department of Energy Office of Legacy Management This page intentionally left blank LMS...

  16. Microsoft Word - Q0032900-Aug-2004.doc

    Office of Legacy Management (LM)

    DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado Document Number Q0032900 Contents U.S. Department of Energy MMTS OU III ...

  17. Microsoft Word - s00400-sept2004.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; ...

  18. Microsoft Word - 08-0370.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    0:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 July 2, 2008 Mr. Steve Zappe, Project Leader Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Subject: Transmittal of the Carlsbad Field Office Final Audit Report for Audit A-08-22 of the Idaho National Laboratory Central Characterization Project Analytical Laboratories Dear Mr. Zappe: This letter transmits the Idaho

  19. Microsoft Word - Attachment A3.doc

    Office of Environmental Management (EM)

    UNITED STATES OF AMERICA DEPARTMENT OF ENERGY OFFICE OF ELECTRICITY DELIVERY AND RELIABILITY APPLICATION FOR A PRESIDENTIAL PERMIT FOR THE NEW ENGLAND CLEAN POWER LINK PROJECT ) ) ) ) Docket No. PP-400 To: Office of Electricity Delivery and Energy Reliability (OE-20) U.S. Department of Energy 1000 Independence Ave. SW Washington, DC 20585 Attention of Brian Mills, Senior Planning Advisor COMMENTS AND MOTION TO INTERVENE OUT OF TIME OF ALLCO RENEWABLE ENERGY LIMITED Pursuant to Rules 212 and 214

  20. AcqGuide70pt3270.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Chapter 70.3270 (April 2007) 1 Guide Chapter 70.32 Contract Financing Guide Subchapter 70.3270 Alternative Financing Guiding Principle The contracting officer should assist program officials in ensuring that neither the contract's statement of work nor any other direction to the contractor precludes qualifying the alternative financing endeavor as an operating lease. Background: The Office of Engineering and Construction Management (MA-50) manages the Department's Alternative Financing policy.

  1. Microsoft Word - 0069tee.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    April 5, 2010 DEPARTMENT OF ENERGY OFFICE OF HEARINGS AND APPEALS Application for Exception Name of Case: Severson Oil & LP Co., Inc. Date of Filing: March 23, 2010 Case No.: TEE-0069 On March 23, 2010, Severson Oil & LP Co., Inc. (Severson) filed an Application for Exception with the Office of Hearings and Appeals (OHA) of the Department of Energy (DOE). The firm requests that it be relieved of the requirement to prepare and file the Energy Information Administration (EIA) Form

  2. Microsoft Word - 0073.tee.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    February 14, 2011 DEPARTMENT OF ENERGY OFFICE OF HEARINGS AND APPEALS Application for Exception Name of Case: Cole Distributing, Inc. Date of Filing: December 13, 2010 Case No.: TEE-0073 On December 13, 2010, Cole Distributing, Inc. (Cole) filed an Application for Exception with the Office of Hearings and Appeals (OHA) of the Department of Energy (DOE). The firm requests that it be permanently relieved of the requirement to prepare and file the Energy Information Administration (EIA) Form

  3. Microsoft Word - 0076.tee.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    27, 2011 DEPARTMENT OF ENERGY OFFICE OF HEARINGS AND APPEALS Application for Exception Name of Case: Brodeur's Oil Service, Inc. Date of Filing: February 18, 2011 Case No.: TEE-0076 On February 18, 2011, Brodeur's Oil Service, Inc. (Brodeur's) filed an Application for Exception with the Office of Hearings and Appeals (OHA) of the Department of Energy (DOE). The firm requests temporary relief from its requirement to prepare and file the Energy Information Administration (EIA) Form EIA-782B,

  4. Microsoft Word - final report.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Inspections Inspection of Savannah River Operations Office Management of Emergency Response and Law Enforcement-Related Grants DOE/IG-0604 June 2003 Inspection Report INSPECTION OF SAVANNAH RIVER OPERATIONS OFFICE MANAGEMENT OF EMERGENCY RESPONSE AND LAW ENFORCEMENT-RELATED GRANTS TABLE OF CONTENTS OVERVIEW Introduction and Objective 1 Observations and Conclusions 1 DETAILS OF FINDINGS Receipt of Grant Deliverables 3 Follow-up on Delinquent Deliverables 4 RECOMMENDATIONS 4 MANAGEMENT COMMENTS 5

  5. Microsoft Word - 12-1433.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    433:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 August 15, 2012 Mr. John Kieling, Chief Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Building 1 Santa Fe, NM 87505-6303 Subject: Transmittal of the Recertification Audit Report for the Oak Ridge National Laboratory/ Central Characterization Project Audit A-12-08 Dear Mr. Kieling: This letter transmits the final audit report for Carlsbad Field Office (CBFO)

  6. Microsoft Word - 2527B.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    5 Description of the ARM Operational Objective Analysis System June 2001 Minghua Zhang State University of New York at Stony Brook, New York Shaocheng Xie Richard T. Cederwall J. John Yio Lawrence Livermore National Laboratory, Livermore, California Work supported by the U.S. Department of Energy, Office of Science, Office of Biological and Environmental Research Zhang et al., June 2001, ARM TR-005 iii Contents 1

  7. Microsoft Word - EmrE.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    SSRL is supported by the U.S. Department of Energy, Office of Basic Energy Sciences. The SSRL Structural Molecular Biology Program is supported by the National Institutes of Health, National Center for Research Resources, Biomedical Technology Program and by the U.S. DOE, Office of Biological and Environmental Research. Crystal Structure of the EmrE Multidrug Transporter with a Substrate O. Pornillos, Y-J. Chen, A. P. Chen and G. Chang Department of Molecular Biology, The Scripps Research

  8. Microsoft Word - P04-00147.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    ER/ARM-0401 Tropical Warm Pool International Cloud Experiment (TWP-ICE): Cloud and Rain Characteristics in the Australian Monsoon May 2004 P. T. May and C. Jakob Bureau of Meteorology Research Centre Victoria 3001, Australia J. H. Mather Pacific Northwest National Laboratory Richland, Washington Work supported by the U.S. Department of Energy, Office of Science, Office of Biological and Environmental Research DOE/ER/ARM-0401 iii SUMMARY The impact of oceanic convection on its environment and the

  9. Microsoft Word - CQA2008_FINAL.doc

    Gasoline and Diesel Fuel Update

    8) Distribution Category UC-950 Cost and Quality of Fuels for Electric Plants 2007 and 2008 January 2010 U.S. Energy Information Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. Department of Energy Washington DC 20585 This report was prepared by the U.S. Energy Information Administration (EIA), the statistical and analytical agency within the U.S. Department of Energy. By law, EIA's data, analyses, and forecasts are independent of approval by any other officer or

  10. Microsoft Word - THILLY, Ludovic - Abstract.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Ludovic Thilly Institut Pprime, CNRS-University of Poitiers-ENSMA SP2MI, 86962 Futuroscope, France Ludovic.thilly@univ-poitiers.fr Cu/Nb nanocomposite wires processed by severe plastic deformation for high pulsed magnets: effects of the nanostructure on the resistance to high stress, high temperature and irradiation Copper-based high strength and high electrical conductivity nanocomposite wires reinforced by Nb nanotubes are prepared by severe plastic deformation, applied with an Accumulative

  11. Project Summary-TES-SNL.doc. (Conference) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Project Summary-TES-SNL.doc. Citation Details In-Document Search Title: Project Summary-TES-SNL.doc. Abstract not provided. Authors: Siegel, Nathan Phillip Publication Date: ...

  12. Microsoft Word - US_Japan_REE_agenda_ver7.doc | Department of...

    Office of Environmental Management (EM)

    Microsoft Word - USJapanREEagendaver7.doc Microsoft Word - USJapanREEagendaver7.doc U.S. - Japan Roundtable on Rare Earth Elements Research PDF icon Microsoft Word -...

  13. DOE HR Guidebook 12_15_05.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications Operating Guidelines Appendix A B.DOC&0; 2 Jun 03 Roles and Responsibilities CSO Highlighted.doc&0; Operating Guidelines Appendix C...

  14. Building Technologies Office Overview

    SciTech Connect (OSTI)

    2013-04-01

    Building Technologies Office Overview Presentation for the 2013 Building Technologies Office's Program Peer Review

  15. Microsoft Word - DOE-HDBK-1110-2008-Concluding Material.doc

    Energy Savers

    Area Office Sandia Fernald Area Office FNL Los Alamos Area Office West Valley Area Office Kirtland Area Office Pinellas Area Office Kansas City Area Office Miamisburg Area Office...

  16. Office of Chief Financial Officer

    Directives, Delegations, and Requirements [Office of Management (MA)]

    2001-11-27

    Page Change 1 to DOE O 520.1 modifies the responsibility statement to include NNSA Field CFO positions, modifies Heads of Field Elements responsibilities for consistency with the CFO responsibilities, and makes a minor change to reflect the establishment of the Office of Management, Budget and Evaluation. Cancels SEN 34-9.

  17. Microsoft Word - Map and Directions to FrCt.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    U.S. Energy Information Administration | Updated Buildings Sector Appliance and Equipment Costs and Efficiencies 2 APPENDIX A FINAL EIA - Technology Forecast Updates - Residential and Commercial Building Technologies - Reference Case Presented to: U.S. Energy Information Administration Prepared by Navigant Consulting, Inc. 1200 19 St. NW, Suite 700 Washington, D.C. 20036 With SAIC 8301 Greensboro Drive McLean, VA 22102 March 2014 Final DISCLAIMER This presentation was prepared as an account of

  18. Microsoft Word - 271C2C7B.doc

    Energy.gov (indexed) [DOE]

    Defense) 1 Office of Environmental Management PSRP Name: The Office of Environmental Management (EM) Defense Environmental Cleanup PSRP Lead Program Office andor LaboratorySite ...

  19. Microsoft Word - 09-1595.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    9-1595:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 July 27, 2009 Mr. Steve Zappe, Project Leader Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Subject: Transmittal of the Final Audit Report A-09-13, Idaho National Laboratory Central Characterization Project Dear Mr. Zappe: Enclosed is the Carlsbad Field Office (CBFO) Final Audit Report for Audit A-09-13 of the

  20. Microsoft Word - RIN 06080459 DVP_112806.doc

    Office of Legacy Management (LM)

    383 2006 - - U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE-AC01-02GJ79491 September 2006 Shiprock, New Mexico, Disposal Site December 2006 U.S. Department of Energy DVP-Shiprock, New Mexico, Disposal Site December 2006 RIN 06080459 Page ii Contents Sampling Event Summary

  1. Microsoft Word - S06010_Ltr.doc

    Office of Legacy Management (LM)

    6010 Task Order LM00-502 Control Number 10-0184 January 21, 2010 U.S. Department of Energy Office of Legacy Management ATTN: Jack Craig Site Manager 3600 Collins Ferry Road Morgantown, WV 26505 SUBJECT: Rulison Long-Term Hydrologic Monitoring Program Sampling and Analysis Results for 2009 Dear Mr. Craig: The U.S. Department of Energy (DOE) Office of Legacy Management conducted annual sampling at the Rulison, Colorado, Site for the Long-Term Hydrologic Monitoring Program (LTHMP) on May 11 and 12,

  2. Microsoft Word - 0060.tee.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    June 30, 2009 DEPARTMENT OF ENERGY OFFICE OF HEARINGS AND APPEALS Application for Exception Name of Case: 7 Oil Co., Inc. Date of Filing: June 11, 2009 Case No.: TEE-0060 On June 11, 2009, 7 Oil Co., Inc. (7 Oil) filed an Application for Exception with the Office of Hearings and Appeals (OHA) of the Department of Energy (DOE). The firm requests that it be permanently relieved of the requirement to prepare and file the Energy Information Administration (EIA) Form EIA-782B, entitled

  3. Microsoft Word - 0067.TEE.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    December 17, 2009 DEPARTMENT OF ENERGY OFFICE OF HEARINGS AND APPEALS Application for Exception Name of Case: North Side Coal & Oil Co., Inc. Date of Filing: December 2, 2009 Case No.: TEE-0067 On December 2, 2009, North Side Coal & Oil Co., Inc. (North Side) filed an Application for Exception with the Office of Hearings and Appeals (OHA) of the Department of Energy (DOE). The firm requests that it be permanently relieved of the requirement to prepare and file the Energy Information

  4. Microsoft Word - Title X Reimbursements.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Office of Inspector General Office of Audit Operations Audit Report Management Controls Over Title X Claims Reimbursement at the West Chicago Thorium Processing Facility OAS-M-04-08 September 2004 previously approved by the Department from the 1994 through 2001 claims. This occurred because the Department had not developed an assurance strategy that included both adequate technical and financial reviews of the Kerr-McGee claims. As a result, the Department could pay Kerr-McGee up to $164

  5. Microsoft Word - 090713HanfordARRAupdate.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Backgrounder Contacts: July 13, 2009 Geoff Tyree, DOE (509) 376-4171, Geoff_Tyree@rl.gov Cameron Hardy, DOE (509) 376-5365, Cameron_M_Hardy@rl.gov Update on Hiring and Recovery Act Funding at the Hanford Site, Richland Operations Office Projects Total Number of Jobs Saved/Created The total number of jobs saved to date with Recovery Act funding for DOE Richland Operations Office projects is approximately 300. The total number of jobs created to date is approximately 900. New Hires in June

  6. Microsoft Word - 12-1584.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    84:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 January 23, 2013 Mr. John E. Kieling, Chief Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Bldg. 1 Santa Fe, NM 87505-6303 Subject: Transmittal of the Final Audit Report for the INL/CCP Recertification Audit A-12-13 Dear Mr. Kieling: This letter transmits the Final Audit Report for Carlsbad Field Office (CBFO) Audit A-12-13 of the Idaho National Laboratory

  7. Microsoft Word - Audit Report Repost.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    6:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 July 15, 2008 Steve Zappe, Project Leader Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Bldg. 1 Santa Fe, New Mexico 87505-6303 Subject: Transmittal of the Carlsbad Field Office Final Audit Report A-08-09 of the Advanced Mixed Waste Treatment Project Dear Mr. Zappe: This letter transmits the Advanced Mixed Waste Treatment Project (AMWTP) Audit Report for the

  8. Operations Office

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    (~ii~,Richland Operations Office ~Z4TESO~Richland, Washington 99352 SEP 2 2009 CERTIFIED MAIL Ms. Sarah Washburn Heart of America Northwest 1314 N.E. 5 6 th Street Suite 100 Seattle, Washington 98105 Dear Ms. Washburn: FREEDOM OF INFORMATION ACT REQUEST (FOI 2009-0067) You requested, pursuant to the Freedom of Information Act (FOJA), the following documents relating to: 1 . "The authorization, decision to use, and actual use of any and all pesticides and herbicides anywhere within the

  9. Office of the Chief Financial Officer .:. Lawrence Berkeley National...

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Office of the Chief Financial Officer Office of the Cheif Financial Officer Lawrence Berkeley Naitonal Laboratory Department of Energy Quicklinks: ---...

  10. Microsoft Word - RIN 06020313 DVP.doc

    Office of Legacy Management (LM)

    206 2006 - -L Data Validation Package U.S. Department of Energy Office of Legacy Management March 2006 Shiprock, New Mexico, Disposal Site June 2006 U.S. Department of Energy DVP-March 2006, Shiprock, New Mexico, Disposal Site June 2006 RIN 06020313 Page ii Contents Sampling Event Summary ...............................................................................................................1 Sample Location Map, Shiprock, New Mexico, Disposal Site

  11. Microsoft Word - RIN 06060399 DVP.doc

    Office of Legacy Management (LM)

    1314 2006 - -L Data Validation Package U.S. Department of Energy Office of Legacy Management June 2006 Monument Valley, Arizona, Processing Site September 2006 U.S. Department of Energy DVP-June 2006 Monument Valley, Arizona, Processing Site September 2006 RIN 06060399 Page ii Contents Sampling Event Summary ...............................................................................................................1 Sample Locations at Monument Valley, Arizona, Processing Site

  12. Microsoft Word - RIN05080225_DVP.doc

    Office of Legacy Management (LM)

    071 2006 - -L Data Validation Package U.S. Department of Energy Office of Legacy Management September 2005 Shiprock, New Mexico, Disposal Site Data Validation Package January 2006 U.S. Department of Energy DVP⎯September 2005, Shiprock, New Mexico, Disposal Site January 2006 RIN 05080225 Page ii Contents Sampling Event Summary ...............................................................................................................1 Shiprock, New Mexico Sample Location

  13. Microsoft Word - Figure_13_2015.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    35 2015 Flow Capacity (million cubic feet per day) Figure 13. Principal Interstate Natural Gas Flow Capacity Summary, 2015 Source: Energy Information Administration, Office of Oil, Gas, and Coal Supply Statistics. = Direction of Flow = Bi-directional 15,000 12,000 9,000 6,000 3,000 0

  14. Microsoft Word - figure_07-2016.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    1 Source: Office of Fossil Energy, U.S. Department of Energy, Natural Gas Imports and Exports. Figure 7. U.S. natural gas trade summary, 2011-2015 0 0.5 1 1.5 2 2.5 3 3.5 4 2011 2012 2013 2014 2015 Total Imports Total Exports Net Imports trillion cubic feet

  15. Microsoft Word - figure_09_2016.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    3 Canada Mexico Figure 9. Flow of natural gas imports, 2015 (billion cubic feet) Source: Energy Information Administration, based on data from the Office of Fossil Energy, U.S. Department of Energy, Natural Gas Imports and Exports. 12 50 674 190 United States 6 1 Trinidad/Tobago 12 Norway 6 Yemen 535 420 233 11 133 430 12 9 7 71 3

  16. Microsoft Word - Mustering card.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Idaho Operations Office Employee Mustering The email based check in system should only be used by DOE ID Employees. (Use in descending order until successful) Call: 1-208-526-COOP (2667) 1-800-DOE-DOE1 Ext. 382 (1-800-363-3631 Ext. 382) Email: id.coop@id.doe.gov CheckinIdaho@nuclear.energy.gov

  17. Microsoft Word - Airport_EA_Final.doc

    National Nuclear Security Administration (NNSA)

    515 Final Environmental Assessment for Proposed Closure of the Airport Landfills Within Technical Area 73 at Los Alamos National Laboratory, Los Alamos, New Mexico May 22, 2005 Department of Energy National Nuclear Security Administration Los Alamos Site Office Final EA for Proposed Closure of the Airport Landfills within TA-73 at LANL Page iii of viii Contents Acronyms and Terms .................................................................................................................. vi

  18. Microsoft Word - PV Report v20.doc

    Gasoline and Diesel Fuel Update

    A EIA Task Order No. DE-DT0000804, Subtask 3 Photovoltaic (PV) Cost and Performance Characteristics for Residential and Commercial Applications Final Report August 2010 Prepared for: Office of Integrated Analysis and Forecasting U.S. Energy Information Administration Prepared by: ICF International Contact: Robert Kwartin T: (703) 934-3586 E: rkwartin@icfi.com ii Table of Contents Executive Summary

  19. Microsoft Word - S08266_App_A-3.doc

    Office of Legacy Management (LM)

    Score 0 Fernald Preserve, Ohio, Wetland Mitigation Monitoring Report U.S. Department of Energy Doc. No. S08266 Appendix A-3, 2011 Amphibian Index of Biotic Integrity Data...

  20. Microsoft Word - VI_12_Degrees Awarded 2015.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    nuclear systems A. Bonasera Post Doc. at INFN - Laboratori Nazionali del Sud, Catania, Italy STUDENTS WHO RECEIVED GRADUATE DEGREES FROM NON-THESIS April 1, 2014 - March 31, 2015 ...

  1. Microsoft Word - Appendix M_ContingencyTrees.doc

    Office of Legacy Management (LM)

    M Groundwater Operable Unit Contingency Trees U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page M-3 Figure M-1. Validation and Statistical...

  2. Microsoft Word - S05993_CY2009 Annual Rpt.doc

    Office of Legacy Management (LM)

    ... Property Utilization and Disposal SEP Solar Evaporation Pond Rocky Flats Annual Report of Site Surveillance and Maintenance Activities-CY 2009 U.S. Department of Energy Doc. No. ...

  3. Microsoft Word - S05993_CY2009 Annual Rpt.doc

    Office of Legacy Management (LM)

    ... of Site Surveillance and Maintenance Activities-CY 2009 U.S. Department of Energy Doc. No. ... Purpose Approval Date Status as of December 31, 2009 Phase II and III Upgrades to Solar ...

  4. Microsoft Word - AL2005-13.doc | Department of Energy

    Energy.gov (indexed) [DOE]

    Microsoft Word - AL2005-13.doc More Documents & Publications PBA2007 Presentation-short-6-19-07DOE&0; Accident Investigation of the February 7, 2013, Scissor Lift Accident in the...

  5. Microsoft Word - AppendixH_CommentResponse.doc

    Office of Legacy Management (LM)

    S06246 Page H-1 Responsiveness Summary The U.S. Department of Energy (DOE) released the ... NFSS Vicinity Property Report U.S. Department of Energy Doc. No. S06246 October 2010 Page ...

  6. Office of Fossil Energy

    Energy.gov (indexed) [DOE]

    Terminal (Bcf) (Bcf) (Bcf) LNG Imports by Company Office of Fossil Energy Office of Oil & Natural Gas Office of Regulation and International Engagement Division of Natural Gas...

  7. Office of Fossil Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    LNG Imports by Receiving Terminal (Bcf) (Bcf) (Bcf) LNG Imports by Company Office of Fossil Energy Office of Oil & Natural Gas Office of Regulation and International Engagement ...

  8. Office of Communication - Staff

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    About Fermilab Office of Communication Office of Communication home | Office of Communication staff | speakers' bureau | available materials | links | talk to Fermilab ...

  9. Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

    Energy.gov [DOE]

    Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

  10. Microsoft Word - GC Mediation Evaluation _2-06-09_.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy GC Mediation Evaluation _2-06-09_.doc Microsoft Word - GC Mediation Evaluation _2-06-09_.doc Microsoft Word - GC Mediation Evaluation _2-06-09_.doc (29.87 KB) More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc HQ Mediation Program Brochure Microsoft Word - DRAFT CRB Interview Guidance

  11. Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

    Office of Energy Efficiency and Renewable Energy (EERE)

    Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

  12. Microsoft Word - FAL2003-03R.doc | Department of Energy

    Office of Environmental Management (EM)

    3-03R.doc Microsoft Word - FAL2003-03R.doc PDF icon Microsoft Word - FAL2003-03R.doc More Documents & Publications Microsoft Word - FAL2003-03Rattach.doc FAL2003-03Attachment.pdf...

  13. Microsoft Word - National Science Bowl Fact Sheet.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy National Science Bowl Fact Sheet.doc Microsoft Word - National Science Bowl Fact Sheet.doc Microsoft Word - National Science Bowl Fact Sheet.doc (244.47 KB) More Documents & Publications Microsoft Word - National Science Bowl Fact Sheet.doc Idaho Operations AMWTP Fact Sheet Heating Ventilation and Air Conditioning Efficiency

  14. Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy PPL 970-Materials and Inventory 5-9-05.doc Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc (22.24 KB) More Documents & Publications Microsoft Word - al95-06.doc DOE-HDBK-1139-2006 ppl970-3.pdf

  15. DOC-DOE China Mission Announcement Press Release | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    China Mission Announcement Press Release DOC-DOE China Mission Announcement Press Release DOC-DOE China Mission Announcement Press Release DOC-DOE China Mission Announcement Press Release (34.5 KB) More Documents & Publications DOC-DOE Joint China Mission Statement China 2015 Business Development Mission Marketing Flyer DOE-LPO_Email-Update_001_Through_11

  16. Petascale Post-Doc Project a Supercomputing Success Story

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Petascale Post-Doc Project a Supercomputing Success Story Petascale Post-Doc Project a Supercomputing Success Story ARRA-funded program takes petascale computing researchers to the next level March 24, 2014 Contact: Kathy Kincade, +1 510 495 2124, kkincade@lbl.gov petascalepostdocs.jpg From left: Jihan Kim, Filipe Maia, Alice Koniges, Robert Preissl, Brian Austin, Wangyi (Bobby) Liu , Kirsten Fagnan and Praveen Narayanan. The first post-doctoral research project centered at the Department of

  17. Richland Operations Office - Hanford Site

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Richland Operations Office Richland Operations Office Richland Operations Office River Corridor Central Plateau Groundwater Mission Support Newsroom Richland Operations Office...

  18. TWP93.0100104 DOC#: TWP-DOC-1.4 SCIENCE AND SITING STRATEGY FOR THE

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TWP93.0100104 DOC#: TWP-DOC-1.4 SCIENCE AND SITING STRATEGY FOR THE TROPICAL WESTERN PACIFIC ARM CART LOCALE Thomas P. Ackerman The Pennsylvania State University Bill Clements Fairley Barnes Los Alamos National Laboratory David S. Renné National Renewable Energy laboratory Science and Siting Strategy for the Tropical Western Pacific ARM CART Locale Ackennan, T., B. Clements, F. Barnes, and D. Renne DISCLAIMER This is a working document of the Tropical Western Pacific Program of the United

  19. Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy NationalPolicyAssurancesAwardTermsFinal81804.doc Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc (31.13 KB) More Documents & Publications Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc National Policy Assurances to be Incorporated as Award Terms Microsoft Word - NationalPolicyAssurances5-06.doc

  20. Microsoft Word - FAL2004-02.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Subject: Implementation of Fiscal Year (FY) 2004 Legislative Provisions What is the Purpose of this Financial Assistance Letter (FAL)? This FAL provides Contracting Officers and grants personnel guidance for the implementation of certain provisions contained in the Energy and Water Development Appropriations Act, 2004 (Energy & Water Act), Pub. L. 108-137, enacted December 1, 2003 and the Department of Interior and Related Agencies Appropriations Act, 2004 (Interior Act), Pub. L. 108-108,

  1. Microsoft Word - FAL2004-05.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy No. 2004-05 Financial Assistance Regulation Date 08/03/04 FINANCIAL ASSISTANCE LETTER Financial Assistance Letter is issued under the authority of the Procurement Executives of DOE and NNSA Subject: SELECTING THE APPROPRIATE AWARD INSTRUMENT What is the purpose of this Financial Assistance Letter (FAL)? This FAL provides Contracting Officers and other grants personnel guidance on selecting the appropriate award instrument. How will this change my work processes? This FAL

  2. Microsoft Word - FAL2004-06.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    4 Department of Energy No. 2004-06 Financial Assistance Regulation Date 11/02/04 FINANCIAL ASSISTANCE LETTER Financial Assistance Letter is issued under the authority of the Procurement Executives of DOE and NNSA SUBJECT: AWARD TERMS What is the Purpose of this Financial Assistance Letter (FAL)? This FAL provides Contracting Officers and other grants personnel guidance relating to standard award terms and reporting requirements for financial assistance awards. How will this Change My Work

  3. Microsoft Word - NETWG Charter.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Tribal Working Group Charter Mission The mission of the Nuclear Energy Tribal Working Group (NETWG) is to engage federally-recognized tribal governments and their designated representatives in U.S. Department of Energy (DOE) Office of Nuclear Energy (NE) activities. NETWG will serve as a conduit to foster communication, education of all generations, and promote active involvement of tribal governments. NETWG is dedicated to assisting in developing and maintaining the government-to-government

  4. Microsoft Word - corr measures addendum.doc

    Office of Legacy Management (LM)

    DOE-LM/GJ1241-2006 Pinellas Environmental Restoration Project Building 100 Area Corrective Measures Study Report Addendum July 2006 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Building 100 Area Corrective Measures Study Report Addendum July 2006 Page iii Contents Acronyms and Abbreviations

  5. Operating Guidelines Appendix C D.DOC

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Competitive Sourcing Program OPERATING GUIDELINES (CS-OG-01) C-1 APPENDIX C. CONFLICT OF INTERESTS GUIDELINES 1. PURPOSE This Appendix identifies personal conflicts of interest (PCI), including participation, representation, post- employment, and procurement information restrictions, and organizational conflict of interest (OCI) restrictions relating to the conduct of Office of Management and Budget (OMB) Circular A-76 competitions and associated procurement actions at the Department of Energy

  6. Microsoft Word - 08-1307.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    07:UFC 2300 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 July 29, 2008 Mr. Steve Zappe, Project Leader Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Subject: Final Audit Report A-08-12, Remote Handled Certification, Oak Ridge National Laboratory Central Characterization Project Dear Mr. Zappe: Enclosed is the final audit report for Oak Ridge National Laboratory Central

  7. Microsoft Word - 08-1315.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    15:UFC 2300 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 August 6, 2008 Mr. Steve Zappe, Project Leader Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Subject: Transmittal of the Final Audit Report for the Idaho National Laboratory/Central Characterization Project, Certification Audit A-08-10 Dear Mr. Zappe: Enclosed is the Idaho National Laboratory/Central Characterization

  8. Microsoft Word - 09-1581.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    581:UFC:2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 July 6, 2009 Mr. Steve Zappe, Project Leader Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Bldg. 1 Santa Fe, New Mexico 87505-6303 Subject: Transmittal of the Certification Audit Report for the Savannah River Site Central Characterization Project (A-09-16) Dear Mr. Zappe: This letter transmits the Savannah River Site Certification Audit Report for the

  9. Microsoft Word - 09-1602.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    602:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 July 28, 2009 Mr. Steve Zappe, Project Leader Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Subject: Transmittal of the Recertification Audit Report A-09-14, Idaho National Laboratory Central Characterization Project Dear Mr. Zappe: Enclosed is the Idaho National Laboratory/Central Characterization Project (INL/CCP)

  10. Microsoft Word - 09-1690.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    MAG:09-1690:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 September 22, 2009 Mr. Steve Zappe, Project Leader Hazardous Materials Bureau New Mexico Environment Department 2905 E. Rodeo Park Drive, Building 1 Santa Fe, New Mexico 87502-6110 Subject: Transmittal of the Contact-Handled Waste Certification Audit Report for the Oak Ridge National Laboratory Central Characterization Project, Audit A-09-24 Dear Mr. Zappe: This letter transmits the

  11. Microsoft Word - 09-1838.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    838:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 October 20, 2009 Mr. Steve Zappe, Project Leader Hazardous Materials Bureau New Mexico Environment Department 2905 E. Rodeo Park Drive, Building 1 Santa Fe, NM 87505-6110 Subject: Transmittal of the Certification Audit Report for the Hanford TRU Program Dear Mr. Zappe: This letter transmits the Hanford TRU Program Audit Report for the processes performed to characterize and certify waste as

  12. Microsoft Word - 45201 Submitted Dec 2003.doc

    Office of Legacy Management (LM)

    30 Long-term Monitoring Plan for the Central Nevada Test Area Prepared by Ahmed E. Hassan submitted to Nevada Site Office National Nuclear Security Administration U.S. Department of Energy Las Vegas, Nevada SEPTEMBER 2003 Publication No. 45201 Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation, or favoring by the United States Government or any

  13. Microsoft Word - 45221b.doc

    Office of Legacy Management (LM)

    51 Validation Analysis of the Groundwater Flow and Transport Model of the Central Nevada Test Area Prepared by Ahmed Hassan, Jenny Chapman, Hesham Bekhit, Brad Lyles, and Karl Pohlmann submitted to Nevada Site Office National Nuclear Security Administration U.S. Department of Energy Las Vegas, Nevada September 2006 Publication No. 45221 Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise, does not necessarily constitute or

  14. Microsoft Word - RioBlancotext.doc

    Office of Legacy Management (LM)

    5 Modeling Approach for Evaluating Radionuclide Transport in Nuclear-Stimulated Gas Reservoirs prepared by Clay Cooper and Jenny Chapman submitted to Nevada Operations Office National Nuclear Security Administration U.S. Department of Energy Las Vegas, Nevada SEPTEMBER 2001 Publication No. 45186 Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation, or

  15. Microsoft Word - U0159200June.doc

    Office of Legacy Management (LM)

    U0159200 GJO-2002-312-TAR GWMON-28.7-1 U.S. Department of Energy UMTRA Ground Water Research Project Phytoremediation of Nitrogen Contamination in Subpile Soils and in the Alluvial Aquifer at the Monument Valley, Arizona, Uranium Mill Tailings Site June 2002 Environmental Research Laboratory University of Arizona, Tucson, Arizona Environmental Sciences Laboratory U.S. Department of Energy Grand Junction Office Grand Junction, Colorado This page intentionally left blank Acknowledgements This

  16. AcqGuide70pt4.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Guide ----------------------------------------------- -------------------------------Chapter 70.4 (March 2016) 1 Cooperative Audit Strategy Reference: DEAR 970.5203-1, entitled, Management Controls ; DEAR 970.5232-3, entitled, Accounts, Records and Inspection; Chapter 4 of the Accounting Handbook, and Chapter 18 of the Inspector General Audit Manual. Overview This chapter provides guidance to contracting officers (CO) in their review of (1) INTERNAL AUDIT IMPLEMENTATION DESIGN, sub mitted

  17. Microsoft Word - 3215504_1.DOC

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Hogan Lovells US LLP is a limited liability partnership registered in the District of Columbia. Hogan Lovells refers to the international legal practice comprising Hogan Lovells US LLP, Hogan Lovells International LLP, Hogan Lovells Worldwide Group (a Swiss Verein), and their affiliated businesses with offices in: Abu Dhabi Alicante Amsterdam Baltimore Beijing Berlin Boulder Brussels Caracas Colorado Springs Denver Dubai Dusseldorf Frankfurt Hamburg Hanoi Ho Chi Minh City Hong Kong Houston

  18. Microsoft Word - CERTS Article May2011.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Two Grids Can Be Better Than One - How the CERTS Microgrid Evolved from Concept to Practice By Elizabeth McGowan Contractor to the U.S. Department of Energy's Office of Electricity Delivery and Energy Reliability Don't let the diminutive name fool you. A microgrid might sound like a tiny achievement. But designing an affordable, reliable integrated power system that can seamlessly isolate from the nation's electric grid during a blackout or a voltage excursion - and then reconnect just as

  19. Microsoft Word - FIA-12-0061.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    John P. Newton ) ) Filing Date: October 9, 2012 ) Case No.: FIA-12-0061 ) ) Issued: October 31, 2012 _______________ Decision and Order _______________ On October 9, 2012, John P. Newton ("Appellant") filed an Appeal from determinations issued to him on September 6, 2012, and September 12, 2012, by the Office of Information Resources (OIR) of the Department of Energy (DOE) (FOIA Request Numbers HQ-2012-01768-F & HQ-2012-01835-F). In those determinations, OIR responded to two

  20. Microsoft Word - FIA-12-0063.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    the Native Hawaiian Legal ) Corporation. ) ) Filing Date: October 12, 2012 ) Case No.: FIA-12-0063 ) ) Issued: October 31, 2012 _______________ Decision and Order _______________ On October 12, 2012, the Native Hawaiian Legal Corporation ("Appellant") filed an Appeal from a determination issued to it on September 11, 2012, by the Golden Field Office (GFO) of the United States Department of Energy (DOE) (FOIA Request Number GO-12-296). In its determination, the GFO responded to the

  1. Microsoft Word - Management Control Cover1.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Management Controls over the Federal Energy Regulatory Commission's Unclassified Cyber Security Program - 2006 OAS-M-06-10 September 2006 Department of Energy Washington, DC 20585 September 25, 2006 MEMORANDUM FOR THE EXECUTIVE DIRECTOR, FEDERAL ENERGY REGULATO Y COMMISSION , -x, FROM: Rickey k. ~ a k Assistant Inspector General for Financial, Technology and Corporate Audits Office of Inspector General SUBJECT: INFORMATION: Audit Report on "Management Controls over the Federal Energy

  2. Microsoft Word - ex parte com_10052010.doc

    Energy Savers

    20 th , 2006 Mr. Lawrence Mansueti Permitting, Siting, and Analysis Division Office of Electricity Delivery and Energy Reliability Department of Energy 1000 Independence Avenue, SW Washington, DC 20585-0119 Dear Mr. Mansueti, This letter is in response to the Department of Energy Emergency Order to Resume Limited Operation at the Potomac River Generating Station, Alexandria, VA, in Response to Electricity Reliability Concerns in Washington, DC. For over 50 years, and as indicated by Mirant's own

  3. Microsoft Word - OKalossa Comments.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Office of Electricity Delivery and Energy Reliability U.S. Department of Energy 1000 Independence Avenue, SW, Room 8H033 Washington, D.C. 20585 RE: Smart Grid RFI: Addressing Policy and Logistical Challenges to Smart Grid Implementation, 75 Fed. Reg. 57,006 (September 17, 2010). Ladies and Gentlemen: Okaloosa Gas District (The District) an Independent Special District of the State of Florida is appreciative of the opportunity to submit for your consideration the following comments in response to

  4. Microsoft Word - supplemental comment letter.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    March 23, 2006 Lawrence Mansueti Permitting, Siting, and Analysis Division Office of Electricity and Energy Reliability U.S. Department of Energy 1000 Independence Avenue, SW Washington, DC 20585-0119 Re: Supplemental Comments on the Department of Energy's Emergency Order To Resume Operation at Mirant's Potomac River Generating Station Dear Mr. Mansueti: The Institute for Public Representation, on behalf of the Anacostia Riverkeeper at Earth Conservation Corps, the Patuxent Riverkeeper, and the

  5. Microsoft Word - 12-1556.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    556:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 December 3, 2012 Mr. John E. Kieling, Bureau Chief Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Bldg. 1 Santa Fe, NM 87505-6303 Subject: Transmittal of the Final Audit Report for the Los Alamos National Laboratory Central Characterization Project Recertification Audit A-12-12 Dear Mr. Kieling: This letter transmits the Final Audit Report for the Carlsbad

  6. Microsoft Word - 12-1568.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    68:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 December 12, 2012 Mr. John E. Kieling, Chief Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Bldg. 1 Santa Fe, New Mexico 87505-6303 Subject: Transmittal of the Final Audit Report for Recertification Audit A-12-14, INL Analytical Laboratories Utilizing the Central Characterization Project Dear Mr. Kieling: This letter transmits the final audit report for

  7. Microsoft Word - BOOK_2003_V4.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Stanford Synchrotron Radiation Laboratory 30 th Annual Users' Meeting PROGRAM & ABSTRACTS OCTOBER 8 - 10, 2003 Stanford Synchrotron Radiation Laboratory SLAC, Stanford University Stanford, CA 94309 Organizers: Benjamin Bostick, Dartmouth College Timothy McPhillips, SSRL SSRL is funded by the Department of Energy, Offices of Basic Energy Sciences and Biological and Environmental Research; the National Institutes of Health, National Center for Research Resources, Biomedical Technology Program,

  8. Microsoft Word - CSC Scorecard.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Energy Fee Determination Posting Requirements Office of Environmental Management Attachment 2 Award Fee Determination Scorecard Contractor: Computer Sciences Corporation (CSC) Contract: Occupational Health Services Contract Number: DE-AC06-04RL14383 Award Period: 10/01/2011 to 09/30/2012 Basis of Evaluation: Performance and Evaluation Plan (PEMP) for Period FY 2012 Award Fee Available: $916,130.00 Award Fee Earned: $824,517.00 (90%) Award Fee Area Adjectival Ratings: Performance Incentive

  9. Microsoft Word - California_cleanup.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    WIPP Completes California Sites Cleanup CARLSBAD, N.M., June 14, 2010 - The U.S. Department of Energy's Carlsbad Field Office (CBFO) has successfully completed its campaign to clean up all defense- related transuranic (TRU) waste at California's Vallecitos Nuclear Center (VNC) near Sunol and Lawrence Livermore National Laboratory (LLNL) Site 300, east of Livermore. The last shipment of defense related TRU waste from VNC was shipped to Idaho National Laboratory on June 7. Following the

  10. Microsoft Word - DOE Sustainability Awards 2012.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    !& ! ! ! ! ! U.S. Department of Energy Carlsbad Field Office Waste Isolation Pilot Plant P.O. Box 3090 Carlsbad, New Mexico 88221 For Immediate Release WIPP Environmental Initiatives Earn DOE Recognition ! CARLSBAD, N.M., October 29, 2012 - The U.S. Department of Energy (DOE) recently recognized four initiatives at the Waste Isolation Pilot Plant (WIPP) and more than 20 people for improvements in energy, water and fleet efficiency while reducing pollution and waste across the DOE complex.

  11. Microsoft Word - ISDAC_orientation_pkt.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    ORIENTATION PACKAGE ISDAC Field Campaign March 29 - May 2 Fairbanks, Alaska 1 Welcome to Alaska! This information package is to help you become familiar with the area and answer some questions you might have as you arrive. If you have any questions please feel free to contact Debbie at 509.392.1854. Contents Cell Phone Numbers Fairbanks * Campaign Info Site Locations in Fairbanks Badging and Access Mission Schedule Safety Network and Communications Office Equipment * Local Information * Map Cell

  12. Microsoft Word - CQA2004_20060727.doc

    Gasoline and Diesel Fuel Update

    4) Distribution Category UC-950 Cost and Quality of Fuels for Electric Plants 2003 and 2004 June 30, 2006 (Updated August 2, 2006) Energy Information Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. Department of Energy Washington DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the Department of Energy. The information contained herein should not be construed as advocating or reflecting

  13. Microsoft Word - CQA2005W.doc

    Gasoline and Diesel Fuel Update

    5) Distribution Category UC-950 Cost and Quality of Fuels for Electric Plants 2004 and 2005 December 2006 Energy Information Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. Department of Energy Washington DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the Department of Energy. The information contained herein should not be construed as advocating or reflecting any policy position of

  14. Microsoft Word - CQA2006W.doc

    Gasoline and Diesel Fuel Update

    6) Distribution Category UC-950 Cost and Quality of Fuels for Electric Plants 2005 and 2006 October 2007 Energy Information Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. Department of Energy Washington DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the Department of Energy. The information contained herein should not be construed as advocating or reflecting any policy position of the

  15. Office of Electricity Delivery and Energy Reliability Recovery Program Plan

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    | Department of Energy Electricity Delivery and Energy Reliability Recovery Program Plan Office of Electricity Delivery and Energy Reliability Recovery Program Plan Microsoft Word - OE PSRP June 5 2009 _OE_ Final.doc (105.88 KB) More Documents & Publications Microsoft Word - PSRP Updates 6-25-10_v2 Update to the 2008 EAC Report: "Smart Grid: Enabler of the New Energy Economy Report Recommendations" EAC Presentation: How DOE is Organized to Provide Leadership on Electricity

  16. Notice of Reestablishment of the Electricity Advisory Committee

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Office of Policy and International Affairs. FR Doc. ... of duties imposed upon the Department of Energy by law. ... L. 92-463), the General Services Administration Final Rule ...

  17. Microsoft Word - M002-SF30.doc

    National Nuclear Security Administration (NNSA)

    I:.CONTRACT ID CODE IPAGE OF PAGES DE-NR0000031 1 I 27 2. AMENDMENT/MODIFICATION NO. 3. EFFECTIVE DATE 4. REQUISITION/PURCHASE REQ. NO. 15. PROJECT NO. (II app/icable) 002 Same as Block 16C N/A 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) Code I U.S. Department of Energy Pittsburgh Naval Reactors Office P.O. Box 109 West Mifflin, PA 15122-0109 8. NAME AND ADDRESS OF CONTRACTOR (No. slreet, county, State and ZIP Code) ..J.:l 9.A. AMENDMENT OF SOLICITATION NO. Bechtel Marine

  18. Microsoft Word - 07-1061.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    DM/KJB:07-1061:UFC2300 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 June 20, 2007 Steve Zappe, Project Leader Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Bldg. 1 Santa Fe, NM 87505-6303 Subject: Transmittal of the Certification Audit Report for the, INL/CCP Audit A-07-19 Dear Mr. Zappe: This letter transmits the Idaho National Laboratory/Central Characterization Project (INL/CCP) Audit Report for the processes

  19. Microsoft Word - March242005-Donna.doc

    Office of Legacy Management (LM)

    Mound Site Transition Plan Rev. 0 March 2005 Mound STP, Rev. 0 - iv - March 2005 Executive Summary The U.S. Department of Energy (DOE) Offices of Legacy Management (LM) and Environmental Management (EM) are planning and implementing the transfer of the Miamisburg Closure Project (MCP) for long-term surveillance and maintenance (LTS&M) and for certain legacy worker and contract liabilities to LM by the end of fiscal year (FY) 2006 (see Exhibit ES-1). The purpose of the Mound Site Transition

  20. Microsoft Word - S03741_CADD.doc

    Office of Legacy Management (LM)

    RECORD OF TECHNICAL CHANGE Technical Change No . . DOE-LM/1555-2007 ROTC-2 Page-~-- of _ _;_3 _ _ _ Activity Name Central Nevada Test Area - ROTC for the CADD/CAP Addendum Date June 12. 2013 The following technical changes (including justification) are requested by: Mark Kautsky Department of Energy/Office of Legacy Management (Site Manager) Description of Change: Throughout Document: The terms "5-year", "Proof of Concept", and "5-year Proof of Concept Monitoring"

  1. Microsoft Word - u01493_July2002.doc

    Office of Legacy Management (LM)

    97-TAR MAC-GWSHP1.9 Final Ground Water Compliance Action Plan for Remediation at the Shiprock, New Mexico, UMTRA Site July 2002 U0149300 GJO-2001-297-TAR GWSHP1.9 Final Ground Water Compliance Action Plan for Remediation at the Shiprock, New Mexico, UMTRA Site July 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed under DOE Contract No. DE-AC13-96GJ87335 This page intentionally left blank Document Number U0149300 Contents DOE/Grand Junction

  2. Microsoft Word - DOE Document _2_.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    UNITED STATES OF AMERICA BEFORE THE DEPARTMENT OF ENERGY OFFICE OF ELECTRICITY DELIVERY AND ENERGY RELIABILITY NORTHERN PASS TRANSMISSION LLC DOCKET NO. PP-___ APPLICATION OF NORTHERN PASS TRANSMISSION LLC FOR PRESIDENTIAL PERMIT OCTOBER 14, 2010 2 TABLE OF CONTENTS Page No. SECTION 1 4 INFORMATION REGARDING THE APPLICANT 4 1.1 Legal Name of the Applicant 5 1.2 Legal Names of All Partners 5 1.3 Communications and Correspondence 5 1.4 Foreign Ownership and Affiliations 6 1.5 Existing Contracts

  3. Microsoft Word - 09-1865.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    65:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 November 4, 2009 Mr. Steve Zappe, Project Leader Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Subject: Transmittal of the Interim and Final Audit Report for the Idaho National Laboratory/Central Characterization Project Remote-Handled Waste Visual Examination Process, Audit A-10-03 Dear Mr. Zappe: Enclosed is the

  4. Microsoft Word - A089 Funding.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    9 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  5. Microsoft Word - A094_SF30.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    A094 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF

  6. Microsoft Word - A100 Funding.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    A100 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF

  7. Microsoft Word - A105 Funding.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    5 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  8. Microsoft Word - A109 Funding.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    9 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  9. Microsoft Word - A111 Funding.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    1 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  10. Microsoft Word - A112, Funding.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    2 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  11. Microsoft Word - A113 Funding.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    3 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  12. Microsoft Word - A116 Funding.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    6 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  13. Microsoft Word - A119 Funding.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    9 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  14. Microsoft Word - A138- Draft.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    8 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 27-08RV14136.010 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A.

  15. Microsoft Word - DOE_EA-1454.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    54 Rev. 0 Environmental Assessment Reactivation and Use of Three Former Borrow Sites in the 100-F, 100-H, and 100-N Areas U.S. Department of Energy Richland Operations Office Richland, Washington 99352 March 2003 DOE/EA-1454 Rev. 0 EA for Reactivation and Use of Three Former Borrow Sites in the 100-F, 100-H, and 100-N Areas March 2003 i TABLE OF CONTENTS 1.0 PURPOSE AND NEED FOR AGENCY ACTION ................................................... 1-1 2.0 BACKGROUND

  16. Microsoft Word - Draft A142 _2_.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    2 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 27-09RV14136.002 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A.

  17. Microsoft Word - FOI 2014-00096.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    CERTIFIED MAIL November 18, 2013 Mr. Paul DeRienzo (home address has been deleted) Dear Mr. DeRienzo: FREEDOM OF INFORMATION ACT REQUEST (FOI 2014-00096) This office is in receipt of your letter dated October 7, 2013, requesting certain documents regarding the design of heat exchanger 4A any other of the heat exchangers used as part of the power generating system used by the New Process Reactor at the Hanford Site in the years 1963 and 1964. In a telephone conversation with me on October 17,

  18. Microsoft Word - Final A139.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    9 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 27-09RV14136.001 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A.

  19. Microsoft Word - HAB adv #147.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    7 Subject: Hanford Budget Process Adopted: April 4, 2003 Page 1 April 4, 2003 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Roy Schepens, Manager U. S Department of Energy, Office of River Protection P.O. Box 450 Richland, WA 99352 John Iani, Regional Administrator U. S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington State Department of Ecology P.O. Box 47600

  20. Microsoft Word - HABAdv#230_LTS.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    230 Subject: Hanford Long-Term Stewardship Plan Adopted: April 9, 2010 Page 1 April 9, 2010 David Brockman, Manager U.S. Department of Energy, Richland Operations Office P.O. Box 550 (A7-75) Richland, WA 99352 Re: Hanford Long-Term Stewardship Program Plan Dear Mr. Brockman, Background The Hanford Advisory Board (Board) appreciates the opportunity to provide early input into the development of, and to provide comments on, the Preliminary Draft of the Hanford Long-Term Stewardship (LTS) Program

  1. Microsoft Word - HABAdv#237EECA.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    7 Subject: EE/CA for 105-KE Reactor Decommissioning Adopted: Nov. 5, 2010 Page 1 November 5, 2010 Dave Brockman, Manager U.S. Department of Energy, Office of River Protection P.O. Box 450 (H6-60) Richland, WA 99352 Matt McCormick, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd,, Suite 115 Richland WA 99352 Jane Hedges, Program Manager Washington State Department

  2. Microsoft Word - HABAdv#251PIP.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    1 Subject: Hanford Public Involvement Plan Adopted: November 4, 2011 Page 1 November 4, 2011 Scott Samuelson, Manager U.S. Department of Energy, Office of River Protection P.O. Box 450 (H6-60) Richland, WA 99352 Matt McCormick, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd,, Suite 115 Richland WA 99352 Jane Hedges, Program Manager Washington State Department of

  3. Microsoft Word - HABAdv#252LSSC.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    2 Subject: Hanford's 2011 Lifecycle Scope, Schedule, and Cost Report Adopted: November 4, 2011 Page 1 November 4, 2011 Scott Samuelson, Manager U.S. Department of Energy, Office of River Protection P.O. Box 450 (H6-60) Richland, WA 99352 Matt McCormick, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd,, Suite 115 Richland WA 99352 Jane Hedges, Program Manager

  4. Microsoft Word - M051 SF 30.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    M051 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF

  5. Microsoft Word - M057 Page 2.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    7 3. EFFECTIVE DATE (M/D/Y) see block 16 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  6. Microsoft Word - M063 SF 30.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    3 3. EFFECTIVE DATE (M/D/Y) see block 16 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  7. Microsoft Word - M066 SF 30.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    5 3. EFFECTIVE DATE (M/D/Y) see block 16 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  8. Microsoft Word - M068 SF 30.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    8 3. EFFECTIVE DATE (M/D/Y) see block 16 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  9. Microsoft Word - M069 SF 30.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    9 3. EFFECTIVE DATE (M/D/Y) see block 16 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  10. Microsoft Word - M071 SF 30.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    1 3. EFFECTIVE DATE (M/D/Y) see block 16 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  11. Microsoft Word - M073 SF 30.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    3 3. EFFECTIVE DATE (M/D/Y) see block 16 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  12. Microsoft Word - M088.SF30.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    88 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  13. Microsoft Word - M090.SF30.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    90 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  14. Microsoft Word - M091.SF30.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    1 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  15. Microsoft Word - M092.SF30.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    2 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  16. Microsoft Word - M093.SF30.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    3 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  17. Microsoft Word - M093.SF30.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    1 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  18. Microsoft Word - M117 Melter.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    7 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  19. Microsoft Word - M128 Word _2_.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    8 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  20. Microsoft Word - M134 Word.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    3 2. AMENDMENT/MODIFICATION NO. M134 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA