National Library of Energy BETA

Sample records for officer fr doc

  1. V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerabilit...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability June 25, 2013 - 12:41am Addthis PROBLEM: ...

  2. DOE/Grand Junction Office Bluewater LTSP July 1997 Doc. No. S00012AA...

    Office of Legacy Management (LM)

    DOEGrand Junction Office Bluewater LTSP July 1997 Doc. No. S00012AA, Page iii Contents Page 1.0 Introduction ......

  3. V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy 85: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability June 25, 2013 - 12:41am Addthis PROBLEM: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability PLATFORM: Apache OpenOffice SDK 3.x ABSTRACT: Apache has acknowledged a vulnerability in Apache OpenOffice SDK REFERENCE LINKS: Apache OpenOffice Secunia Advisory SA53963 Secunia Advisory SA53846 CVE-2013-1571 IMPACT ASSESSMENT:

  4. Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc (160.81 KB) More Documents & Publications Notice of Proposed Rulemaking (August 6, 2009) Notice of Proposed Rulemaking (May 16, 2007) Final Rule (December 4, 2009)

  5. webinar_innovation_organizing_strategizing.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    organizingstrategizing.doc webinarinnovationorganizingstrategizing.doc webinarinnovationorganizingstrategizing.doc Microsoft Office document icon webinarinnovationorganizi...

  6. webinar_innovation_net_metering_interconnection.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    netmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc Microsoft Office document icon ...

  7. fed_finance_facilities_ee_upgrades_deployment.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc Microsoft Office document icon ...

  8. webinar_innovation_financing.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    financing.doc webinarinnovationfinancing.doc webinarinnovationfinancing.doc Microsoft Office document icon webinarinnovationfinancing.doc More Documents & Publications ...

  9. webinar_innovation_planning_zoning.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    planningzoning.doc webinarinnovationplanningzoning.doc webinarinnovationplanningzoning.doc Microsoft Office document icon webinarinnovationplanningzoning.doc More ...

  10. finance_programs.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    financeprograms.doc financeprograms.doc financeprograms.doc Microsoft Office document icon financeprograms.doc More Documents & Publications Tools for Designing & Implementing ...

  11. csep_transcript_arlington.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Office document icon cseptranscriptarlington.doc More Documents & Publications Tools for Designing & Implementing Better Finance Programs financeprograms.doc financeprograms

  12. Microsoft Word - Report Cover.doc

    Office of Environmental Management (EM)

    on Smart Grid RFI RedSeal Systems, Inc. 1 October 29, 2010 Office of Electricity Delivery and Energy Reliability US Department of Energy Room 8H033 1000 Independence Avenue, SW Washington, DC 20585 Re: Comments on "Smart Grid RFI: Addressing Policy and Logistical Challenges" 75 FR 57006 [FR Doc. 2010-23251] From: Steve Dauber Vice-President, Marketing RedSeal Systems 2121 South El Camino Real, Suite 300 San Mateo, CA 94403 Ph: 650-645-6209 RedSeal

  13. Microsoft Word - DOETTQuestions.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    DOETTQuestions.doc Microsoft Word - DOETTQuestions.doc Microsoft Word - DOETTQuestions.doc (48.9 KB) More Documents & Publications Microsoft Word - 73FR72036_UC signed 1� Microsoft Word - SRNL Fed Register Response.doc Subcontractor Rights Under CRADAs and WFO Agreements

  14. Office of Electricity Delivery and Energy Reliability

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Comments of Cisco Systems to Office of Electricity Delivery and Energy Reliability Department of Energy in Response to Request for Information: Addressing Policy and Logistical Challenges to Smart Grid Implementation Issued September 13, 2010 FR Doc. 2010-23251 November 30, 2010 Cisco Systems provides these Comments in response to the Request for Information ("RFI") issued by the Office of Electricity Delivery and Energy Reliability of the Department of Energy ("DOE") on

  15. Savannah River Operations Office; Interim Management of Nuclear Materials at the Savannah River Site

    Office of Environmental Management (EM)

    099 Federal Register / Vol. 62, No. 220 / Friday, November 14, 1997 / Notices Barbara A. Carmichael, Alternate Air Force Federal Register Liaison Officer. [FR Doc. 97-29919 Filed 11-13-97; 8:45 am] BILLING CODE 3910-01-P DEPARTMENT OF EDUCATION Notice of Proposed Information Collection Requests AGENCY: Department of Education. ACTION: Proposed collection; comment request. SUMMARY: The Deputy Chief Information Officer, Office of the Chief Information Officer, invites comments on the proposed

  16. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    22.62 KB) More Documents & Publications Microsoft Word - FOA cover sheet.doc Recovery Act, Office of the Biomass Program,Funding Opportunity Announcements Special Notice Microsoft Word - FOA cover sheet.doc

  17. raising_investment_funds_for_clean_energy_programs.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc Microsoft ...

  18. howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc (117.5 KB) More Documents & Publications How to Design and Market Energy Efficiency Programs to Specific Neighborhoods Using Social Media to Engage the Community in Energy Efficiency

  19. highperformanceleasingstrategiesforstateandlocalgovernments.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc (93 KB) More Documents & Publications High Performance Leasing Strategies for State and Local Governments Leveraging Portfolio Manager for Disclosure and Green Leasing Practices

  20. OSTIblog Articles in the FR Topic | OSTI, US Dept of Energy Office of

    Office of Scientific and Technical Information (OSTI)

    Scientific and Technical Information FR

  1. OFFICE,

    Office of Legacy Management (LM)

    OFFICE, . . . . . ..-..__. _ --.-.__.. .-..I............ !..-... bUmME. wArl&l ' rrsldu*. in the dw6lopmQt pmgrwh : Be ostiamts Uuat not man lf+ .b%'o,Q~~~ds. cik'e%ah of the eevenl reel&~ will be require& In : 'ri~ofthehereiabefor6notedeopreodo~ of puriata~tio.aadap :, Iv ve unbntend you vi11 not obj.& to:tha aoe " ai spoh +ant+lea of the mirloua real&es ,, ', ',"" ': ., .,.. i. : /~. ,".. .I,: /, . . ' .* ,; ., ,' ,:.' . .-;. ,-Y .b4 P-0 : ,.

  2. Doc...~En.

    Office of Legacy Management (LM)

    ' : ,:#;: .' :.' . ,.:: :,; ..,' ... ..,,..,.... - .~~._ I&i3:scD .::-:, TO-340 .":: ..' . - ' - -. ' . .." ,.. .;.. Very traly yours;, -' .~X :, Doc...~En. ' Br.:Re&ng ';;a' : _, Div. Reading File ., ,, .~, ,.~-

  3. exploringpowerpurchaseagreementsthebasicspart1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc (112.5 KB) More Documents & Publications Exploring Power Purchase Agreements - The Basics Part 1

  4. O:\IM-20\E-Government Program Office\FDMS\FDMS database\DOE\2012\Document List 03-02-2012 10-10-11-600\Document List 03-02-2012 10-10-11-600_docs\DOE-HQ-2012-0004-DRAFT-0005.html

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5.html[2/3/2012 12:41:43 PM] PUBLIC SUBMISSION As of: February 03, 2012 Received: January 17, 2012 Status: Pending_Post Tracking No. 80f99189 Comments Due: January 20, 2012 Submission Type: Web Docket: DOE-HQ-2012-0004 U.S. Department of Energy Audit Guidance: For-Profit Recipients Comment On: DOE-HQ-2012-0004-0001 Audit Guidance: For-Profit Recipients Document: DOE-HQ-2012-0004-DRAFT-0005 Comment on FR Doc # 2011-32622 Submitter Information Name: Carol Hellmann Address: US Dept of Energy 1617

  5. O:\IM-20\E-Government Program Office\FDMS\FDMS database\DOE\2012\Document List 03-02-2012 10-10-11-600\Document List 03-02-2012 10-10-11-600_docs\Robin Hindel_ Comment -DRAFT-0003.html

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Robin%20Hindel_%20Comment%20-DRAFT-0003.html[2/3/2012 12:39:35 PM] PUBLIC SUBMISSION As of: February 03, 2012 Received: January 11, 2012 Status: Pending_Post Tracking No. 80f93029 Comments Due: January 20, 2012 Submission Type: Web Docket: DOE-HQ-2012-0004 U.S. Department of Energy Audit Guidance: For-Profit Recipients Comment On: DOE-HQ-2012-0004-0001 Audit Guidance: For-Profit Recipients Document: DOE-HQ-2012-0004-DRAFT-0003 Comment on FR Doc # 2011-32622 Submitter Information Name: Robin

  6. Microsoft Word - Corp Impl | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Corp Impl Microsoft Word - Corp Impl Microsoft Word - Corp Impl (422.79 KB) More Documents & Publications ESTABLISHMENT OF MANAGEMENT DECISIONS ON OFFICE OF INSPECTOR GENERAL REPORTS, DOE O 221.3 Microsoft Word - AL2007-01.doc DOE Systems Engineering Methodology (SEM): Stage Exit V

  7. Doc.~:Ru.

    Office of Legacy Management (LM)

    .' , .' c,j .c; Distriblition:~ ;. <; ~..,:L.D.i&%.ay,FiN-OR00 Doc.~:Ru. ,.,. 75. ' Br..Reading 'ire' ,lliv. Read&q File ,: '. ~ ,, .-' . ...: - SURNAME..

  8. partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc (129.5 KB) More Documents & Publications Partnering With Utilities to Offer Energy Efficiency Programs Webinar Transcript Partnering with Utilities Part 2 - Advanced Topics for Local Governments in Creating

  9. Microsoft Word - 2007 NESHAP Final with Signature page.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    2005 FOIA ANNUAL REPORT.doc Microsoft Word - 2005 FOIA ANNUAL REPORT.doc report2005.pdf Microsoft Word - 2005 FOIA ANNUAL REPORT.doc (45.24 KB) More Documents & Publications U.S. Department of Energy 2008 Annual FOIA Report Office of Information Resources (MA-90) ANNUAL FOIA REPORT FOR 2009

    trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation, or favoring by the U.S. Government or any agency thereof. Available for sale to the

  10. Microsoft Word - U0194500July2005.doc

    Office of Legacy Management (LM)

    4500 GJO-2004-579-TAC Office of Legacy Management Refinement of Conceptual Model and Recommendations for Improving Remediation Efficiency at the Shiprock, New Mexico, Site July 2005 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Conceptual Model Refinement and Efficiency Recommendations July 2005 Doc. No.

  11. U0174100.doc

    Office of Legacy Management (LM)

    Environmental Assessment of Ground Water Compliance at the Durango, Colorado, UMTRA ... DOE Grand Junction Office EA of Ground Water Compliance at the Durango Site November ...

  12. U0083900.doc

    Office of Legacy Management (LM)

    ... Grand Junction Office) Robert Bleil (Compliance Specialist) (970) 248-6503 Michelle Smith (Public Relations) (970) 248-6583 Project Description DOE has (1) installed wells to ...

  13. Microsoft Word - S0244800.doc

    Office of Legacy Management (LM)

    ... ground water from the interceptor drains and extraction wells is solar evaporation. ... Annual Performance Report, Shiprock, New Mexico U.S. Department of Energy Doc. No. ...

  14. Microsoft Word - ContractManagementPlanningDRIVERS.doc | Department... (indexed) [DOE]

    ContractManagementPlanningDRIVERS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS.doc Microsoft Word - ARRAMOModelMod.doc...

  15. energydisclosureandleasingstandardsbestpractices.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    energydisclosureandleasingstandardsbestpractices.doc energydisclosureandleasingstandardsbestpractices.doc energydisclosureandleasingstandardsbestpractices.doc (100.5 KB) More Documents & Publications Leveraging Portfolio Manager for Disclosure and Green Leasing Practices Communicating Success, Measuring Improvements, Sharing Results Communicating Success, Measuring Improvements, Sharing Results

  16. HABadv-121.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Manager Department of Energy, Richland Operations P.O. 550 (A7-50) Richland, WA 99352 Harry Boston, Manager Department of Energy, Office of River Protection 2440 Stevens...

  17. 2B-01.doc

    Energy Savers

    ... performed under DOE contract number DE-AC01-02GJ79491 by the S.M. Stoller Corporation for the U.S. Department of Energy, Office of Legacy Man- agement, Grand Junction, Colorado. ...

  18. Category:NEPA Doc | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    NEPA Doc Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Category: NEPA Documents Collections Add.png Add a new NEPA Document Collection Pages in category "NEPA Doc"...

  19. N0057000.doc

    Office of Legacy Management (LM)

    000 GJO- 2002-380- TAC GJO-PIN 13.5.1-1 Pinellas Environmental Restoration Project Northeast Site Non-Aqueous Phase Liquids Interim Measures Progress Report July through September 2002 October 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-02GJ79491 Task Order Number ST03-107 Document Number N0057000 Contents DOE/Grand Junction Office Northeast Site NAPL Interim Measures Progress Report October 2002 Page

  20. spurring_local_economic_development_clean_energy_programs.doc... (indexed) [DOE]

    spurringlocaleconomicdevelopmentcleanenergyprograms.doc spurringlocaleconomicdevelopmentcleanenergyprograms.doc More Documents & Publications Spurring Local Economic...

  1. webinar_innovation_permitting_inspections.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications webinarinnovationfinancing.doc raisinginvestmentfundsforcleanenergyprograms.doc Communicating Success, Measuring Improvements, Sharing Results

  2. Microsoft Word - AL2002-03.doc | Department of Energy

    Office of Environmental Management (EM)

    2-03.doc Microsoft Word - AL2002-03.doc PDF icon Microsoft Word - AL2002-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - FAL2004-01.doc...

  3. Microsoft Word - FAL2004-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - FAL2004-01.doc PDF icon Microsoft Word - FAL2004-01.doc More Documents & Publications Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-02.doc...

  4. Microsoft Word - AL2006-08.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    8.doc Microsoft Word - AL2006-08.doc PDF icon Microsoft Word - AL2006-08.doc More Documents & Publications AL2007-05.doc&0; Microsoft Word - AL2005-14.doc Microsoft Word - ...

  5. Microsoft Word - AL2005-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5-03.doc Microsoft Word - AL2005-03.doc PDF icon Microsoft Word - AL2005-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - AL2006-08.doc ...

  6. Microsoft Word - 98-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    8-11.doc Microsoft Word - 98-11.doc PDF icon Microsoft Word - 98-11.doc More Documents & Publications Microsoft Word - AL2006-08.doc Microsoft Word - AL2005-01.doc Microsoft Word -...

  7. Oak Ridge's Department of Energy Offices Achieve Small Business Contract

    National Nuclear Security Administration (NNSA)

    Funding Record | National Nuclear Security Administration | (NNSA) Ridge's Department of Energy Offices Achieve Small Business Contract Funding Record December 15, 2008 Microsoft Office document icon NR-08-53.doc

  8. Microsoft Word - 45196.doc

    Office of Legacy Management (LM)

    24 Contaminant Boundary at the Faultless Underground Nuclear Test Prepared by Greg Pohll, Karl Pohlmann, Jeff Daniels, Ahmed Hassan and Jenny Chapman submitted to Nevada Site Office National Nuclear Security Administration U.S. Department of Energy Las Vegas, Nevada APRIL 2003 Publication No. 45196 Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation,

  9. sr0801.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Office, P.O. Box A, Aiken, S.C. 29802 NEWS MEDIA CONTACTS: For Immediate Release June 19, 2008 Julie Petersen (803) 952-7690 Jim Giusti (803) 952-7684 DOE Marks Key Cleanup and Closure Milestones at its Savannah River Site AIKEN, S.C. - U.S. Department of Energy (DOE) Assistant Secretary for Environmental Management (EM) James A. Rispoli today marked the start of normal operations of interim salt waste processing facilities - the Actinide Removal

  10. Microsoft Word - 1897.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    97 (9/12) Page 1 of 4 Form 1897 Onsite Non-US Government-Owned Controlled Article Authorization Form When properly executed, this form authorizes the described controlled article (see P217 Controlled Articles) to reside at, or be removed from, LANL during the specified period of time. No other controlled article may be substituted under this authorization. The original, signed form must be kept with the controlled article at all times, and a copy sent to the Information Security Office by fax at

  11. Habadv-120.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    20 Subject: Fiscal Year 2002 and 2003 Budgets Adopted: June 8, 2001 Page 1 June 8, 2001 Keith Klein, Manager Department of Energy, Richland Operations P.O. 550 (A7-50) Richland, WA 99352 Harry Boston, Manager Department of Energy, Office of River Protection 2440 Stevens Richland, WA 99352 Re: Fiscal Year 2002 and 2003 Budgets Dear Messrs Klein and Boston, The U.S. Department of Energy (DOE) proposed fiscal year (FY) 2002 and preliminary FY 2003 budgets signal an intent to slow Hanford cleanup

  12. 2010sr26.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Thursday, September 2, 2010 SRS Federal Employees Give to Area Food Bank Aiken, SC -- Representatives of the U.S. Department of Energy's Savannah River Operations Office (DOE-SR) at the Savannah River Site delivered the sixth and final truckload of food and non perishables to the Golden Harvest Food Bank today. The 335 federal employees at SRS donated 66,292 pounds of goods in just over 30 days to feed the needy in Georgia and South Carolina. If one does the math, the

  13. Aug08.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    of Energy Aug. 31 Webinar to Focus on Project Regulatory Considerations Aug. 31 Webinar to Focus on Project Regulatory Considerations August 23, 2016 - 11:43am Addthis The U.S. Department of Energy Office of Indian Energy, in partnership with Western Area Power Administration, is hosting a free webinar on "Project Regulatory Considerations" Wednesday, Aug. 31, from 11 a.m. to 12:30 p.m. Mountain Daylight Time. Attendees will get an overview of the many permitting and project

  14. Microsoft Word - S05551_1stqtr report.doc

    Office of Legacy Management (LM)

    09 July 2009 LMS/RFS/S05551 This page intentionally left blank LMS/RFS/S05551 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2009 July 2009 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2009 July 2009 Doc. No. S05551 Page i Contents

  15. Microsoft Word - S06528_1st qtr 2010.doc

    Office of Legacy Management (LM)

    10 July 2010 LMS/RFS/S06528 This page intentionally left blank LMS/RFS/S06528 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2010 July 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2010 July 2010 Doc. No. S06528 Page i Contents

  16. Microsoft Word - S07033_2nd qtr 2010.doc

    Office of Legacy Management (LM)

    Second Quarter Calendar Year 2010 October 2010 LMS/RFS/S07033 This page intentionally left blank LMS/RFS/S07033 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities Second Quarter Calendar Year 2010 October 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-2nd Quarter CY 2010 October 2010 Doc. No. S07033 Page i Contents

  17. ATS Recertification Final.doc

    Office of Environmental Management (EM)

    Program Onsite Review January 7-17, 2008 U.S. Department of Energy Office of Health, Safety and Security Office of Health and Safety Office of Worker Safety and Health...

  18. Microsoft Word - CMPTemplate031307.doc | Department of Energy

    Office of Environmental Management (EM)

    CMPTemplate031307.doc Microsoft Word - CMPTemplate031307.doc PDF icon Microsoft Word - CMPTemplate031307.doc More Documents & Publications Chapter 42 - Contract Administration...

  19. Microsoft Word - ACQUISITION LETTER.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ACQUISITION LETTER.doc Microsoft Word - ACQUISITION LETTER.doc PDF icon Microsoft Word - ACQUISITION LETTER.doc More Documents & Publications ACQUISITION LETTER DEAR Part 933 OPAM ...

  20. Microsoft Word - SpecialTermsandConditions0506.doc | Department...

    Energy Savers

    Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc More Documents &...

  1. Microsoft Word - FY2005finaliparhandbook.doc | Department of...

    Energy Savers

    Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc More Documents & Publications...

  2. Microsoft Word - ARRAAttachment2.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAAttachment2.doc Microsoft Word - ARRAAttachment2.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment3.rtf Microsoft Word -...

  3. Microsoft Word - ARRAMOModelMod.doc | Department of Energy

    Energy Savers

    ARRAMOModelMod.doc Microsoft Word - ARRAMOModelMod.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS...

  4. Microsoft Word - ARRAModelWAS.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ARRAModelWAS.doc Microsoft Word - ARRAModelWAS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAMOModelMod...

  5. Microsoft Word - August06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    August06.doc Microsoft Word - August06.doc PDF icon Microsoft Word - August06.doc More Documents & Publications Microsoft Word - April

  6. Microsoft Word - FY10PropertyBSCContractor.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor.doc PDF icon Microsoft Word - FY10PropertyBSCContractor.doc More Documents & Publications Microsoft Word - ...

  7. Microsoft Word - GJPPGPracticesDraft.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    GJPPGPracticesDraft.doc Microsoft Word - GJPPGPracticesDraft.doc PDF icon Microsoft Word - GJPPGPracticesDraft.doc More Documents & Publications 1 DOE Purchase Card Policy Natural ...

  8. Microsoft Word - Cross Reference Matrix Introduction.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Cross Reference Matrix Introduction.doc Microsoft Word - Cross Reference Matrix Introduction.doc PDF icon Microsoft Word - Cross Reference Matrix Introduction.doc More Documents & ...

  9. Microsoft Word - April06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    April06.doc Microsoft Word - April06.doc PDF icon Microsoft Word - April06.doc More Documents & Publications Secretary Directs FPO to Prepare Strategic Plan Microsoft Word - August

  10. Engaging Financial Institution Partners Transcript.doc | Department...

    Office of Environmental Management (EM)

    Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Microsoft ...

  11. Microsoft Word - SWCN.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Permanent address: Lehrstuhl fr Physikalische Chemie II, Universitt Erlangen-Nrnberg, Egerlandstr. 3, D- 91058 Erlangen, Germany Science Highlight - January 2006 ...

  12. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page I-3 U n c o n t r o l l e d c o p y Long-Term Surveillance and Maintenance ...

  13. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Doc. No. S06401 June 2010 Page B-2 U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. ...

  14. Ammendment 2.doc | Department of Energy (indexed) [DOE]

    Ammendment 2.doc More Documents & Publications Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&0; RFQ DE-RQ01-04ME90001.doc&0; Attachment 3-Past Performance...

  15. Index2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Index2.doc Index2.doc Index2.doc (11.46 KB) More Documents & Publications Sylvania Corporation, Hicksville, NY and Bayside, NY - Addendum to July 8, 2004 O:\HOMEPAGE\FOIA\report99.PDF&#0; U.S. Department of Energy 2004 Annual Report

  16. SubcontractingGuidelines.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; (245.71 KB) More Documents & Publications Guidance of the Department of Energy Subcontracting Program Acquisition Guide Chapter 19 Update Chapter 19 - Small Business Programs

  17. Microsoft Word - AL2005-16.doc | Department of Energy

    Office of Environmental Management (EM)

    6.doc Microsoft Word - AL2005-16.doc PDF icon Microsoft Word - AL2005-16.doc More Documents & Publications Microsoft Word - AL2005-10.doc Audit Report: IG-0860 Microsoft Word -...

  18. Microsoft Word - AL2005-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5-02.doc Microsoft Word - AL2005-02.doc PDF icon Microsoft Word - AL2005-02.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc...

  19. Microsoft Word - AL2005-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - AL2005-11.doc PDF icon Microsoft Word - AL2005-11.doc More Documents & Publications Audit Report: OAS-L-13-08 Microsoft Word - AL2005-12.doc CHAPTER 7...

  20. Microsoft Word - AL2006-02.doc | Department of Energy

    Energy Savers

    2.doc Microsoft Word - AL2006-02.doc PDF icon Microsoft Word - AL2006-02.doc More Documents & Publications Microsoft Word - AL2006-03.doc Archived Financial Assistance Letters...

  1. Microsoft Word - AL2006-03.doc | Department of Energy

    Energy Savers

    3.doc Microsoft Word - AL2006-03.doc PDF icon Microsoft Word - AL2006-03.doc More Documents & Publications Microsoft Word - AL2006-02.doc Archived Financial Assistance Letters...

  2. Microsoft Word - al2005-04.doc | Department of Energy

    Energy Savers

    al2005-04.doc Microsoft Word - al2005-04.doc PDF icon Microsoft Word - al2005-04.doc More Documents & Publications AL2005-04ClassDeviation.pdf Microsoft Word - Matrixpart2.doc...

  3. Microsoft Word - AL2005-14.doc | Department of Energy

    Office of Environmental Management (EM)

    4.doc Microsoft Word - AL2005-14.doc PDF icon Microsoft Word - AL2005-14.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc...

  4. Microsoft Word - AL2005-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    7.doc Microsoft Word - AL2005-07.doc PDF icon Microsoft Word - AL2005-07.doc More Documents & Publications Microsoft Word - AL2006-07.doc OPAM Policy Acquisition Guides Initial ...

  5. Microsoft Word - AL2005-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - AL2005-01.doc PDF icon Microsoft Word - AL2005-01.doc More Documents & Publications Microsoft Word - AL2006-08.doc Acquisition Letter Archive listing ...

  6. Microsoft Word - AL2006-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - AL2006-01.doc PDF icon Microsoft Word - AL2006-01.doc More Documents & Publications Microsoft Word - al2005-06.doc Chapter 19 - Small Business Programs OPAM...

  7. Microsoft Word - Flash2007-43.doc | Department of Energy

    Office of Environmental Management (EM)

    43.doc Microsoft Word - Flash2007-43.doc Microsoft Word - Flash2007-43.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash...

  8. al99-06attachment.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    attachment.doc&0; al99-06attachment.doc&0; PDF icon al99-06attachment.doc&0; More Documents & Publications Microsoft Word - AL2000-05Attachment.doc Microsoft Word - NSRC...

  9. Microsoft Word - FWP- Fact Sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FWP- Fact Sheet.doc Microsoft Word - FWP- Fact Sheet.doc PDF icon Microsoft Word - FWP- Fact Sheet.doc More Documents & Publications Microsoft Word - FOA cover sheet.doc Microsoft ...

  10. Microsoft Word - AL2005-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2005-10.doc Microsoft Word - AL2005-10.doc Microsoft Word - AL2005-10.doc (133.11 KB) More Documents & Publications Microsoft Word - AL2005-16.doc Audit Report: IG-0860 Microsoft ...

  11. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    SAR.doc Microsoft Word - PeerReviewSAR.doc Microsoft Word - PeerReviewSAR.doc (13.47 KB) More Documents & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross ...

  12. Microsoft Word - al2007-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    al2007-11.doc Microsoft Word - al2007-11.doc PDF icon Microsoft Word - al2007-11.doc More Documents & Publications Acquisition Letter: AL2005-08 Microsoft Word - al2004-03.doc OPAM...

  13. Microsoft Word - Matrixpart1.doc | Department of Energy (indexed) [DOE]

    Matrixpart1.doc More Documents & Publications Part 1, Clauses Prescribed in FAR Part 52 Microsoft Word - Matrixpart2.doc...

  14. csep_transcript_aspen.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications highperformanceleasingstrategiesforstateandlocalgovernments.doc Using Social Media to Engage the Community in Energy Efficiency Projects.doc ...

  15. csep_transcript_minneapolis.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications newguideforcommunityenergystrategicplanning.doc cseptranscriptaspen.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, ...

  16. Office of the Executive Secretariat

    Energy Savers

    the Executive Secretariat, MA-70 Acting Director Carol A. Matthews Special Projects Security Policy and Analysis Group Programmatic Expertise High-level Review and Analysis Correspondence Management Group Correspondence Control & Assignment Correspondence Support FOIA Management Special Projects Receiving and Delivery Administration and Executive Commitments Group eDOCS Executive Commitments Information Management Budget Personnel Administration Office of History and Heritage Resources

  17. Microsoft Word - S0180700.doc

    Office of Legacy Management (LM)

    Sites June 2005 Office of Legacy Management DOE M/GJ896-2005 -L U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management S0180700 DOE-LM/GJ896-2005 Office of Legacy Management Verification Monitoring Report for the Slick Rock, Colorado, Processing Sites June 2005 Work

  18. Microsoft Word - S0195200.doc

    Office of Legacy Management (LM)

    5 Office of Legacy Management U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management DOE-LM/GJ958-2005 This page intentionally left blank DOE-LM/GJ958-2005 Office of Legacy Management Verification Monitoring Report for the Durango, Colorado, Processing Site October 2005

  19. Microsoft Word - S0255900.doc

    Office of Legacy Management (LM)

    September 2006 Office of Legacy Management DOE M/1301-2006 -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy This page intentionally left blank DOE-LM/1301-2006 Office of Legacy Management Verification Monitoring Report for the Durango, Colorado, Processing Site

  20. Microsoft Word - S0150800.doc

    Office of Legacy Management (LM)

    Office of Legacy Management DOE MGJ881-2005 -L U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. ...

  1. Microsoft Word - S03274.DOC

    Office of Legacy Management (LM)

    Office of Legacy Management - - Work Performed Under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management. Approved for public release; ...

  2. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Office of Legacy Management DOE M1465 2007 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for ...

  3. Microsoft Word - S01409.doc

    Office of Legacy Management (LM)

    GJ - - 724 2004 U.S. Department of Energy Interim Remedial Action Report Monticello Mill Tailings (USDOE) National Priorities List Site EPA CERCLIS Identification UT 3890090035 OU III - Surface Water and Ground Water Monitored Natural Attenuation Remedy September 2004 Office of Legacy Management Office of Legacy Management Office of Legacy Management Office of Legacy Management DOE-LM/GJ724-2004 Interim Remedial Action Report Monticello Mill Tailings (USDOE) National Priorities List Site EPA

  4. Mini-Doc: Behind the Scenes at the Collegiate Wind Competition |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Mini-Doc: Behind the Scenes at the Collegiate Wind Competition Mini-Doc: Behind the Scenes at the Collegiate Wind Competition July 5, 2016 - 11:15am Addthis Simon Edelman Simon Edelman Chief Creative Officer Paul Lester Paul Lester Digital Content Specialist, Office of Public Affairs In this short documentary, we follow three student teams who participated in the 2016 U.S. Department of Energy Collegiate Wind Competition in New Orleans. The

  5. Microsoft Word - BPAbstract.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Approved: 5-16-14 FEDERAL EMPLOYEE TRAINING NATIONAL NUCLEAR SECURITY ADMINISTRATION Office of Management and Budget NNSA SD 360.1 CONTROLLED DOCUMENT OFFICE OF PRIMARY INTEREST (OPI): AVAILABLE ONLINE AT: Office of Leadership and Career Management printed copies are uncontrolled THIS PAGE INTENTIONALLY LEFT BLANK NNSA SD 360.1 1 5-16-14 FEDERAL EMPLOYEE TRAINING 1. PURPOSE. To establish and implement a consistent process for Federal Employee Training. This SD provides

  6. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    F Radiological Survey Procedures U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page F-3 F.1 Radiological Survey Procedures This section describes the actions and method used by the Monticello Legacy Management (LM) Representative when conducting radiological surveys for the purpose of identifying radiologically contaminated material and determining the Radium-226

  7. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    G Uranium Scanning Procedure U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page G-3 Uranium Scanning Procedure for Property MP-00211 1. Select a Ludlum Model 12 ratemeter with a 44-9 pancake Geiger-Mueller beta-gamma detector or equivalent instrument capable of meeting detection limit criteria. 2. Check that the ratemeter and the detector have calibration

  8. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Appendix H Procedures for the Transportation of Radioactive Materials U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page H-3 H1.0 Purpose The purpose of this procedure is to ensure that radioactive material is transported (1) using best management practices, (2) in compliance with U.S. Department of Transportation (DOT) requirements, and (3) with minimal risk to

  9. Microsoft Word - BEPA.doc

    National Nuclear Security Administration (NNSA)

    ... or other agreement pursuant to U.S. Fish and Wildlife Service Office of Law ... into cooperative agreements with State fish and wildlife agencies or other appropriate ...

  10. FinalProgramReportfinal.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    ... In 1992 the Department of Energy's (DOE) office of Occupational Medicine and Medical Surveillance provided support to formalize what had been an informal dosimetry recall program ...

  11. Microsoft Word - U0186500.doc

    Office of Legacy Management (LM)

    New Mexico, UMTRA Site September 2003 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number ...

  12. Microsoft Word - U0179700.doc

    Office of Legacy Management (LM)

    Environmental Assessment of Ground Water Compliance at the Naturita, Colorado, ... DOE Grand Junction Office EA of Ground Water Compliance at the Naturita Site April 2003 ...

  13. Microsoft Word - U0163300.doc

    Office of Legacy Management (LM)

    EA-1458 Environmental Assessment of Ground Water Compliance at the Slick Rock, Colorado, ... DOE Grand Junction Office EA of Ground Water Compliance at the Slick Rock Sites ...

  14. Microsoft Word - Award.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    and Engineering, Inc. has been awarded a five-year contract to provide specialized environmental technical support services to the Carlsbad Field Office, located in...

  15. Microsoft Word - TPHP9420.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    with financial support from the Safety, Codes and Standards program element of the Hydrogen, Fuel Cells and Infrastructure program, Office of Energy Efficiency and Renewable...

  16. Microsoft Word - n0045000.doc

    Office of Legacy Management (LM)

    by U.S. Department of Energy Grand Junction Office ... 1.2.2 Old Drum Storage Site......100 Health Physics Drain System ......

  17. Microsoft Word - S05575_AP.doc

    Office of Legacy Management (LM)

    ... Department of Energy Annual Performance Report, Shiprock, New Mexico December 2009 Doc. ... groundwater from the interceptor drains and extraction wells is solar evaporation. ...

  18. Microsoft Word - Appendix-B.doc

    Office of Legacy Management (LM)

    1 Site Environmental Report May 2012 Doc. No. S08629 Page B-i Contents Abbreviations ................................................................................................................................. iii Measurement Abbreviations .......................................................................................................... iii References

  19. PIC DOC 01/08/11 ? SOS

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    PIC DOC 010811 - SOS Content Outline 1) Usable Quotes We shouldn't equate public involvement with meetings. Maynard Plahuta Meetings, of many kinds, are probably the most...

  20. Microsoft Word - S05527_VMR 2009.DOC

    Office of Legacy Management (LM)

    ... Wells - Golf Course and Residential, Near the Gunnison Site U.S. Department of Energy 2009 Verification Monitoring Report-Gunnison, Colorado, Processing Site August 2009 Doc. ...

  1. Microsoft Word - S06692_VMR.doc

    Office of Legacy Management (LM)

    ... DOE Monitoring Wells - Golf Course and Residential, Near the Gunnison Site ... Monitoring Report-Gunnison, Colorado, Processing Site U.S. Department of Energy Doc. No. ...

  2. Microsoft Word - S05914_MR.doc

    Office of Legacy Management (LM)

    ... Energy 2009 Groundwater Monitoring Report Project Shoal Area, CAU 447 March 2010 Doc. No. ... The contaminant boundary (Figure 2) is a probabilistic forecast of the maximum extent over ...

  3. Associate Research Physicist (Post Doc, Experimental Research...

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Post Doc, Experimental Research, NSTX-U, Radio Frequency Waves) Department: Research Staff: RM1 Requisition Number: 1500421 The Princeton Plasma Physics Laboratory (PPPL) seeks to...

  4. Microsoft Word - S07050_WM.doc

    Office of Legacy Management (LM)

    ... NI), Setaria viridis (green foxtail, UPL), Xanthium strumarium (cocklebur, FAC) Naturita-Monitoring Report for Wetland Area U.S. Department of Energy Doc. No. S07050 September ...

  5. The Office of Environmental Management Uranium Enrichment D&D...

    Energy Savers

    Uranium Enrichment D&D The Office of Environmental Management Uranium Enrichment D&D Microsoft Word - B996F741.doc (100.04 KB) More Documents & Publications Microsoft Word - PSRP ...

  6. Partnering Policy for the Office of Environmental Management | Department

    Office of Environmental Management (EM)

    of Energy Policy for the Office of Environmental Management Partnering Policy for the Office of Environmental Management Partnering Policy for the Office of Environmental Management (448.69 KB) More Documents & Publications DOE Project Management Risk Committee (PMRC) SOP Microsoft Word - ADR Revised Policy82508Reformatted.doc OMB and CEQ Joint Memorandum on Environmental Collaboration and Conflict Resolution (CEQ, 2012)

  7. Microsoft Word - n0021500.doc

    Office of Legacy Management (LM)

    PIN 16.2 Environmental Restoration Program Wastewater Neutralization Area/Building 200 Area Corrective Measures Implementation Plan Addendum January 2000 Environmental Restoration Program Wastewater Neutralization Area/Building 200 Area Corrective Measures Implementation Plan Addendum January 2000 Prepared for U.S. Department of Energy Albuquerque Operations Office Grand Junction Office Prepared by MACTEC Environmental Restoration Services, LLC Grand Junction, Colorado Project Number

  8. Microsoft Word - U0197300.doc

    Office of Legacy Management (LM)

    GJO-2004-591-TAC ESL-RPT-2004-03 ESL-RPT-2004-03 U0197300 Office of Legacy Management ... DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand ...

  9. Microsoft Word - AL2000-05.doc | Department of Energy

    Energy Savers

    .doc Microsoft Word - AL2000-05.doc PDF icon Microsoft Word - AL2000-05.doc More Documents & Publications al99-06.doc&0; Microsoft Word - AL2000-05Attachment.doc AL2004-01r2.pdf...

  10. transcript_pv_mapper.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    transcript_pv_mapper.doc transcript_pv_mapper.doc transcript_pv_mapper.doc transcript_pv_mapper.doc (74.5 KB) More Documents & Publications PVMapper: A Tool for Energy Siting transcript_jedi_model.doc 2009 National Electric Transmission Congestion Study - San Francisco Workshop

  11. Microsoft Word - AL2007-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    7-01.doc Microsoft Word - AL2007-01.doc Microsoft Word - AL2007-01.doc (151.65 KB) More Documents & Publications Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc Microsoft Word - Corp Impl Microsoft Word - AL2006-11

  12. Microsoft Word - FAL2004-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    4-03.doc Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-03.doc (538.96 KB) More Documents & Publications Microsoft Word - FAL2004-01.doc Financial Assistance Letter No. FAL 2006-04 Microsoft Word - FAL2006-04.doc

  13. Microsoft Word - S05773_2009 VerifMonRpt.doc

    Office of Legacy Management (LM)

    September 2009 LMS/DUP/S05773 This page intentionally left blank LMS/DUP/S05773 Office of Legacy Management Verification Monitoring Report for the Durango, Colorado, Processing Site September 2009 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report-Durango, Colorado, Processing Site September 2009 Doc. No. S05773 Page i Contents

  14. State Energy Program - Program Year 2014 - Formula Award - Administrative and Legal Requirement Doc (indexed) [DOE]

    Weatherization and Intergovernmental Programs Office (WIPO) STATE: Mult PROJECT TITLE : State Energy Program - Program Year 2014 - Formula Award - Administrative and Legal Requirement Doc (ALRD) Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number SEP-ALRD-2014 GFO-SEP-ALRD-2014 Based on my review of the information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 451.1A), I have made the following

  15. Microsoft Word - Appendix N_Historical.doc

    Office of Legacy Management (LM)

    N Example Historical Marker and Plaque U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page N-3 Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page N-4

  16. Microsoft Word - AL2000-01.doc | Department of Energy

    Office of Environmental Management (EM)

    AL2000-01.doc Microsoft Word - AL2000-01.doc PDF icon Microsoft Word - AL2000-01.doc More Documents & Publications ALFAL 99-01 Department of Energy No Microsoft Word -...

  17. Microsoft Word - AL2008-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2008-06.doc Microsoft Word - AL2008-06.doc PDF icon Microsoft Word - AL2008-06.doc More Documents & Publications Chapter 9 - Contracting Qualifications Microsoft Word - PART...

  18. Microsoft Word - 99-04.doc | Department of Energy (indexed) [DOE]

    Word - 99-04.doc More Documents & Publications Policy Flash 2014-18 Complex-Wide Strategic Sourcing Microsoft Word - AL2000-01.doc Microsoft Word - AL2005-11.doc...

  19. Microsoft Word - AL2006-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    0.doc Microsoft Word - AL2006-10.doc PDF icon AL2006-10 More Documents & Publications Microsoft Word - Matrixpart2.doc Microsoft Word - AcqGuide70pt52Matrixpart2Redo...

  20. Microsoft Word - AL2004-02.doc | Department of Energy (indexed) [DOE]

    Microsoft Word - AL2004-02.doc More Documents & Publications Microsoft Word - AL2005-02.doc Microsoft Word - al2005-04.doc Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all...

  1. Microsoft Word - al95-06.doc | Department of Energy

    Energy Savers

    5-06.doc Microsoft Word - al95-06.doc PDF icon Microsoft Word - al95-06.doc More Documents & Publications ppl970-1.pdf Audit Report: IG-0589 Inspection Report: INS-O-02-01...

  2. Microsoft Word - meritrev.doc | Department of Energy

    Energy Savers

    Microsoft Word - meritrev.doc Microsoft Word - meritrev.doc PDF icon Microsoft Word - meritrev.doc More Documents & Publications Policy Flash 2013-38 Revised Merit Review Guide For...

  3. Microsoft Word - al95-14.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    al95-14.doc Microsoft Word - al95-14.doc PDF icon Microsoft Word - al95-14.doc More Documents & Publications Cooperation with the New Independent States of the Former Soviet Union ...

  4. Microsoft Word - AL2006-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    7.doc Microsoft Word - AL2006-07.doc PDF icon Microsoft Word - AL2006-07.doc More Documents & Publications OPAM Policy Acquisition Guides Personal Property Management Certification ...

  5. Microsoft Word - FAC2005-27.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAC2005-27.doc Microsoft Word - FAC2005-27.doc PDF icon Microsoft Word - FAC2005-27.doc More Documents & Publications Policy Flash 2015-07 - FAC 2005-78 Policy Flash Search Listing ...

  6. Microsoft Word - al2005-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    - al2005-06.doc PDF icon Microsoft Word - al2005-06.doc More Documents & Publications Microsoft Word - AL2006-01.doc OPAM Policy Acquisition Guides Acquisition Letter: AL2005-08...

  7. Microsoft Word - al96-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    6-09.doc Microsoft Word - al96-09.doc PDF icon Microsoft Word - al96-09.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis Chapter...

  8. Microsoft Word - AL2005-08.doc | Department of Energy

    Office of Environmental Management (EM)

    8.doc Microsoft Word - AL2005-08.doc Microsoft Word - AL2005-08.doc More Documents & Publications OPAM Policy Acquisition Guides Attachment FY2011-28 OPAM Microsoft Word -...

  9. Microsoft Word - FAC2005-19.doc | Department of Energy

    Office of Environmental Management (EM)

    FAC2005-19.doc Microsoft Word - FAC2005-19.doc Microsoft Word - FAC2005-19.doc More Documents & Publications Acquisitlon Letter No. AL 2008-06 AL2008-06.pdf fac2001-27.pdf...

  10. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word -...

  11. Microsoft Word - FORM46002.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    2.doc Microsoft Word - FORM46002.doc Microsoft Word - FORM46002.doc More Documents & Publications DOE F 4600.2 ATTACHMENT FLASH 2011-46(6) Attachment FY2011-63 OPAM...

  12. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc More Documents & Publications Microsoft Word - AL 2010-07 Acquistion Letters Remaining...

  13. Operating Guidelines Appendix C D.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Operating Guidelines Appendix C D.DOC&0; Operating Guidelines Appendix C D.DOC&0; PDF icon Operating Guidelines Appendix C D.DOC&0; More Documents & Publications Operating ...

  14. Microsoft Word - FAL2006-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAL2006-03.doc Microsoft Word - FAL2006-03.doc PDF icon Microsoft Word - FAL2006-03.doc More Documents & Publications Financial Assistance Letter No. FAL 2006-03 Microsoft Word - ...

  15. Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc |...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Speech 082508 FINAL.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc More Documents & Publications Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc ...

  16. Microsoft Word - 2005 FOIA ANNUAL REPORT.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    2005 FOIA ANNUAL REPORT.doc Microsoft Word - 2005 FOIA ANNUAL REPORT.doc report2005.pdf PDF icon Microsoft Word - 2005 FOIA ANNUAL REPORT.doc More Documents & Publications U.S. ...

  17. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2008-05.doc Microsoft Word - AL2008-05.doc PDF icon Microsoft Word - AL2008-05.doc More Documents & Publications Acquisition Letters Remaining In Effect Acquisition Letters ...

  18. Microsoft Word - Matrixpart2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Matrixpart2.doc Microsoft Word - Matrixpart2.doc PDF icon Microsoft Word - Matrixpart2.doc More Documents & Publications AcqGuide70.52Matrixpart2Redo-OPAM Microsoft Word - ...

  19. Microsoft Word - al2004-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    al2004-03.doc Microsoft Word - al2004-03.doc PDF icon Microsoft Word - al2004-03.doc More Documents & Publications Acquisition Letter: AL2005-08 OPAM Policy Acquisition Guides ...

  20. Microsoft Word - FY09PropertyBSCContractor.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FY09PropertyBSCContractor.doc Microsoft Word - FY09PropertyBSCContractor.doc PDF icon Microsoft Word - FY09PropertyBSCContractor.doc More Documents & Publications FY09 Property ...

  1. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAL2004-05.doc Microsoft Word - FAL2004-05.doc PDF icon Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word - Section ...

  2. Microsoft Word - Brochure_Senior Officials.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    BrochureSenior Officials.doc Microsoft Word - BrochureSenior Officials.doc Microsoft Word - BrochureSenior Officials.doc (29.28 KB) More Documents & Publications Preservation of ...

  3. Microsoft Word - CSATCourseCatalog_02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    CSATCourseCatalog02.doc Microsoft Word - CSATCourseCatalog02.doc classroom-1008856960720.jpg Microsoft Word - CSATCourseCatalog02.doc (554.38 KB) More Documents & Publications ...

  4. Microsoft Word - May2009.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    May2009.doc Microsoft Word - May2009.doc Microsoft Word - May2009.doc (6.77 MB) More Documents & Publications Special Resource StudyEnvironmental Assessment for Manhattan Project ...

  5. Property:NEPA TieredDoc | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    TieredDoc Jump to: navigation, search Property Name NEPA TieredDoc Property Type Page This is a property of type Page. Pages using the property "NEPA TieredDoc" Showing 25 pages...

  6. Microsoft Word - ARRAAttachment12v1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment12v1.doc More Documents & Publications Microsoft Word - DRAFT CRB Interview Guidance.doc Microsoft Word - ARRAGuideAttachment10v1

  7. Microsoft Word - AL2006-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2006-11.doc Microsoft Word - AL2006-11.doc PDF icon Microsoft Word - AL2006-11.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis...

  8. AL2007-02.doc (indexed) [DOE]

    (FAR) or Department of Energy Acquisition Regulation (DEAR) policy. Contact Rose Johnson at or (202) 287-1552 in the Office of Contract and...

  9. Microsoft Word - Matrixpart1.doc

    Energy Savers

    or (g) Exempt under regulations of the Secretary of Labor (29 CFR 5.15). 52.222-6 Davis-Bacon Act Jul 2005 A A I 22.407(a)(1) The contracting officer shall insert the...

  10. Microsoft Word - uranium.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    A partner- ship was formed in June of 1996 between the DOE (Grand Junction Office), US EPA, Interior Department, Geological Survey (USGS), Bureau of Land Management (BLM), and the ...

  11. Microsoft Word - U0195900.doc

    Office of Legacy Management (LM)

    GJO-2004-589-TAC ESL-RPT-2004-02 ESL-RPT-2004-02 U0195900 Office of Legacy Management ... Number U0195900 Contents DOEOffice of Legacy Management Diffusion Multilayer Sampling ...

  12. n0053200-sitewide.doc

    Office of Legacy Management (LM)

    by U.S. Department of Energy Grand Junction Office ... 5.0 Treatment System and Recovery Well ... These four SWMUs, the Old Drum Storage Site (PIN06), the ...

  13. Microsoft Word - LLNLHRPfinal062606.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    HUMAN RELIABILITY PROGRAM AT LAWRENCE LIVERMORE NATIONAL LABORATORY U.S. Department of Energy Office of Inspector General Office of Inspections and Special Inquiries Inspection Report The Human Reliability Program at Lawrence Livermore National Laboratory DOE/IG-0732 June 2006 THE HUMAN RELIABILITY PROGRAM AT LAWRENCE LIVERMORE NATIONAL LABORATORY TABLE OF CONTENTS OVERVIEW Introduction and Objective 1 Observations and Conclusions 2 DETAILS OF FINDINGS Drug and Alcohol Test Random Selection

  14. Microsoft Word - U01866.doc

    Office of Legacy Management (LM)

    186600 GJO-2003-489-TAC GJO-GWDUR 2.0 UMTRA Ground Water Project Verification Monitoring Report for the Durango, Colorado, UMTRA Project Site September 2003 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract No. DE-AC13-02GJ79491 Document Number U0186600 Contents DOE/Grand Junction Office Verification Monitoring Report-Durango, Colorado September 2003 Page iii Contents 1.0

  15. Microsoft Word - August06.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    August 2006 Office of History and Heritage Resources Volume 2, Number 2 In This Issue * B-Reactor Study for Deputy Secretary * Museum and Visitor Center Conference * National Park Service Manhattan Project Resource Study * DOE Headquarters Museum/Visitor Center * Want to Receive Partners in Preservation? * 2007 DOE Cultural Resources Forum: Hanford, Washington * 2006 DOE Cultural Resources Forum: Oak Ridge, Tennessee * K-25 Racetrack? * FPO Funds Field Office Preservation * Pantex Donates Cold

  16. Microsoft Word - IG-0780.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Inspection Report Work Order Estimate and Cost Issues for Site Support Services at Los Alamos National Laboratory DOE/IG-0780 October 2007 U.S. Department of Energy Office of Inspector General Office of Inspections and Special Inquiries WORK ORDER ESTIMATE AND COST ISSUES FOR SITE SUPPORT SERVICES AT LOS ALAMOS NATIONAL LABORATORY TABLE OF CONTENTS OVERVIEW Introduction and Objectives 1 Observations and Conclusions 2 DETAILS OF FINDINGS Estimated Cost 4 Labor and Material Charges 5 Internal

  17. Microsoft Word - IG-0784.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Inspection Report The Department of Energy's Pandemic Influenza Planning DOE/IG-0784 December 2007 U.S. Department of Energy Office of Inspector General Office of Inspections and Special Inquiries THE DEPARTMENT OF ENERGY'S PANDEMIC INFLUENZA PLANNING TABLE OF CONTENTS OVERVIEW Introduction and Objective 1 Observations and Conclusions 2 Background 3 DETAILS OF FINDINGS Pandemic Plans 4 Coordination of Vaccines and Antivirals 6 Monitoring Team Positions 7 Attendance Process 7 Social Distancing

  18. 20NESHAP.fnl.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    1 National Emission Standards for Hazardous Air Pollutants Calendar Year 2001 June 2002 June 2002 U.S. Department of Energy National Nuclear Security Administration Nevada Operations Office Las Vegas, Nevada U.S. Department of Energy National Nuclear Security Administration Nevada Operations Office Las Vegas, Nevada DOE/NV/11718--719 DOE/NV/11718--719 DISCLAIMER Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise, does not

  19. Operating Guidelines Appendix A B.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Operating Guidelines Appendix A B.DOC&#0; Operating Guidelines Appendix A B.DOC&#0; Operating Guidelines Appendix A B.DOC&#0; (73.17 KB) More Documents & Publications Operating Guidelines Appendix C D.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; DOE HR Guidebook 12_15_05.DOC&#0;

  20. Microsoft Word - RIN 06110582_DocProd.doc

    Office of Legacy Management (LM)

    448 2007 - - U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE-AC01-02GJ79491 December 2006, Monument Valley, Arizona This page intentionally left blank U.S. Department of Energy DVP⎯December 2006, Monument Valley, Arizona March 2007 RIN 06110582 Page iii Contents Sampling Event Summary

  1. Microsoft Word - RIN 07081119 DocProd.doc

    Office of Legacy Management (LM)

    85 2008 - - U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE-AC01-02GJ79491 September 2007 Groundwater and Surface Water Sampling at the Shiprock, New Mexico, Disposal Site January 2008 This page intentionally left blank U.S. Department of Energy DVP-September 2007, Shiprock, New Mexico, Disposal Site

  2. Microsoft Word - 08041519_08051593_DocProd.doc

    Office of Legacy Management (LM)

    LMS/GUP/S04641 U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE AM01 07LM00060 - - May and June 2008 Groundwater and Surface Water Sampling at the Gunnison, Colorado, Processing, Site August 2008 This page intentionally left blank U.S. Department of Energy DVP-May and June 2008, Gunnison, Colorado,

  3. Microsoft Word - RIN07050889_ DocProd.doc

    Office of Legacy Management (LM)

    512 2007 - - U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE-AC01-02GJ79491 May 2007 Ground Water and Surface Water Sampling at the Durango, Colorado, Disposal and Processing Sites August 2007 This page intentionally left blank U.S. Department of Energy DVP-May 2007, Durango, Colorado, Disposal and

  4. Microsoft Word - CERFDOE Final Report - 071204.doc | Department...

    Office of Environmental Management (EM)

    Microsoft Word - CERFDOE Final Report - 071204.doc (394.42 KB) More Documents & Publications Integrated Project Team RM DOE EIR FM.doc Independent Oversight Activity Report, ...

  5. Microsoft Word - ADR-Provisions-FederalAcquisitionReg.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications ADR Provisions in Federal Acquisition Regulation (FAR) Microsoft Word - ACQUISITION LETTER.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc...

  6. Microsoft Word - AL2005-12.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon Microsoft Word - AL2005-12.doc More Documents & Publications Microsoft Word - AL2005-11.doc OPAM Policy Acquisition Guides Chapter 31 - Contract Cost Principles...

  7. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Energy Savers

    & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross Reference Matrix Introduction.doc Assessment of the Effects of Climate Change on Federal Hydropower...

  8. Design Potential of Metal Foil Substrates for Optimized DOC Performanc...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Design Potential of Metal Foil Substrates for Optimized DOC Performance Design Potential of Metal Foil Substrates for Optimized DOC Performance Poster presentation at the 2007 ...

  9. DOE EIR FM.doc | Department of Energy

    Office of Environmental Management (EM)

    EIR FM.doc PDF icon DOE EIR FM.doc More Documents & Publications Contractor Statement of Work (SOW) Template (for EIR) External Independent Review (EIR) Standard Operating...

  10. Microsoft Word - RIN 07040836 DocProd.doc

    Office of Legacy Management (LM)

    Data Validation Package - - U.S. Department of Energy Office of Legacy Management This page intentionally left blank U.S. Department of Energy DVPMay 2007, Gunnison, Colorado, Processing Site August 2007 RIN 07040836 Page iii Contents Sampling Event Summary ...............................................................................................................1 Gunnison, Colorado, Processing Site Sample Location Map ..........................................................3 Data

  11. Office of Enterprise Assessments Targeted Review of Radiological... (indexed) [DOE]

    and Repair Area EA DOE Office of Enterprise Assessments EPD Electronic Pocket Dosimeter ESDH Environment, Safety and Health Division ES&H Environment, Safety and Health FR...

  12. Microsoft Word - N0049800.doc

    Office of Legacy Management (LM)

    49800 GJO-2002-306-TAR MAC-PIN 14.5.2 Pinellas Environmental Restoration Project at the Young-Rainey STAR Center Building 100 Area Plume Control Technology Selection Report February 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-96GJ87335 Task Order Number MAC02-10 This page intentionally left blank Document Number N0049800 Contents DOE/Grand Junction Office Building 100 Area Plume Control Technology

  13. Microsoft Word - Summary.doc

    Office of Environmental Management (EM)

    Letter Report on "Allegations of Retaliation at a Department Site" S10IS013 September 29, 2010 Department of Energy Office of Inspector General This is a summary of Inspection Letter Report S10IS013 dated September 22, 2010, pertaining to a "Review of Allegations Involving Potential Retaliation" at a Department Site. The complete report is not available for public disclosure. Public release is controlled pursuant to the Freedom of Information Act. The Office of Inspector

  14. Daniel Hoag Named Y-12 Site Office Deputy Manager | National Nuclear

    National Nuclear Security Administration (NNSA)

    Security Administration | (NNSA) Y-12 Site Office Deputy Manager March 23, 2011 Daniel hoag named y-12 site office deputy manager. OAK RIDGE, Tenn. -- Daniel K. Hoag has been named Deputy Manager for the National Nuclear Security Administration's Y-12 Site Office (YSO). Microsoft Office document icon NR-03-23.doc

  15. Microsoft Word - S05949_IR.doc

    Office of Legacy Management (LM)

    ... erosion. 2.1.4 Pond 4 Pond 4 is a lined solar evaporation pond that collects water ... store U.S. Department of Energy 2009 Annual Inspection-Monticello, Utah December 2009 Doc. ...

  16. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    and Recovery Act Cleanups This page intentionally left blank U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. ...

  17. Form:NEPA Doc | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    NEPA Doc Jump to: navigation, search Input the name of a NEPA Document below. If the document already exists, you will be able to edit its information. AddEdit a NEPA Document...

  18. Microsoft Word - Appendix A_Background.doc

    Office of Legacy Management (LM)

    ... and Maintenance (LTSM) Program records at the DOE Grand ... Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. ... (DOE 2003c). The two communities closest to the Chemical ...

  19. Microsoft Word - Appendix A.doc

    Office of Legacy Management (LM)

    ... and Maintenance (LTSM) Program records at the DOE Grand ... Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. ... (DOE 2003c). The two communities closest to the Chemical ...

  20. Edwin Parks (Doc) | Department of Energy

    Office of Environmental Management (EM)

    Doc Parks has over 27 years of active-duty military service with the U.S. Air Force (USAF), serving a broad range of command and staff positions in nuclear operations policy, ...

  1. RetTrendReport1205.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    RetTrendReport1205.doc&#0; RetTrendReport1205.doc&#0; RetTrendReport1205.doc&#0; (2.58 MB) More Documents & Publications Pension Plans for Contractor Workers April 1-10 comments.doc&#0; POLICY GUIDANCE MEMORANDUM #39 Phased Retirement

  2. AcqGuide70pt5.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AcqGuide70pt5.doc&#0; AcqGuide70pt5.doc&#0; AcqGuide70pt5.doc&#0; (16.21 KB) More Documents & Publications Chapter 70.3102-05-6: Contractor Compensation - Variable Pay Policy Flash 2016-34 AcqGuide41pt1.doc&#0;

  3. Microsoft Word - Chapter 05 a.doc | Department of Energy

    Office of Environmental Management (EM)

    Microsoft Word - Chapter 05 a.doc Microsoft Word - Chapter 05 a.doc Microsoft Word - Chapter 05 a.doc (7.05 MB) More Documents & Publications Microsoft Word - Chapter 01.doc EIS-0426: Record of Decision EIS-0426: Final Environmental Impact Statement

  4. Microsoft Word - Chapter 01.doc | Department of Energy

    Office of Environmental Management (EM)

    Microsoft Word - Chapter 01.doc Microsoft Word - Chapter 01.doc Microsoft Word - Chapter 01.doc (10.76 MB) More Documents & Publications Microsoft Word - Chapter 05 a.doc EIS-0426: Record of Decision EIS-0426: Final Environmental Impact Statement

  5. DOC-DOE Joint China Mission Statement | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Joint China Mission Statement DOC-DOE Joint China Mission Statement DOC-DOE Joint China Mission Statement DOC-DOE Joint China Mission Statement (109.75 KB) More Documents & Publications DOC-DOE China Mission Announcement Press Release FACT SHEET: U.S.-China Clean Energy Cooperation Announcements US-China Clean Energy Cooperation

  6. expanding_chp_in_your_state.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc (130 KB) More Documents & Publications Combined Heat and Power: Expanding CHP in Your State Sustainable Energy Resources for Consumers (SERC) - Solar Hot Water Sustainable Energy Resources for Consumers (SERC) - Geothermal/Ground-Source Heat Pumps

  7. Microsoft Word - FAL2006-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAL2006-04.doc Microsoft Word - FAL2006-04.doc Microsoft Word - FAL2006-04.doc (74.69 KB) More Documents & Publications Financial Assistance Letter No. FAL 2006-04 Microsoft Word - AL2006-03.doc Microsoft Word - FAL2004-01

  8. Microsoft Word - Federal Register Response _Jan09_.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Federal Register Response _Jan09_.doc Microsoft Word - Federal Register Response _Jan09_.doc Microsoft Word - Federal Register Response _Jan09_.doc (13.88 KB) More Documents & Publications Microsoft Word - Document2 Microsoft Word - Intellectual Property Provisions _NRD-1003_.doc Microsoft Word - ARRAAttachment12v1

  9. Microsoft Word - Final Sample Participant Profile November 2008.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Final Sample Participant Profile November 2008.doc Microsoft Word - Final Sample Participant Profile November 2008.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - DRAFT CRB Interview Guidance

  10. Microsoft Word - PART 970.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PART 970.doc Microsoft Word - PART 970.doc Microsoft Word - PART 970.doc (1.03 MB) More Documents & Publications Searchable Electronic Department of Energy Acquisition Regulation Microsoft Word - Matrixpart2.doc AcqGuide70.52Matrixpart2Redo-OPAM

  11. Office of International Affairs | Department of Energy

    U.S. Department of Energy (DOE) - all webpages

    International Affairs Search Search form Search Office of International Affairs Office of International Affairs Services Initiatives Initiatives Home Climate Action Plan Clean Energy Ministerial DOC-DOE Joint Trade Mission to China Energy and Climate Partnership of the Americas International Commitments International Commitments Home Primer Glossary & Acronyms International Energy Agency Turkey Near-Zero Zone U.S.-Africa Energy Ministerial U.S.-Canada Clean Energy Dialogue (CED) U.S.-China

  12. Microsoft Word - U0127400.doc

    Office of Legacy Management (LM)

    12-TAR MAC-GWMON 1.8 Chemistry of Phase I Phytoremediation Soils: Work Plan for the Monument Valley, Arizona, UMTRA Project Site September 2001 This page intentionally left blank UMTRA Ground Water Project Chemistry of Phase I Phytoremediation Soils: Work Plan for the Monument Valley, Arizona, UMTRA Project Site September 2001 Prepared for U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Project Number UGW-511-0015-37-000 Document Number U0127400 Work Performed Under DOE

  13. Microsoft Word - s0070700.doc

    Office of Legacy Management (LM)

    Report Second Five-Year Review Report for Monticello Mill Tailings (U.S. Department of Energy) City of Monticello San Juan County, Utah June 2002 Work Performed Under DOE Contract No. DE-AC13-96GJ87335 for the U.S. Department of Energy Approved forpvbJic release; dislribution is unlimifed. DOE/Grand Junction Office Second Five-Year Report for MMTS June 2002 Page ii Five-Year Review Report Table of Contents List of Acronyms

  14. Microsoft Word - master.doc

    Gasoline and Diesel Fuel Update

    9 (Released January 8, 1999) Energy Information Administration DOE/EIA-0202(99/1Q) Distribution Category UC-950 Short-Term Energy Outlook January 1999 Energy Information Administration Office of Energy Markets and End Use U.S. Department of Energy Washington, DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the U.S. Department of Energy. The information contained herein should be attributed to the Energy

  15. SR-08-02.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Media Contacts: For Immediate Release Embargoed until August 1, 2008 DOE: Julie Petersen, (803) 952-7697 SRNS: Will Callicott, (803) 952-9583 DOE Authorizes New Contractor to Begin Management and Operations of the Savannah River Site Aiken, SC - Yesterday (July 31), the U.S. Department of Energy Savannah River Operations Office (DOE-SR) Manager, Jeffrey M. Allison, and the Savannah River Nuclear Solutions (SRNS) President and Chief Executive

  16. Microsoft Word - IG-0576.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Inspections Inspection Report Inspection of Nuclear Safety At The Ashtabula Environmental Management Project DOE/IG-0576 November 2002 U.S. DEPARTMENT OF ENERGY Washington, DC 20585 November 26, 2002 MEMORANDUM FOR THE SECRETARY FROM: Gregory H. Friedman /s/ Inspector General SUBJECT: INFORMATION: Report on "Inspection of Nuclear Safety at the Ashtabula Environmental Management Project" BACKGROUND The Office of Inspector General, U.S. Department of Energy (DOE), conducted an inspection

  17. Microsoft Word - IG-0660.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    and Special Inquiries Inspection Report Internal Controls Over the Accountability of Computers at Sandia National Laboratory, New Mexico DOE/IG-0660 August 2004 This inspection complements similar work performed by the Office of Inspector General at several other DOE sites. MANAGEMENT REACTION Management concurred with our recommendations and has taken or initiated corrective actions. Management's comments are provided in their entirety in Appendix B of the report. We found management's comments

  18. Microsoft Word - Paper 1.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    April 19-20, 2011 Editors: Joseph H. Eto Lawrence Berkeley National Laboratory Robert J. Thomas Cornell University Proceedings Computational Needs for the Next Generation Electric Grid LBNL-5105E Computational Needs for the Next Generation Electric Grid Proceedings April 19-20, 2011 Editors: Joseph H. Eto, Lawrence Berkeley National Laboratory Robert J. Thomas, Cornell University The work described in this report was funded by the Office of Electricity Delivery and Energy Reliability of the U.S.

  19. OfficeGovernmentEthicsGuidanceEthicsandProcurementIntegrity.pdf |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy OfficeGovernmentEthicsGuidanceEthicsandProcurementIntegrity.pdf OfficeGovernmentEthicsGuidanceEthicsandProcurementIntegrity.pdf (2.33 MB) More Documents & Publications POLICY FLASH 2016-04 Procurement Integrity AcqGuide3pt1.doc&#0;

  20. Office of Information Resources (MA-90) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Resources (MA-90) Office of Information Resources (MA-90) Freedom of Information 2007 Annual Report Office of Information Resources (MA-90) (220.69 KB) More Documents & Publications ANNUAL FOIA REPORT FOR 2009 U.S. Department of Energy 2008 Annual FOIA Report Microsoft Word - 2005 FOIA ANNUAL REPORT.doc

  1. Microsoft Word - S0171500.doc

    Office of Legacy Management (LM)

    DOE-LM/GJ850-2005 ESL-RPT-2005-03 Alternatives for Mending a Permeable Reactive Barrier at a Former Uranium Milling Site: Monticello, Utah April 2005 Prepared for U. S. Environmental Protection Agency Region 8, Denver, Colorado Under Interagency Agreement DW89953767018 By U. S. Department of Energy Grand Junction, Colorado Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado

  2. Microsoft Word - S02808.doc

    Office of Legacy Management (LM)

    Sciences Laboratory Environmental Sciences Laboratory Prepared for U.S. Department of Energy Grand Junction, Colorado Third (March 2006) Coring and Analysis of Zero-Valent Iron Permeable Reactive Barrier, Monticello, Utah November 2006 DOE-LM/1379-2006 ESL-RPT-2006-03 Work Performed nder DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. by the S.M. Stoller Corporation u DE AC01 02GJ79491 - - Approved for public release; distribution is unlimited. This page

  3. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    K MMTS and MVP Site Inspection Checklists U n c o n t r o l l e d c o p y MMTS Annual Inspection Checklist U n c o n t r o l l e d c o p y MMTS Annual Inspection Checklist Page 1 of 38 I. MMTS Site Information Site name: Monticello Mill Tailings (USDOE) Site; Operable Units I, II, and III Date of inspection: Site Location: Monticello, Utah: EPA Region 8 EPA ID: UT 3890090035 Lead Agency: U.S. Department of Energy Office of Legacy Management (DOE-LM) PCOR Date: September 2004 Operational and

  4. Microsoft Word - TITLE.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    CELLS FOR TRANSPORTATION 2 0 0 1 A N N U A L P R O G R E S S R E P O R T U.S. Department of Energy Energy Efficiency and Renewable Energy Office of Transportation Technologies A C K N O W L E D G E M E N T We would like to express our sincere appreciation to Argonne National Laboratory for its artistic and technical contributions in preparing and publishing this report. In addition, we would like to thank all our program participants for their contributions to the programs and all the authors

  5. Ombuds Office

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Ombuds Office Ombuds Office The mission of the Ombuds Office is to enhance communication and mitigate conflict at the Laboratory. Contact (505) 665-2837 Email Anonymous Helpline (505) 667-9370 Ombuds program is an independent, neutral, impartial, confidential, and informal process The Ombuds Office provides a confidential and impartial alternative for assistance with informal complaint resolution, problem solving, and communication. The Ombuds Office operates in accordance with the standards of

  6. Microsoft Word - S06087_3rd qtr 2009 rpt - final.doc

    Office of Legacy Management (LM)

    Third Quarter Calendar Year 2009 January 2010 LMS/RFS/S06087 This page intentionally left blank LMS/RFS/S06087 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities Third Quarter Calendar Year 2009 January 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-3rd Quarter CY 2009 January 2010 Doc. No. S06087 Page i Contents

  7. Microsoft Word - S0226100June 2006.doc

    Office of Legacy Management (LM)

    5 July 2006 Office of Legacy Management DOE MGJ1213-2006 -L DOE MGJ1213-2006 -L U.S. Department of Energy Office of Legacy Management U.S. Department of Energy Office of Legacy ...

  8. AcqGuide42pt3.doc | Department of Energy

    Office of Environmental Management (EM)

    1pt1.doc&#0; AcqGuide41pt1.doc&#0; AcqGuide41pt1.doc&#0; (13.23 KB) More Documents & Publications Chapter 41 - Acquisition of Utility Services Policy Flash 2016-31 Chapter 41: Utilities

    2pt3.doc&#0; AcqGuide42pt3.doc&#0; AcqGuide42pt3.doc&#0; (56.38 KB) More Documents & Publications Chapter 42 - Contract Administration Acquisition Guide Chapter 42.1202 - Novation Agreements Chapter 9.2: Performance Guarantees

  9. Microsoft Word - 01 Hirshfeld.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Office of Chief Financial Officer Volume 1 DOE/CF-0047 Volume 1 National Nuclear Security Administration Office of the Administrator Weapons Activities Defense Nuclear Nonproliferation Naval Reactors Department of Energy FY 2011 Congressional Budget Request February 2010 Office of Chief Financial Officer Volume 1 DOE/CF-0047 Volume 1 National Nuclear Security Administration Office of the Administrator Weapons Activities Defense Nuclear Nonproliferation Naval Reactors Printed with soy ink on

  10. Microsoft Word - Clay Memo PMC Coburn Obama 11_9_06.doc | Department...

    Office of Environmental Management (EM)

    Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc More Documents & Publications...

  11. Microsoft Word - DP_cover_and_front matter_FINAL1.DOC | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FINAL1.DOC Microsoft Word - DPcoverandfront matterFINAL1.DOC PDF icon Microsoft Word - DPcoverandfront matterFINAL1.DOC More Documents & Publications Microsoft Word - ...

  12. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc PDF icon Microsoft Word - TSLCC 200750508 rev 1.doc More Documents & Publications FY 2007 Total System ...

  13. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of...

    Office of Environmental Management (EM)

    TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc More Documents & Publications FY 2007 Total System Life...

  14. Microsoft Word - EA March 05.doc

    Office of Legacy Management (LM)

    by U.S. Department of Energy Office of Legacy Management Grand Junction, Colorado Work ... Page Intentionally Blank DOE Office of Legacy Management EA of Ground Water Compliance ...

  15. AcqGuide4pt2.doc (indexed) [DOE]

    Background The Office of Public Affairs is responsible for collecting and disseminating information about the Department's programs, missions, and activities. The Office of Public ...

  16. The Office of Environmental Management Non-Defense Environmental Cleanup |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Non-Defense Environmental Cleanup The Office of Environmental Management Non-Defense Environmental Cleanup Microsoft Word - 8E2A4440.doc (100.45 KB) More Documents & Publications Microsoft Word - PSRP Updates 6-25-10_v2 The Office of Environmental Management (EM) Defense Environmental Cleanup The Office of Environmental Management Uranium Enrichment D&D

  17. Office | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Office Jump to: navigation, search Building Type Office Definition Buildings used for general office space, professional office, or administrative offices. Medical offices are...

  18. CMTA Office

    High Performance Buildings Database

    Prospect, KY When CMTA outgrew their old office space, the consultant engineering company decided to construct a new building. Not only does the structure provide offices for the firm, it also showcases progressive design elements and allows the firm to test new technologies and demonstrate their effectiveness to clients. The new CMTA office building is located in a live-work development on the outskirts of Louisville, KY. The location was selected to place the office close to where the employees live.

  19. AcqGuide39pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon AcqGuide39pt1.doc&0; More Documents & Publications Chapter 39 - Acquisition of Information Technology AcqGuide38pt1.doc&0; Microsoft Word - AcqGuide16pt1...

  20. AcqGuide70pt31.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon AcqGuide70pt31.doc&0; More Documents & Publications Microsoft Word - AcqGuide70pt31A.doc Policy Flash 2014-26 Acquisition Guide Chapter 70.31A - Costs...

  1. AcqGuide47pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AcqGuide47pt1.doc&0; PDF icon AcqGuide47pt1.doc&0; More Documents & Publications Chapter 47 - Transportation TEC Working Group Topic Groups Manual Review Key Documents ...

  2. Microsoft Word - DOENV--FY2007.doc

    National Nuclear Security Administration (NNSA)

    Office Las Vegas, Nevada This page intentionally left blank TABLE OF CONTENTS 1.0 INTRODUCTION......

  3. csep_transcript_transportation.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications cseptranscriptminneapolis.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, 2011 (Text Version) Transcript: Biomass ...

  4. comm_pace_updates_field_resources_prog_design_implementation.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy comm_pace_updates_field_resources_prog_design_implementation.doc comm_pace_updates_field_resources_prog_design_implementation.doc comm_pace_updates_field_resources_prog_design_implementation.doc comm_pace_updates_field_resources_prog_design_implementation.doc (126.5 KB) More Documents & Publications Commercial PACE: Updates from the Field & New Resources for Design and Implementation Combined Heat and Power: Expanding CHP in Your State expanding_chp_in_your_state

  5. 20130226_sunshot_transcript_lbnl.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc (73.5 KB) More Documents & Publications Why Are Resiential PV Prices in Germany So Much Lower Than in the United States? text_alternative_stat_webinar_2012_7_25.docx An Analysis of Residential PV System Price Differences between the United States and Germany

  6. DOCS System Configuration Management Plan | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    DOCS System Configuration Management Plan DOCS System Configuration Management Plan The DOCS Systems Configuration Management Plan (SCMP), from an actual DOE systems engineering project, can be used as a template to facilitate the creation of the CMP for your particular project. DOCS System Configuration Management Plan (654.98 KB) More Documents & Publications OPC Security Whitepaper #3Hardening Guidelines for OPC Hosts NMMSS Software Quality Assurance Plan ABB SCADA/EMS System INEEL

  7. CompleteProject List.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    CompleteProject List.doc&#0; CompleteProject List.doc&#0; CompleteProject List.doc&#0; (9.47 KB) More Documents & Publications Tribal Energy Program February 2012 Award Project Descriptions CX-008525: Categorical Exclusion Determination 2010 Program Review Meeting

  8. AcqGuide41pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1pt1.doc&#0; AcqGuide41pt1.doc&#0; AcqGuide41pt1.doc&#0; (13.23 KB) More Documents & Publications Chapter 41 - Acquisition of Utility Services Policy Flash 2016-31 Chapter 41: Utilities

  9. AcqGuide9pt2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AcqGuide9pt2.doc&#0; AcqGuide9pt2.doc&#0; AcqGuide9pt2.doc&#0; (16.88 KB) More Documents & Publications Chapter 9.2: Performance Guarantees Policy Flash 2016-32 Chapter 9 - Contracting Qualifications

  10. Microsoft Word - AL2003-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    3-04.doc Microsoft Word - AL2003-04.doc Microsoft Word - AL2003-04.doc (254.1 KB) More Documents & Publications AL2004-01r2.pdf City of Tulare Renewable Biogas Fuel Cell Project

  11. Microsoft Word - LibraryofPriorRulemakings.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    LibraryofPriorRulemakings.doc Microsoft Word - LibraryofPriorRulemakings.doc Microsoft Word - LibraryofPriorRulemakings.doc (28.89 KB) More Documents & Publications Solar Background Document 1 Natural Gas Imports and Exports First Quarter Report 2014 Natural Gas Imports and Exports Second Quarter Report 2014

  12. Microsoft Word - Political Activity and the Federal Employee.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Political Activity and the Federal Employee.doc Microsoft Word - Political Activity and the Federal Employee.doc Microsoft Word - Political Activity and the Federal Employee.doc (165.92 KB) More Documents & Publications Political Activity at DOE Facilities by DOE Contractors Audit Report: IG-0473 PROCESSING INVITATIONS FOR A PRESIDENTIAL APPOINTEE

  13. Microsoft Word - competitionincontractingguidev2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc (215.28 KB) More Documents & Publications AcqGuide 5.2-OPAM Acquisition Guide, Chapter 6.1, Competition Requirements Microsoft Word - AG Chapter 6 1 Nov 2010

  14. Microsoft Word - fal2004-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    fal2004-04.doc Microsoft Word - fal2004-04.doc Microsoft Word - fal2004-04.doc (132.28 KB) More Documents & Publications U.S. Department of Energy - Guide to Financial Assistance - Audit Requirements for For-Profit Organizations Financial Assistance Guide (2013) Revised Guide for Financial Assistance

  15. AcqGuide3pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    pt1.doc&0; AcqGuide3pt1.doc&0; PDF icon AcqGuide3pt1.doc&0; More Documents & Publications POLICY FLASH 2016-04 Procurement Integrity PI Brief 6 15 07 final2&0;

  16. Microsoft Word - FY08AnnualReport.doc | Department of Energy

    Office of Environmental Management (EM)

    FY08AnnualReport.doc Microsoft Word - FY08AnnualReport.doc PDF icon Microsoft Word - FY08AnnualReport.doc More Documents & Publications Microsoft Word - FY09AnnualReportv1.doc...

  17. Microsoft Word - AL2005-05Revised.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2005-05Revised.doc Microsoft Word - AL2005-05Revised.doc PDF icon Microsoft Word - AL2005-05Revised.doc More Documents & Publications AL2007-03.doc&0; 2011-31 Attachment...

  18. Microsoft Word - ALonEO13423Last.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ALonEO13423Last.doc Microsoft Word - ALonEO13423Last.doc PDF icon Microsoft Word - ALonEO13423Last.doc More Documents & Publications Microsoft Word - AL2008-05.doc Tri-Party ...

  19. Microsoft Word - ITSI award doc 06-D0008 conformed to P00001...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ITSI award doc 06-D0008 conformed to P00001.doc Microsoft Word - ITSI award doc 06-D0008 conformed to P00001.doc More Documents & Publications Policy Flash 2015-02 Acquisition ...

  20. Microsoft Word - Flash2008-09Attachment.doc | Department of Energy (indexed) [DOE]

    9Attachment.doc More Documents & Publications Flash2007-02Attachment.doc&0; Microsoft Word - AL2000-05Attachment.doc Flash2007-03Attachment.doc&0;...

  1. Microsoft Word - Policy Flash 2008-04.doc | Department of Energy

    Office of Environmental Management (EM)

    4.doc Microsoft Word - Policy Flash 2008-04.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  2. Microsoft Word - Policy Flash 2008-06.doc | Department of Energy

    Office of Environmental Management (EM)

    6.doc Microsoft Word - Policy Flash 2008-06.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  3. Microsoft Word - AL2000-05Attachment.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Attachment.doc Microsoft Word - AL2000-05Attachment.doc PDF icon Microsoft Word - AL2000-05Attachment.doc More Documents & Publications al99-06attachment.doc&0; EXHIBIT A: CRADA,...

  4. Microsoft Word - DRAFT CRB Interview Guidance.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    DRAFT CRB Interview Guidance.doc Microsoft Word - DRAFT CRB Interview Guidance.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc Microsoft Word - Document2

  5. Microsoft Word - Policy Flash 2008-07.doc | Department of Energy

    Office of Environmental Management (EM)

    07.doc Microsoft Word - Policy Flash 2008-07.doc More Documents & Publications Microsoft Word - Policy Flash 2008-10...

  6. Microsoft Word - Policy Flash 2008-10.doc | Department of Energy

    Office of Environmental Management (EM)

    10.doc Microsoft Word - Policy Flash 2008-10.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07...

  7. Offices | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Offices Offices All Offices Program Offices Advanced Research Projects Agency - Energy Loan Programs Office Office of Electricity Delivery & Energy Reliability Office of Energy Efficiency & Renewable Energy Office of Environmental Management Office of Fossil Energy Office of Indian Energy Policy and Programs Office of Legacy Management Office of Nuclear Energy Office of Science Staff Offices Office of the Under Secretary for Science and Energy Office of Project Management Oversight &

  8. Microsoft Word - S0171800August.doc

    Office of Legacy Management (LM)

    Office of Legacy Management Grand Junction, Colorado, Site Site Environmental Report for Calendar Year 2004 August 2005 Office of Legacy Management DOE M/GJ885-2005 -L U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management DOE-LM/GJ885-2005 U.S. Department of Energy

  9. Office Buildings - Types of Office Buildings

    U.S. Energy Information Administration (EIA) (indexed site)

    administration building Insurance company headquarters building Local insurance agency Social services office Attorney's office Real estate sales office Government office State...

  10. Fellows' Officers

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Officers Fellows' Officers Current officers and listing of coordinators from 1982 to present. Current and past officers, coordinators 2015-2016 Dipen Sinha, Coordinator Chuck Farrar, Deputy Coordinator Brenda Dingus, Secretary Past coordinators 2014-2015: Brad Meyer 2013-2014: Toni Taylor 2012-2013: Pat Colestock 2011-2012: Quanxi Jia 2010-2011: Joyce Guzik 2009-2010: Darryl L. Smith 2008-2009: S. Peter Gary 2007-2008: R. S. Hixson 2006-2007: W. C. Priedhorsky 2005-2006: G. T. Gray III

  11. Security Officer [DOE]

    This position is located in the Security and Continuity of Operations (NN) organization of the Chief Administrative Office (N), Bonneville Power Administration. The Security and Continuity of...

  12. Microsoft Word - AL2008-06.doc (indexed) [DOE]

    or (202) 287-1332 in the Office of Procurement and Assistance Policy or for NNSA, Stephen Law at or (202) 586-4321 in the Office of Acquisition and...

  13. Microsoft Word - AL2006-09.doc (indexed) [DOE]

    Policy, MA-61, (202) 287-1339 or or for NNSA, Mr. Stephen Law, Office of Acquisition and Supply Management Office, NA-63, (202) 586-4321 or...

  14. Microsoft Word - SF30 A053.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TITLE OF SIGNER (Type or print) 16A NAME AND TITLE OF CONTRACTING OFFICER (Type or print) Michael K. Barrett, Contracting Officer 15B. CONTRACTOROFFEROR 15C. DATE SIGNED 16B....

  15. Microsoft Word - S03347_final.doc

    Office of Legacy Management (LM)

    July 2007 Office of Legacy Management DOE M1495 2007 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 ...

  16. Microsoft Word - dec-may07.doc

    Office of Legacy Management (LM)

    December 2006 through May 2007 June 2007 Office of Legacy Management DOE M1493 2007 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy ...

  17. Microsoft Word - S04200VMR.doc

    Office of Legacy Management (LM)

    Update for 2007 Office of Legacy Management DOE M1603 2008 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. ...

  18. Microsoft Word - S0224300 September 2006.doc

    Office of Legacy Management (LM)

    Third Five-Year Review September 2006 Office of Legacy Management DOE MGJ1158-2006 -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy ...

  19. Microsoft Word - cover-pi.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    FY04-FY05 WORK PROPOSAL March 2003 Submitted to: Office of Fusion Energy Sciences Office of Energy Research U.S. Department of Energy Germantown, MD 20874 Alcator Project Principal...

  20. Microsoft Word - S03736_ FMP010609.doc

    Office of Legacy Management (LM)

    Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 LMS/CNT/S03736 This page intentionally left blank LMS/CNT/S03736 Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 This page intentionally left blank U.S. Department of Energy Fluid Management Plan For CAU 443: CNTA, Subsurface, Nevada January 2009 Doc. No. S0373600 Page i Contents Acronyms and Abbreviations

  1. Microsoft Word - S04019_GSB.doc

    Office of Legacy Management (LM)

    Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 LMS/GSB/S04019 This page intentionally left blank LMS/GSB/S04019 Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 This page intentionally left blank U.S. Department of Energy Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009, Rev. 3 Doc. No. S04019 Page i Contents Abbreviations

  2. Microsoft Word - S06178_MP.doc

    Office of Legacy Management (LM)

    Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited LMS/RUL/S06178 This page intentionally left blank LMS/RUL/S06178 Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited This page intentionally left blank U.S. Department of Energy Rulison Monitoring Plan July 2010 Doc. No. S06178 Page i Contents 1.0

  3. Microsoft Word - S06596_GW.doc

    Office of Legacy Management (LM)

    Annual Groundwater Report May 2009 through April 2010 September 2010 LMS/MNT/S06596 This page intentionally left blank LMS/MNT/S06596 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report May 2009 through April 2010 September 2010 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report May 2009-April 2010 September 2010 Doc. No. S06596 Page i Contents

  4. Microsoft Word - S05428_VMR.doc

    Office of Legacy Management (LM)

    Slick Rock, Colorado, Processing Sites 2008 and 2009 Update July 2010 LMS/SRE-SRW/S05428 This page intentionally left blank LMS/SRE-SRW/S05428 Verification Monitoring Report for the Slick Rock, Colorado, Processing Sites 2008 and 2009 Update July 2010 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report-Slick Rock, Colorado, 2008 and 2009 Update July 2010 Doc. No. S05428 Page i Contents

  5. Microsoft Word - Exit Brochure.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Records Management Exit Procedures For Departing Department of Energy Federal and Contractor Employees Office of IT Planning, Architecture and E-Government March 2009 Office of the Chief Information Officer 2 Preservation of Federal Records The Federal Records Act requires the Department of Energy (DOE) Records Officer to remind departing Federal and contractor employees that Federal records may not be removed from Government custody nor may they be destroyed without a records disposition

  6. Fermilab | Directorate | Offices

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    (IPPM) Office of Project Support Services (PSS) Office of Partnerships and Technology Transfer (OPTT) Office of Communication Program Planning Office Legal Office Last modified:...

  7. Office of Chief Financial Officer (indexed) [DOE]

    Vehicles Manufacturing Loan Program Title 17 Innovative Tech. Loan Guarantee Program Tribal Indian Energy Loan Guarantee Program Office of Indian Energy Policy and Programs Energy ...

  8. Microsoft Word - S0106300-December2004.DOC

    Office of Legacy Management (LM)

    704 U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for Site A/Plot M, Illinois, Decommissioned Reactor December 2004 Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management S0106300 DOE-LM/GJ704-2004 U.S. Department of Energy Office of Legacy Management Long-Term

  9. Microsoft Word - S0221000_072606.doc

    Office of Legacy Management (LM)

    Soil and Ground Water Phytoremediation Pilot Studies at Monument Valley, Arizona 2005 Status Report July 2006 Office of Legacy Management DOE M/1254-2006 -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy This page intentionally left blank DOE LM/1254-2006 Soil

  10. Microsoft Word - S02997_mmts 2007.doc

    Office of Legacy Management (LM)

    Third Five-Year Review Report for Monticello Mill Tailings (USDOE) Site City of Monticello San Juan County, Utah June 2007 Office of Legacy Management DOE M/1472 2007 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy U.S. Department of Energy MMTS Third

  11. Microsoft Word - S03729_Dec2007.doc

    Office of Legacy Management (LM)

    of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2007 Office of Legacy Management DOE M/1554 2007 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy DOE-LM/1554-2007 2007 Annual Inspection of the

  12. Microsoft Word - s00400-sept2004.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management Long-Term Surveillance Plan for the U.S. Department of Energy L-Bar, New Mexico, (UMTRCA Title II) Disposal Site, Seboyeta, New Mexico September 2004 DOE LM/GJ709 2004 - - S00400 DOE-LM/GJ709-2004 Office of Legacy

  13. Microsoft Word - s00799-december-2004.doc

    Office of Legacy Management (LM)

    GJ766-2004 -L U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management Long-Term Surveillance Plan for the U.S. Department of Energy Shirley Basin South (UMTRCA Title II) Disposal Site, Carbon County, Wyoming December 2004 S00799 DOE-LM/GJ766-2004 Office of Legacy

  14. Microsoft Word - S0123800_050107.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Legacy Management CERCLA Sites Quality Assurance Project Plan Office of Legacy Management DOE M/GJ1232-2006 -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy U n c o n t r o l l e d C o p y CERCLA Sites QAPP Summary of Changes May 3, 2007 Page i Summary of

  15. Office of Chief Financial Officer

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    6 DOE/CF-0101 Volume 6 Power Marketing Administrations Southeastern Power Administration Southwestern Power Administration Western Area Power Administration Bonneville Power Administration Department of Energy FY 2015 Congressional Budget Request March 2014 Office of Chief Financial Officer Volume 6 DOE/CF-0101 Volume 6 Power Marketing Administrations Southeastern Power Administration Southwestern Power Administration Western Area Power Administration Bonneville Power Administration Printed with

  16. Office of Chief Financial Officer

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    6 DOE/CF-0112 Volume 6 Power Marketing Administrations Southeastern Power Administration Southwestern Power Administration Western Area Power Administration Bonneville Power Administration Department of Energy FY 2016 Congressional Budget Request February 2015 Office of Chief Financial Officer Volume 6 DOE/CF-0112 Volume 6 Power Marketing Administrations Southeastern Power Administration Southwestern Power Administration Western Area Power Administration Bonneville Power Administration Printed

  17. WNR Offices

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Offices, Experimental Areas, Buildings, and Contacts Description Contact Name Bldg/Room Phone Pager/Alt. Phone Group Office Julie Quintana 622/220 667-5377 665-5390 User Office Tanya Herrera 622/212 667-6797 MPF-31 Building Manager Kenny Madrid 31/125 665-0944 664-8327 MPF-17 Building Manager Gene Cartelli 6/133 667-2127 664-4234 MPF-7 Building Manager Bruce Wheeler 622/248 667-6715 664-8336 Property Julie Martinez 24/110 665-2058 664-6775 Waste Manager Lance Kloefkorn 6/236 665-3288 664-5972

  18. Division, NN-43, Office of Arms Control

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    8 10 CFR Ch. III (1-1-10 Edition) § 810.14 Division, NN-43, Office of Arms Control and Nonproliferation. [51 FR 44574, Dec. 10, 1986, as amended at 58 FR 39639, July 16, 1993; 65 FR 16128, Mar. 27, 2000] § 810.14 Additional information. The Department of Energy may at any time require a person engaging in any generally or specifically author- ized activity to submit additional in- formation. § 810.15 Violations. (a) The Atomic Energy Act provides that: (1) Permanent or temporary injunc- tions

  19. Microsoft Word - 6-19-06 TEC NOTES.doc

    Office of Environmental Management (EM)

    48D7DF19-707E-28B27A.doc Microsoft Word - 48D7DF19-707E-28B27A.doc Microsoft Word - 48D7DF19-707E-28B27A.doc (126.75 KB) More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - GSP_Charter.doc Department of Energy

    564M_Biomass_Project Descriptions FINAL 120409 Microsoft Word - 564M_Biomass_Project Descriptions FINAL 120409 Microsoft Word - 564M_Biomass_Project Descriptions FINAL 120409 (100.66

  20. Director's Office

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Director's Office Director's Office Print Roger Falcone Director, Advanced Light Source, Ernest Orlando Lawrence Berkeley National Laboratory and Professor of Physics, University of California, Berkeley. Roger Falcone Web page at the University of California, Berkeley Advanced Light Source Lawrence Berkeley National Laboratory 1 Cyclotron Road, MS 80R0114 Berkeley, CA 94720 USA Tel. (510) 486-6692 Fax (510) 486-4960 Email: This e-mail address is being protected from spambots. You need JavaScript

  1. Microsoft Word - CBFO Manager Transition.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Carlsbad Field Office Manager Transition CARLSBAD, N.M., September 7, 2010 - Dr. Dave Moody has been selected to lead DOE's Office of Environmental Management at the Savannah River Site. Moody has served as DOE Carlsbad Field Office manager, which oversees the Waste Isolation Pilot Plant (WIPP), since December 2005. Under his leadership, WIPP achieved record waste disposal milestones. DOE Assistant Secretary for Environmental Management Dr. Ines Triay, herself a former CBFO manager, will

  2. Microsoft Word - BPA Personal Property.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    U.S. Department of Energy Office of Inspector General Office of Audit Services Audit Report Management Controls over the Bonneville Power Administration's Personal Property Accountability OAS-M-08-01 October 2007 Department of Energy vvasnlngron, UL LUSU:, October 1 , 2007 MEMORANDUM FOR TQ-YADMINISTRATOR, BONNEVILLE POWER ADNIINISTRATION [?L&& < / ( ' F'IIOM. or" Collard / Assistant Inspector General for Performance Audits Office of Inspector General INFORMATION: Audit Report

  3. Microsoft Word - Yucca PCard Report.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AAAAAAAAAAAAAAAAA Inspection Report Yucca Mountain Project Purchase Card Programs INS-O-09-04 August 2009 U.S. Department of Energy Office of Inspector General Office of Inspections MEMORANDUM FOR DIRECTOR, OFFICE OF CILIVIAN RADIOACTIVE WASTE MANAGEMENT FROM: Herbert Richardson Principal Deputy Inspector General SUBJECT: INFORMATION: Inspection Report on "Yucca Mountain Purchase Card Programs" BACKGROUND Yucca Mountain Project (Project) is the Nation's first proposed storage facility

  4. Microsoft Word - S03273_Rev1.doc

    Office of Legacy Management (LM)

    Surface, Hot Creek Valley, Nevada, for Calendar Year 2007 September 2008 Rev. 1 DOE-LM/1558-2007 This page intentionally left blank DOE-LM/1558-2008 Post-Closure Inspection and Monitoring Report for Corrective Action Unit 417: Central Nevada Test Area Surface, Hot Creek Valley, Nevada for Calendar Year 2007 September 2008 Rev. 1 This page intentionally left blank U.S. Department of Energy CY 2007 Post-Closure Inspection & Monitoring Report for CAU 417 September 2008, Rev. 1 Doc. No. S0327300

  5. Microsoft Word - S05069_ROD.doc

    Office of Legacy Management (LM)

    Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 LMS/LEH/S05069 This page intentionally left blank LMS/LEH/S05069 Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 This page intentionally left blank U.S. Department of Energy ROD for DOE Areas for LEHR September 2009 Doc. No. S05069, Rev. 0 Page i Contents Acronyms and Abbreviations

  6. Microsoft Word - AL2006-01.doc (indexed) [DOE]

    in effect until superseded or canceled. What are the Points of Contact? Contact Stephen Zvolensky, Department of Energy (DOE) Office of Procurement and Assistance Policy, at...

  7. Microsoft Word - al93-4.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ... work (including service work) for a DOE facility ... B.The Office of Contractor Human Resource Management shall ... contractor concerning DOE policies, requirements, and ...

  8. Microsoft Word - SEA_MAPAR_2001.doc

    National Nuclear Security Administration (NNSA)

    to the Cerro Grande Fire Mitigation Action Plan Annual Report for 2001 February 20, 2002 Prepared by: Department of Energy Office of Los Alamos Site Operations National ...

  9. Microsoft Word - AL2005-12.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    principles. Second, the contracting officer determines if the costs are reasonable in nature and amount. The Standards for Reimbursement of Contractor Meal Costs The standards for...

  10. Microsoft Word - al2006-12.doc (indexed) [DOE]

    AL-2006-12 (092906) 7 III. What Procedures Ensure Effective Audit Management? Some strategies for managing required audit activity include: 1. Contracting officers should...

  11. Microsoft Word - TR12-17.doc

    Office of Legacy Management (LM)

    ... log * Contingency PlanEmergency Response Plan: (Office of ... Charles Planning and Zoning Department also was contacted ... maintenance. 2. Any problems encountered with the remedies? ...

  12. Microsoft Word - DOE Sustainability Awards 2012.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    very pleased by the Department's Sustainability Awards," said Carlsbad Field Office, ... Pilot Plant, with a 2012 DOE Sustainability Award during a recognition event at ...

  13. Microsoft Word - AL2005-08.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ... that are competitive in terms of market prices, quality, ... Contracting Officers to search the database with results ... prime contractors to enter into Mentor-Protg ...

  14. Microsoft Word - SF30 A050.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Contractor is not, is required to sign this document and return copies to the issuing office. 14. DESCRIPTION OF AMENDMENTMODIFICATION (Organized by UCF section headings,...

  15. Microsoft Word - coverAl.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    with financial support from the Safety, Codes and Standards program element of the Hydrogen, Fuel Cells and Infrastructure program, Office of Energy Efficiency and Renewable...

  16. AcqGuide70pt5.doc

    Energy Savers

    Variable Pay Programs Variable pay is a lump-sum, non-base building, cash payment. ... Contracting Officers consider the type of contract incentive payment, (award fee, ...

  17. Microsoft Word - TOC - ALL.doc

    National Nuclear Security Administration (NNSA)

    ... Test SHPO State Historic Preservation Office SJVUAPCD San Joaquin Valley Unified Air Pollution Control District SMR standardized mortality rate SNF Spent nuclear fuel SNL Sandia ...

  18. Microsoft Word - Report Cover _2_.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Audit Report Management Controls over Small Business Opportunities at Oak Ridge National Laboratory OAS-M-08-08 July 2008 U.S. Department of Energy Office of Inspector General Office of Audit Services Department of Energy Washington, DC 2 0 5 8 5 July 2 , 2 0 0 8 MEMORANDUM FOR T H ~ ~ ~ A N A G E R , OAK RIDGE OFFICE FROM: - ~ s s i s t a n ~ ~ n s ~ e c t o r General for NNSA and Energy Audits Office of Inspector General SUBJECT: INFORMATION: Audit Report on "Management Controls over

  19. Microsoft Word - 3215504_1.DOC

    Energy Savers

    their affiliated businesses with offices in: Abu Dhabi Alicante Amsterdam Baltimore Beijing Berlin Boulder Brussels Caracas Colorado Springs Denver Dubai Dusseldorf Frankfurt ...

  20. Microsoft Word - hCE1.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    the treatment of cocaine and heroin abuse, and victims of chemical warfare or terrorism. ... Offices of Basic Energy Sciences and Biological and Environmental Research, with ...

  1. Microsoft Word - energy efficiency _2_.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Nuclear Security Administration Nevada Site Office (NNSANSO) and National Security Technologies (NSTec) are once again gearing up to prove their commitment to energy conservation. ...

  2. AcqGuide9pt3.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    taken by one agency are recognized and effective for all Executive Branch agencies. ... While in many agencies, the debarment and suspension function resides within the Office of ...

  3. pocforms06a0399.doc | Department of Energy (indexed) [DOE]

    More Documents & Publications fleetappforms04f1298.doc&0; OPC Security Whitepaper 3Hardening Guidelines for OPC Hosts Critical Decision 2 (CD-2) Approval Template...

  4. transcript_jedi_model.doc | Department of Energy (indexed) [DOE]

    document icon transcriptjedimodel.doc More Documents & Publications TAP Webcast Transcript July-29, 2009 Scenario Jedi Tools for Designing & Implementing Better Finance Programs

  5. Microsoft Word - al2006-12.doc | Department of Energy (indexed) [DOE]

    Microsoft Word - al2006-12.doc More Documents & Publications Acquisition Letter No. AL 2008-02 Department of Energy Special Report: DOEIG-0934...

  6. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    A NRC Concurrence with Completion of Remedial Action This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page A-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No.

  7. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    Real Estate Documentation This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page B-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page B-6

  8. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    Agency Notification Agreements This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page E-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008

  9. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    09 Doc. No. S05767 Page A-1 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page A-2 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page A-3 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page A-4 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009

  10. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    Response to Comments This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page G-1 Well Completion Report for CAU 443 CNTA U.S. Department of Energy Doc. No. S05827 December 2009 Page G-2 U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page G-3 Well Completion Report for CAU 443 CNTA U.S. Department of Energy Doc. No. S05827 December 2009 Page G-4

  11. Enter the Post-Doc: The Untapped Sourcing Pipeline

    SciTech Connect (OSTI)

    Boscow, Ryan B.


    This article addresses the potential formulation and utilization of an industry-based Post-Doc program in order to create workforce candidate pipelines with targeted universities.

  12. Effectiveness of a Diesel Oxidation Catalyst (DOC) to control...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion Effectiveness of a ...

  13. Microsoft Word - 8E2A4440.doc (indexed) [DOE]

    48D7DF19-707E-28B27A.doc (126.75 KB) More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - GSP_Charter.doc

    Grant Amount Non-Fed Amount Project Location (City) Project Location (State) Description 1) Pilot and Demonstration Scale FOA - Pilot Scale Algenol Biofuels Inc. $25,000,000 $33,915,478 Freeport TX This project will make ethanol directly from carbon dioxide and seawater using algae. The

  14. Microsoft Word - AL2006-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon Microsoft Word - AL2006-09.doc More Documents & Publications Microsoft PowerPoint - Executive Order13423rbl Sample Contract Language for Construction Using ...

  15. Microsoft Word - S05837_FFA 4th qtr 09.doc

    Office of Legacy Management (LM)

    ... - - - -- - -- -- ,Additional Quarterly Sun*cillancc RcquircHcnts Note: All ... Sites FFA Quarterly Report: July 1-September 30, 2009 U.S. Department of Energy Doc. No. ...

  16. Microsoft Word - DOE_Staffing_Study_Cover.doc | Department of...

    Office of Environmental Management (EM)

    Word - DOEStaffingStudyCover.doc More Documents & Publications 2010 DOE Strategic Sustainability Performance Plan - Report to the White House Council on Environmental...

  17. Microsoft Word - FFATA Memo 30 March 2007.doc | Department of... (indexed) [DOE]

    FFATA Memo 30 March 2007.doc More Documents & Publications Policy Flash 2014-35 Rescission of American Recovery and Reinvestment Act Reporting Requirements. Flash2008-44attachment....

  18. Microsoft Word - S04268_Mar07 thru Mar08.doc

    Office of Legacy Management (LM)

    ... molybdenum, nitrate, selenium, sulfate, and uranium (DOE 1999). Restoration standards (see Table 1) for these Tuba City Annual Performance Evaluation U.S. Department of Energy Doc. ...

  19. Doc Cambell's Post Greenhouse Low Temperature Geothermal Facility...

    Open Energy Information (Open El) [EERE & EIA]

    Low Temperature Geothermal Facility Facility Doc Cambell's Post Sector Geothermal energy Type Greenhouse Location Las Cruces, New Mexico Coordinates 32.3123157,...

  20. Office of Chief Financial Officer

    Directives, Delegations, and Requirements [Office of Management (MA)]


    This Order implements the provisions of the Chief Financial Officers Act of 1990 within the Department of Energy. Cancels SEN 34-91. Canceled by DOE O 520.1A.

  1. Microsoft Word - S09330_2ndQtr2012.doc

    Office of Legacy Management (LM)

    Second Quarter Calendar Year 2012 October 2012 LMS/RFS/S09930 This page intentionally left blank LMS/RFS/S09930 U.S. Department of Energy Office of Legacy Management Rocky Flats, Colorado, Site Quarterly Report of Site Surveillance and Maintenance Activities Second Quarter Calendar Year 2012 October 2012 This page intentionally left blank U.S. Department of Energy Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities-2nd Quarter CY 2012 October 2012 Doc. No. S09330

  2. Microsoft Word - 09012033_DVP.doc

    Office of Legacy Management (LM)

    Grand Junction, Colorado, Office Site April 2009 LMS/GJO/S00209 This page intentionally left blank U.S. Department of Energy DVP-February 2009, Grand Junction, Colorado, Office Site April 2009 RIN 09012033 Page i Contents Sampling Event Summary ...............................................................................................................1 Grand Junction Site, Sample Location Map ....................................................................................4 Data Assessment

  3. Microsoft Word - IG-0659 pdf.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    U.S. Department of Energy Office of Inspector General Office of Audit Operations Audit Report The Stabilization of Nuclear Materials at Los Alamos National Laboratory DOE/IG-0659 August 2004 REPORT ON THE STABILIZATION OF NUCLEAR MATERIALS AT LOS ALAMOS NATIONAL LABORATORY TABLE OF CONTENTS Nuclear Materials Stabilization Program Details of Finding................................................... 1 Recommendations and Comments................................ 3 Appendices 1. Objective, Scope,

  4. Building Technologies Office Overview

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Roland Risser Director, Building Technologies Office Building Technologies Office Energy Efficiency Starts Here. 2 Building Technologies Office Integrated Approach: Improving ...

  5. Office Buildings - Full Report

    U.S. Energy Information Administration (EIA) (indexed site)

    administration building Insurance company headquarters building Local insurance agency Social services office Attorney's office Real estate sales office Government office State...


    Office of Legacy Management (LM)

    OFFICE FOR EMERGENCY MANAGEMENT 155OP STREETNW. WiSHINGTON. D.C. ' , iQns 25,19&L At-t :. I' .' ~ at l530 P Btmat, IO&, XtwMn&m, 0. 6., at 9130 A.Jb Sa 1 llmbemupoftbaaomlttaal8~f~r :::i.: :;::j:/ :::.,:.,::: . . . -2, . -3- .,... .:.:. . . ,::;:: 2. lktlv4rsityof-ta ?oral8rtbnsfoaofth4~cnlLmd farumd4rContraotO~~9 t4a : lwlnde the d4v4logmullt. construotion j andop4ratloaofadditl~auls, s~tNm4t4ln. /; ./ 3. alllY4rsltyofcb.l4s&o on4fth4w*callyd sar tmdor OoBtroct OEUS~ 7 :;::.

  7. Microsoft Word - FOIA Log FY 2002.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    2 FOIA - Request Log 1 Closed/ Date No. Dated Date Rec'd HQ or Dir. Subject Yes/ 1/30/02 001 12/3/02 12/21/02 Richland Transfer Richland Operation Office search for records they located documents originated by the DOE Carlsbad Field Office that may be responsive to Mr. Hongs request. By transfer of this letter they forwarded Mr. Hong request, along with the documents located at Richland to the Carlsbad FOIA Office. CBFO will respond directly to Mr. Hong with a release determination Yes/ 2/13/02

  8. Microsoft Word - AcqGuide71pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1pt1.doc Microsoft Word - AcqGuide71pt1.doc PDF icon Microsoft Word - AcqGuide71pt1.doc More Documents & Publications Chapter 71 - Review and Approval of Contract and Financial ...

  9. Microsoft Word - AcqGuide7pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    pt1.doc Microsoft Word - AcqGuide7pt1.doc ACQUISITION PLANNING PDF icon Microsoft Word - AcqGuide7pt1.doc More Documents & Publications ACQUISITION PLANNING Policy Flash 2015-13 ...

  10. Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc | Department...

    Energy Savers

    ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc More Documents & Publications Microsoft Word -...

  11. Microsoft Word - Flash2009dashxxFAC34.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc More Documents & Publications Federal Acquisition Regulation; Federal...

  12. Microsoft Word - Flash2008-08attachmentFAC22.doc | Department...

    Energy Savers

    Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc More Documents & Publications Policy Flash 2013-75...

  13. Microsoft Word - Flash2007-61FACAttachment.doc | Department of...

    Energy Savers

    Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc More Documents & Publications Microsoft Word -...

  14. Microsoft Word - PolicyFlash2007-10Attch2.doc | Department of...

    Energy Savers

    PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc More Documents & Publications Policy Flash 2013-37 Federal...

  15. Microsoft Word - Policy Flash 2008-02.doc | Department of Energy

    Energy Savers

    Microsoft Word - Policy Flash 2008-02.doc Microsoft Word - Policy Flash 2008-02.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  16. Microsoft Word - Policy Flash 2008-03.doc | Department of Energy

    Energy Savers

    Microsoft Word - Policy Flash 2008-03.doc Microsoft Word - Policy Flash 2008-03.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  17. Microsoft Word - NationalPolicyAssurances5-06.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    NationalPolicyAssurances5-06.doc Microsoft Word - NationalPolicyAssurances5-06.doc PDF icon Microsoft Word - NationalPolicyAssurances5-06.doc More Documents & Publications ...

  18. Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc |...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Press Release RECOMP 2-8-08 REV FINAL.doc Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc PDF icon Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc More ...

  19. Microsoft Word - FY10PropertyBSCFed.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PropertyBSCFed.doc Microsoft Word - FY10PropertyBSCFed.doc PDF icon Microsoft Word - FY10PropertyBSCFed.doc More Documents & Publications Microsoft Word - FY09PropertyBSCContractor...

  20. Microsoft Word - DP_cover_and_front matter_R1_Draft_3.DOC | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    R1Draft3.DOC Microsoft Word - DPcoverandfront matterR1Draft3.DOC PDF icon Microsoft Word - DPcoverandfront matterR1Draft3.DOC More Documents & Publications Microsoft ...

  1. Microsoft Word - ARRAGuideAttachment10v1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ARRAGuideAttachment10v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - DRAFT CRB Interview Guidance

  2. Microsoft Word - figure_10_2015.doc

    Gasoline and Diesel Fuel Update

    Pipeline Imports LNG Imports * In 2014, 303 million cubic feet of compressed natural gas (CNG) were imported from Canada. Source: Office of Fossil Energy, U.S. Department of ...

  3. Microsoft Word - Audit Report Repost.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Field Office Final Audit Report A-08-09 of the Advanced Mixed Waste Treatment Project Dear Mr. ... as required by Section II.C.2.c of the WIPP Hazardous Waste Facility Permit. ...

  4. Microsoft Word - Santa Fe Dec 14.doc

    National Nuclear Security Administration (NNSA)

    I'm with the Department of Energy in Los 21 Alamos, and I'm ... actions which could be 8 office space, library, the ... I have a Ph.D. in 7 medical sciences, pharmacology and ...

  5. Microsoft Word - HABAdv#252LSSC.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    2 Subject: Hanford's 2011 Lifecycle Scope, Schedule, and Cost Report Adopted: November 4, 2011 Page 1 November 4, 2011 Scott Samuelson, Manager U.S. Department of Energy, Office of...

  6. Microsoft Word - HABAdv#251PIP.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    1 Subject: Hanford Public Involvement Plan Adopted: November 4, 2011 Page 1 November 4, 2011 Scott Samuelson, Manager U.S. Department of Energy, Office of River Protection P.O. Box...

  7. Microsoft Word - 12-1433.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    have any questions, please contact Mr. Randy Unger, Director of the Office of Quality Assurance at (575) 234-7065. Sincerely, Original Signature on File Jose R. Franco, Manager...

  8. Guneafinal-for laser printer.doc

    Office of Legacy Management (LM)

    Environmental Assessment of Ground Water Compliance at the Gunnison, Colorado, ... DE-AC13-96GJ87355 DOE Grand Junction Office EA of Ground Water Compliance at the Gunnison ...

  9. Microsoft Word - S06713_SER.doc

    Office of Legacy Management (LM)

    August 2010 LMSWELS06713 LMSWELS06713 ENERGY Legacy Management U.S. DEPARTMENT OF U.S. Department of Energy Office of Legacy Management This page intentionally left blank LMS...

  10. Microsoft Word - 09-1690.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    MAG:09-1690:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 September 22, 2009 Mr. Steve Zappe, Project Leader Hazardous Materials...

  11. Microsoft Word - M057 Page 2.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    unchanged and in full force and effect. 15A. NAME AND TITLE OF SIGNER (Type or print) James P. Henschel, Project Director 16A NAME AND TITLE OF CONTRACTING OFFICER (Type or...

  12. Microsoft Word - 12-1568.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    68:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 December 12, 2012 Mr. John E. Kieling, Chief Hazardous Waste Bureau New Mexico...

  13. AcqGuide4pt2.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    2 (August 2004) Requirements for Contracting with Public Relations Firms Overview This section discusses the Department of Energy's procedures when obtaining contractual services from public relations firms. Background The Office of Public Affairs is responsible for collecting and disseminating information about the Department's programs, missions, and activities. The Office of Public Affairs establishes guidelines for the review and coordination of activities for that mission. These activities

  14. AcqGuide70pt3270.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Chapter 70.3270 (April 2007) 1 Guide Chapter 70.32 Contract Financing Guide Subchapter 70.3270 Alternative Financing Guiding Principle The contracting officer should assist program officials in ensuring that neither the contract's statement of work nor any other direction to the contractor precludes qualifying the alternative financing endeavor as an operating lease. Background: The Office of Engineering and Construction Management (MA-50) manages the Department's Alternative Financing policy.

  15. Microsoft Word - Attachment A3.doc

    Office of Environmental Management (EM)

    UNITED STATES OF AMERICA DEPARTMENT OF ENERGY OFFICE OF ELECTRICITY DELIVERY AND RELIABILITY APPLICATION FOR A PRESIDENTIAL PERMIT FOR THE NEW ENGLAND CLEAN POWER LINK PROJECT ) ) ) ) Docket No. PP-400 To: Office of Electricity Delivery and Energy Reliability (OE-20) U.S. Department of Energy 1000 Independence Ave. SW Washington, DC 20585 Attention of Brian Mills, Senior Planning Advisor COMMENTS AND MOTION TO INTERVENE OUT OF TIME OF ALLCO RENEWABLE ENERGY LIMITED Pursuant to Rules 212 and 214

  16. Microsoft Word - 0073.tee.doc

    Office of Environmental Management (EM)

    February 14, 2011 DEPARTMENT OF ENERGY OFFICE OF HEARINGS AND APPEALS Application for Exception Name of Case: Cole Distributing, Inc. Date of Filing: December 13, 2010 Case No.: TEE-0073 On December 13, 2010, Cole Distributing, Inc. (Cole) filed an Application for Exception with the Office of Hearings and Appeals (OHA) of the Department of Energy (DOE). The firm requests that it be permanently relieved of the requirement to prepare and file the Energy Information Administration (EIA) Form

  17. Microsoft Word - 0076.tee.doc

    Office of Environmental Management (EM)

    27, 2011 DEPARTMENT OF ENERGY OFFICE OF HEARINGS AND APPEALS Application for Exception Name of Case: Brodeur's Oil Service, Inc. Date of Filing: February 18, 2011 Case No.: TEE-0076 On February 18, 2011, Brodeur's Oil Service, Inc. (Brodeur's) filed an Application for Exception with the Office of Hearings and Appeals (OHA) of the Department of Energy (DOE). The firm requests temporary relief from its requirement to prepare and file the Energy Information Administration (EIA) Form EIA-782B,

  18. Microsoft Word - P04-00147.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    ER/ARM-0401 Tropical Warm Pool International Cloud Experiment (TWP-ICE): Cloud and Rain Characteristics in the Australian Monsoon May 2004 P. T. May and C. Jakob Bureau of Meteorology Research Centre Victoria 3001, Australia J. H. Mather Pacific Northwest National Laboratory Richland, Washington Work supported by the U.S. Department of Energy, Office of Science, Office of Biological and Environmental Research DOE/ER/ARM-0401 iii SUMMARY The impact of oceanic convection on its environment and the

  19. Microsoft Word - 08-0370.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    0:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 July 2, 2008 Mr. Steve Zappe, Project Leader Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Subject: Transmittal of the Carlsbad Field Office Final Audit Report for Audit A-08-22 of the Idaho National Laboratory Central Characterization Project Analytical Laboratories Dear Mr. Zappe: This letter transmits the Idaho

  20. Microsoft Word - 12-1433.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    433:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 August 15, 2012 Mr. John Kieling, Chief Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Building 1 Santa Fe, NM 87505-6303 Subject: Transmittal of the Recertification Audit Report for the Oak Ridge National Laboratory/ Central Characterization Project Audit A-12-08 Dear Mr. Kieling: This letter transmits the final audit report for Carlsbad Field Office (CBFO)

  1. Microsoft Word - 2527B.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    5 Description of the ARM Operational Objective Analysis System June 2001 Minghua Zhang State University of New York at Stony Brook, New York Shaocheng Xie Richard T. Cederwall J. John Yio Lawrence Livermore National Laboratory, Livermore, California Work supported by the U.S. Department of Energy, Office of Science, Office of Biological and Environmental Research Zhang et al., June 2001, ARM TR-005 iii Contents 1

  2. Microsoft Word - EmrE.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    SSRL is supported by the U.S. Department of Energy, Office of Basic Energy Sciences. The SSRL Structural Molecular Biology Program is supported by the National Institutes of Health, National Center for Research Resources, Biomedical Technology Program and by the U.S. DOE, Office of Biological and Environmental Research. Crystal Structure of the EmrE Multidrug Transporter with a Substrate O. Pornillos, Y-J. Chen, A. P. Chen and G. Chang Department of Molecular Biology, The Scripps Research

  3. AcqGuide42pt1.doc

    Energy Savers

    1.1 (March 2004) 1 Acquisition Regulations System [Reference: FAR 1; DEAR 901; DOE O 541.1] Overview This section discusses the Civilian Agency Acquisition Council, agency acquisition regulations, deviations from the FAR and DEAR, ratification of unauthorized commitments, and Contracting Officers and their representatives. The Civilian Agency Acquisition Council The DOE representative to the Civilian Agency Acquisition Council is a staff member of the Office of Procurement and Assistance Policy,

  4. Microsoft Word - CQA2008_FINAL.doc

    Gasoline and Diesel Fuel Update

    8) Distribution Category UC-950 Cost and Quality of Fuels for Electric Plants 2007 and 2008 January 2010 U.S. Energy Information Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. Department of Energy Washington DC 20585 This report was prepared by the U.S. Energy Information Administration (EIA), the statistical and analytical agency within the U.S. Department of Energy. By law, EIA's data, analyses, and forecasts are independent of approval by any other officer or

  5. interiorlightingefficiencyformunicipalities.doc | Department of Energy (indexed) [DOE]

    ARCHITECT AND ENGINEERING COSTS AT LOS ALAMOS AND SANDIA NATIONAL LABORATORIES U.S. DEPARTMENT OF ENERGY OFFICE OF INSPECTOR GENERAL OFFICE OF AUDIT SERVICES AUGUST 1998 DOE/IG-0424 August 7, 1998 MEMORANDUM FOR THE ACTING SECRETARY FROM: Gregory H. Friedman Acting Inspector General SUBJECT: INFORMATION : Audit Report on "Architect and Engineering Costs at Los Alamos and Sandia National Laboratories" BACKGROUND The 1993 National Performance Review Report recommended performance

  6. Microsoft Word - Management Control Cover1.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Management Controls over the State Energy Program's Formula Grants OAS-M-06-05 April 2006 2 meaningful performance metrics to determine the cost benefit of the Program in meeting its goals. Furthermore, it is unclear at this time how a recent reorganization of EERE's field structure will impact monitoring of the Program. Monitoring EERE Regional Offices were not regularly visiting State Energy Offices to monitor the use of funds or the results of Program activities. We reviewed monitoring

  7. Microsoft Word - THILLY, Ludovic - Abstract.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Ludovic Thilly Institut Pprime, CNRS-University of Poitiers-ENSMA SP2MI, 86962 Futuroscope, France Cu/Nb nanocomposite wires processed by severe plastic deformation for high pulsed magnets: effects of the nanostructure on the resistance to high stress, high temperature and irradiation Copper-based high strength and high electrical conductivity nanocomposite wires reinforced by Nb nanotubes are prepared by severe plastic deformation, applied with an Accumulative

  8. DOE HR Guidebook 12_15_05.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    HR Guidebook 12_15_05.DOC&#0; DOE HR Guidebook 12_15_05.DOC&#0; DOE HR Guidebook 12_15_05.DOC&#0; (8.6 MB) More Documents & Publications Operating Guidelines Appendix A B.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; Operating Guidelines Appendix C D.DOC&#0;

  9. Building Technologies Office Overview

    SciTech Connect (OSTI)


    Building Technologies Office Overview Presentation for the 2013 Building Technologies Office's Program Peer Review

  10. Office of Chief Financial Officer

    Directives, Delegations, and Requirements [Office of Management (MA)]


    Page Change 1 to DOE O 520.1 modifies the responsibility statement to include NNSA Field CFO positions, modifies Heads of Field Elements responsibilities for consistency with the CFO responsibilities, and makes a minor change to reflect the establishment of the Office of Management, Budget and Evaluation. Cancels SEN 34-9.

  11. Project Summary-TES-SNL.doc. (Conference) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Project Summary-TES-SNL.doc. Citation Details In-Document Search Title: Project Summary-TES-SNL.doc. Abstract not provided. Authors: Siegel, Nathan Phillip Publication Date: ...

  12. Microsoft Word - US_Japan_REE_agenda_ver7.doc | Department of...

    Office of Environmental Management (EM)

    Microsoft Word - USJapanREEagendaver7.doc Microsoft Word - USJapanREEagendaver7.doc U.S. - Japan Roundtable on Rare Earth Elements Research PDF icon Microsoft Word -...

  13. Microsoft Word - FY11 DNWD Budget CJ_Draft_20100124.doc

    Energy Savers

    PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor.doc (59.07 KB) More Documents & Publications Microsoft Word - FY09PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCFed

    PropertyBSCFed.doc Microsoft Word - FY10PropertyBSCFed.doc Microsoft Word - FY10PropertyBSCFed.doc (59.02 KB) More Documents & Publications Microsoft Word - FY09PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor


  14. The Office

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Office of Energy Efficiency and Renewable Energy (EERE) is leading the U.S. Department of Energy's efforts to deliver market-driven solutions for energy- saving homes, buildings, and manufacturing; sustainable transportation; and renewable power. Sustainable TRANSPORTATION Renewable ENERGY Energy EFFICIENCY EERE research has helped reduce production costs of automotive lithium-ion batteries by ~70% since 2008 More than electric charging units 20,000

  15. Microsoft Word - DOE-HDBK-1110-2008-Concluding Material.doc

    Energy Savers

    Area Office Sandia Fernald Area Office FNL Los Alamos Area Office West Valley Area Office Kirtland Area Office Pinellas Area Office Kansas City Area Office Miamisburg Area Office...

  16. Microsoft Word - Map and Directions to FrCt.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Frederiksen Court Housing Iowa State University Ames, IA 50011 Ames Laboratory - Public Affairs 111 TASF Iowa State University Ames, IA 50011-3020 Page 1 515.294.9557 1 Enter Ames...

  17. Microsoft Word - IG-0744 Cover.doc

    Office of Environmental Management (EM)

    I I D D E E N N T T I I F F Y Y A A N N D D P P R R O O T T E E C C T T Y Y O O U U R R V V I I T T A A L L R R E E C C O O R R D D S S July 2010 Records Management Division Office of IT Planning, Architecture, and E-Government Office of the Chief Information Officer 2 INTRODUCTION Each Federal agency is responsible for establishing a Vital Records Program for the identification and protection of those records needed for continuity of operations before, during, and after emergencies; and those

  18. Microsoft Word - Appendix M_ContingencyTrees.doc

    Office of Legacy Management (LM)

    M Groundwater Operable Unit Contingency Trees U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page M-3 Figure M-1. Validation and Statistical Evaluation Scheme Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page M-4 Figure M-2. Decision Tree for Objective 1 Data U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page M-5 Figure M-3. Decision Tree for Objective 2 Data Weldon

  19. Microsoft Word - Annual Report 2006_Final.doc (indexed) [DOE]

    AcqGuide37pt1 binney Nov 2010 (201 KB) More Documents & Publications Chapter 37 - Service Contracting AcqGuide37pt1.doc&#0; Special Review: OAS-M-15-05

    AcqGuide70pt31A.doc (30.08 KB) More Documents & Publications AcqGuide70pt31.doc&#0; Acquisition Guide Chapter 70.31A - Costs Associated with Whistleblower Actions Acquisition Letter No. AL-2016-06

    0, Small Business Programs - An Overview Guiding Principles It is the policy of the Department of Energy to provide maximum

  20. Microsoft Word - RIN 06080459 DVP_112806.doc

    Office of Legacy Management (LM)

    383 2006 - - U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE-AC01-02GJ79491 September 2006 Shiprock, New Mexico, Disposal Site December 2006 U.S. Department of Energy DVP-Shiprock, New Mexico, Disposal Site December 2006 RIN 06080459 Page ii Contents Sampling Event Summary

  1. Microsoft Word - S06010_Ltr.doc

    Office of Legacy Management (LM)

    6010 Task Order LM00-502 Control Number 10-0184 January 21, 2010 U.S. Department of Energy Office of Legacy Management ATTN: Jack Craig Site Manager 3600 Collins Ferry Road Morgantown, WV 26505 SUBJECT: Rulison Long-Term Hydrologic Monitoring Program Sampling and Analysis Results for 2009 Dear Mr. Craig: The U.S. Department of Energy (DOE) Office of Legacy Management conducted annual sampling at the Rulison, Colorado, Site for the Long-Term Hydrologic Monitoring Program (LTHMP) on May 11 and 12,

  2. Microsoft Word - 0067.TEE.doc

    Office of Environmental Management (EM)

    December 17, 2009 DEPARTMENT OF ENERGY OFFICE OF HEARINGS AND APPEALS Application for Exception Name of Case: North Side Coal & Oil Co., Inc. Date of Filing: December 2, 2009 Case No.: TEE-0067 On December 2, 2009, North Side Coal & Oil Co., Inc. (North Side) filed an Application for Exception with the Office of Hearings and Appeals (OHA) of the Department of Energy (DOE). The firm requests that it be permanently relieved of the requirement to prepare and file the Energy Information

  3. Microsoft Word - 09-1595.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    9-1595:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 July 27, 2009 Mr. Steve Zappe, Project Leader Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Subject: Transmittal of the Final Audit Report A-09-13, Idaho National Laboratory Central Characterization Project Dear Mr. Zappe: Enclosed is the Carlsbad Field Office (CBFO) Final Audit Report for Audit A-09-13 of the

  4. Microsoft Word - 090713HanfordARRAupdate.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Backgrounder Contacts: July 13, 2009 Geoff Tyree, DOE (509) 376-4171, Cameron Hardy, DOE (509) 376-5365, Update on Hiring and Recovery Act Funding at the Hanford Site, Richland Operations Office Projects Total Number of Jobs Saved/Created The total number of jobs saved to date with Recovery Act funding for DOE Richland Operations Office projects is approximately 300. The total number of jobs created to date is approximately 900. New Hires in June

  5. Microsoft Word - 12-1584.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    84:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 January 23, 2013 Mr. John E. Kieling, Chief Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Bldg. 1 Santa Fe, NM 87505-6303 Subject: Transmittal of the Final Audit Report for the INL/CCP Recertification Audit A-12-13 Dear Mr. Kieling: This letter transmits the Final Audit Report for Carlsbad Field Office (CBFO) Audit A-12-13 of the Idaho National Laboratory

  6. Microsoft Word - Audit Report Repost.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    6:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 July 15, 2008 Steve Zappe, Project Leader Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Bldg. 1 Santa Fe, New Mexico 87505-6303 Subject: Transmittal of the Carlsbad Field Office Final Audit Report A-08-09 of the Advanced Mixed Waste Treatment Project Dear Mr. Zappe: This letter transmits the Advanced Mixed Waste Treatment Project (AMWTP) Audit Report for the

  7. Operations Office

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    (~ii~,Richland Operations Office ~Z4TESO~Richland, Washington 99352 SEP 2 2009 CERTIFIED MAIL Ms. Sarah Washburn Heart of America Northwest 1314 N.E. 5 6 th Street Suite 100 Seattle, Washington 98105 Dear Ms. Washburn: FREEDOM OF INFORMATION ACT REQUEST (FOI 2009-0067) You requested, pursuant to the Freedom of Information Act (FOJA), the following documents relating to: 1 . "The authorization, decision to use, and actual use of any and all pesticides and herbicides anywhere within the

  8. Microsoft Word - RIN 06020313 DVP.doc

    Office of Legacy Management (LM)

    206 2006 - -L Data Validation Package U.S. Department of Energy Office of Legacy Management March 2006 Shiprock, New Mexico, Disposal Site June 2006 U.S. Department of Energy DVP-March 2006, Shiprock, New Mexico, Disposal Site June 2006 RIN 06020313 Page ii Contents Sampling Event Summary ...............................................................................................................1 Sample Location Map, Shiprock, New Mexico, Disposal Site

  9. Microsoft Word - RIN 06060399 DVP.doc

    Office of Legacy Management (LM)

    314 2006 - -L Data Validation Package U.S. Department of Energy Office of Legacy Management June 2006 Monument Valley, Arizona, Processing Site September 2006 U.S. Department of Energy DVP-June 2006 Monument Valley, Arizona, Processing Site September 2006 RIN 06060399 Page ii Contents Sampling Event Summary ...............................................................................................................1 Sample Locations at Monument Valley, Arizona, Processing Site

  10. Microsoft Word - RIN05080225_DVP.doc

    Office of Legacy Management (LM)

    071 2006 - -L Data Validation Package U.S. Department of Energy Office of Legacy Management September 2005 Shiprock, New Mexico, Disposal Site Data Validation Package January 2006 U.S. Department of Energy DVP⎯September 2005, Shiprock, New Mexico, Disposal Site January 2006 RIN 05080225 Page ii Contents Sampling Event Summary ...............................................................................................................1 Shiprock, New Mexico Sample Location

  11. Microsoft Word - RIN 10022849 DVP.doc

    Office of Legacy Management (LM)

    0 Water Sampling at the Grand Junction, Colorado, Office Site May 2010 LMS/GJO/S00210 This page intentionally left blank U.S. Department of Energy DVP-February 2010, Grand Junction, Colorado May 2010 RIN 10022849 Page i Contents Sampling Event Summary ...............................................................................................................1 Grand Junction Site, Sample Location Map ....................................................................................4 Data

  12. Microsoft Word - RIN06040365_DVP_092506.doc

    Office of Legacy Management (LM)

    271 2006 - -L Data Validation Package U.S. Department of Energy Office of Legacy Management May 2006 Gunnison, Colorado, Processing and Disposal Sites September 2006 U.S. Department of Energy DVP-May 2006 Gunnison, Colorado, Processing and Disposal Site September 2006 RIN 06040365 Page ii Contents Sampling Event Summary ...............................................................................................................1 Gunnison, Colorado, Processing Site Sample Location Map

  13. Microsoft Word - FINAL DOENV--1363.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    363 ANNUAL TRANSPORTATION REPORT FY 2009 Radioactive Waste Shipments to and from the Nevada Test Site (NTS) February 2010 United States Department of Energy National Nuclear Security Administration Nevada Site Office Las Vegas, Nevada This page intentionally left blank TABLE OF CONTENTS 1.0 INTRODUCTION....................................................................................1 2.0 SUMMARY OF WASTE SHIPMENTS (FY 2009)..........................................1 2.1 Waste Transporters

  14. Microsoft Word - Mustering card.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Idaho Operations Office Employee Mustering The email based check in system should only be used by DOE ID Employees. (Use in descending order until successful) Call: 1-208-526-COOP (2667) 1-800-DOE-DOE1 Ext. 382 (1-800-363-3631 Ext. 382) Email:

  15. Microsoft Word - Figure_13_2015.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    35 2014 Flow Capacity (million cubic feet per day) Figure 13. Principal Interstate Natural Gas Flow Capacity Summary, 2014 Source: Energy Information Administration, Office of Oil, Gas, and Coal Supply Statistics. = Direction of Flow = Bi-directional 15,000 12,000 9,000 6,000 3,000 0

  16. Microsoft Word - figure_07-2015.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    1 Source: Office of Fossil Energy, U.S. Department of Energy, Natural Gas Imports and Exports. Figure 7. U.S. natural gas trade summary, 2010-2014 0 0.5 1 1.5 2 2.5 3 3.5 4 2010 2011 2012 2013 2014 Total Imports Total Exports Net Imports trillion cubic feet

  17. Office of the Chief Financial Officer .:. Lawrence Berkeley National...

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Office of the Chief Financial Officer Office of the Cheif Financial Officer Lawrence Berkeley Naitonal Laboratory Department of Energy Quicklinks: ---...

  18. Microsoft Word - S05993_CY2009 Annual Rpt.doc

    Office of Legacy Management (LM)

    ... of Site Surveillance and Maintenance Activities-CY 2009 U.S. Department of Energy Doc. No. ... Purpose Approval Date Status as of December 31, 2009 Phase II and III Upgrades to Solar ...

  19. Microsoft Word - ex1b-ITER-mar07.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    B - Patent Rights - Acquisition by the Government - ITER UT-B Contracts Div March 2007 Page 1 of 6 ex1b-ITER-mar07.doc Exhibit 1B ITER Ref: DEAR 952.227-13 PATENT RIGHTS - ...

  20. Microsoft Word - AL2005-13.doc | Department of Energy (indexed) [DOE]

    Microsoft Word - AL2005-13.doc More Documents & Publications PBA2007 Presentation-short-6-19-07DOE&0; Accident Investigation of the February 7, 2013, Scissor Lift Accident in the...

  1. Microsoft Word - S08266_App_A-3.doc

    Office of Legacy Management (LM)

    Score 0 Fernald Preserve, Ohio, Wetland Mitigation Monitoring Report U.S. Department of Energy Doc. No. S08266 Appendix A-3, 2011 Amphibian Index of Biotic Integrity Data...

  2. Microsoft Word - Appendix B_RiskAssessmenr.doc

    Office of Legacy Management (LM)

    ... U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page ... if ingested at frequencies and amounts similar to those of residential use (DOE 1997). ...

  3. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    NRC Technical Evaluation Report on Revised LTSP This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. ...

  4. Microsoft Word - N01058_LTSM Plan.doc

    Office of Legacy Management (LM)

    ... for the Pinellas Site U.S. Department of Energy Doc. No. ... replaced by an aboveground system that currently is in use (DOE 1997b). The Old Drum Storage Site is located at the ...

  5. Microsoft Word - VI_12_Degrees Awarded 2015.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    nuclear systems A. Bonasera Post Doc. at INFN - Laboratori Nazionali del Sud, Catania, Italy STUDENTS WHO RECEIVED GRADUATE DEGREES FROM NON-THESIS April 1, 2014 - March 31, 2015 ...

  6. Microsoft Word - Appendix D_LegalDescription.doc

    Office of Legacy Management (LM)

    for the Chemical Plant Area Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page D-4 Legal Description for the Chemical Plant Area All that ...

  7. Microsoft Word - Appendix G_DistributionList.doc

    Office of Legacy Management (LM)

    ... Jefferson City, MO 65102-0180 Ms. Cynthia Green, Realty Specialist Missouri Department of ... Jefferson City, MO 65102 Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. ...

  8. Microsoft Word - S04801_Avian2008 _2_ revised.doc

    Office of Legacy Management (LM)

    ... Swallows were observed throughout the spring and summer. Violet-green, Barn, and Cliff ... Avian Wetland Surveys at Monticello Mill Tailing Site, 2008 U.S. Department of Energy Doc. ...

  9. Office of Fossil Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    LNG Imports by Receiving Terminal (Bcf) (Bcf) (Bcf) LNG Imports by Company Office of Fossil Energy Office of Oil & Natural Gas Office of Regulation and International Engagement ...

  10. Office of Fossil Energy (indexed) [DOE]

    Terminal (Bcf) (Bcf) (Bcf) LNG Imports by Company Office of Fossil Energy Office of Oil & Natural Gas Office of Regulation and International Engagement Division of Natural Gas...

  11. TO: Procurement Directors/Contracting Officers FROM: Chief

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    0 DATE: January 4, 2016 TO: Procurement Directors/Contracting Officers FROM: Chief Contract and Financial Assistance Policy Division Office of Policy Office of Acquisition Management SUBJECT: Federal Acquisition Circular (FAC) 2005-86 SUMMARY: Attached for your information is a brief summary of Federal Acquisition Regulation (FAR) amendments, published in the December 31, 2015 Federal Register at 80 FR 81886. FAC 2005- 86 issued 3 final rules and 1interim rule. This Flash will be available

  12. Petascale Post-Doc Project a Supercomputing Success Story

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Petascale Post-Doc Project a Supercomputing Success Story Petascale Post-Doc Project a Supercomputing Success Story ARRA-funded program takes petascale computing researchers to the next level March 24, 2014 Contact: Kathy Kincade, +1 510 495 2124, petascalepostdocs.jpg From left: Jihan Kim, Filipe Maia, Alice Koniges, Robert Preissl, Brian Austin, Wangyi (Bobby) Liu , Kirsten Fagnan and Praveen Narayanan. The first post-doctoral research project centered at the Department of

  13. FAQs Docs for the Buy American Provision | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAQs Docs for the Buy American Provision FAQs Docs for the Buy American Provision These documents answer the most frequently asked questions about the Buy American Provision. International Trade Agreements and the Recovery Act Buy American Provisions: Frequently Asked Questions (57.16 KB) Computer Hardware and Software: Frequently Asked Questions (50.6 KB) More Documents & Publications Questions and Answers for the Smart Grid Investment Grant Program: Buy American Buy American Guidance

  14. Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc [DOE]

    Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

  15. Microsoft Word - AcqGuide70pt31A.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AcqGuide70pt31A.doc Microsoft Word - AcqGuide70pt31A.doc PDF icon Microsoft Word - AcqGuide70pt31A.doc More Documents & Publications AcqGuide70pt31.doc&0; Policy Flash 2014-26...

  16. DOC-DOE China Mission Announcement Press Release | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    China Mission Announcement Press Release DOC-DOE China Mission Announcement Press Release DOC-DOE China Mission Announcement Press Release DOC-DOE China Mission Announcement Press Release (34.5 KB) More Documents & Publications DOC-DOE Joint China Mission Statement China 2015 Business Development Mission Marketing Flyer DOE-LPO_Email-Update_001_Through_11

  17. Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

    Office of Energy Efficiency and Renewable Energy (EERE)

    Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

  18. Microsoft Word - GC Mediation Evaluation _2-06-09_.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy GC Mediation Evaluation _2-06-09_.doc Microsoft Word - GC Mediation Evaluation _2-06-09_.doc Microsoft Word - GC Mediation Evaluation _2-06-09_.doc (29.87 KB) More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc HQ Mediation Program Brochure Microsoft Word - DRAFT CRB Interview Guidance

  19. Microsoft Word - National Science Bowl Fact Sheet.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy National Science Bowl Fact Sheet.doc Microsoft Word - National Science Bowl Fact Sheet.doc Microsoft Word - National Science Bowl Fact Sheet.doc (244.47 KB) More Documents & Publications Microsoft Word - National Science Bowl Fact Sheet.doc Idaho Operations AMWTP Fact Sheet Heating Ventilation and Air Conditioning Efficiency

  20. Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy PPL 970-Materials and Inventory 5-9-05.doc Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc (22.24 KB) More Documents & Publications Microsoft Word - al95-06.doc DOE-HDBK-1139-2006 ppl970-3.pdf

  1. Richland Operations Office - Hanford Site

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Richland Operations Office Richland Operations Office Richland Operations Office River Corridor Central Plateau Groundwater Mission Support Newsroom Richland Operations Office...

  2. Microsoft Word - FAL2004-05.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy No. 2004-05 Financial Assistance Regulation Date 08/03/04 FINANCIAL ASSISTANCE LETTER Financial Assistance Letter is issued under the authority of the Procurement Executives of DOE and NNSA Subject: SELECTING THE APPROPRIATE AWARD INSTRUMENT What is the purpose of this Financial Assistance Letter (FAL)? This FAL provides Contracting Officers and other grants personnel guidance on selecting the appropriate award instrument. How will this change my work processes? This FAL

  3. Microsoft Word - FAL2004-06.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    4 Department of Energy No. 2004-06 Financial Assistance Regulation Date 11/02/04 FINANCIAL ASSISTANCE LETTER Financial Assistance Letter is issued under the authority of the Procurement Executives of DOE and NNSA SUBJECT: AWARD TERMS What is the Purpose of this Financial Assistance Letter (FAL)? This FAL provides Contracting Officers and other grants personnel guidance relating to standard award terms and reporting requirements for financial assistance awards. How will this Change My Work

  4. Microsoft Word - FAL2004-02.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Subject: Implementation of Fiscal Year (FY) 2004 Legislative Provisions What is the Purpose of this Financial Assistance Letter (FAL)? This FAL provides Contracting Officers and grants personnel guidance for the implementation of certain provisions contained in the Energy and Water Development Appropriations Act, 2004 (Energy & Water Act), Pub. L. 108-137, enacted December 1, 2003 and the Department of Interior and Related Agencies Appropriations Act, 2004 (Interior Act), Pub. L. 108-108,

  5. Microsoft Word - FAL2004-03.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5 Department of Energy No. 2004-03 Financial Assistance Regulation Date 02/12/04 FINANCIAL ASSISTANCE LETTER Financial Assistance Letter is issued under the authority of the Procurement Executives of DOE and NNSA Subject: Intellectual Property What is the purpose of this Financial Assistance Letter (FAL)? This FAL provides Contracting Officers, Patent Counsel, and other grants personnel guidance regarding intellectual property (IP) requirements in financial assistance awards and lists the

  6. AcqGuide3pt2.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Chapter 3.2 (March 2004) Antitrust Teaming Arrangements [Reference: FAR 3.3, 9.6; DEAR 903.3; DCAA Contract Audit Manual Vol. 1, Section 4-705; FTC/DOJ Antitrust Guidelines for Collaborations Among Competitors (April 2000)] Overview This section provides guidance that is in use Government-wide to assist the Department's Contracting Officers in identifying whether certain contractor teaming arrangements may unduly restrict competition. Although no specific situations within the Department have

  7. AcqGuide70pt4.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Guide ----------------------------------------------- -------------------------------Chapter 70.4 (March 2016) 1 Cooperative Audit Strategy Reference: DEAR 970.5203-1, entitled, Management Controls ; DEAR 970.5232-3, entitled, Accounts, Records and Inspection; Chapter 4 of the Accounting Handbook, and Chapter 18 of the Inspector General Audit Manual. Overview This chapter provides guidance to contracting officers (CO) in their review of (1) INTERNAL AUDIT IMPLEMENTATION DESIGN, sub mitted

  8. Microsoft Word - 45201 Submitted Dec 2003.doc

    Office of Legacy Management (LM)

    30 Long-term Monitoring Plan for the Central Nevada Test Area Prepared by Ahmed E. Hassan submitted to Nevada Site Office National Nuclear Security Administration U.S. Department of Energy Las Vegas, Nevada SEPTEMBER 2003 Publication No. 45201 Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation, or favoring by the United States Government or any

  9. Microsoft Word - 45221b.doc

    Office of Legacy Management (LM)

    51 Validation Analysis of the Groundwater Flow and Transport Model of the Central Nevada Test Area Prepared by Ahmed Hassan, Jenny Chapman, Hesham Bekhit, Brad Lyles, and Karl Pohlmann submitted to Nevada Site Office National Nuclear Security Administration U.S. Department of Energy Las Vegas, Nevada September 2006 Publication No. 45221 Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise, does not necessarily constitute or

  10. Microsoft Word - RioBlancotext.doc

    Office of Legacy Management (LM)

    5 Modeling Approach for Evaluating Radionuclide Transport in Nuclear-Stimulated Gas Reservoirs prepared by Clay Cooper and Jenny Chapman submitted to Nevada Operations Office National Nuclear Security Administration U.S. Department of Energy Las Vegas, Nevada SEPTEMBER 2001 Publication No. 45186 Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation, or

  11. Microsoft Word - ex parte com_10052010.doc

    Office of Environmental Management (EM)

    20 th , 2006 Mr. Lawrence Mansueti Permitting, Siting, and Analysis Division Office of Electricity Delivery and Energy Reliability Department of Energy 1000 Independence Avenue, SW Washington, DC 20585-0119 Dear Mr. Mansueti, This letter is in response to the Department of Energy Emergency Order to Resume Limited Operation at the Potomac River Generating Station, Alexandria, VA, in Response to Electricity Reliability Concerns in Washington, DC. For over 50 years, and as indicated by Mirant's own

  12. Microsoft Word - corr measures addendum.doc

    Office of Legacy Management (LM)

    DOE-LM/GJ1241-2006 Pinellas Environmental Restoration Project Building 100 Area Corrective Measures Study Report Addendum July 2006 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Building 100 Area Corrective Measures Study Report Addendum July 2006 Page iii Contents Acronyms and Abbreviations

  13. Microsoft Word - TRUacceptcritrev0e2.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    121 Determining Transuranic Alpha Activity Concentration for Compliance with the Nevada Test Site Waste Acceptance Criteria Revision 0 May 10, 2006 Approved By: U.S. Department of Energy National Nuclear Security Administration Nevada Site Office (NNSA/NSO) Original Signed by Gary Pyles 05/17/2006 Gary Pyles, NNSA/NSO RWAP Task Lead Date Prepared By: Bechtel Nevada, Radioactive Waste Acceptance Program (RWAP) Original Signed by Deron Linkenheil 05/17/2006 Deron Linkenheil, Senior Engineer, CHP

  14. Microsoft Word - greeneCV.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    CURRICULUM VITAE Judith L. Greene ADDRESS: Savannah River Ecology Laboratory P. O. Drawer E Aiken, SC 29802 Office Phone: (803) 725-5988 Email: PERSONAL: Born October 20, 1953, Augusta, GA Married, 1 child EDUCATION: B.S. in Biology, Furman University, 1975 EMPLOYMENT HISTORY: 1992-Present Research Coordinator, Savannah River Ecology Laboratory, Aiken, SC 1976-1992 Research Technician, Savannah River Ecology Laboratory, Aiken, SC 1975-1976 Research Technician, Medical College of

  15. Operating Guidelines Appendix C D.DOC

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Competitive Sourcing Program OPERATING GUIDELINES (CS-OG-01) C-1 APPENDIX C. CONFLICT OF INTERESTS GUIDELINES 1. PURPOSE This Appendix identifies personal conflicts of interest (PCI), including participation, representation, post- employment, and procurement information restrictions, and organizational conflict of interest (OCI) restrictions relating to the conduct of Office of Management and Budget (OMB) Circular A-76 competitions and associated procurement actions at the Department of Energy

  16. Microsoft Word - 03NESHAP-FINAL.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Standards Hazardous Air Pollutants DOE/NV/11718--929 June 2004 Calendar Year 2003 Prepared by: Bechtel Nevada Post Office Box 98521 Las Vegas, NV 89193-8521 for DISCLAIMER Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation, or favoring by the U.S. Government or any agency thereof or its contractors or subcontractors. This report has been reproduced

  17. Microsoft Word - 08-1307.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    07:UFC 2300 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 July 29, 2008 Mr. Steve Zappe, Project Leader Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Subject: Final Audit Report A-08-12, Remote Handled Certification, Oak Ridge National Laboratory Central Characterization Project Dear Mr. Zappe: Enclosed is the final audit report for Oak Ridge National Laboratory Central

  18. Microsoft Word - 08-1315.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    15:UFC 2300 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 August 6, 2008 Mr. Steve Zappe, Project Leader Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Subject: Transmittal of the Final Audit Report for the Idaho National Laboratory/Central Characterization Project, Certification Audit A-08-10 Dear Mr. Zappe: Enclosed is the Idaho National Laboratory/Central Characterization

  19. Microsoft Word - 09-1581.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    581:UFC:2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 July 6, 2009 Mr. Steve Zappe, Project Leader Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Bldg. 1 Santa Fe, New Mexico 87505-6303 Subject: Transmittal of the Certification Audit Report for the Savannah River Site Central Characterization Project (A-09-16) Dear Mr. Zappe: This letter transmits the Savannah River Site Certification Audit Report for the

  20. Microsoft Word - 09-1602.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    602:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 July 28, 2009 Mr. Steve Zappe, Project Leader Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Subject: Transmittal of the Recertification Audit Report A-09-14, Idaho National Laboratory Central Characterization Project Dear Mr. Zappe: Enclosed is the Idaho National Laboratory/Central Characterization Project (INL/CCP)

  1. Microsoft Word - 09-1690.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    MAG:09-1690:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 September 22, 2009 Mr. Steve Zappe, Project Leader Hazardous Materials Bureau New Mexico Environment Department 2905 E. Rodeo Park Drive, Building 1 Santa Fe, New Mexico 87502-6110 Subject: Transmittal of the Contact-Handled Waste Certification Audit Report for the Oak Ridge National Laboratory Central Characterization Project, Audit A-09-24 Dear Mr. Zappe: This letter transmits the

  2. Microsoft Word - 09-1838.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    838:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 October 20, 2009 Mr. Steve Zappe, Project Leader Hazardous Materials Bureau New Mexico Environment Department 2905 E. Rodeo Park Drive, Building 1 Santa Fe, NM 87505-6110 Subject: Transmittal of the Certification Audit Report for the Hanford TRU Program Dear Mr. Zappe: This letter transmits the Hanford TRU Program Audit Report for the processes performed to characterize and certify waste as

  3. Microsoft Word - 12-1556.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    556:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 December 3, 2012 Mr. John E. Kieling, Bureau Chief Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Bldg. 1 Santa Fe, NM 87505-6303 Subject: Transmittal of the Final Audit Report for the Los Alamos National Laboratory Central Characterization Project Recertification Audit A-12-12 Dear Mr. Kieling: This letter transmits the Final Audit Report for the Carlsbad

  4. Microsoft Word - 12-1568.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    68:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 December 12, 2012 Mr. John E. Kieling, Chief Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Bldg. 1 Santa Fe, New Mexico 87505-6303 Subject: Transmittal of the Final Audit Report for Recertification Audit A-12-14, INL Analytical Laboratories Utilizing the Central Characterization Project Dear Mr. Kieling: This letter transmits the final audit report for

  5. Microsoft Word - BOOK_2003_V4.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Stanford Synchrotron Radiation Laboratory 30 th Annual Users' Meeting PROGRAM & ABSTRACTS OCTOBER 8 - 10, 2003 Stanford Synchrotron Radiation Laboratory SLAC, Stanford University Stanford, CA 94309 Organizers: Benjamin Bostick, Dartmouth College Timothy McPhillips, SSRL SSRL is funded by the Department of Energy, Offices of Basic Energy Sciences and Biological and Environmental Research; the National Institutes of Health, National Center for Research Resources, Biomedical Technology Program,

  6. Microsoft Word - CSC Scorecard.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Fee Determination Posting Requirements Office of Environmental Management Attachment 2 Award Fee Determination Scorecard Contractor: Computer Sciences Corporation (CSC) Contract: Occupational Health Services Contract Number: DE-AC06-04RL14383 Award Period: 10/01/2011 to 09/30/2012 Basis of Evaluation: Performance and Evaluation Plan (PEMP) for Period FY 2012 Award Fee Available: $916,130.00 Award Fee Earned: $824,517.00 (90%) Award Fee Area Adjectival Ratings: Performance Incentive Allocated

  7. Microsoft Word - California_cleanup.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    WIPP Completes California Sites Cleanup CARLSBAD, N.M., June 14, 2010 - The U.S. Department of Energy's Carlsbad Field Office (CBFO) has successfully completed its campaign to clean up all defense- related transuranic (TRU) waste at California's Vallecitos Nuclear Center (VNC) near Sunol and Lawrence Livermore National Laboratory (LLNL) Site 300, east of Livermore. The last shipment of defense related TRU waste from VNC was shipped to Idaho National Laboratory on June 7. Following the

  8. Microsoft Word - Educational funding.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    NSTec Exceeds $1 Million in Educational Support WSI-NV adds to contributions The National Nuclear Security Administration Nevada Site Office (NNSA/NSO) contract partners have donated millions of dollars in educational and charitable support this year. National Security Technologies (NSTec), the operational contractor for the Nevada Test Site (NTS), has invested more than $1 million in education grants and focused science and engineering support. Wackenhut Services Inc. (WSI-NV), the security

  9. Microsoft Word - CQA2004_20060727.doc

    Gasoline and Diesel Fuel Update

    4) Distribution Category UC-950 Cost and Quality of Fuels for Electric Plants 2003 and 2004 June 30, 2006 (Updated August 2, 2006) Energy Information Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. Department of Energy Washington DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the Department of Energy. The information contained herein should not be construed as advocating or reflecting

  10. Microsoft Word - CQA2005W.doc

    Gasoline and Diesel Fuel Update

    5) Distribution Category UC-950 Cost and Quality of Fuels for Electric Plants 2004 and 2005 December 2006 Energy Information Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. Department of Energy Washington DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the Department of Energy. The information contained herein should not be construed as advocating or reflecting any policy position of

  11. Microsoft Word - CQA2006W.doc

    Gasoline and Diesel Fuel Update

    6) Distribution Category UC-950 Cost and Quality of Fuels for Electric Plants 2005 and 2006 October 2007 Energy Information Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. Department of Energy Washington DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the Department of Energy. The information contained herein should not be construed as advocating or reflecting any policy position of the

  12. Microsoft Word - EPA_combine_append.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    February 18, 2009 SUBJECT: Finding of No Significant Impact for the Final Environmental Assessment for the Remote-handled Waste Disposition Project (WDP-RWMC-09-008) Dear Interested Party: The U.S. Department of Energy, Idaho Operations Office (DOE-ID) issued a Finding of No Significant Impact (FONSI) for the Final Environmental Assessment for the Remote-handled Waste Disposition Project. The environmental assessment contains the analysis of the potential environmental impacts of processing for

  13. Microsoft Word - Figure_09-2015.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    3 Canada Mexico Figure 9. Flow of natural gas imports, 2014 (billion cubic feet) Source: Energy Information Administration, based on data from the Office of Fossil Energy, U.S. Department of Energy, Natural Gas Imports and Exports. 12 29 608 200 United States 6 1 Trinidad/Tobago Other 6 Norway 6 Yemen 541 433 329 21 143 359 3 7 6 8 4

  14. Microsoft Word - 3215504_1.DOC

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Hogan Lovells US LLP is a limited liability partnership registered in the District of Columbia. Hogan Lovells refers to the international legal practice comprising Hogan Lovells US LLP, Hogan Lovells International LLP, Hogan Lovells Worldwide Group (a Swiss Verein), and their affiliated businesses with offices in: Abu Dhabi Alicante Amsterdam Baltimore Beijing Berlin Boulder Brussels Caracas Colorado Springs Denver Dubai Dusseldorf Frankfurt Hamburg Hanoi Ho Chi Minh City Hong Kong Houston

  15. Microsoft Word - FIA-12-0061.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    John P. Newton ) ) Filing Date: October 9, 2012 ) Case No.: FIA-12-0061 ) ) Issued: October 31, 2012 _______________ Decision and Order _______________ On October 9, 2012, John P. Newton ("Appellant") filed an Appeal from determinations issued to him on September 6, 2012, and September 12, 2012, by the Office of Information Resources (OIR) of the Department of Energy (DOE) (FOIA Request Numbers HQ-2012-01768-F & HQ-2012-01835-F). In those determinations, OIR responded to two

  16. Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy NationalPolicyAssurancesAwardTermsFinal81804.doc Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc (31.13 KB) More Documents & Publications Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc National Policy Assurances to be Incorporated as Award Terms Microsoft Word - NationalPolicyAssurances5-06.doc

  17. Office of Electricity Delivery and Energy Reliability Recovery Program Plan

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    | Department of Energy Electricity Delivery and Energy Reliability Recovery Program Plan Office of Electricity Delivery and Energy Reliability Recovery Program Plan Microsoft Word - OE PSRP June 5 2009 _OE_ Final.doc (105.88 KB) More Documents & Publications Microsoft Word - PSRP Updates 6-25-10_v2 Update to the 2008 EAC Report: "Smart Grid: Enabler of the New Energy Economy Report Recommendations" EAC Presentation: How DOE is Organized to Provide Leadership on Electricity

  18. Microsoft Word - PeerReview_CCSP.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    the Peer Review of the U.S. Climate Change Science Program Synthesis and Assessment Report entitled 'Climate Models: An Assessment of Strengths and Limitations for User Applications' Pursuant to Section V of the "Information Quality Bulletin for Peer Review" of the Office of Management and Budget (OMB), under the authority of the Information Quality Act of 2000 (P.L. 106-554), the U.S. Climate Change Science Program (CCSP) announces a plan for the peer review of its Synthesis and

  19. Microsoft Word - PeerReview_SAR.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    a Peer Review of a "Synthesis and Assessment Report on Scenarios of Greenhouse Gas Emissions and Atmospheric Concentrations and Review of Integrated Scenario Development and Application" Pursuant to Section V of the "Information Quality Bulletin for Peer Review" of the Office of Management and Budget (OMB), under the authority of the Information Quality Act of 2000 (P.L. 106-554), the U.S. Climate Change Science Program (CCSP) announces a plan for a peer review of its

  20. Microsoft Word - M002-SF30.doc

    National Nuclear Security Administration (NNSA)

    I:.CONTRACT ID CODE IPAGE OF PAGES DE-NR0000031 1 I 27 2. AMENDMENT/MODIFICATION NO. 3. EFFECTIVE DATE 4. REQUISITION/PURCHASE REQ. NO. 15. PROJECT NO. (II app/icable) 002 Same as Block 16C N/A 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) Code I U.S. Department of Energy Pittsburgh Naval Reactors Office P.O. Box 109 West Mifflin, PA 15122-0109 8. NAME AND ADDRESS OF CONTRACTOR (No. slreet, county, State and ZIP Code) ..J.:l 9.A. AMENDMENT OF SOLICITATION NO. Bechtel Marine

  1. Microsoft Word - March242005-Donna.doc

    Office of Legacy Management (LM)

    Mound Site Transition Plan Rev. 0 March 2005 Mound STP, Rev. 0 - iv - March 2005 Executive Summary The U.S. Department of Energy (DOE) Offices of Legacy Management (LM) and Environmental Management (EM) are planning and implementing the transfer of the Miamisburg Closure Project (MCP) for long-term surveillance and maintenance (LTS&M) and for certain legacy worker and contract liabilities to LM by the end of fiscal year (FY) 2006 (see Exhibit ES-1). The purpose of the Mound Site Transition

  2. Microsoft Word - Q0032900-Aug-2004.doc

    Office of Legacy Management (LM)

    Q0032900 DOE-LM/GJ684-2004 Monticello Mill Tailings Site Operable Unit III Post-Record of Decision Monitoring Plan Draft Final August 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado Document Number Q0032900 Contents U.S. Department of Energy MMTS OU III Post-ROD Monitoring Plan August 2004 Draft Final Page iii Contents Page

  3. Microsoft Word - S03741_CADD.doc

    Office of Legacy Management (LM)

    RECORD OF TECHNICAL CHANGE Technical Change No . . DOE-LM/1555-2007 ROTC-2 Page-~-- of _ _;_3 _ _ _ Activity Name Central Nevada Test Area - ROTC for the CADD/CAP Addendum Date June 12. 2013 The following technical changes (including justification) are requested by: Mark Kautsky Department of Energy/Office of Legacy Management (Site Manager) Description of Change: Throughout Document: The terms "5-year", "Proof of Concept", and "5-year Proof of Concept Monitoring"

  4. Microsoft Word - HABAdv#237EECA.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    7 Subject: EE/CA for 105-KE Reactor Decommissioning Adopted: Nov. 5, 2010 Page 1 November 5, 2010 Dave Brockman, Manager U.S. Department of Energy, Office of River Protection P.O. Box 450 (H6-60) Richland, WA 99352 Matt McCormick, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd,, Suite 115 Richland WA 99352 Jane Hedges, Program Manager Washington State Department

  5. Microsoft Word - M051 SF 30.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    M051 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF

  6. Microsoft Word - SF30 A049.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    9 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. See Block 14 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION

  7. Microsoft Word - SF30 A052.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    2 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. See Block 14 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION

  8. Microsoft Word - SF30 A054.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    4 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 06RV14136 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF

  9. Microsoft Word - 07-1061.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    DM/KJB:07-1061:UFC2300 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 June 20, 2007 Steve Zappe, Project Leader Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Bldg. 1 Santa Fe, NM 87505-6303 Subject: Transmittal of the Certification Audit Report for the, INL/CCP Audit A-07-19 Dear Mr. Zappe: This letter transmits the Idaho National Laboratory/Central Characterization Project (INL/CCP) Audit Report for the processes

  10. Microsoft Word - 09-1865.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    65:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 November 4, 2009 Mr. Steve Zappe, Project Leader Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Subject: Transmittal of the Interim and Final Audit Report for the Idaho National Laboratory/Central Characterization Project Remote-Handled Waste Visual Examination Process, Audit A-10-03 Dear Mr. Zappe: Enclosed is the

  11. Microsoft Word - A089 Funding.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    9 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  12. Microsoft Word - A094_SF30.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    A094 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF

  13. Microsoft Word - A100 Funding.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    A100 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF

  14. Microsoft Word - A105 Funding.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    5 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  15. Microsoft Word - A109 Funding.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    9 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  16. Microsoft Word - A111 Funding.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    1 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  17. Microsoft Word - A112, Funding.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    2 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  18. Microsoft Word - A113 Funding.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    3 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  19. Microsoft Word - A116 Funding.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    6 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/

  20. Microsoft Word - A119 Funding.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    9 3. EFFECTIVE DATE (M/D/Y) See Block 16C 4. REQUISITION/PURCHASE REQ. NO. 5. PROJECT NO. (If applicable) 6. ISSUED BY CODE 7. ADMINISTERED BY (If other than Item 6) CODE U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A. AMENDMENT OF SOLICITATION NO. Bechtel National, Inc. 2435 Stevens Center Place 9B. DATED (SEE ITEM 11) Richland, WA 99352 10A. MODIFICATION OF CONTRACT/