National Library of Energy BETA

Sample records for lead agency doc

  1. Property:NEPA LeadAgencyDocNumber | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    LeadAgencyDocNumber Jump to: navigation, search Property Name NEPA LeadAgencyDocNumber Property Type String This is a property of type String. Pages using the property "NEPA...

  2. Property:LeadAgency | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Subproperties This property has the following 1 subproperty: R RAPIDRoadmap9-FD-k Pages using the property "LeadAgency" Showing 25 pages using this property. (previous...

  3. Microsoft Word - Final Lead Assembly SA.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ... of European Fabrication of Lead MOX Assemblies. ...... 20 Table 4. Comparison of Human Health ...

  4. Energy Secretary Bodman Leads US Delegation to International Energy Agency

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Ministerial | Department of Energy Leads US Delegation to International Energy Agency Ministerial Energy Secretary Bodman Leads US Delegation to International Energy Agency Ministerial May 2, 2005 - 12:41pm Addthis PARIS, FRANCE -- Secretary of Energy Samuel W. Bodman this week is leading the U.S. Delegation to the Ministerial Meeting of the International Energy Agency (IEA), being held in Paris. Secretary Bodman will emphasize three principles at the IEA Ministerial -- that energy security

  5. Microsoft Word - Transmission - DOE lead agency NOPR - Final... (indexed) [DOE]

    ... DOE explains that only then will the authorizing agencies have a sufficiently complete application to start the one-year clock. But the statute calls for the clock to begin upon ...

  6. Microsoft Word - Position on the use of lead shielding 05-15-061.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    1120 Position Paper on the Use of Lead Shielding for the Disposal of Low Level Waste at the Nevada Test Site Revision 2, June 2, 2005 Approved By: U.S. Department of Energy National Nuclear Security Administration Nevada Site Office Original Signed by Gary Pyles 05/17/2006 Gary Pyles, NNSA/NSO, RWAP Task Manager Date Concur: Original Signed James B. Zovi 05/17/2006 James B. Zovi, Bechtel Nevada, RWAP Manager Date Prepared By: Bechtel Nevada, Radioactive Waste Acceptance Program Original Signed

  7. raising_investment_funds_for_clean_energy_programs.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc Microsoft ...

  8. howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc (117.5 KB) More Documents & Publications How to Design and Market Energy Efficiency Programs to Specific Neighborhoods Using Social Media to Engage the Community in Energy Efficiency

  9. highperformanceleasingstrategiesforstateandlocalgovernments.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc (93 KB) More Documents & Publications High Performance Leasing Strategies for State and Local Governments Leveraging Portfolio Manager for Disclosure and Green Leasing Practices

  10. Doc...~En.

    Office of Legacy Management (LM)

    ' : ,:#;: .' :.' . ,.:: :,; ..,' ... ..,,..,.... - .~~._ I&i3:scD .::-:, TO-340 .":: ..' . - ' - -. ' . .." ,.. .;.. Very traly yours;, -' .~X :, Doc...~En. ' Br.:Re&ng ';;a' : _, Div. Reading File ., ,, .~, ,.~-

  11. exploringpowerpurchaseagreementsthebasicspart1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc (112.5 KB) More Documents & Publications Exploring Power Purchase Agreements - The Basics Part 1

  12. finance_programs.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    financeprograms.doc financeprograms.doc financeprograms.doc Microsoft Office document icon financeprograms.doc More Documents & Publications Tools for Designing & Implementing ...

  13. Key Agency Targets Summary _FY 2012_.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    all projects in the capital work plan; and 3) At least 80% of Capital Allocation Board (CAB) approved "major capital investment" projectprogram elements of cost, schedule, and...

  14. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    Agency Notification Agreements This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page E-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008

  15. Doc.~:Ru.

    Office of Legacy Management (LM)

    .' , .' c,j .c; Distriblition:~ ;. <; ~..,:L.D.i&%.ay,FiN-OR00 Doc.~:Ru. ,.,. 75. ' Br..Reading 'ire' ,lliv. Read&q File ,: '. ~ ,, .-' . ...: - SURNAME..

  16. partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc (129.5 KB) More Documents & Publications Partnering With Utilities to Offer Energy Efficiency Programs Webinar Transcript Partnering with Utilities Part 2 - Advanced Topics for Local Governments in Creating

  17. webinar_innovation_financing.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    financing.doc webinarinnovationfinancing.doc webinarinnovationfinancing.doc Microsoft Office document icon webinarinnovationfinancing.doc More Documents & Publications ...

  18. webinar_innovation_planning_zoning.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    planningzoning.doc webinarinnovationplanningzoning.doc webinarinnovationplanningzoning.doc Microsoft Office document icon webinarinnovationplanningzoning.doc More ...

  19. webinar_innovation_organizing_strategizing.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    organizingstrategizing.doc webinarinnovationorganizingstrategizing.doc webinarinnovationorganizingstrategizing.doc Microsoft Office document icon webinarinnovationorganizi...

  20. webinar_innovation_net_metering_interconnection.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    netmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc Microsoft Office document icon ...

  1. fed_finance_facilities_ee_upgrades_deployment.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc Microsoft Office document icon ...

  2. shprkEA.doc

    Office of Legacy Management (LM)

    ... Name Agency or Company Madeline Roanhorse Ray Russell Harlen Charlie Navajo UMTRA Program ... Quality, 13(1):146-150. International Atomic Energy Agency (IAEA), 1994. Handbook of ...

  3. Microsoft Word - 2007 NESHAP Final with Signature page.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    2005 FOIA ANNUAL REPORT.doc Microsoft Word - 2005 FOIA ANNUAL REPORT.doc report2005.pdf Microsoft Word - 2005 FOIA ANNUAL REPORT.doc (45.24 KB) More Documents & Publications U.S. Department of Energy 2008 Annual FOIA Report Office of Information Resources (MA-90) ANNUAL FOIA REPORT FOR 2009

    trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation, or favoring by the U.S. Government or any agency thereof. Available for sale to the

  4. Advanced Research Projects Agency - Energy Program Specific Recovery...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Advanced Research Projects Agency - Energy Program Specific Recovery Plan PDF icon Microsoft Word - 44F1801D.doc More Documents & Publications Microsoft Word - PSRP Updates ...

  5. Environmental Records.doc

    Office of Environmental Management (EM)

    Protection Agency EPCRA Emergency Planning and Community Right-To-Know Act of ... of management services organizations dedicated to solving waste cleanup problems. ...

  6. Microsoft Word - S0244800.doc

    Office of Legacy Management (LM)

    ... ground water from the interceptor drains and extraction wells is solar evaporation. ... Annual Performance Report, Shiprock, New Mexico U.S. Department of Energy Doc. No. ...

  7. Microsoft Word - ContractManagementPlanningDRIVERS.doc | Department... (indexed) [DOE]

    ContractManagementPlanningDRIVERS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS.doc Microsoft Word - ARRAMOModelMod.doc...

  8. energydisclosureandleasingstandardsbestpractices.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    energydisclosureandleasingstandardsbestpractices.doc energydisclosureandleasingstandardsbestpractices.doc energydisclosureandleasingstandardsbestpractices.doc (100.5 KB) More Documents & Publications Leveraging Portfolio Manager for Disclosure and Green Leasing Practices Communicating Success, Measuring Improvements, Sharing Results Communicating Success, Measuring Improvements, Sharing Results

  9. TentativeAgreement.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Iani, Region 10 Administrator U.S. Environmental Protection Agency CC: R. Jim, YN P. Sobotta, NPT K. Niles, Oregon Energy W. J. Taylor, ORP R. Gay, CTUIR J. H. Swailes, ORP L....

  10. Category:NEPA Doc | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    NEPA Doc Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Category: NEPA Documents Collections Add.png Add a new NEPA Document Collection Pages in category "NEPA Doc"...

  11. spurring_local_economic_development_clean_energy_programs.doc... (indexed) [DOE]

    spurringlocaleconomicdevelopmentcleanenergyprograms.doc spurringlocaleconomicdevelopmentcleanenergyprograms.doc More Documents & Publications Spurring Local Economic...

  12. webinar_innovation_permitting_inspections.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications webinarinnovationfinancing.doc raisinginvestmentfundsforcleanenergyprograms.doc Communicating Success, Measuring Improvements, Sharing Results

  13. Microsoft Word - AL2002-03.doc | Department of Energy

    Office of Environmental Management (EM)

    2-03.doc Microsoft Word - AL2002-03.doc PDF icon Microsoft Word - AL2002-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - FAL2004-01.doc...

  14. Microsoft Word - FAL2004-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - FAL2004-01.doc PDF icon Microsoft Word - FAL2004-01.doc More Documents & Publications Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-02.doc...

  15. Microsoft Word - AL2006-08.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    8.doc Microsoft Word - AL2006-08.doc PDF icon Microsoft Word - AL2006-08.doc More Documents & Publications AL2007-05.doc&0; Microsoft Word - AL2005-14.doc Microsoft Word - ...

  16. Microsoft Word - AL2005-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5-03.doc Microsoft Word - AL2005-03.doc PDF icon Microsoft Word - AL2005-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - AL2006-08.doc ...

  17. Microsoft Word - 98-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    8-11.doc Microsoft Word - 98-11.doc PDF icon Microsoft Word - 98-11.doc More Documents & Publications Microsoft Word - AL2006-08.doc Microsoft Word - AL2005-01.doc Microsoft Word -...

  18. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    K MMTS and MVP Site Inspection Checklists U n c o n t r o l l e d c o p y MMTS Annual Inspection Checklist U n c o n t r o l l e d c o p y MMTS Annual Inspection Checklist Page 1 of 38 I. MMTS Site Information Site name: Monticello Mill Tailings (USDOE) Site; Operable Units I, II, and III Date of inspection: Site Location: Monticello, Utah: EPA Region 8 EPA ID: UT 3890090035 Lead Agency: U.S. Department of Energy Office of Legacy Management (DOE-LM) PCOR Date: September 2004 Operational and

  19. HABAdv#1671.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    6 Subject: U Plant Closure Plan Adopted: September 10, 2004 Page 1 September 10, 2004 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Linda Hoffman, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Ron Kreizeneeck, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Subject: U Plant Closure Plan Dear Mssrs. Klein, Kreizeneeck, and Ms.

  20. Habadv-119.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    9 Subject: B Reactor Engineering Evaluation and Cost Analysis Adopted: June 8, 2001 Page 1 June 8, 2001 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Chuck Findley, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Re: B Reactor Engineering Evaluation and Cost Analysis Dear

  1. Microsoft Word - CMPTemplate031307.doc | Department of Energy

    Office of Environmental Management (EM)

    CMPTemplate031307.doc Microsoft Word - CMPTemplate031307.doc PDF icon Microsoft Word - CMPTemplate031307.doc More Documents & Publications Chapter 42 - Contract Administration...

  2. Microsoft Word - ACQUISITION LETTER.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ACQUISITION LETTER.doc Microsoft Word - ACQUISITION LETTER.doc PDF icon Microsoft Word - ACQUISITION LETTER.doc More Documents & Publications ACQUISITION LETTER DEAR Part 933 OPAM ...

  3. Microsoft Word - SpecialTermsandConditions0506.doc | Department...

    Energy Savers

    Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc More Documents &...

  4. Microsoft Word - FY2005finaliparhandbook.doc | Department of...

    Energy Savers

    Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc More Documents & Publications...

  5. Microsoft Word - ARRAAttachment2.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAAttachment2.doc Microsoft Word - ARRAAttachment2.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment3.rtf Microsoft Word -...

  6. Microsoft Word - ARRAMOModelMod.doc | Department of Energy

    Energy Savers

    ARRAMOModelMod.doc Microsoft Word - ARRAMOModelMod.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS...

  7. Microsoft Word - ARRAModelWAS.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ARRAModelWAS.doc Microsoft Word - ARRAModelWAS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAMOModelMod...

  8. Microsoft Word - August06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    August06.doc Microsoft Word - August06.doc PDF icon Microsoft Word - August06.doc More Documents & Publications Microsoft Word - April

  9. Microsoft Word - FY10PropertyBSCContractor.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor.doc PDF icon Microsoft Word - FY10PropertyBSCContractor.doc More Documents & Publications Microsoft Word - ...

  10. Microsoft Word - GJPPGPracticesDraft.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    GJPPGPracticesDraft.doc Microsoft Word - GJPPGPracticesDraft.doc PDF icon Microsoft Word - GJPPGPracticesDraft.doc More Documents & Publications 1 DOE Purchase Card Policy Natural ...

  11. Microsoft Word - Cross Reference Matrix Introduction.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Cross Reference Matrix Introduction.doc Microsoft Word - Cross Reference Matrix Introduction.doc PDF icon Microsoft Word - Cross Reference Matrix Introduction.doc More Documents & ...

  12. Microsoft Word - April06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    April06.doc Microsoft Word - April06.doc PDF icon Microsoft Word - April06.doc More Documents & Publications Secretary Directs FPO to Prepare Strategic Plan Microsoft Word - August

  13. Engaging Financial Institution Partners Transcript.doc | Department...

    Office of Environmental Management (EM)

    Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Microsoft ...

  14. AL2007-03.doc (indexed) [DOE]

    from GAO and Inspector General (IG) reports of other federal agencies. Introduction The IA relationship involves two Federal agencies that enter into a relationship for the...

  15. Highlights.doc

    Gasoline and Diesel Fuel Update

    September 2002 1 Short-Term Energy Outlook September 2002 Overview World Oil Markets: The waxing and waning intensities of concern surrounding potential military action against Iraq and uncertainty over OPEC production policy leading up to their September 19 meeting have contributed to WTI spot crude oil prices bouncing between $26 and $30 per barrel since early August. The average spot WTI price in August was $28.40 per barrel. Developments suggesting an easing of tensions could temporarily

  16. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page I-3 U n c o n t r o l l e d c o p y Long-Term Surveillance and Maintenance ...

  17. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Doc. No. S06401 June 2010 Page B-2 U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. ...

  18. Ammendment 2.doc | Department of Energy (indexed) [DOE]

    Ammendment 2.doc More Documents & Publications Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&0; RFQ DE-RQ01-04ME90001.doc&0; Attachment 3-Past Performance...

  19. Index2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Index2.doc Index2.doc Index2.doc (11.46 KB) More Documents & Publications Sylvania Corporation, Hicksville, NY and Bayside, NY - Addendum to July 8, 2004 O:\HOMEPAGE\FOIA\report99.PDF&#0; U.S. Department of Energy 2004 Annual Report

  20. SubcontractingGuidelines.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; (245.71 KB) More Documents & Publications Guidance of the Department of Energy Subcontracting Program Acquisition Guide Chapter 19 Update Chapter 19 - Small Business Programs

  1. Microsoft Word - AL2005-16.doc | Department of Energy

    Office of Environmental Management (EM)

    6.doc Microsoft Word - AL2005-16.doc PDF icon Microsoft Word - AL2005-16.doc More Documents & Publications Microsoft Word - AL2005-10.doc Audit Report: IG-0860 Microsoft Word -...

  2. Microsoft Word - AL2005-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5-02.doc Microsoft Word - AL2005-02.doc PDF icon Microsoft Word - AL2005-02.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc...

  3. Microsoft Word - AL2005-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - AL2005-11.doc PDF icon Microsoft Word - AL2005-11.doc More Documents & Publications Audit Report: OAS-L-13-08 Microsoft Word - AL2005-12.doc CHAPTER 7...

  4. Microsoft Word - AL2006-02.doc | Department of Energy

    Energy Savers

    2.doc Microsoft Word - AL2006-02.doc PDF icon Microsoft Word - AL2006-02.doc More Documents & Publications Microsoft Word - AL2006-03.doc Archived Financial Assistance Letters...

  5. Microsoft Word - AL2006-03.doc | Department of Energy

    Energy Savers

    3.doc Microsoft Word - AL2006-03.doc PDF icon Microsoft Word - AL2006-03.doc More Documents & Publications Microsoft Word - AL2006-02.doc Archived Financial Assistance Letters...

  6. Microsoft Word - al2005-04.doc | Department of Energy

    Energy Savers

    al2005-04.doc Microsoft Word - al2005-04.doc PDF icon Microsoft Word - al2005-04.doc More Documents & Publications AL2005-04ClassDeviation.pdf Microsoft Word - Matrixpart2.doc...

  7. Microsoft Word - AL2005-14.doc | Department of Energy

    Office of Environmental Management (EM)

    4.doc Microsoft Word - AL2005-14.doc PDF icon Microsoft Word - AL2005-14.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc...

  8. Microsoft Word - AL2005-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    7.doc Microsoft Word - AL2005-07.doc PDF icon Microsoft Word - AL2005-07.doc More Documents & Publications Microsoft Word - AL2006-07.doc OPAM Policy Acquisition Guides Initial ...

  9. Microsoft Word - AL2005-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - AL2005-01.doc PDF icon Microsoft Word - AL2005-01.doc More Documents & Publications Microsoft Word - AL2006-08.doc Acquisition Letter Archive listing ...

  10. Microsoft Word - AL2006-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - AL2006-01.doc PDF icon Microsoft Word - AL2006-01.doc More Documents & Publications Microsoft Word - al2005-06.doc Chapter 19 - Small Business Programs OPAM...

  11. Microsoft Word - Flash2007-43.doc | Department of Energy

    Office of Environmental Management (EM)

    43.doc Microsoft Word - Flash2007-43.doc Microsoft Word - Flash2007-43.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash...

  12. al99-06attachment.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    attachment.doc&0; al99-06attachment.doc&0; PDF icon al99-06attachment.doc&0; More Documents & Publications Microsoft Word - AL2000-05Attachment.doc Microsoft Word - NSRC...

  13. Microsoft Word - FWP- Fact Sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FWP- Fact Sheet.doc Microsoft Word - FWP- Fact Sheet.doc PDF icon Microsoft Word - FWP- Fact Sheet.doc More Documents & Publications Microsoft Word - FOA cover sheet.doc Microsoft ...

  14. Microsoft Word - AL2005-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2005-10.doc Microsoft Word - AL2005-10.doc Microsoft Word - AL2005-10.doc (133.11 KB) More Documents & Publications Microsoft Word - AL2005-16.doc Audit Report: IG-0860 Microsoft ...

  15. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    SAR.doc Microsoft Word - PeerReviewSAR.doc Microsoft Word - PeerReviewSAR.doc (13.47 KB) More Documents & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross ...

  16. Microsoft Word - al2007-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    al2007-11.doc Microsoft Word - al2007-11.doc PDF icon Microsoft Word - al2007-11.doc More Documents & Publications Acquisition Letter: AL2005-08 Microsoft Word - al2004-03.doc OPAM...

  17. Flash2007-33DomesticDeliveryParticipatingAgencies.doc

    Energy Savers

    Securities and Exchange Commission 900,500.00 13 Department of TransportationFederal Motor Carrier Safety Administration 252,027.08 14 Pension Benefit Guaranty Corporation ...

  18. Microsoft Word - FOIA NOT AGENCY RECORD RESPONSE.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    April 11, 2013 CERTIFIED MAIL Mr. Ryan Henry Law Offices of Ryan Henry, P.L.L.C. 1380 Pantheon Way, Suite 215 San Antonio, Texas 78232 Dear Mr. Henry: FREEDOM OF INFORMATION ACT REQUEST (FOI 2013-00782) This letter is in response to your electronic Freedom of Information Act (FOIA) request that you sent to the Department of Energy (DOE), Richland Operations Office (RL) requesting documents relating to the jobs performed by Dritherm International, Inc., from January 1, 1995, to present, including

  19. Microsoft Word - Matrixpart1.doc | Department of Energy (indexed) [DOE]

    Matrixpart1.doc More Documents & Publications Part 1, Clauses Prescribed in FAR Part 52 Microsoft Word - Matrixpart2.doc...

  20. csep_transcript_aspen.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications highperformanceleasingstrategiesforstateandlocalgovernments.doc Using Social Media to Engage the Community in Energy Efficiency Projects.doc ...

  1. csep_transcript_minneapolis.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications newguideforcommunityenergystrategicplanning.doc cseptranscriptaspen.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, ...

  2. csep_transcript_arlington.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Office document icon cseptranscriptarlington.doc More Documents & Publications Tools for Designing & Implementing Better Finance Programs financeprograms.doc financeprograms

  3. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    F Radiological Survey Procedures U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page F-3 F.1 Radiological Survey Procedures This section describes the actions and method used by the Monticello Legacy Management (LM) Representative when conducting radiological surveys for the purpose of identifying radiologically contaminated material and determining the Radium-226

  4. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    G Uranium Scanning Procedure U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page G-3 Uranium Scanning Procedure for Property MP-00211 1. Select a Ludlum Model 12 ratemeter with a 44-9 pancake Geiger-Mueller beta-gamma detector or equivalent instrument capable of meeting detection limit criteria. 2. Check that the ratemeter and the detector have calibration

  5. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Appendix H Procedures for the Transportation of Radioactive Materials U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page H-3 H1.0 Purpose The purpose of this procedure is to ensure that radioactive material is transported (1) using best management practices, (2) in compliance with U.S. Department of Transportation (DOT) requirements, and (3) with minimal risk to

  6. Microsoft Word - BEPA.doc

    National Nuclear Security Administration (NNSA)

    ... or other agreement pursuant to U.S. Fish and Wildlife Service Office of Law ... into cooperative agreements with State fish and wildlife agencies or other appropriate ...

  7. Microsoft Word - Chapter 11.doc

    National Nuclear Security Administration (NNSA)

    ... Continued Operation of the Department of EnergyNational Nuclear Security Administration ... Protection Agency), 2010c, The Green Book Nonattainment Areas for Criteria ...

  8. Microsoft Word - S05575_AP.doc

    Office of Legacy Management (LM)

    ... Department of Energy Annual Performance Report, Shiprock, New Mexico December 2009 Doc. ... groundwater from the interceptor drains and extraction wells is solar evaporation. ...

  9. Microsoft Word - Appendix-B.doc

    Office of Legacy Management (LM)

    1 Site Environmental Report May 2012 Doc. No. S08629 Page B-i Contents Abbreviations ................................................................................................................................. iii Measurement Abbreviations .......................................................................................................... iii References

  10. PIC DOC 01/08/11 ? SOS

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    PIC DOC 010811 - SOS Content Outline 1) Usable Quotes We shouldn't equate public involvement with meetings. Maynard Plahuta Meetings, of many kinds, are probably the most...

  11. Microsoft Word - S05527_VMR 2009.DOC

    Office of Legacy Management (LM)

    ... Wells - Golf Course and Residential, Near the Gunnison Site U.S. Department of Energy 2009 Verification Monitoring Report-Gunnison, Colorado, Processing Site August 2009 Doc. ...

  12. Microsoft Word - S06692_VMR.doc

    Office of Legacy Management (LM)

    ... DOE Monitoring Wells - Golf Course and Residential, Near the Gunnison Site ... Monitoring Report-Gunnison, Colorado, Processing Site U.S. Department of Energy Doc. No. ...

  13. Microsoft Word - S05914_MR.doc

    Office of Legacy Management (LM)

    ... Energy 2009 Groundwater Monitoring Report Project Shoal Area, CAU 447 March 2010 Doc. No. ... The contaminant boundary (Figure 2) is a probabilistic forecast of the maximum extent over ...

  14. Associate Research Physicist (Post Doc, Experimental Research...

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Post Doc, Experimental Research, NSTX-U, Radio Frequency Waves) Department: Research Staff: RM1 Requisition Number: 1500421 The Princeton Plasma Physics Laboratory (PPPL) seeks to...

  15. Microsoft Word - S07050_WM.doc

    Office of Legacy Management (LM)

    ... NI), Setaria viridis (green foxtail, UPL), Xanthium strumarium (cocklebur, FAC) Naturita-Monitoring Report for Wetland Area U.S. Department of Energy Doc. No. S07050 September ...

  16. Microsoft Word - AL2000-05.doc | Department of Energy

    Energy Savers

    .doc Microsoft Word - AL2000-05.doc PDF icon Microsoft Word - AL2000-05.doc More Documents & Publications al99-06.doc&0; Microsoft Word - AL2000-05Attachment.doc AL2004-01r2.pdf...

  17. transcript_pv_mapper.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    transcript_pv_mapper.doc transcript_pv_mapper.doc transcript_pv_mapper.doc transcript_pv_mapper.doc (74.5 KB) More Documents & Publications PVMapper: A Tool for Energy Siting transcript_jedi_model.doc 2009 National Electric Transmission Congestion Study - San Francisco Workshop

  18. Microsoft Word - AL2007-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    7-01.doc Microsoft Word - AL2007-01.doc Microsoft Word - AL2007-01.doc (151.65 KB) More Documents & Publications Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc Microsoft Word - Corp Impl Microsoft Word - AL2006-11

  19. Microsoft Word - FAL2004-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    4-03.doc Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-03.doc (538.96 KB) More Documents & Publications Microsoft Word - FAL2004-01.doc Financial Assistance Letter No. FAL 2006-04 Microsoft Word - FAL2006-04.doc

  20. Microsoft Word - Appendix N_Historical.doc

    Office of Legacy Management (LM)

    N Example Historical Marker and Plaque U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page N-3 Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page N-4

  1. Microsoft Word - AL2000-01.doc | Department of Energy

    Office of Environmental Management (EM)

    AL2000-01.doc Microsoft Word - AL2000-01.doc PDF icon Microsoft Word - AL2000-01.doc More Documents & Publications ALFAL 99-01 Department of Energy No Microsoft Word -...

  2. Microsoft Word - AL2008-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2008-06.doc Microsoft Word - AL2008-06.doc PDF icon Microsoft Word - AL2008-06.doc More Documents & Publications Chapter 9 - Contracting Qualifications Microsoft Word - PART...

  3. Microsoft Word - 99-04.doc | Department of Energy (indexed) [DOE]

    Word - 99-04.doc More Documents & Publications Policy Flash 2014-18 Complex-Wide Strategic Sourcing Microsoft Word - AL2000-01.doc Microsoft Word - AL2005-11.doc...

  4. Microsoft Word - AL2006-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    0.doc Microsoft Word - AL2006-10.doc PDF icon AL2006-10 More Documents & Publications Microsoft Word - Matrixpart2.doc Microsoft Word - AcqGuide70pt52Matrixpart2Redo...

  5. Microsoft Word - AL2004-02.doc | Department of Energy (indexed) [DOE]

    Microsoft Word - AL2004-02.doc More Documents & Publications Microsoft Word - AL2005-02.doc Microsoft Word - al2005-04.doc Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all...

  6. Microsoft Word - al95-06.doc | Department of Energy

    Energy Savers

    5-06.doc Microsoft Word - al95-06.doc PDF icon Microsoft Word - al95-06.doc More Documents & Publications ppl970-1.pdf Audit Report: IG-0589 Inspection Report: INS-O-02-01...

  7. Microsoft Word - meritrev.doc | Department of Energy

    Energy Savers

    Microsoft Word - meritrev.doc Microsoft Word - meritrev.doc PDF icon Microsoft Word - meritrev.doc More Documents & Publications Policy Flash 2013-38 Revised Merit Review Guide For...

  8. Microsoft Word - al95-14.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    al95-14.doc Microsoft Word - al95-14.doc PDF icon Microsoft Word - al95-14.doc More Documents & Publications Cooperation with the New Independent States of the Former Soviet Union ...

  9. Microsoft Word - AL2006-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    7.doc Microsoft Word - AL2006-07.doc PDF icon Microsoft Word - AL2006-07.doc More Documents & Publications OPAM Policy Acquisition Guides Personal Property Management Certification ...

  10. Microsoft Word - FAC2005-27.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAC2005-27.doc Microsoft Word - FAC2005-27.doc PDF icon Microsoft Word - FAC2005-27.doc More Documents & Publications Policy Flash 2015-07 - FAC 2005-78 Policy Flash Search Listing ...

  11. Microsoft Word - al2005-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    - al2005-06.doc PDF icon Microsoft Word - al2005-06.doc More Documents & Publications Microsoft Word - AL2006-01.doc OPAM Policy Acquisition Guides Acquisition Letter: AL2005-08...

  12. Microsoft Word - al96-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    6-09.doc Microsoft Word - al96-09.doc PDF icon Microsoft Word - al96-09.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis Chapter...

  13. Microsoft Word - AL2005-08.doc | Department of Energy

    Office of Environmental Management (EM)

    8.doc Microsoft Word - AL2005-08.doc Microsoft Word - AL2005-08.doc More Documents & Publications OPAM Policy Acquisition Guides Attachment FY2011-28 OPAM Microsoft Word -...

  14. Microsoft Word - FAC2005-19.doc | Department of Energy

    Office of Environmental Management (EM)

    FAC2005-19.doc Microsoft Word - FAC2005-19.doc Microsoft Word - FAC2005-19.doc More Documents & Publications Acquisitlon Letter No. AL 2008-06 AL2008-06.pdf fac2001-27.pdf...

  15. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word -...

  16. Microsoft Word - FORM46002.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    2.doc Microsoft Word - FORM46002.doc Microsoft Word - FORM46002.doc More Documents & Publications DOE F 4600.2 ATTACHMENT FLASH 2011-46(6) Attachment FY2011-63 OPAM...

  17. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc More Documents & Publications Microsoft Word - AL 2010-07 Acquistion Letters Remaining...

  18. Operating Guidelines Appendix C D.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Operating Guidelines Appendix C D.DOC&0; Operating Guidelines Appendix C D.DOC&0; PDF icon Operating Guidelines Appendix C D.DOC&0; More Documents & Publications Operating ...

  19. Microsoft Word - FAL2006-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAL2006-03.doc Microsoft Word - FAL2006-03.doc PDF icon Microsoft Word - FAL2006-03.doc More Documents & Publications Financial Assistance Letter No. FAL 2006-03 Microsoft Word - ...

  20. Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc |...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Speech 082508 FINAL.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc More Documents & Publications Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc ...

  1. Microsoft Word - 2005 FOIA ANNUAL REPORT.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    2005 FOIA ANNUAL REPORT.doc Microsoft Word - 2005 FOIA ANNUAL REPORT.doc report2005.pdf PDF icon Microsoft Word - 2005 FOIA ANNUAL REPORT.doc More Documents & Publications U.S. ...

  2. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2008-05.doc Microsoft Word - AL2008-05.doc PDF icon Microsoft Word - AL2008-05.doc More Documents & Publications Acquisition Letters Remaining In Effect Acquisition Letters ...

  3. Microsoft Word - Matrixpart2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Matrixpart2.doc Microsoft Word - Matrixpart2.doc PDF icon Microsoft Word - Matrixpart2.doc More Documents & Publications AcqGuide70.52Matrixpart2Redo-OPAM Microsoft Word - ...

  4. Microsoft Word - al2004-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    al2004-03.doc Microsoft Word - al2004-03.doc PDF icon Microsoft Word - al2004-03.doc More Documents & Publications Acquisition Letter: AL2005-08 OPAM Policy Acquisition Guides ...

  5. Microsoft Word - FY09PropertyBSCContractor.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FY09PropertyBSCContractor.doc Microsoft Word - FY09PropertyBSCContractor.doc PDF icon Microsoft Word - FY09PropertyBSCContractor.doc More Documents & Publications FY09 Property ...

  6. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAL2004-05.doc Microsoft Word - FAL2004-05.doc PDF icon Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word - Section ...

  7. Microsoft Word - Brochure_Senior Officials.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    BrochureSenior Officials.doc Microsoft Word - BrochureSenior Officials.doc Microsoft Word - BrochureSenior Officials.doc (29.28 KB) More Documents & Publications Preservation of ...

  8. Microsoft Word - CSATCourseCatalog_02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    CSATCourseCatalog02.doc Microsoft Word - CSATCourseCatalog02.doc classroom-1008856960720.jpg Microsoft Word - CSATCourseCatalog02.doc (554.38 KB) More Documents & Publications ...

  9. Microsoft Word - May2009.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    May2009.doc Microsoft Word - May2009.doc Microsoft Word - May2009.doc (6.77 MB) More Documents & Publications Special Resource StudyEnvironmental Assessment for Manhattan Project ...

  10. Property:NEPA TieredDoc | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    TieredDoc Jump to: navigation, search Property Name NEPA TieredDoc Property Type Page This is a property of type Page. Pages using the property "NEPA TieredDoc" Showing 25 pages...

  11. Microsoft Word - ARRAAttachment12v1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment12v1.doc More Documents & Publications Microsoft Word - DRAFT CRB Interview Guidance.doc Microsoft Word - ARRAGuideAttachment10v1

  12. Microsoft Word - AL2006-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2006-11.doc Microsoft Word - AL2006-11.doc PDF icon Microsoft Word - AL2006-11.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis...

  13. Microsoft Word - figure_03.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    Oil and Gas Reserves"; PointLogic Energy; Ventyx; and the Bureau of Safety and Environmental Enforcement, and predecessor agencies. IN OH TN WV VA KY MD PA NY VT NH MA CT ME RI ...

  14. Microsoft Word - references.doc

    Office of Legacy Management (LM)

    ... D.C., June 29. U.S. Environmental Protection Agency (EPA), 1995, "Compilation of Air Pollution Emission Factors," Volume 1, "Stationary Point and Area Sources," AP 42, 5th ...

  15. Operating Guidelines Appendix A B.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Operating Guidelines Appendix A B.DOC&#0; Operating Guidelines Appendix A B.DOC&#0; Operating Guidelines Appendix A B.DOC&#0; (73.17 KB) More Documents & Publications Operating Guidelines Appendix C D.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; DOE HR Guidebook 12_15_05.DOC&#0;

  16. Microsoft Word - CERFDOE Final Report - 071204.doc | Department...

    Office of Environmental Management (EM)

    Microsoft Word - CERFDOE Final Report - 071204.doc (394.42 KB) More Documents & Publications Integrated Project Team RM DOE EIR FM.doc Independent Oversight Activity Report, ...

  17. Microsoft Word - ADR-Provisions-FederalAcquisitionReg.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications ADR Provisions in Federal Acquisition Regulation (FAR) Microsoft Word - ACQUISITION LETTER.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc...

  18. Microsoft Word - AL2005-12.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon Microsoft Word - AL2005-12.doc More Documents & Publications Microsoft Word - AL2005-11.doc OPAM Policy Acquisition Guides Chapter 31 - Contract Cost Principles...

  19. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Energy Savers

    & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross Reference Matrix Introduction.doc Assessment of the Effects of Climate Change on Federal Hydropower...

  20. Design Potential of Metal Foil Substrates for Optimized DOC Performanc...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Design Potential of Metal Foil Substrates for Optimized DOC Performance Design Potential of Metal Foil Substrates for Optimized DOC Performance Poster presentation at the 2007 ...

  1. DOE EIR FM.doc | Department of Energy

    Office of Environmental Management (EM)

    EIR FM.doc PDF icon DOE EIR FM.doc More Documents & Publications Contractor Statement of Work (SOW) Template (for EIR) External Independent Review (EIR) Standard Operating...

  2. AcqGuide9pt3.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    taken by one agency are recognized and effective for all Executive Branch agencies. ... While in many agencies, the debarment and suspension function resides within the Office of ...

  3. Microsoft Word - S05949_IR.doc

    Office of Legacy Management (LM)

    ... erosion. 2.1.4 Pond 4 Pond 4 is a lined solar evaporation pond that collects water ... store U.S. Department of Energy 2009 Annual Inspection-Monticello, Utah December 2009 Doc. ...

  4. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    and Recovery Act Cleanups This page intentionally left blank U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. ...

  5. Form:NEPA Doc | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    NEPA Doc Jump to: navigation, search Input the name of a NEPA Document below. If the document already exists, you will be able to edit its information. AddEdit a NEPA Document...

  6. Microsoft Word - Appendix A_Background.doc

    Office of Legacy Management (LM)

    ... and Maintenance (LTSM) Program records at the DOE Grand ... Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. ... (DOE 2003c). The two communities closest to the Chemical ...

  7. Microsoft Word - Appendix A.doc

    Office of Legacy Management (LM)

    ... and Maintenance (LTSM) Program records at the DOE Grand ... Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. ... (DOE 2003c). The two communities closest to the Chemical ...

  8. Edwin Parks (Doc) | Department of Energy

    Office of Environmental Management (EM)

    Doc Parks has over 27 years of active-duty military service with the U.S. Air Force (USAF), serving a broad range of command and staff positions in nuclear operations policy, ...

  9. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    CO Site Safety Supervisor Joe Slade Contractor Monticello, UT LM Records Lead Cindy Smith Contractor Grand Junction, CO LM Records Coordinator Dianna Roberts Contractor Grand ...

  10. RetTrendReport1205.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    RetTrendReport1205.doc&#0; RetTrendReport1205.doc&#0; RetTrendReport1205.doc&#0; (2.58 MB) More Documents & Publications Pension Plans for Contractor Workers April 1-10 comments.doc&#0; POLICY GUIDANCE MEMORANDUM #39 Phased Retirement

  11. AcqGuide70pt5.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AcqGuide70pt5.doc&#0; AcqGuide70pt5.doc&#0; AcqGuide70pt5.doc&#0; (16.21 KB) More Documents & Publications Chapter 70.3102-05-6: Contractor Compensation - Variable Pay Policy Flash 2016-34 AcqGuide41pt1.doc&#0;

  12. Microsoft Word - Chapter 05 a.doc | Department of Energy

    Office of Environmental Management (EM)

    Microsoft Word - Chapter 05 a.doc Microsoft Word - Chapter 05 a.doc Microsoft Word - Chapter 05 a.doc (7.05 MB) More Documents & Publications Microsoft Word - Chapter 01.doc EIS-0426: Record of Decision EIS-0426: Final Environmental Impact Statement

  13. Microsoft Word - Chapter 01.doc | Department of Energy

    Office of Environmental Management (EM)

    Microsoft Word - Chapter 01.doc Microsoft Word - Chapter 01.doc Microsoft Word - Chapter 01.doc (10.76 MB) More Documents & Publications Microsoft Word - Chapter 05 a.doc EIS-0426: Record of Decision EIS-0426: Final Environmental Impact Statement

  14. DOC-DOE Joint China Mission Statement | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Joint China Mission Statement DOC-DOE Joint China Mission Statement DOC-DOE Joint China Mission Statement DOC-DOE Joint China Mission Statement (109.75 KB) More Documents & Publications DOC-DOE China Mission Announcement Press Release FACT SHEET: U.S.-China Clean Energy Cooperation Announcements US-China Clean Energy Cooperation

  15. expanding_chp_in_your_state.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc (130 KB) More Documents & Publications Combined Heat and Power: Expanding CHP in Your State Sustainable Energy Resources for Consumers (SERC) - Solar Hot Water Sustainable Energy Resources for Consumers (SERC) - Geothermal/Ground-Source Heat Pumps

  16. Microsoft Word - DOETTQuestions.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    DOETTQuestions.doc Microsoft Word - DOETTQuestions.doc Microsoft Word - DOETTQuestions.doc (48.9 KB) More Documents & Publications Microsoft Word - 73FR72036_UC signed 1&#0; Microsoft Word - SRNL Fed Register Response.doc Subcontractor Rights Under CRADAs and WFO Agreements

  17. Microsoft Word - FAL2006-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAL2006-04.doc Microsoft Word - FAL2006-04.doc Microsoft Word - FAL2006-04.doc (74.69 KB) More Documents & Publications Financial Assistance Letter No. FAL 2006-04 Microsoft Word - AL2006-03.doc Microsoft Word - FAL2004-01

  18. Microsoft Word - Federal Register Response _Jan09_.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Federal Register Response _Jan09_.doc Microsoft Word - Federal Register Response _Jan09_.doc Microsoft Word - Federal Register Response _Jan09_.doc (13.88 KB) More Documents & Publications Microsoft Word - Document2 Microsoft Word - Intellectual Property Provisions _NRD-1003_.doc Microsoft Word - ARRAAttachment12v1

  19. Microsoft Word - Final Sample Participant Profile November 2008.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Final Sample Participant Profile November 2008.doc Microsoft Word - Final Sample Participant Profile November 2008.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - DRAFT CRB Interview Guidance

  20. Microsoft Word - PART 970.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PART 970.doc Microsoft Word - PART 970.doc Microsoft Word - PART 970.doc (1.03 MB) More Documents & Publications Searchable Electronic Department of Energy Acquisition Regulation Microsoft Word - Matrixpart2.doc AcqGuide70.52Matrixpart2Redo-OPAM

  1. Microsoft Word - master.doc

    Gasoline and Diesel Fuel Update

    9 (Released January 8, 1999) Energy Information Administration DOE/EIA-0202(99/1Q) Distribution Category UC-950 Short-Term Energy Outlook January 1999 Energy Information Administration Office of Energy Markets and End Use U.S. Department of Energy Washington, DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the U.S. Department of Energy. The information contained herein should be attributed to the Energy

  2. Microsoft Word - S0171500.doc

    Office of Legacy Management (LM)

    DOE-LM/GJ850-2005 ESL-RPT-2005-03 Alternatives for Mending a Permeable Reactive Barrier at a Former Uranium Milling Site: Monticello, Utah April 2005 Prepared for U. S. Environmental Protection Agency Region 8, Denver, Colorado Under Interagency Agreement DW89953767018 By U. S. Department of Energy Grand Junction, Colorado Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado

  3. Habadv#165 RCBRA.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    5 Subject: River Corridor Baseline Risk Assessment (RCBRA) Adopted: September 10, 2004 Page 1 September 10, 2004 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Ron Kreizeneeck, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Linda Hoffman, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Subject: Risk Assessment Work Plan for the 100 Area

  4. Microsoft Word - figure_03.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    0 U.S. Energy Information Administration | Natural Gas Annual Figure 3. Marketed production of natural gas in the United States and the Gulf of Mexico, 2014 (million cubic feet) None 1-15,000 15,001-100,000 100,001-200,000 200,001-500,000 500,001 and over Sources: Energy Information Administration (EIA), Form EIA-895, "Annual Quantity and Value of Natural Gas Report"; Form EIA-914, "Monthly Natural Gas Production Report"; state agencies; Form EIA-23, "Annual Survey of

  5. AcqGuide42pt3.doc | Department of Energy

    Office of Environmental Management (EM)

    1pt1.doc&#0; AcqGuide41pt1.doc&#0; AcqGuide41pt1.doc&#0; (13.23 KB) More Documents & Publications Chapter 41 - Acquisition of Utility Services Policy Flash 2016-31 Chapter 41: Utilities

    2pt3.doc&#0; AcqGuide42pt3.doc&#0; AcqGuide42pt3.doc&#0; (56.38 KB) More Documents & Publications Chapter 42 - Contract Administration Acquisition Guide Chapter 42.1202 - Novation Agreements Chapter 9.2: Performance Guarantees

  6. Microsoft Word - Clay Memo PMC Coburn Obama 11_9_06.doc | Department...

    Office of Environmental Management (EM)

    Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc More Documents & Publications...

  7. Microsoft Word - DP_cover_and_front matter_FINAL1.DOC | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FINAL1.DOC Microsoft Word - DPcoverandfront matterFINAL1.DOC PDF icon Microsoft Word - DPcoverandfront matterFINAL1.DOC More Documents & Publications Microsoft Word - ...

  8. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc PDF icon Microsoft Word - TSLCC 200750508 rev 1.doc More Documents & Publications FY 2007 Total System ...

  9. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of...

    Office of Environmental Management (EM)

    TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc More Documents & Publications FY 2007 Total System Life...

  10. Microsoft Word - APPENDIX E flysheet.doc

    National Nuclear Security Administration (NNSA)

    ... and potential impacts of these activities were assessed using standard methods endorsed by the U.S. Environmental Protection Agency (EPA) and local air pollution control agencies. ...

  11. Microsoft Word - Highlights.doc

    Gasoline and Diesel Fuel Update

    08 1 December 2008 Short-Term Energy Outlook December 9, 2008 Release Highlights The current global economic slowdown is now projected to be more severe and longer than in last month's Outlook, leading to further reductions of global energy demand and additional declines in crude oil and other energy prices. The monthly average price of West Texas Intermediate (WTI) crude oil has fallen by more than half between July and November, reflecting the fallout from the rapid decline in world petroleum

  12. Microsoft Word - Highlights.doc

    Gasoline and Diesel Fuel Update

    7 1 February 2007 Short-Term Energy Outlook February 6, 2007 Release (Next Update: March 6, 2007) Highlights * The unseasonably warm temperatures in the United States and throughout most of the northern hemisphere through early January reduced the demand for heating fuels, leading to an easing of petroleum and natural gas prices. Between mid-December 2006 and January 18, 2007, the spot price of West Texas Intermediate (WTI) crude oil fell by about $12 per barrel to a low of $50.51 per barrel.

  13. Microsoft Word - Highlights.doc

    Gasoline and Diesel Fuel Update

    May 2010 1 May 2010 Short-Term Energy Outlook May 11, 2010 Release Highlights  EIA projects U.S. real gross domestic product (GDP) will grow by 3.0 percent and world real oil-consumption-weighted GDP will increase by 3.6 percent in 2010, both of which are 0.2 percent higher than in the previous Outlook. The 2011 forecast for real GDP growth is at 2.9 percent and 3.7 percent for the United States and the world, respectively.  The more optimistic economic growth forecasts lead to an increase

  14. AcqGuide39pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon AcqGuide39pt1.doc&0; More Documents & Publications Chapter 39 - Acquisition of Information Technology AcqGuide38pt1.doc&0; Microsoft Word - AcqGuide16pt1...

  15. AcqGuide70pt31.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon AcqGuide70pt31.doc&0; More Documents & Publications Microsoft Word - AcqGuide70pt31A.doc Policy Flash 2014-26 Acquisition Guide Chapter 70.31A - Costs...

  16. AcqGuide47pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AcqGuide47pt1.doc&0; PDF icon AcqGuide47pt1.doc&0; More Documents & Publications Chapter 47 - Transportation TEC Working Group Topic Groups Manual Review Key Documents ...

  17. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    22.62 KB) More Documents & Publications Microsoft Word - FOA cover sheet.doc Recovery Act, Office of the Biomass Program,Funding Opportunity Announcements Special Notice Microsoft Word - FOA cover sheet.doc

  18. csep_transcript_transportation.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications cseptranscriptminneapolis.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, 2011 (Text Version) Transcript: Biomass ...

  19. comm_pace_updates_field_resources_prog_design_implementation.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy comm_pace_updates_field_resources_prog_design_implementation.doc comm_pace_updates_field_resources_prog_design_implementation.doc comm_pace_updates_field_resources_prog_design_implementation.doc comm_pace_updates_field_resources_prog_design_implementation.doc (126.5 KB) More Documents & Publications Commercial PACE: Updates from the Field & New Resources for Design and Implementation Combined Heat and Power: Expanding CHP in Your State expanding_chp_in_your_state

  20. 20130226_sunshot_transcript_lbnl.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc (73.5 KB) More Documents & Publications Why Are Resiential PV Prices in Germany So Much Lower Than in the United States? text_alternative_stat_webinar_2012_7_25.docx An Analysis of Residential PV System Price Differences between the United States and Germany

  1. DOCS System Configuration Management Plan | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    DOCS System Configuration Management Plan DOCS System Configuration Management Plan The DOCS Systems Configuration Management Plan (SCMP), from an actual DOE systems engineering project, can be used as a template to facilitate the creation of the CMP for your particular project. DOCS System Configuration Management Plan (654.98 KB) More Documents & Publications OPC Security Whitepaper #3Hardening Guidelines for OPC Hosts NMMSS Software Quality Assurance Plan ABB SCADA/EMS System INEEL


    SciTech Connect (OSTI)



    This paper documents Fluor Hanford's use of Leading Indicators, management leadership, and statistical methodology in order to improve safe performance of work. By applying these methods, Fluor Hanford achieved a significant reduction in injury rates in 2003 and 2004, and the improvement continues today. The integration of data, leadership, and teamwork pays off with improved safety performance and credibility with the customer. The use of Statistical Process Control, Pareto Charts, and Systems Thinking and their effect on management decisions and employee involvement are discussed. Included are practical examples of choosing leading indicators. A statistically based color coded dashboard presentation system methodology is provided. These tools, management theories and methods, coupled with involved leadership and employee efforts, directly led to significant improvements in worker safety and health, and environmental protection and restoration at one of the nation's largest nuclear cleanup sites.

  3. CompleteProject List.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    CompleteProject List.doc&#0; CompleteProject List.doc&#0; CompleteProject List.doc&#0; (9.47 KB) More Documents & Publications Tribal Energy Program February 2012 Award Project Descriptions CX-008525: Categorical Exclusion Determination 2010 Program Review Meeting

  4. AcqGuide41pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1pt1.doc&#0; AcqGuide41pt1.doc&#0; AcqGuide41pt1.doc&#0; (13.23 KB) More Documents & Publications Chapter 41 - Acquisition of Utility Services Policy Flash 2016-31 Chapter 41: Utilities

  5. AcqGuide9pt2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AcqGuide9pt2.doc&#0; AcqGuide9pt2.doc&#0; AcqGuide9pt2.doc&#0; (16.88 KB) More Documents & Publications Chapter 9.2: Performance Guarantees Policy Flash 2016-32 Chapter 9 - Contracting Qualifications

  6. Microsoft Word - AL2003-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    3-04.doc Microsoft Word - AL2003-04.doc Microsoft Word - AL2003-04.doc (254.1 KB) More Documents & Publications AL2004-01r2.pdf City of Tulare Renewable Biogas Fuel Cell Project

  7. Microsoft Word - LibraryofPriorRulemakings.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    LibraryofPriorRulemakings.doc Microsoft Word - LibraryofPriorRulemakings.doc Microsoft Word - LibraryofPriorRulemakings.doc (28.89 KB) More Documents & Publications Solar Background Document 1 Natural Gas Imports and Exports First Quarter Report 2014 Natural Gas Imports and Exports Second Quarter Report 2014

  8. Microsoft Word - Political Activity and the Federal Employee.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Political Activity and the Federal Employee.doc Microsoft Word - Political Activity and the Federal Employee.doc Microsoft Word - Political Activity and the Federal Employee.doc (165.92 KB) More Documents & Publications Political Activity at DOE Facilities by DOE Contractors Audit Report: IG-0473 PROCESSING INVITATIONS FOR A PRESIDENTIAL APPOINTEE

  9. Microsoft Word - competitionincontractingguidev2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc (215.28 KB) More Documents & Publications AcqGuide 5.2-OPAM Acquisition Guide, Chapter 6.1, Competition Requirements Microsoft Word - AG Chapter 6 1 Nov 2010

  10. Microsoft Word - fal2004-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    fal2004-04.doc Microsoft Word - fal2004-04.doc Microsoft Word - fal2004-04.doc (132.28 KB) More Documents & Publications U.S. Department of Energy - Guide to Financial Assistance - Audit Requirements for For-Profit Organizations Financial Assistance Guide (2013) Revised Guide for Financial Assistance

  11. AcqGuide3pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    pt1.doc&0; AcqGuide3pt1.doc&0; PDF icon AcqGuide3pt1.doc&0; More Documents & Publications POLICY FLASH 2016-04 Procurement Integrity PI Brief 6 15 07 final2&0;

  12. Microsoft Word - FY08AnnualReport.doc | Department of Energy

    Office of Environmental Management (EM)

    FY08AnnualReport.doc Microsoft Word - FY08AnnualReport.doc PDF icon Microsoft Word - FY08AnnualReport.doc More Documents & Publications Microsoft Word - FY09AnnualReportv1.doc...

  13. Microsoft Word - AL2005-05Revised.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2005-05Revised.doc Microsoft Word - AL2005-05Revised.doc PDF icon Microsoft Word - AL2005-05Revised.doc More Documents & Publications AL2007-03.doc&0; 2011-31 Attachment...

  14. Microsoft Word - ALonEO13423Last.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ALonEO13423Last.doc Microsoft Word - ALonEO13423Last.doc PDF icon Microsoft Word - ALonEO13423Last.doc More Documents & Publications Microsoft Word - AL2008-05.doc Tri-Party ...

  15. Microsoft Word - ITSI award doc 06-D0008 conformed to P00001...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ITSI award doc 06-D0008 conformed to P00001.doc Microsoft Word - ITSI award doc 06-D0008 conformed to P00001.doc More Documents & Publications Policy Flash 2015-02 Acquisition ...

  16. Microsoft Word - Flash2008-09Attachment.doc | Department of Energy (indexed) [DOE]

    9Attachment.doc More Documents & Publications Flash2007-02Attachment.doc&0; Microsoft Word - AL2000-05Attachment.doc Flash2007-03Attachment.doc&0;...

  17. Microsoft Word - Policy Flash 2008-04.doc | Department of Energy

    Office of Environmental Management (EM)

    4.doc Microsoft Word - Policy Flash 2008-04.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  18. Microsoft Word - Policy Flash 2008-06.doc | Department of Energy

    Office of Environmental Management (EM)

    6.doc Microsoft Word - Policy Flash 2008-06.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  19. Microsoft Word - AL2000-05Attachment.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Attachment.doc Microsoft Word - AL2000-05Attachment.doc PDF icon Microsoft Word - AL2000-05Attachment.doc More Documents & Publications al99-06attachment.doc&0; EXHIBIT A: CRADA,...

  20. Microsoft Word - DRAFT CRB Interview Guidance.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    DRAFT CRB Interview Guidance.doc Microsoft Word - DRAFT CRB Interview Guidance.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc Microsoft Word - Document2

  1. Microsoft Word - Policy Flash 2008-07.doc | Department of Energy

    Office of Environmental Management (EM)

    07.doc Microsoft Word - Policy Flash 2008-07.doc More Documents & Publications Microsoft Word - Policy Flash 2008-10...

  2. Microsoft Word - Policy Flash 2008-10.doc | Department of Energy

    Office of Environmental Management (EM)

    10.doc Microsoft Word - Policy Flash 2008-10.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07...

  3. Microsoft Word - S03736_ FMP010609.doc

    Office of Legacy Management (LM)

    Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 LMS/CNT/S03736 This page intentionally left blank LMS/CNT/S03736 Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 This page intentionally left blank U.S. Department of Energy Fluid Management Plan For CAU 443: CNTA, Subsurface, Nevada January 2009 Doc. No. S0373600 Page i Contents Acronyms and Abbreviations

  4. Microsoft Word - S04019_GSB.doc

    Office of Legacy Management (LM)

    Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 LMS/GSB/S04019 This page intentionally left blank LMS/GSB/S04019 Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 This page intentionally left blank U.S. Department of Energy Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009, Rev. 3 Doc. No. S04019 Page i Contents Abbreviations

  5. Microsoft Word - S06178_MP.doc

    Office of Legacy Management (LM)

    Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited LMS/RUL/S06178 This page intentionally left blank LMS/RUL/S06178 Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited This page intentionally left blank U.S. Department of Energy Rulison Monitoring Plan July 2010 Doc. No. S06178 Page i Contents 1.0

  6. Microsoft Word - S06596_GW.doc

    Office of Legacy Management (LM)

    Annual Groundwater Report May 2009 through April 2010 September 2010 LMS/MNT/S06596 This page intentionally left blank LMS/MNT/S06596 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report May 2009 through April 2010 September 2010 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report May 2009-April 2010 September 2010 Doc. No. S06596 Page i Contents

  7. Microsoft Word - S05428_VMR.doc

    Office of Legacy Management (LM)

    Slick Rock, Colorado, Processing Sites 2008 and 2009 Update July 2010 LMS/SRE-SRW/S05428 This page intentionally left blank LMS/SRE-SRW/S05428 Verification Monitoring Report for the Slick Rock, Colorado, Processing Sites 2008 and 2009 Update July 2010 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report-Slick Rock, Colorado, 2008 and 2009 Update July 2010 Doc. No. S05428 Page i Contents

  8. AcqGuide42pt1.doc

    Energy Savers

    1.1 (March 2004) 1 Acquisition Regulations System [Reference: FAR 1; DEAR 901; DOE O 541.1] Overview This section discusses the Civilian Agency Acquisition Council, agency acquisition regulations, deviations from the FAR and DEAR, ratification of unauthorized commitments, and Contracting Officers and their representatives. The Civilian Agency Acquisition Council The DOE representative to the Civilian Agency Acquisition Council is a staff member of the Office of Procurement and Assistance Policy,

  9. Microsoft Word - 20111012_RAP Dec_Mtg_Topics.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    October12, 2011 1/2 Potential December RAP Committee Meeting Agenda Topics Topic/Purpose (incl. any framing questions) 2012 Priority? Issue Managers (* denotes lead) Agency Lead (s) Time Allocation 618-10&11 * Characterization (bottles) * Etc. TBD TBD TBD 60 min (30 min) 100 - K * What RAP will do based on review of Proposed Plan * River Corridor decisions - schedule * In situ technology development - status * Discuss potential concerns (advice points?) TBD TBD TBD 120 min Site-wide Permit *

  10. [Agency Name]

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    3, 2012 1. Introduction The Department of Energy sees the implementation of the Plain Writing Act as an important initiative that helps the Department share relevant information in a way that is clear, concise, and informative. The areas referenced in this report are only a few of the successes we have encountered as we continue to implement the Act. 1. Departmental Plain Writing Officials 2. Ingrid Kolb, Director of the Office of Management, Senior Agency Official Responsible for Plain Writing

  11. [Agency Name]

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Plain Writing Compliance Report | page 1 I. SENIOR AGENCY OFFICIAL FOR PLAIN WRITING Senior Official for Plain Writing: Ingrid Kolb Director, Office of Management Plain Writing Implementation Contact: Michael Coogan Office of the Executive Secretariat II. TO DATE, DEPARTMENT OF ENERGY (DOE) COMMUNICATIONS RELEASED IN PLAIN LANGUAGE * DOE website overhaul includes a focus on Plain Writing, geared toward the public and DOE employees. * DOE Powerpedia Page (DOE's internal Wikipedia site) shares

  12. Microsoft Word - 6-19-06 TEC NOTES.doc

    Office of Environmental Management (EM)

    48D7DF19-707E-28B27A.doc Microsoft Word - 48D7DF19-707E-28B27A.doc Microsoft Word - 48D7DF19-707E-28B27A.doc (126.75 KB) More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - GSP_Charter.doc Department of Energy

    564M_Biomass_Project Descriptions FINAL 120409 Microsoft Word - 564M_Biomass_Project Descriptions FINAL 120409 Microsoft Word - 564M_Biomass_Project Descriptions FINAL 120409 (100.66

  13. International Energy Agency [DOE]

    DOE's market transformation efforts have reached to European and other countries who are part of the international distributed and decentralized energy community. Through its partnership with DOE, the combined heat and power (CHP) program of the International Energy Agency (IEA) conducts research and analysis of CHP markets and deployment efforts around the world and has used lessons learned from U.S. research, development, and deployment efforts to recommend market transformation activities and policies that will lead to new CHP installations worldwide.

  14. Microsoft Word - S03273_Rev1.doc

    Office of Legacy Management (LM)

    Surface, Hot Creek Valley, Nevada, for Calendar Year 2007 September 2008 Rev. 1 DOE-LM/1558-2007 This page intentionally left blank DOE-LM/1558-2008 Post-Closure Inspection and Monitoring Report for Corrective Action Unit 417: Central Nevada Test Area Surface, Hot Creek Valley, Nevada for Calendar Year 2007 September 2008 Rev. 1 This page intentionally left blank U.S. Department of Energy CY 2007 Post-Closure Inspection & Monitoring Report for CAU 417 September 2008, Rev. 1 Doc. No. S0327300

  15. Microsoft Word - S05069_ROD.doc

    Office of Legacy Management (LM)

    Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 LMS/LEH/S05069 This page intentionally left blank LMS/LEH/S05069 Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 This page intentionally left blank U.S. Department of Energy ROD for DOE Areas for LEHR September 2009 Doc. No. S05069, Rev. 0 Page i Contents Acronyms and Abbreviations

  16. Microsoft Word - U0194500July2005.doc

    Office of Legacy Management (LM)

    4500 GJO-2004-579-TAC Office of Legacy Management Refinement of Conceptual Model and Recommendations for Improving Remediation Efficiency at the Shiprock, New Mexico, Site July 2005 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Conceptual Model Refinement and Efficiency Recommendations July 2005 Doc. No.

  17. Microsoft Word - Report Cover.doc

    Office of Environmental Management (EM)

    on Smart Grid RFI RedSeal Systems, Inc. 1 October 29, 2010 Office of Electricity Delivery and Energy Reliability US Department of Energy Room 8H033 1000 Independence Avenue, SW Washington, DC 20585 Re: Comments on "Smart Grid RFI: Addressing Policy and Logistical Challenges" 75 FR 57006 [FR Doc. 2010-23251] From: Steve Dauber Vice-President, Marketing RedSeal Systems 2121 South El Camino Real, Suite 300 San Mateo, CA 94403 Ph: 650-645-6209 RedSeal

  18. Microsoft Word - Renew the Parks.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    cost of PV systems was the biggest concern. To overcome this barrier, the National Park Service will have to form partnerships with other agencies and groups. Potential...

  19. Microsoft Word - Transportation pdf.doc

    National Nuclear Security Administration (NNSA)

    ... These regulations interpret the terms of NEPA and define the ... the less extensive the search for alternatives an agency ... 1995), where the user can enter the pertinent accident ...

  20. M-90-03-02.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    of Hanford Federal Facility Agreement and Consent Order (HFFACO) requirements M-90-10 and M-90- 11 to accelerate joint agency decisions and schedule establishment...

  1. Microsoft Word - Grant Rating Sheet.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    No Proposed project supports agency education objectives-increasing understanding, awareness and appreciation of the Columbia River system and its many uses? Does it enhance the...

  2. AcqGuide38pt1.doc (indexed) [DOE]

    the competitive nature of the purchase. Must agencies conduct Procurement Planning and Market Research before using an FSS contract? Not necessarily. As a general rule, obtaining...

  3. pocforms06a0399.doc | Department of Energy (indexed) [DOE]

    More Documents & Publications fleetappforms04f1298.doc&0; OPC Security Whitepaper 3Hardening Guidelines for OPC Hosts Critical Decision 2 (CD-2) Approval Template...

  4. transcript_jedi_model.doc | Department of Energy (indexed) [DOE]

    document icon transcriptjedimodel.doc More Documents & Publications TAP Webcast Transcript July-29, 2009 Scenario Jedi Tools for Designing & Implementing Better Finance Programs

  5. Microsoft Word - al2006-12.doc | Department of Energy (indexed) [DOE]

    Microsoft Word - al2006-12.doc More Documents & Publications Acquisition Letter No. AL 2008-02 Department of Energy Special Report: DOEIG-0934...

  6. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    A NRC Concurrence with Completion of Remedial Action This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page A-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No.

  7. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    Real Estate Documentation This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page B-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page B-6

  8. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    09 Doc. No. S05767 Page A-1 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page A-2 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page A-3 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page A-4 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009

  9. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    Response to Comments This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page G-1 Well Completion Report for CAU 443 CNTA U.S. Department of Energy Doc. No. S05827 December 2009 Page G-2 U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page G-3 Well Completion Report for CAU 443 CNTA U.S. Department of Energy Doc. No. S05827 December 2009 Page G-4

  10. Enter the Post-Doc: The Untapped Sourcing Pipeline

    SciTech Connect (OSTI)

    Boscow, Ryan B.


    This article addresses the potential formulation and utilization of an industry-based Post-Doc program in order to create workforce candidate pipelines with targeted universities.

  11. Effectiveness of a Diesel Oxidation Catalyst (DOC) to control...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion Effectiveness of a ...

  12. Microsoft Word - 8E2A4440.doc (indexed) [DOE]

    48D7DF19-707E-28B27A.doc (126.75 KB) More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - GSP_Charter.doc

    Grant Amount Non-Fed Amount Project Location (City) Project Location (State) Description 1) Pilot and Demonstration Scale FOA - Pilot Scale Algenol Biofuels Inc. $25,000,000 $33,915,478 Freeport TX This project will make ethanol directly from carbon dioxide and seawater using algae. The

  13. Microsoft Word - AL2006-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon Microsoft Word - AL2006-09.doc More Documents & Publications Microsoft PowerPoint - Executive Order13423rbl Sample Contract Language for Construction Using ...

  14. Microsoft Word - S05837_FFA 4th qtr 09.doc

    Office of Legacy Management (LM)

    ... - - - -- - -- -- ,Additional Quarterly Sun*cillancc RcquircHcnts Note: All ... Sites FFA Quarterly Report: July 1-September 30, 2009 U.S. Department of Energy Doc. No. ...

  15. Microsoft Word - DOE_Staffing_Study_Cover.doc | Department of...

    Office of Environmental Management (EM)

    Word - DOEStaffingStudyCover.doc More Documents & Publications 2010 DOE Strategic Sustainability Performance Plan - Report to the White House Council on Environmental...

  16. Microsoft Word - FFATA Memo 30 March 2007.doc | Department of... (indexed) [DOE]

    FFATA Memo 30 March 2007.doc More Documents & Publications Policy Flash 2014-35 Rescission of American Recovery and Reinvestment Act Reporting Requirements. Flash2008-44attachment....

  17. Microsoft Word - S04268_Mar07 thru Mar08.doc

    Office of Legacy Management (LM)

    ... molybdenum, nitrate, selenium, sulfate, and uranium (DOE 1999). Restoration standards (see Table 1) for these Tuba City Annual Performance Evaluation U.S. Department of Energy Doc. ...

  18. Doc Cambell's Post Greenhouse Low Temperature Geothermal Facility...

    Open Energy Information (Open El) [EERE & EIA]

    Low Temperature Geothermal Facility Facility Doc Cambell's Post Sector Geothermal energy Type Greenhouse Location Las Cruces, New Mexico Coordinates 32.3123157,...

  19. Microsoft Word - AcqGuide71pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1pt1.doc Microsoft Word - AcqGuide71pt1.doc PDF icon Microsoft Word - AcqGuide71pt1.doc More Documents & Publications Chapter 71 - Review and Approval of Contract and Financial ...

  20. Microsoft Word - AcqGuide7pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    pt1.doc Microsoft Word - AcqGuide7pt1.doc ACQUISITION PLANNING PDF icon Microsoft Word - AcqGuide7pt1.doc More Documents & Publications ACQUISITION PLANNING Policy Flash 2015-13 ...

  1. Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc | Department...

    Energy Savers

    ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc More Documents & Publications Microsoft Word -...

  2. Microsoft Word - Flash2009dashxxFAC34.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc More Documents & Publications Federal Acquisition Regulation; Federal...

  3. Microsoft Word - Flash2008-08attachmentFAC22.doc | Department...

    Energy Savers

    Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc More Documents & Publications Policy Flash 2013-75...

  4. Microsoft Word - Flash2007-61FACAttachment.doc | Department of...

    Energy Savers

    Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc More Documents & Publications Microsoft Word -...

  5. Microsoft Word - PolicyFlash2007-10Attch2.doc | Department of...

    Energy Savers

    PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc More Documents & Publications Policy Flash 2013-37 Federal...

  6. Microsoft Word - Policy Flash 2008-02.doc | Department of Energy

    Energy Savers

    Microsoft Word - Policy Flash 2008-02.doc Microsoft Word - Policy Flash 2008-02.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  7. Microsoft Word - Policy Flash 2008-03.doc | Department of Energy

    Energy Savers

    Microsoft Word - Policy Flash 2008-03.doc Microsoft Word - Policy Flash 2008-03.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  8. Microsoft Word - NationalPolicyAssurances5-06.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    NationalPolicyAssurances5-06.doc Microsoft Word - NationalPolicyAssurances5-06.doc PDF icon Microsoft Word - NationalPolicyAssurances5-06.doc More Documents & Publications ...

  9. Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc |...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Press Release RECOMP 2-8-08 REV FINAL.doc Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc PDF icon Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc More ...

  10. Microsoft Word - FY10PropertyBSCFed.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PropertyBSCFed.doc Microsoft Word - FY10PropertyBSCFed.doc PDF icon Microsoft Word - FY10PropertyBSCFed.doc More Documents & Publications Microsoft Word - FY09PropertyBSCContractor...

  11. Microsoft Word - DP_cover_and_front matter_R1_Draft_3.DOC | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    R1Draft3.DOC Microsoft Word - DPcoverandfront matterR1Draft3.DOC PDF icon Microsoft Word - DPcoverandfront matterR1Draft3.DOC More Documents & Publications Microsoft ...

  12. Microsoft Word - ARRAGuideAttachment10v1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ARRAGuideAttachment10v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - DRAFT CRB Interview Guidance

  13. Microsoft Word - HABAdv#230_LTS.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    on record destruction and develop a plan to preserve historical records. The Board looks forward to continuing to work with the Tri-Party agencies to assist with the determination...

  14. Microsoft Word - HABAdv#219 ERDF.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Program Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd, Suite 115 (B1-46) Richland,...

  15. Flash2007-02Attachment.doc (indexed) [DOE]

    April 11, 2005 and April 17, 2006, requiring agencies to publish on the Government-wide point of entry (GPE) or e-Buy the documentation required by the FAR to support the use of...

  16. Microsoft Word - FAC2005-27.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    the Act contain the definitions of minority institution and Hispanic-serving institution. ... and comply with 8.405 and 16.505 in a report to the agency senior procurement ...

  17. Microsoft Word - ayers_jk.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Overview of National Aeronautics and Space Agency Langley Atmospheric Radiation Measurement Project Cloud Products and Validation J.K. Ayers, R. Palikonda, M. Khaiyer, D.R. Doelling, D.A. Spangenberg, M.L. Nordeen, D.N. Phan, and H. Yi Analytical Services and Materials, Inc. Hampton, Virginia P. Minnis and L. Nguyen National Aeronautics and Space Agency Langley Research Center Climate Science Branch Hampton, Virginia Q.Z. Trepte Science Applications International Corporation Hampton, Virginia

  18. Microsoft Word - PV Report v20.doc

    Gasoline and Diesel Fuel Update

    2 APPENDIX A FINAL EIA - Technology Forecast Updates - Residential and Commercial Building Technologies - Reference Case Presented to: U.S. Energy Information Administration Prepared by Navigant Consulting, Inc. 1200 19 St. NW, Suite 700 Washington, D.C. 20036 With SAIC 8301 Greensboro Drive McLean, VA 22102 March 2014 Final DISCLAIMER This presentation was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government, nor any agency

  19. DOE HR Guidebook 12_15_05.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    HR Guidebook 12_15_05.DOC&#0; DOE HR Guidebook 12_15_05.DOC&#0; DOE HR Guidebook 12_15_05.DOC&#0; (8.6 MB) More Documents & Publications Operating Guidelines Appendix A B.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; Operating Guidelines Appendix C D.DOC&#0;

  20. Project Summary-TES-SNL.doc. (Conference) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Project Summary-TES-SNL.doc. Citation Details In-Document Search Title: Project Summary-TES-SNL.doc. Abstract not provided. Authors: Siegel, Nathan Phillip Publication Date: ...

  1. Microsoft Word - US_Japan_REE_agenda_ver7.doc | Department of...

    Office of Environmental Management (EM)

    Microsoft Word - USJapanREEagendaver7.doc Microsoft Word - USJapanREEagendaver7.doc U.S. - Japan Roundtable on Rare Earth Elements Research PDF icon Microsoft Word -...

  2. Microsoft Word - FY11 DNWD Budget CJ_Draft_20100124.doc

    Energy Savers

    PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor.doc (59.07 KB) More Documents & Publications Microsoft Word - FY09PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCFed

    PropertyBSCFed.doc Microsoft Word - FY10PropertyBSCFed.doc Microsoft Word - FY10PropertyBSCFed.doc (59.02 KB) More Documents & Publications Microsoft Word - FY09PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor


  3. Microsoft Word - Appendix M_ContingencyTrees.doc

    Office of Legacy Management (LM)

    M Groundwater Operable Unit Contingency Trees U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page M-3 Figure M-1. Validation and Statistical Evaluation Scheme Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page M-4 Figure M-2. Decision Tree for Objective 1 Data U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page M-5 Figure M-3. Decision Tree for Objective 2 Data Weldon

  4. Microsoft Word - Annual Report 2006_Final.doc (indexed) [DOE]

    AcqGuide37pt1 binney Nov 2010 (201 KB) More Documents & Publications Chapter 37 - Service Contracting AcqGuide37pt1.doc&#0; Special Review: OAS-M-15-05

    AcqGuide70pt31A.doc (30.08 KB) More Documents & Publications AcqGuide70pt31.doc&#0; Acquisition Guide Chapter 70.31A - Costs Associated with Whistleblower Actions Acquisition Letter No. AL-2016-06

    0, Small Business Programs - An Overview Guiding Principles It is the policy of the Department of Energy to provide maximum

  5. Microsoft Word - S05993_CY2009 Annual Rpt.doc

    Office of Legacy Management (LM)

    ... of Site Surveillance and Maintenance Activities-CY 2009 U.S. Department of Energy Doc. No. ... Purpose Approval Date Status as of December 31, 2009 Phase II and III Upgrades to Solar ...

  6. Microsoft Word - ex1b-ITER-mar07.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    B - Patent Rights - Acquisition by the Government - ITER UT-B Contracts Div March 2007 Page 1 of 6 ex1b-ITER-mar07.doc Exhibit 1B ITER Ref: DEAR 952.227-13 PATENT RIGHTS - ...

  7. Microsoft Word - AL2005-13.doc | Department of Energy (indexed) [DOE]

    Microsoft Word - AL2005-13.doc More Documents & Publications PBA2007 Presentation-short-6-19-07DOE&0; Accident Investigation of the February 7, 2013, Scissor Lift Accident in the...

  8. Microsoft Word - S08266_App_A-3.doc

    Office of Legacy Management (LM)

    Score 0 Fernald Preserve, Ohio, Wetland Mitigation Monitoring Report U.S. Department of Energy Doc. No. S08266 Appendix A-3, 2011 Amphibian Index of Biotic Integrity Data...

  9. Microsoft Word - Appendix B_RiskAssessmenr.doc

    Office of Legacy Management (LM)

    ... U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page ... if ingested at frequencies and amounts similar to those of residential use (DOE 1997). ...

  10. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    NRC Technical Evaluation Report on Revised LTSP This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. ...

  11. Microsoft Word - N01058_LTSM Plan.doc

    Office of Legacy Management (LM)

    ... for the Pinellas Site U.S. Department of Energy Doc. No. ... replaced by an aboveground system that currently is in use (DOE 1997b). The Old Drum Storage Site is located at the ...

  12. Microsoft Word - VI_12_Degrees Awarded 2015.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    nuclear systems A. Bonasera Post Doc. at INFN - Laboratori Nazionali del Sud, Catania, Italy STUDENTS WHO RECEIVED GRADUATE DEGREES FROM NON-THESIS April 1, 2014 - March 31, 2015 ...

  13. Microsoft Word - Appendix D_LegalDescription.doc

    Office of Legacy Management (LM)

    for the Chemical Plant Area Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page D-4 Legal Description for the Chemical Plant Area All that ...

  14. Microsoft Word - Appendix G_DistributionList.doc

    Office of Legacy Management (LM)

    ... Jefferson City, MO 65102-0180 Ms. Cynthia Green, Realty Specialist Missouri Department of ... Jefferson City, MO 65102 Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. ...

  15. Microsoft Word - S04801_Avian2008 _2_ revised.doc

    Office of Legacy Management (LM)

    ... Swallows were observed throughout the spring and summer. Violet-green, Barn, and Cliff ... Avian Wetland Surveys at Monticello Mill Tailing Site, 2008 U.S. Department of Energy Doc. ...

  16. Petascale Post-Doc Project a Supercomputing Success Story

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Petascale Post-Doc Project a Supercomputing Success Story Petascale Post-Doc Project a Supercomputing Success Story ARRA-funded program takes petascale computing researchers to the next level March 24, 2014 Contact: Kathy Kincade, +1 510 495 2124, petascalepostdocs.jpg From left: Jihan Kim, Filipe Maia, Alice Koniges, Robert Preissl, Brian Austin, Wangyi (Bobby) Liu , Kirsten Fagnan and Praveen Narayanan. The first post-doctoral research project centered at the Department of

  17. FAQs Docs for the Buy American Provision | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAQs Docs for the Buy American Provision FAQs Docs for the Buy American Provision These documents answer the most frequently asked questions about the Buy American Provision. International Trade Agreements and the Recovery Act Buy American Provisions: Frequently Asked Questions (57.16 KB) Computer Hardware and Software: Frequently Asked Questions (50.6 KB) More Documents & Publications Questions and Answers for the Smart Grid Investment Grant Program: Buy American Buy American Guidance

  18. BPA-2010-01339-FCorrespondence.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    of search time and 100 pages of duplication at no cost. Ms. Jo Jeter, Lead Human Resources Specialist, Talent Acquisition, has been assigned as the Authorizing Official for...

  19. Microsoft Word - best-fa.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    leading to failure. Fourteenth ARM Science Team Meeting Proceedings, Albuquerque, New Mexico, March 22-26, 2004 9 Solution and Implementation Many solutions were investigated and...

  20. Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc [DOE]

    Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

  1. Microsoft Word - AcqGuide70pt31A.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AcqGuide70pt31A.doc Microsoft Word - AcqGuide70pt31A.doc PDF icon Microsoft Word - AcqGuide70pt31A.doc More Documents & Publications AcqGuide70pt31.doc&0; Policy Flash 2014-26...

  2. DOC-DOE China Mission Announcement Press Release | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    China Mission Announcement Press Release DOC-DOE China Mission Announcement Press Release DOC-DOE China Mission Announcement Press Release DOC-DOE China Mission Announcement Press Release (34.5 KB) More Documents & Publications DOC-DOE Joint China Mission Statement China 2015 Business Development Mission Marketing Flyer DOE-LPO_Email-Update_001_Through_11

  3. Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

    Office of Energy Efficiency and Renewable Energy (EERE)

    Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

  4. Microsoft Word - GC Mediation Evaluation _2-06-09_.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy GC Mediation Evaluation _2-06-09_.doc Microsoft Word - GC Mediation Evaluation _2-06-09_.doc Microsoft Word - GC Mediation Evaluation _2-06-09_.doc (29.87 KB) More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc HQ Mediation Program Brochure Microsoft Word - DRAFT CRB Interview Guidance

  5. Microsoft Word - National Science Bowl Fact Sheet.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy National Science Bowl Fact Sheet.doc Microsoft Word - National Science Bowl Fact Sheet.doc Microsoft Word - National Science Bowl Fact Sheet.doc (244.47 KB) More Documents & Publications Microsoft Word - National Science Bowl Fact Sheet.doc Idaho Operations AMWTP Fact Sheet Heating Ventilation and Air Conditioning Efficiency

  6. Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy PPL 970-Materials and Inventory 5-9-05.doc Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc (22.24 KB) More Documents & Publications Microsoft Word - al95-06.doc DOE-HDBK-1139-2006 ppl970-3.pdf

  7. Property:NEPA FundingAgencyDocNumber | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    + DOEEA-1676 + N NV-020-03-26 + DE-PS07-02ID14264 + O One Nevada + NA + S Sigurd Red Butte No2 + NA + Retrieved from "http:en.openei.orgwindex.php?titleProperty:NEPAF...

  8. Microsoft Word - FAL2004-02.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Subject: Implementation of Fiscal Year (FY) 2004 Legislative Provisions What is the Purpose of this Financial Assistance Letter (FAL)? This FAL provides Contracting Officers and grants personnel guidance for the implementation of certain provisions contained in the Energy and Water Development Appropriations Act, 2004 (Energy & Water Act), Pub. L. 108-137, enacted December 1, 2003 and the Department of Interior and Related Agencies Appropriations Act, 2004 (Interior Act), Pub. L. 108-108,

  9. Microsoft Word - 03NESHAP-FINAL.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Standards Hazardous Air Pollutants DOE/NV/11718--929 June 2004 Calendar Year 2003 Prepared by: Bechtel Nevada Post Office Box 98521 Las Vegas, NV 89193-8521 for DISCLAIMER Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation, or favoring by the U.S. Government or any agency thereof or its contractors or subcontractors. This report has been reproduced

  10. Microsoft Word - 2007_Final.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    402 ECOLOGICAL MONITORING AND COMPLIANCE PROGRAM 2007 REPORT March 2008 Prepared by National Security Technologies, LLC Ecological Services P.O. Box 98521 Las Vegas, NV 89193-8521 DISCLAIMER Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation, or favoring by the United States Government or any agency thereof or its contractors or subcontractors.

  11. Microsoft Word - Full Thesis.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Fuel Competition in Power Generation and Elasticities of Substitution June 2012 Independent Statistics & Analysis U.S. Department of Energy Washington, DC 20585 U.S. Energy Information Administration | Fuel Competition in Power Generation and Elasticities of Substitution i This report was prepared by the U.S. Energy Information Administration (EIA), the statistical and analytical agency within the U.S. Department of Energy. By law, EIA's data, analyses, and forecasts are

  12. Microsoft Word - CQA2004_20060727.doc

    Gasoline and Diesel Fuel Update

    4) Distribution Category UC-950 Cost and Quality of Fuels for Electric Plants 2003 and 2004 June 30, 2006 (Updated August 2, 2006) Energy Information Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. Department of Energy Washington DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the Department of Energy. The information contained herein should not be construed as advocating or reflecting

  13. Microsoft Word - CQA2005W.doc

    Gasoline and Diesel Fuel Update

    5) Distribution Category UC-950 Cost and Quality of Fuels for Electric Plants 2004 and 2005 December 2006 Energy Information Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. Department of Energy Washington DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the Department of Energy. The information contained herein should not be construed as advocating or reflecting any policy position of

  14. Microsoft Word - CQA2006W.doc

    Gasoline and Diesel Fuel Update

    6) Distribution Category UC-950 Cost and Quality of Fuels for Electric Plants 2005 and 2006 October 2007 Energy Information Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. Department of Energy Washington DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the Department of Energy. The information contained herein should not be construed as advocating or reflecting any policy position of the

  15. Microsoft Word - CQA2008_FINAL.doc

    Gasoline and Diesel Fuel Update

    8) Distribution Category UC-950 Cost and Quality of Fuels for Electric Plants 2007 and 2008 January 2010 U.S. Energy Information Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. Department of Energy Washington DC 20585 This report was prepared by the U.S. Energy Information Administration (EIA), the statistical and analytical agency within the U.S. Department of Energy. By law, EIA's data, analyses, and forecasts are independent of approval by any other officer or

  16. Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy NationalPolicyAssurancesAwardTermsFinal81804.doc Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc (31.13 KB) More Documents & Publications Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc National Policy Assurances to be Incorporated as Award Terms Microsoft Word - NationalPolicyAssurances5-06.doc

  17. Using Other Agencies' Contracts [DOE]

    The Department of Energy's (DOE) use of other agencies contracts has increased in recent years. Other agency contracts include Economy Act interagency agreements, Franchise Fund Organizations,...

  18. Microsoft Word - AMB 2008-final.doc

    Office of Legacy Management (LM)

    ... Site is along a gravel road that crosses private property and leads to the site for ... the road continues to private mining and grazing interests that lie east of the site. ...

  19. Microsoft Word - PB-II.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    J.S. Magyar & H.A. Godwin, Northwestern University Lead poisoning can damage the brain and nervous system and is particularly dangerous for young children who are still developing. ...

  20. Microsoft Word -

    Office of Legacy Management (LM)

    PROCEEDINGS, TOUGH Symposium 2006 Lawrence Berkeley National Laboratory, Berkeley, California, May 15-17, 2006 - 1 - TRITIUM TRANSPORT THROUGH A LOW-PERMEABILITY NATURAL GAS RESERVOIR Clay A. Cooper 1 , Ming Ye 2 , and Jenny Chapman 2 Desert Research Institute 1 2215 Raggio Pkwy Reno, Nevada, 89512, USA E-mail: 2 755 E. Flamingo Road Las Vegas, NV 89119, USA ABSTRACT The U.S. Department of Energy and its predecessor agencies conducted a program in the 1960s and 1970s to evaluate

  1. Microsoft Word - HABAdv#237EECA.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    7 Subject: EE/CA for 105-KE Reactor Decommissioning Adopted: Nov. 5, 2010 Page 1 November 5, 2010 Dave Brockman, Manager U.S. Department of Energy, Office of River Protection P.O. Box 450 (H6-60) Richland, WA 99352 Matt McCormick, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd,, Suite 115 Richland WA 99352 Jane Hedges, Program Manager Washington State Department

  2. Microsoft Word - NEPA18_Final.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    6415 Rev. 18 Hanford Site National Environmental Policy Act (NEPA) Characterization J. P. Duncan, Editor K. W. Burk M. A. Chamness R. A. Fowler B. G. Fritz P. L. Hendrickson E. P. Kennedy G. V. Last T. M. Poston M. R. Sackschewsky M. J. Scott S. F. Snyder M. D. Sweeney P. D. Thorne September 2007 Prepared for the U.S. Department of Energy under Contract DE-AC05-76RL01830 DISCLAIMER This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the

  3. Microsoft Word - 2012O-01.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    1 Subject: PW 1,3,6 and CW-5 February 10, 2012 Page 1 February 10, 2012 Matt McCormick, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd,, Suite 115 Richland WA 99352 Jane Hedges, Program Manager Washington State Department of Ecology 3100 Port of Benton Blvd. Richland, WA 99354 Re: PW 1,3,6 and CW-5 Record of Decision Dear Messrs. McCormick, Faulk and Ms. Hedges,

  4. Microsoft Word - DOE_EA-1454.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    54 Rev. 0 Environmental Assessment Reactivation and Use of Three Former Borrow Sites in the 100-F, 100-H, and 100-N Areas U.S. Department of Energy Richland Operations Office Richland, Washington 99352 March 2003 DOE/EA-1454 Rev. 0 EA for Reactivation and Use of Three Former Borrow Sites in the 100-F, 100-H, and 100-N Areas March 2003 i TABLE OF CONTENTS 1.0 PURPOSE AND NEED FOR AGENCY ACTION ................................................... 1-1 2.0 BACKGROUND

  5. Microsoft Word - IG-0744 Cover.doc

    Office of Environmental Management (EM)

    I I D D E E N N T T I I F F Y Y A A N N D D P P R R O O T T E E C C T T Y Y O O U U R R V V I I T T A A L L R R E E C C O O R R D D S S July 2010 Records Management Division Office of IT Planning, Architecture, and E-Government Office of the Chief Information Officer 2 INTRODUCTION Each Federal agency is responsible for establishing a Vital Records Program for the identification and protection of those records needed for continuity of operations before, during, and after emergencies; and those

  6. Microsoft Word - 02 Tilghman.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    APPROPRIATION FY 2015 FY 2015 FY 2016 FY 2017 Enacted Current Enacted Request 1 $ % Department of Energy Budget by Appropriation Energy and Water Development, and Related Agencies Energy Programs Energy Efficiency and Renewable Energy 1,914,195 1,840,847 2,069,194 2,898,400 +829,206 +40.1% Electricity Delivery and Energy Reliability 146,975 143,901 206,000 262,300 +56,300 +27.3% Nuclear Energy 833,379 821,883 986,161 993,896 +7,735 +0.8% Office of Technology Transitions 0 0 0 8,400 +8,400 N/A

  7. First NESAP Post-doc Takes on BoxLib

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    First NESAP Post-doc Takes on BoxLib First NESAP Post-doc Takes on BoxLib Brian Friesen to Work with Ann Almgren's Group in CCSE June 22, 2015 brianfriesenphoto Brian Friesen, PhD The first of eight post-doctoral researchers participating in the NERSC Exascale Science Applications Program (NESAP) is now working full time at NERSC. Brian Friesen, a graduate student in computational astrophysics at the University of Oklahoma, joined the NESAP team May 18. He's been assigned to Ann Almgren's group

  8. Microsoft Word - AL-PO-0001-0007.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Authorized List Doc. ID: OP-AL-0001-007.doc Off-Hours Shift Operator Date: 2001/11/20 This policy is effective 11/20/2001 and denotes those individuals who have been authorized for Off-Hours Shift Operation. 1. Alderman, Steven 2. Aigeldinger, Georg 3. Baethke, Niko 4. Bauer, Benjamin 5. Brendebach, Boris 6. Day, Lorraine 7. Desta, Yohannes 8. Doomes, Edward 9. Dust, Reinhard 10. Farquar, George 11. Fluegge, Michael 12. Goettert, Jost 13. Koch, Kevin 14. Kong, Jong Ren 15. Lian, Kun 16. Ling,

  9. Microsoft Word - TRUacceptcritrev0e2.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    121 Determining Transuranic Alpha Activity Concentration for Compliance with the Nevada Test Site Waste Acceptance Criteria Revision 0 May 10, 2006 Approved By: U.S. Department of Energy National Nuclear Security Administration Nevada Site Office (NNSA/NSO) Original Signed by Gary Pyles 05/17/2006 Gary Pyles, NNSA/NSO RWAP Task Lead Date Prepared By: Bechtel Nevada, Radioactive Waste Acceptance Program (RWAP) Original Signed by Deron Linkenheil 05/17/2006 Deron Linkenheil, Senior Engineer, CHP

  10. Microsoft Word - CBFO Manager Transition.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Carlsbad Field Office Manager Transition CARLSBAD, N.M., September 7, 2010 - Dr. Dave Moody has been selected to lead DOE's Office of Environmental Management at the Savannah River Site. Moody has served as DOE Carlsbad Field Office manager, which oversees the Waste Isolation Pilot Plant (WIPP), since December 2005. Under his leadership, WIPP achieved record waste disposal milestones. DOE Assistant Secretary for Environmental Management Dr. Ines Triay, herself a former CBFO manager, will

  11. Leading Edge Technology in Diesel Emissions Control | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Leading Edge Technology in Diesel Emissions Control Leading Edge Technology in Diesel Emissions Control Poster presented at the 16th Directions in Engine-Efficiency and Emissions Research (DEER) Conference in Detroit, MI, September 27-30, 2010. p-02_roberts.pdf (193.56 KB) More Documents & Publications NO2 Management in Diesel Exhaust System Experimental Evaluation of DOC Performance Using Secondary Fuel Injection Low Temperature Catalyst for Fuel Injection System

  12. Microsoft Word - 080530Wind.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    FOR IMMEDIATE RELEASE Jennifer Scoggins, (202) 586-4940 Thursday, May 29, 2008 U.S. Continues to Lead the World in Wind Power Growth DOE Report Shows Rapidly Growing U.S. Wind Power Market WASHINGTON - The U.S. Department of Energy (DOE) today released the 2007 edition of its Annual Report on U.S. Wind Power Installation, Cost, and Performance Trends, which provides a comprehensive overview of developments in the rapidly evolving U.S. wind power market. Notably, the report finds that U.S. wind

  13. Microsoft Word - ex15-ITER-sept10.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    5 - Rights in Data-Special Works - ITER UT-B Contracts Div Sept 2010 Page 1 of 1 ex15-ITER-sept10.doc Exhibit 15-ITER Ref: FAR 52.227-17 RIGHTS IN DATA SPECIAL WORKS ITER ...

  14. Microsoft Word - FY07AnnualReport.doc | Department of Energy (indexed) [DOE]

    FY07AnnualReport.doc More Documents & Publications Microsoft Word - FY08AnnualReport.doc Audit Report: IG-0857 Attachment 5 Volume II Pricing Matrix.xls...

  15. Microsoft Word - 0-PEP-6-14-07.doc | Department of Energy

    Energy Savers

    Word - 0-PEP-6-14-07.doc Microsoft Word - 0-PEP-6-14-07.doc PSF.pdf More Documents & Publications Sample Project Execution Plan Project Execution Plan Review Module (RM) Microsoft...

  16. Microsoft Word - g413.3-10Final5-6-08.doc | Department of Energy

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    g413.3-10Final5-6-08.doc Microsoft Word - g413.3-10Final5-6-08.doc DOEEVMSGoldCardSep2011.pdf More Documents & Publications EVMS and Project Analysis Standard Operating...

  17. V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerabilit...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability June 25, 2013 - 12:41am Addthis PROBLEM: ...

  18. RFQ DE-RQ01-04ME90001.doc | Department of Energy

    Energy Savers

    DE-RQ01-04ME90001.doc&0; More Documents & Publications Ammendment 2.doc Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&0; Operating Guidelines Appendix A B...

  19. Ex Parte Memo - 09 02 Mtg-09.09.10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Parte Memo - 09 02 Mtg-09.09.10.doc Ex Parte Memo - 09 02 Mtg-09.09.10.doc Summary of ex parte meeting on energy efficiency standards PDF icon Ex Parte Memo - 09 02 ...

  20. Application to Export Electric Energy OE Doc No. EA-339-A Shell...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Doc No. EA-339-A Shell Energy North America (US), L.P. Application to Export Electric Energy OE Doc No. EA-339-A Shell Energy North America (US), L.P. Application from Shell Energy ...

  1. Federal Agency NEPA Procedures [DOE]

    Each Federal agency is required to develop NEPA procedures that supplement the CEQ Regulations. Developed in consultation with CEQ, Federal agency NEPA procedures must meet the standards in the CEQ...

  2. Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy National Policy AssurancesAwardTermsREVJuly2005.doc Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc (31.87 KB) More Documents & Publications Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc National Policy Assurances to be Incorporated as Award Terms Microsoft Word - NationalPolicyAssurances5-06

  3. Microsoft Word - Corp Impl | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Corp Impl Microsoft Word - Corp Impl Microsoft Word - Corp Impl (422.79 KB) More Documents & Publications ESTABLISHMENT OF MANAGEMENT DECISIONS ON OFFICE OF INSPECTOR GENERAL REPORTS, DOE O 221.3 Microsoft Word - AL2007-01.doc DOE Systems Engineering Methodology (SEM): Stage Exit V

  4. DOE/Grand Junction Office Bluewater LTSP July 1997 Doc. No. S00012AA...

    Office of Legacy Management (LM)

    DOEGrand Junction Office Bluewater LTSP July 1997 Doc. No. S00012AA, Page iii Contents Page 1.0 Introduction ......

  5. advanced_biofuels_pathways_webinar_alt_text.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    advanced_biofuels_pathways_webinar_alt_text.doc advanced_biofuels_pathways_webinar_alt_text.doc advanced_biofuels_pathways_webinar_alt_text.doc advanced_biofuels_pathways_webinar_alt_text.doc (113 KB) More Documents & Publications Sustainability for the Global Biofuels Industry: Minimizing Risks and Maximizing Opportunities Webinar Transcript "The Promise and Challenge of Algae as Renewable Sources of Biofuels" 9-8-2010 - Transcript NABC Webinar

  6. Microsoft Word - FAL2003-03R.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    3-03R.doc Microsoft Word - FAL2003-03R.doc Microsoft Word - FAL2003-03R.doc (198.25 KB) More Documents & Publications WPN 06-8: Dun and Bradstreet Universal Numbering System (DUNS) and Central Contractor Registration (CCR) and Grants.Gov Reminder Microsoft Word - FAL2003-03Rattach.doc WPN 03-7: Grants.Gov: Dun and Bradstreet Universal Numbering System (Duns) and Central Contractor Registration (CCR)

  7. Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion [DOE]

    Performance of two commercially available DOCs with different precious metal loadings and Pt:Pd ratios were compared to model DOC containing Pt only

  8. Microsoft Word - Fact Sheet Environment 100808 FINAL.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Environment 100808 FINAL.doc Microsoft Word - Fact Sheet Environment 100808 FINAL.doc Microsoft Word - Fact Sheet Environment 100808 FINAL.doc (56.51 KB) More Documents & Publications Major Communications Report May 5, 2009 Major Communications Report April 30, 2009 Major Communications Report April 28, 2009

  9. Microsoft Word - va_Final3a_06-04-032.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    vaFinal3a06-04-032.doc Microsoft Word - vaFinal3a06-04-032.doc PDF icon Microsoft Word - vaFinal3a06-04-032.doc More Documents & Publications DOE F 473.2 Headquarters ...

  10. Microsoft Word - Bill's version 5-20-05.doc | Department of Energy

    Office of Environmental Management (EM)

    Bill's version 5-20-05.doc Microsoft Word - Bill's version 5-20-05.doc Microsoft Word - Bill's version 5-20-05.doc (717.91 KB) More Documents & Publications Audit Report: IG-0690 Audit Report: OAS-M-06-04 Audit Report: OAI-M-16-15

  11. Fact Sheet -- Climate VISION 02-12-031.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Fact Sheet -- Climate VISION 02-12-031.doc&#0; Fact Sheet -- Climate VISION 02-12-031.doc&#0; Fact Sheet -- Climate VISION 02-12-031.doc&#0; (28.89 KB) More Documents & Publications Meeting President Bush's Climate Change Challenge to Business and Industry Climate Vision Progress Report 2007 Climate VISION Progress Report 2007

  12. Microsoft Word - PressRelease_Siting_2-8-06_Final.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PressReleaseSiting2-8-06Final.doc Microsoft Word - PressReleaseSiting2-8-06Final.doc PDF icon Microsoft Word - PressReleaseSiting2-8-06Final.doc More Documents & ...

  13. Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    DOE E-Government Act Report 11.16.06 Final.doc Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc ...

  14. AcqGuide35pt1rev2.doc | Department of Energy

    Energy Savers

    AcqGuide35pt1rev2.doc&0; AcqGuide35pt1rev2.doc&0; AcqGuide35pt1rev2.doc&0; More Documents & Publications Attachment FY2011-58 OPAM Chapter 35 - Research and Development...

  15. Microsoft Word - ADR Revised Policy82508Reformatted.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy ADR Revised Policy82508Reformatted.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc (52.42 KB) More Documents & Publications ADR Policy Federal Register Document 2009 ECR FINAL REPORT 2010

  16. Microsoft Word - CHAP02ESH _REVISED1_3.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    CHAP02ESH _REVISED1_3.doc Microsoft Word - CHAP02ESH _REVISED1_3.doc Microsoft Word - CHAP02ESH _REVISED1_3.doc (183.77 KB) More Documents & Publications Regulatory Aspects of ISM COMMENTS&#0; A:\CHAP05PERFASSM(REVISED).PDF&#0;

  17. EM Leads Successful Workshop Supporting Fukushima Cleanup | Department... (indexed) [DOE]

    officials leading the cleanup of the Fukushima Daiichi Nuclear Power Plant site and surrounding area, this time addressing priorities identified by Japan's government agencies. ...

  18. Designation of Non-Federal Agencies as Cooperating Agencies ...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    that are relevant in determining appropriate cooperating agencies, and encourages agencies to document their expectations, roles, and responsibilities (including funding). ...

  19. Microsoft Word - HABAdv #231_TPA_Change_Package.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    budget. The Tri-Party agencies should maintain a clear commitment to these milestones to signal potential opportunities to the private sector. * The Tri-Party agencies should not...

  20. Microsoft Word - NMMSS News DEC 23 08 Update.doc

    National Nuclear Security Administration (NNSA)

    IS SPONSORED BY DOE AND NRC NMMSS news PUBLISHED PERIODICALLY BY & FOR NMMSS USERS December 23, 2008 SPECIAL EDITION NUREG/BR-0007, Rev.6 Published The NRC wishes to inform industry that it has published its update of NUREG/BR-0007. This NUREG was updated to reflect changes to NMMSS reports that become effective January 1, 2009. Link to the updated NUREG:

  1. Microsoft Word - Appendix E_InstiControls.doc

    Office of Legacy Management (LM)

    Institutional Control Documentation U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page E-iii Appendix E Institutional Control Documentation Notation on Ownership Record for Notification to Potential Owners of Contaminated Groundwater and Applied Restrictions Chemical Plant Site and Quarry Areas (Recorded Book 3754, Pages 419-424, St. Charles County, Missouri)................................E-1 Real Estate License, Groundwater Wells and Sampling on

  2. Microsoft Word - NO1113_Dewatering report.doc

    Office of Legacy Management (LM)

    Hydrologic Assessment of Dewatering for Installation of the Belcher Road Water Transmission Line This page intentionally left blank U.S. Department of Energy Dewatering Evaluation Report for Road Const. & Water Line Replacement June 2008 Doc. No. N0111300 Page C-3 The rate of pumping resulting from aquifer dewatering for installation of the planned water transmission line beneath Belcher Road is expected be larger than any of the discharge rates associated with drainage infrastructure

  3. Microsoft Word - S04877_AnnInspRpt2008.doc

    Office of Legacy Management (LM)

    Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2008 LMS/MNT/S04877 This page intentionally left blank LMS/MNT/S04877 2008 Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2008 This page intentionally left blank U.S. Department of Energy 2008 Annual Inspection-Monticello, Utah December 2008 Doc. No. S487700 Page i Contents Executive

  4. Microsoft Word - S04929_GW_Mon_NDEP_Final.doc

    Office of Legacy Management (LM)

    Groundwater Monitoring Report Central Nevada Test Area, Corrective Action Unit 443 March 2009 Rev. 1 LMS/CNT/S04929 This page intentionally left blank LMS/CNT/S04929 2008 Groundwater Monitoring Report Central Nevada Test Area, Corrective Action Unit 443 March 2009 Rev. 1 This page intentionally left blank U.S. Department of Energy 2008 Groundwater Monitoring Report-CNTA, CAU 443 March 2009 Doc. No. S04929 Rev. 1 Page i Contents 1.0

  5. Microsoft Word - S04932 History final.doc

    Office of Legacy Management (LM)

    FUSRAP History of the Chupadera Mesa, NM, Site December 2008 Doc. No. S0493200 (FUSRAP NM.04-5) Page 1 of 9 FUSRAP History of the Chupadera Mesa, NM, Site The following historical summary is provided to document the inclusion of the Chupadera Mesa, NM, Site into the Formerly Utilized Sites Remedial Action Program (FUSRAP). Although no remedial action was required, the site met eligibility criterion and was included under FUSRAP, under which the final radiological surveys were performed.

  6. Microsoft Word - S05378_2009 GW Rpt.doc

    Office of Legacy Management (LM)

    08 through April 2009 October 2009 LMS/MNT/S05378 This page intentionally left blank LMS/MNT/S05378 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report May 2008 through April 2009 October 2009 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report May 2008-April 2009 October 2009 Doc. No. S05378 Page i Contents

  7. Microsoft Word - S05551_1stqtr report.doc

    Office of Legacy Management (LM)

    09 July 2009 LMS/RFS/S05551 This page intentionally left blank LMS/RFS/S05551 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2009 July 2009 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2009 July 2009 Doc. No. S05551 Page i Contents

  8. Microsoft Word - S06528_1st qtr 2010.doc

    Office of Legacy Management (LM)

    10 July 2010 LMS/RFS/S06528 This page intentionally left blank LMS/RFS/S06528 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2010 July 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2010 July 2010 Doc. No. S06528 Page i Contents

  9. Microsoft Word - S07079_jul_sep_10.doc

    Office of Legacy Management (LM)

    July 1-September 30, 2010 October 2010 Doc. No. S07079 Page 1 Monticello, Utah, National Priorities List (NPL) Sites Federal Facilities Agreement (FFA) Quarterly Report: July 1-September 30, 2010 This report summarizes project status and activities implemented July through September 2010, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) Site. This report also includes disposal cell and Pond 4 leachate

  10. Microsoft Word - S08999_Apr11-Mar12.doc

    Office of Legacy Management (LM)

    1 Through March 2012 Tuba City, Arizona, Disposal Site July 2012 LMS/TUB/S08999 This page intentionally left blank LMS/TUB/S08999 Annual Groundwater Report April 2011 Through March 2012 Tuba City, Arizona, Disposal Site July 2012 This page intentionally left blank U.S. Department of Energy Tuba City Annual Groundwater Report-April 2011 through March 2012 July 2012 Doc. No. S08999 Page i Contents Abbreviations

  11. Microsoft Word - AppendixH_CommentResponse.doc

    Office of Legacy Management (LM)

    NFSS Vicinity Property Report October 2010 Doc. No. S06246 Page H-1 Responsiveness Summary The U.S. Department of Energy (DOE) released the Formerly Utilized Sites Remedial Action Program Niagara Falls Storage Site Vicinity Properties, New York: Review of Radiological Conditions at Six Vicinity Properties and Two Drainage Ditches on April 23, 2010, for public comment. Report availability was announced through a message to stakeholders sent on behalf of DOE by USACE. The announcement provided a

  12. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    2009 Revegetation Success Monitoring This page intentionally left blank 2009 Revegetation Success Monitoring Central Nevada Test Area Corrective Action Unit 417 UC-1 Central Mud Pit This page intentionally left blank U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc No. S05767 Page C-i Contents 1.0 Introduction and Purpose ..................................................................................................C-1 2.0 Monitoring

  13. Microsoft Word - S05775_2009 VMR.doc

    Office of Legacy Management (LM)

    Report for the Old and New Rifle, Colorado, Processing Sites September 2009 LMS/RFO/RFN/S05775 This page intentionally left blank LMS/RFO/RFN/S05775 2009 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2009 This page intentionally left blank U.S. Department of Energy 2009 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2009 Doc. No. S05775 Page i Contents

  14. Microsoft Word - S07012_RFL_2010_VMR_LEC.doc

    Office of Legacy Management (LM)

    Old and New Rifle, Colorado, Processing Sites September 2010 LMS/RFO/RFN/S07012 This page intentionally left blank LMS/RFO/RFN/S07012 2010 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2010 This page intentionally left blank U.S. Department of Energy 2010 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2010 Doc. No. S07012 Page i Contents

  15. Microsoft Word - S07033_2nd qtr 2010.doc

    Office of Legacy Management (LM)

    Second Quarter Calendar Year 2010 October 2010 LMS/RFS/S07033 This page intentionally left blank LMS/RFS/S07033 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities Second Quarter Calendar Year 2010 October 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-2nd Quarter CY 2010 October 2010 Doc. No. S07033 Page i Contents

  16. Zarb Appointed to Lead the Federal Energy Administration | National Nuclear

    National Nuclear Security Administration (NNSA)

    Security Administration | (NNSA) Zarb Appointed to Lead the Federal Energy Administration Zarb Appointed to Lead the Federal Energy Administration Washington, DC President Ford appoints Frank Zarb to be the first Administrator of the newly created Federal Energy Agency

  17. Microsoft Word - FAL2003-03Rattach.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Agency Name(s). Required {Select all that apply} * U.S. Department of Energy {Enter DOE Office, Division, etc.} * National Nuclear Security Administration {Enter NNSA Office, Division, etc.} * If appropriate, list other agencies: {Enter name of other agency. Can have more than one} Funding Opportunity Title. Required {Enter title of the funding opportunity announcement} Announcement Type. Required {Select one} * Initial Announcement * Modification Funding Opportunity Number. Required Complete in

  18. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    MV-4 Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page B-1 Table B-1. MV-4 Chronology Date Time Depth (ft bgs) Activity 04/16/09 through 04/22/09 NA NA Mobilization to CNTA and rig-up to drill 04/22/09 15:45 0 Rig inspection and drill pad walk through inspection, continue with preparations for drilling. 04/22/09 21:50 0 Begin drilling 31-inch diameter conductor casing borehole 04/23/09 10:10 100 Advanced

  19. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    MV-5 Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page C-1 Table C-1. MV-5 Chronology Date Time Depth (ft bgs) Activity 05/09/09 through 05/10/09 NA NA Move rig and equipment from MV-4 pad to MV-5 pad and prepare to drill MV-5. 05/10/09 12:10 0 Rig inspection and drill pad walk through inspection, continue with preparations for drilling. 05/10/09 14:00 0 Begin drilling 31-inch diameter conductor casing

  20. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    UC-1-P-1SRC Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page D-1 Table D-1. UC-1-P-1SRC Chronology Date Time Depth (ft bgs) Activity 05/23/09 13:30 - 18:30 NA Position workover rig over the hole and pulled out about 50 ft of 4.5-in. casing. A steel die fell into hole and indications were that casing had separated during initial pulling. 05/24/09 06:00 - 09:00 NA Workover rig moves off the hole after

  1. Microsoft Word - ex15-ITER-sept10.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    5 - Rights in Data-Special Works - ITER UT-B Contracts Div Sept 2010 Page 1 of 1 ex15-ITER-sept10.doc Exhibit 15-ITER Ref: FAR 52.227-17 RIGHTS IN DATA í SPECIAL WORKS í ITER (Sept 2010) (a) Definitions. (1) "Data", as used in this clause, means recorded information, regardless of form or the media on which it may be recorded. The term includes technical data and computer software. The term does not include information incidental to contract administration, such as financial,

  2. Microsoft Word - ex1b-ITER-mar07.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    B - Patent Rights - Acquisition by the Government - ITER UT-B Contracts Div March 2007 Page 1 of 6 ex1b-ITER-mar07.doc Exhibit 1B ITER Ref: DEAR 952.227-13 PATENT RIGHTS - ACQUISITION BY THE GOVERNMENT - ITER (Mar 2007) (a) Definitions. (1) "Invention", as used in this clause, means any invention or discovery which is or may be patentable or otherwise protectable under title 35 of the United States Code or any novel variety of plant that is or may be protectable under the Plant Variety

  3. Microsoft Word - ex9-ITER-june11.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    - Technical Data - ITER UT-B Contracts Div June 2011 Page 1 of 5 ex9-ITER-june11.doc Exhibit 9 ITER Ref: DEAR 927.409; FAR 52.227-14, 52.227-14 Alt.V, 52.227-16 TECHNICAL DATA - ITER (June 2011) 1. RIGHTS IN DATA - GENERAL (a) Definitions. (1) "Computer data bases," as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include computer software. (2) "Computer

  4. Microsoft Word - ex9ed-ITER-june11.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    ED - Technical Data - ITER UT-B Contracts Div June 2011 Page 1 of 5 ex9ed-ITER-june11.doc Exhibit 9ED ITER Ref: DEAR 927.409; FAR 52.227-14, 52.227-14 Alt. IV, 52.227-14 Alt. V, 52.227-16 TECHNICAL DATA - ITER (June 2011) 1. RIGHTS IN DATA-GENERAL (a) Definitions. (1) "Computer data bases," as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include computer

  5. Microsoft Word - ex9rdf-ITER-sept09.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    RDF - Technical Data - ITER UT-B Contracts Div Sept 2009 Page 1 of 5 ex9rdf-ITER-sept09.doc Exhibit 9RDF-ITER Ref: DEAR 970.5227-1 TECHNICAL DATA - ITER (Sept 2009) 1. Rights in Data-Facilities. (a) Definitions. (1) "Computer Data Bases", as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include Computer Software. (2) "Computer Software", as used in this

  6. Microsoft Word - FINAL_Recommendation_2008-03.doc

    Office of Environmental Management (EM)

    Regarding the EPA Stormwater Discharge Permit Background The U.S. Environmental Protection Agency (EPA) regulates Stormwater discharge at Los Alamos National Laboratory (LANL). ...

  7. Microsoft Word - Rhode Island EA - FINAL EA.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    ... The pipeline would be insulated to provide freeze ... The six major greenhouse gases are carbon dioxide, methane, ... Agency floodplain maps, the proposed project ...

  8. Microsoft Word - No Fear Stats FY02.doc

    Office of Environmental Management (EM)

    ... Pending Written Notification 3 Investigation 61 Hearings 115 Final Agency Action 15 Appeal with EEOC Office of Federal Operations NA XI. Complaint Investigations: 29 CFR ...

  9. Microsoft Word - No Fear Stats FY04.doc

    Office of Environmental Management (EM)

    ... Pending Written Notification 8 Investigation 34 Hearings 45 Final Agency Action 10 Appeal with EEOC Office of Federal Operations 28 XI. Complaint Investigations: 29 CFR ...

  10. Microsoft Word - No Fear Stats FY06.doc

    Office of Environmental Management (EM)

    ... Pending Written Notification 1 Investigation 61 Hearings 31 Final Agency Action 14 Appeal with EEOC Office of Federal Operations 24 XI. Complaint Investigations: 29 CFR ...

  11. Microsoft Word - No Fear Stats FY03.doc

    Office of Environmental Management (EM)

    ... Pending Written Notification 12 Investigation 52 Hearings 69 Final Agency Action 15 Appeal with EEOC Office of Federal Operations NA XI. Complaint Investigations: 29 CFR ...

  12. Microsoft Word - Canceled -7 Section C April 16 2010.doc

    Office of Environmental Management (EM)

    ... Law Enforcement Agency LMG Light Machine Gun LRI Live Round Inhibitor LRMB Live Round ... Incident Response Plan SMG Submachine Gun SNM Special Nuclear Material SO Office of ...

  13. Microsoft Word - HABAdv #234_FY2012_Budget_Requests.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Protection Agency, Region 10 309 Bradley Blvd., Suite 115 Richland, WA 99352 Jane Hedges, Program Manager Washington State Department of Ecology 3100 Port of Benton...

  14. Microsoft Word - HABAdv#227_ModelingvsCharacterization.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Protection Agency, Region 10 309 Bradley Blvd., Suite 115 Richland, WA 99352 Jane Hedges, Program Manager Washington State Department of Ecology 3100 Port of Benton...

  15. Microsoft Word - HABAdv #232_ARRA_Funding.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Protection Agency, Region 10 309 Bradley Blvd., Suite 115 Richland, WA 99352 Jane Hedges, Program Manager Washington State Department of Ecology 3100 Port of Benton...

  16. Microsoft Word - HABChairSelectionProcess_2006.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    ChairVice-chairs Selection Process Nominations 1) Board members, alternates and Tri-Party agencies provide nominations for HAB chair (from September to October 15, 2006). a....

  17. Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Citrix_2FA_Authentication_12_3_2009.doc Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc (453.3 KB) More Documents & Publications Citrix_2FA_Authentication_09.09 Using Two-Factor RSA Token with WebVPN User guide for remote access to VDI and Workplace using RSA token

  18. Microsoft Word - GNEP Website Glossary 2006-02-03_no_links.doc | Department

    Office of Environmental Management (EM)

    of Energy GNEP Website Glossary 2006-02-03_no_links.doc Microsoft Word - GNEP Website Glossary 2006-02-03_no_links.doc Microsoft Word - GNEP Website Glossary 2006-02-03_no_links.doc (29.63 KB) More Documents & Publications GNEP Glossary Generation-IV Roadmap Report of the Fuel Cycle Crosscut Group DOE-HDBK-1113-2008

  19. Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc (160.81 KB) More Documents & Publications Notice of Proposed Rulemaking (August 6, 2009) Notice of Proposed Rulemaking (May 16, 2007) Final Rule (December 4, 2009)

  20. Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy NSRC precompetitive User Agreement amended 1-18-07.doc Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc (69.15 KB) More Documents & Publications EXHIBIT A: CRADA, WFO, PUA and NPUA Comparison Table, with suggested changes Class_Waiver_NPUA-2.pdf ClassWaiver-PUA.pdf

  1. Agency-Wide Screening [DOE]

    Federal agencies face energy-related requirements on new construction projects and major renovations. These Federal requirements range from reductions in fossil-fuel use to specifying the use of...

  2. State Agency Loan Program [DOE]

    Just over half of all SALP loans are directed to Energy Performance Contracts (EPCs) that the Maryland Department of General Services coordinates with the State’s agencies. These EPCs are typical...

  3. The EURATOM Supply Agency

    SciTech Connect (OSTI)

    Lightner, J.


    With the coming liberalization of trade and industry within the European Community (EC) and a more centrally-coordinated EC external trade policy, it is timely to ask if in the 1990s there will be any significant changes in the commercial relations between the EC and non-EC companies trading in nuclear fuel. The key vehicle for implementing any change of policy would probably be the European Atomic Energy Community (EURATOM) Supply Agency in Brussels, which is charged under the EURATOM Treaty with overseeing the equitable supply of nuclear fuel to and among EC companies. The EURATOM Supply Agency (the Agency) is a signatory to almost all EC-company contracts for transactions that occur on the territory of the Community, which includes Belgium, Denmark, France, the Federal Republic of Germany (FRG), Great Britain, Greece, Ireland, Italy, Luxembourg, the Netherlands, Portugal, and Spain. During the 1980s, the Supply Agency has rarely tried to influence the commercial decisions of EC member companies. The nuclear fuel industry has largely perceived the Agency as an administrative office that registers contracts and maintains relations with some outside governments, particularly Australia, Canada, and the USA. However, in 1988 the Agency began to have a more direct commercial impact when it reviewed the practice-previously conducted routinely by the EURATOM Safeguards Directorate in Luxembourg at the request of EC-member companies-of swapping safeguards obligations on equivalent quantities of uranium at different locations (flag swapping). The Agency`s actions inhibiting flag swaps, as well as a related de facto policy restricting material swaps of Southern African uranium, caused it to be viewed as obstructive by some EC companies. During 1989 the discussion about flag swaps and swaps involving South African and Namibian uranium has subsided, and a far-reaching discussion has arisen about EC trade policy in general.

  4. Broad Agency Announcements

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Broad Agency Announcements Broad Agency Announcements World-class experts and capabilities countering all aspects of explosive threats, and aiming predominantly at enhanced detection capabilities. LACED can respond to BAAs, so long as the BAA solicitations satisfies FOA criteria noted in "When LACED can Participate" under the FOAs section. When a BAA is relevant to LACED's unique capabilities and its Department of Energy mission, LACED in general may respond to the BAA on its own.

  5. Industrial lead paint removal specifications

    SciTech Connect (OSTI)

    Stone, R.C.


    The purpose of this paper is to inform the reader as to some of the pertinent rules and regulations promulgated by the Environmental Protection Agency (EPA) and the Occupational Safety and Health Administration (OSHA) that may effect an industrial lead paint removal project. The paper discusses a recommended schedule of procedures and preparations to be followed by the lead paint removal specification writer when analyzing the possible impact of the project on the environment, the public and workers. Implications of the Clean Air Act, the Clean Water Act and the Resource Conservation and Recovery Act (RCRA) along with hazardous waste handling, manifesting, transporting and disposal procedures are discussed with special emphasis placed as to their impact on the writer and the facility owner. As the rules and regulations are highly complex, the writer has attempted to explain the methodology currently being used in state-of-the-art industrial lead abatement specifications.

  6. NDIA_PMSC_SurveillanceGuide_Oct2004.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon NDIAPMSCSurveillanceGuideOct2004.doc More Documents & Publications EVMS Surveillance Standard Operating Procedure (ESSOP) NDIAPMSCEVMSIntentGuideNov2006.pdf ...

  7. Microsoft Word - S02459_2006Annual GW Rpt.doc

    Office of Legacy Management (LM)

    Site Operable Unit III Annual Ground Water Report October 2005 through April 2006 ... Site OU III Annual Ground Water Report October 2005-April 2006 September 2006 Doc. ...

  8. Microsoft Word - S05212_2008 Post-Closure InspRpt.doc

    Office of Legacy Management (LM)

    ... and maintenance program * Communicate with ... Salmon-Calendar Year 2008 U.S. Department of Energy Doc. No. ... businesses from nearby communities. * Continue the ...

  9. OSTIblog Articles in the Adopt-A-Doc Topic | OSTI, US Dept of...

    Office of Scientific and Technical Information (OSTI)

    STIP is a robust and effective collaboration across the DOE... Related Topics: .EDUconnections, Adopt-A-Doc, DOE Green Energy, DOE STI, journal literature, National Library of ...

  10. Microsoft Word - S04916_2008 Macroinvert Biomonitoring Rpt.doc

    Office of Legacy Management (LM)

    ... retention pond are cliff swallows, violet-green swallows, song sparrows, and black phoebes. 2008 Macroinvertebrate Sampling-Monticello, Utah U.S. Department of Energy Doc. No. ...

  11. Energy Efficiency Lead-by-Example Resources | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Lead-by-Example Resources Energy Efficiency Lead-by-Example Resources State and local governments can lead by example by promoting energy efficiency programs and policies for public facilities, equipment, and government operations. Find energy efficiency lead-by-example resources below. DOE Resource Federal Energy Management Program Publications. Other Resources Environmental Protection Agency: Lead by Example in Government Operations ACEEE's Lead By Example Initiatives National Governors

  12. FEMP Best Practices and Lessons Learned for Federal Agency ESPC Projects: Preliminary Assessment

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5. PRELIMINARY ASSESSMENT (PA) 5.1 To get a useful PA from the ESCO, the agency should provide the ESCO with all relevant current information about the facilities, including energy consumption and previous audits. 5.2 The PA should be only as long as necessary to convey the viability of a project. An example/template of a PA can be found at: . 5.3 Set deadlines for PA submission and for agency completion of PA review and response to the

  13. Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc meeting on Energy Efficiency and Sustainable Design of Federal Buildings Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc (99.54 KB) More Documents & Publications Ex Parte Memo - 09 02 Mtg-09.09.10.doc Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc

  14. Agencies sign last record of decision for DOE Idaho cleanup program

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    but the agencies concluded that two sites require cleanup because of concentrations of lead, arsenic or mercury in the soil. Also in the ROD, the agencies agreed to implement a...


    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    41 Federal Register / Vol. 80, No. 243 / Friday, December 18, 2015 / Notices ENVIRONMENTAL PROTECTION AGENCY [ER-FRL-9024-5] Environmental Impact Statements; Notice of Availability Responsible Agency: Office of Federal Activities, General Information (202) 564-7146 or Weekly receipt of Environmental Impact Statements Filed 12/07/2015 Through 12/11/2015 Pursuant to 40 CFR 1506.9. Notice Section 309(a) of the Clean Air Act requires that EPA make public its comments on

  16. Designation of Non-Federal Agencies as Cooperating Agencies [DOE]

    This Council on Environmental Quality Memorandum (CEQ) urges agencies to more actively solicit the participation of state, tribal and local governments as cooperating agencies in implementing the environmental impact statement process. The Memorandum refers agencies to existing CEQ guidance on the types of actions and expertise that are relevant in determining appropriate cooperating agencies, and encourages agencies to document their expectations, roles, and responsibilities (including funding).

  17. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page B-1 Table 1. UC-1 Monument Elevations and Subsidence Elevation at Top of Monument a,b Subsidence (m) Date SM-1 N 6,430,874.2869 E 539,588.2339 SM-2 N 6,430,863.3239 E 539,644.8195 SM-3 N 6,430,855.2553 E 539,684.3327 SM-4 N 6,430,849.7763 E 539,715.7991 SM-5 N 6,430,852.0243 E 539,585.4651 SM-6 N 6,430,841.7590 E 539,641.4674 SM-7 N 6,430,834.5289 E 539,680.5243 SM-8 N

  18. Microsoft Word - settlement closeout press release _2_ _2_.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    fuel to dry storage, and emptying and closing 11 of 15 underground high- level waste storage tanks. The agency met its commitment providing 30 million to the state over a...

  19. Microsoft Word - CFAC 7-Year PSA.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    be deemed unreasonable for BPA to require credit security from an assignee with a Moody's credit rating below "A", or the equivalent if rated by another credit rating agency. No...

  20. Microsoft Word - Power Sales Agreement ALCOA - 081909 pm.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    be deemed unreasonable for BPA to require credit security from an assignee with a Moody's credit rating below "A", or the equivalent if rated by another credit rating agency. No...

  1. Microsoft Word - HABAdv#225_CommunityRelationsplan.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    communication technologies as they come into use by the general public. The Board looks forward to continuing to work with the Tri-Party Agencies on the draft Community Relations...

  2. Microsoft Word - HABAdv#220 FY2010 Budget.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Protection Agency, Region 10 309 Bradley Blvd., Suite 115 (B1-46) Richland, WA 99352 Jane Hedges, Program Manager Washington State Department of Ecology 3100 Port of Benton...

  3. Microsoft Word - FIA-13-0047 & 0048.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ... to use and dispose of the record as it sees fit; (3) The extent to which agency ... Accordingly, DOE cannot use and dispose of the record as it sees fit and the videotape has ...

  4. Microsoft Word - AMI White paper final 013108 _2_.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    NETL Modern Grid Strategy Powering our 21st-Century Economy ADVANCED METERING INFRASTRUCTURE Conducted by the National Energy Technology Laboratory for the U.S. Department of Energy Office of Electricity Delivery and Energy Reliability February 2008 Office of Electricity Delivery and Energy Reliability V1.0 DISCLAIMER This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government nor any agency thereof, nor any of

  5. Microsoft Word - Vol 1 Chapters TOC.doc

    National Nuclear Security Administration (NNSA)

    iii COVER SHEET Responsible Agency: U.S. Department of Energy/National Nuclear Security Administration Cooperating Agencies: U.S. Air Force U.S. Department of the Interior, Bureau of Land Management Nye County, NV Title: Final Site-Wide Environmental Impact Statement for the Continued Operation of the Department of Energy/National Nuclear Security Administration Nevada National Security Site and Off-Site Locations in the State of Nevada (DOE/EIS-0426) Location: Nye and Clark Counties, Nevada

  6. Relative importance of multiple factors on terrestrial loading of DOC to Arctic river networks

    SciTech Connect (OSTI)

    Kicklighter, David W.; Hayes, Daniel J; Mcclelland, James W; Peterson, Bruce; Mcguire, David; Melillo, Jerry


    Terrestrial carbon dynamics influence the contribution of dissolved organic carbon (DOC) to river networks in addition to controlling carbon fluxes between the land surface and the atmosphere. In this study, we use a biogeochemical process model to simulate the lateral transfer of DOC from land to the Arctic Ocean via riverine transport. We estimate that the pan-arctic watershed has contributed, on average, 32 Tg C/yr of DOC to the Arctic Ocean over the 20th century with most coming from the extensive area of boreal deciduous needle-leaved forests and forested wetlands in Eurasian watersheds. We also estimate that the rate of terrestrial DOC loading has been increasing by 0.037 Tg C/yr2 over the 20th century primarily as a result of increases in air temperatures and precipitation. These increases have been partially compensated by decreases in terrestrial DOC loading caused by wildfires. Other environmental factors (CO2 fertilization, ozone pollution, atmospheric nitrogen deposition, timber harvest, agriculture) are estimated to have relatively small effects on terrestrial DOC loading to arctic rivers. The effects of the various environmental factors on terrestrial carbon dynamics have both compensated and enhanced concurrent effects on hydrology to influence terrestrial DOC loading. Future increases in riverine DOC concentrations and export may occur from warming-induced increases in terrestrial DOC production associated with enhanced microbial metabolism and the exposure of additional organic matter from permafrost degradation along with decreases in water yield associated with warming-induced increases in evapotranspiration. Improvements in simulating terrestrial DOC loading to pan-arctic rivers in the future will require better information on the spatial distribution of precipitation and its temporal trends, carbon dynamics of larch-dominated ecosystems in eastern Siberia, and the role of industrial organic effluents on carbon budgets of rivers in western

  7. Microsoft Word - 48D7DF19-707E-28B27A.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    48D7DF19-707E-28B27A.doc Microsoft Word - 48D7DF19-707E-28B27A.doc PDF icon Microsoft Word - 48D7DF19-707E-28B27A.doc More Documents & Publications Microsoft Word - ...

  8. Microsoft Word - 46ED31B8-1E53-08CF52.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    46ED31B8-1E53-08CF52.doc Microsoft Word - 46ED31B8-1E53-08CF52.doc PDF icon Microsoft Word - 46ED31B8-1E53-08CF52.doc More Documents & Publications Microsoft Word - ...

  9. Getting the Lead Out

    DOE R&D Accomplishments [OSTI]

    Gibson, Kerry


    Discarded electronics no longer pose an environmental hazard from lead solder thanks to a lead-free alternative developed at the Ames Laboratory.

  10. International Atomic Energy Agency | National Nuclear Security

    National Nuclear Security Administration (NNSA)

    Administration International Atomic Energy Agency Secretary Moniz awards Hutcheon memorial nonproliferation fellowship to Thomas Gray Energy Secretary Ernest Moniz (second from bottom left, clockwise) and Anne Harrington, NNSA deputy administrator for Defense Nuclear Nonproliferation (sitting next to Moniz), discuss Ian Hutcheon's legacy with his wife Nancy (across from Harrington) and daughter Dana Hutcheon Gordon. Energy... DOE/NNSA's Nonproliferation Experts Lead First Workshop on the

  11. Microsoft Word - Second_ ITER Council Press Release.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Second_ ITER Council Press Release.doc Microsoft Word - Second_ ITER Council Press Release.doc Microsoft Word - Second_ ITER Council Press Release.doc (123.14 KB) More Documents & Publications Before the House Subcommittee on Energy - Committee on Science, Space, and Technology Joint Statement by Energy Ministers of G8, The People's Republic of China, India and The Republic of Korea (June 2008) Joint Statement by Energy Ministers of G8, The People's Republic of China, India and

  12. V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy 85: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability June 25, 2013 - 12:41am Addthis PROBLEM: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability PLATFORM: Apache OpenOffice SDK 3.x ABSTRACT: Apache has acknowledged a vulnerability in Apache OpenOffice SDK REFERENCE LINKS: Apache OpenOffice Secunia Advisory SA53963 Secunia Advisory SA53846 CVE-2013-1571 IMPACT ASSESSMENT:

  13. Microsoft Word - Turbine Manufactures MOU FINAL_5-31-08_.doc | Department

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    of Energy Turbine Manufactures MOU FINAL_5-31-08_.doc Microsoft Word - Turbine Manufactures MOU FINAL_5-31-08_.doc Microsoft Word - Turbine Manufactures MOU FINAL_5-31-08_.doc (65.18 KB) More Documents & Publications Memorandum of Understanding between the U.S. Wind Turbine Manufacturers and the U.S. Department of Energy on Developing a Shared Strategy to Achieve 20% Wind Energy in 2030 Linkages from DOE's Wind Energy Program to Commercial Renewable Power Generation DOE Wind Energy

  14. Microsoft Word - Final_APPROVED_Recommendation2009-01.doc

    Office of Environmental Management (EM)

    DR. ARUN MAJUMDAR DIRECTOR ADVANCED RESEARCH PROJECTS AGENCY-ENERGY U.S. DEPARTMENT OF ENERGY BEFORE THE SUBCOMMITTEE ON INVESTIGATIONS AND OVERSIGHT COMMITTEE ON SCIENCE, SPACE, AND TECHNOLOGY U.S. HOUSE OF REPRESENTATIVES JANUARY 24, 2012 Mr. Chairman, Ranking Member Tonko, and the esteemed Members of this Subcommittee, I want to thank you for inviting me to testify on behalf of the Advanced Research Projects Agency-Energy (ARPA-E) about our recent R&D activities, a recent report by the

  15. Microsoft Word - ARP-III press release Final _2_.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    CH2M-WG Idaho, LLC. News Release For Immediate Release Date: June 23, 2008 Media Contact: Erik Simpson, 208-360-0426 Agencies propose to commence exhumation in third buried waste retrieval area The U.S. Department of Energy (DOE), the U.S. Environmental Protection Agency and the State of Idaho are proposing to expand the removal of buried waste to a third retrieval area at the Idaho National Laboratory Site's Radioactive Waste Management Complex (RWMC). There are currently two adjacent

  16. Microsoft Word - FINAL_PIC_Apr2007_summary.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    4, 2007 FINAL MEETING SUMMARY HANFORD ADVISORY BOARD PUBLIC INVOLVEMENT AND COMMUNICATION COMMITTEE MEETING April 4, 2007 Clackamas, OR Topics in this Meeting Summary Welcome and Introductions ................................................................................................ 1 Tri-Party Agency Quarterly Update - Look Ahead, Look Back ........................................ 1 Budget Meetings

  17. Microsoft Word - FINAL_PIC_Jan2007_summary.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    January 31, 2007 FINAL MEETING SUMMARY HANFORD ADVISORY BOARD PUBLIC INVOLVEMENT AND COMMUNICATION COMMITTEE MEETING January 31, 2007 Richland, WA Topics in this Meeting Summary Welcome and Introductions............................................................................................................. 1 Tri-Party Agency Quarterly Update - Look Ahead, Look Back..................................................... 1 Budget

  18. Microsoft Word - FINAL_PIC_Sept2007_summary.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    September 5, 2007 FINAL MEETING SUMMARY HANFORD ADVISORY BOARD PUBLIC INVOLVEMENT COMMITTEE MEETING September 5, 2007 Seattle, WA Topics in this Meeting Summary Welcome and Introductions ................................................................................................ 1 Tri-Party Agency Update - Look Ahead, Look Back ........................................................ 1 Debrief of Regional Budget Meetings

  19. Environmental Protection Agency

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    ulllicu 3idica Environmental Protection Agency riivirrjlriiiciliar rVruillivitlr~ Systems Laboratory P.O. Box 93478 Las Vegas NV 89193-3478 ctr\/ O",, +-05, " 63 -EOE/DP/00539-061 May 1989 Research and Development . GEPA Off-Site Environmental Monitoring Report Radiation Monitoring Around United. States Nuclear Test Areas, Calendar Year 1988 EPA-600/4-891019 DOE/DP/00539-061 May 1989 Off-Site Environmental Monitoring Report Radiation Monitoring Around United'States Nuclear Test Areas,

  20. Application to Export Electric Energy OE Doc No. EA-339-A Shell...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    78, No. 45 - March 7, 2013 Application to Export Electric Energy OE Doc No. EA-339-A Shell Energy North America (US), L.P.: Federal Register Notice, Volume 78, No. 45 - March 7,...

  1. Microsoft Word - FEMP-State MOU pdf version.doc | Department... (indexed) [DOE]

    FEMP-State MOU pdf version.doc (15.06 KB) More Documents & Publications FEMP Peer Review 2001 FEMP Customer Survey Report (Appendices) Federal Utility Partnership Working Group ...

  2. Microsoft Word - S04516_2008 GW Rpt Cover.doc

    Office of Legacy Management (LM)

    ... along the bank, and the pond becomes nearly choked with green algae in late summer. ... III Annual Groundwater Report October 2007-April 2008 U.S. Department of Energy Doc. No. ...

  3. An Mini-Doc: 2016 Collegiate Wind Competition | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy An Mini-Doc: 2016 Collegiate Wind Competition An Mini-Doc: 2016 Collegiate Wind Competition Addthis In this short documentary, we follow three student teams who participated in the 2016 U.S. Department of Energy Collegiate Wind Competition in New Orleans. The competition provides undergraduate students real-world skills they need to enter tomorrow's clean energy workforce. The challenge is to: develop and deliver a business plan, establish a deployment strategy,

  4. Sulfur Effect and Performance Recovery of a DOC + CSF + Cu-Zeolite SCR

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    System | Department of Energy Sulfur Effect and Performance Recovery of a DOC + CSF + Cu-Zeolite SCR System Sulfur Effect and Performance Recovery of a DOC + CSF + Cu-Zeolite SCR System effect and performance recovery studies at system level with typical diesel emission control consisting of diesel oxidation catalyst, catalyzed soot filter, and selective catalytic reduction deer11_tang.pdf (504.68 KB) More Documents & Publications Investigation of Sulfur Deactivation on Cu/Zeolite SCR

  5. Microsoft Word - PowerTower_work_2009.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    ... conditions due to rapid degradation of steam temperature and pressure. Receiver trip leads to a turbine trip because there is no buffer storage between the receiver and turbine. ...


    SciTech Connect (OSTI)

    M.A. Ebadian, Ph.D.; S.K. Dua; David Roelant; Sachin Kumar


    This report describes a system for handling and radioassay of lead, consisting of a robot, a conveyor, and a gamma spectrometer. The report also presents a cost-benefit analysis of options: radioassay and recycling lead vs. disposal as waste.

  7. Microsoft Word - Contract Administration Long Testimony _FINAL_.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Statement of Gregory H. Friedman Inspector General Department of Energy Before the Subcommittee on Government Management, Organization and Procurement of the Committee on Oversight and Government Reform U.S. House of Representatives FOR RELEASE ON DELIVERY 2:00 PM July 18, 2007 1 Mr. Chairman and members of the Subcommittee, I am pleased to be here today at your request to testify on issues pertaining to contract management at the Department of Energy. More than any other civilian agency in the

  8. Tentative Agreement as it went to public comment.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Tentative Agreement on Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Negotiations on the Overall Strategy and Approach for Hanford Groundwater Protection, Monitoring and Remediation (Tri-Party Agreement Milestone Series M-024) The U.S. Department of Energy, Richland Operations Office (RL), the State of Washington, Department of Ecology, and the U.S. Environmental Protection Agency (EPA), hereinafter referred to as the parties, have concluded negotiations on an

  9. Microsoft Word - FINAL_Recommendation_2008-01.doc

    Office of Environmental Management (EM)

    i Foreword Environmental justice is the fair treatment and meaningful involvement of all people regardless of race, color, national origin, or income with respect to the development, implementation, and enforcement of environmental laws, regulations, and policies. On February 11, 1994, President Clinton issued Executive Order 12898, Federal Actions to Address Environmental Justice in Minority Populations and Low-Income Populations tasked each federal agency to make achieving EJ part of its

  10. Microsoft Word - S05993_CY2009 Annual Rpt.doc

    Office of Legacy Management (LM)

    4-1 4.0 References ATSDR (Agency for Toxic Substances and Disease Registry), 2007. Analyses of Groundwater Flow, Contaminant Fate and Transport, and Distribution of Drinking Water at Tarawa Terrace and Vicinity, U.S. Marine Corps Base Camp Lejeune, North Carolina: Historical Reconstruction and Present Day Conditions, Chapter D, "Properties and Degradation Pathways of Common Organic Compounds in Groundwater," Atlanta, Georgia, September. Carter, R.W. and J. Davidian, 1968. General

  11. Microsoft Word - RAP_Central_Plateau_Milestones_Draft_Advice.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TPA Proposed Changes to Hanford Central Plateau Cleanup Work and Schedule Authors: Cimon, Niles, Catrell, Bouchey, Garnant, Vanni, Mattson, Engstrom, Serres, Leckband Originating Committee: River and Plateau Version #1 :Color: __pink__yellow__green__salmon__purple_X_blue Background (paragraphs numbered to aid review) 1. The Hanford Advisory Board (Board) provides the Tri-Party Agreement (TPA) agencies with policy advice that reflects the Board's core values related to Hanford cleanup. These

  12. Microsoft Word - FOI 2013-00962.Partial.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    21, 2013 CERTIFIED MAIL Mr. Tom Carpenter Hanford Challenge 219 1 st Avenue South Suite 310 Seattle, Washington 98104 Dear Mr. Carpenter: FREEDOM OF INFORMATION ACT REQUEST (FOI 2013-00962) This letter is in response to your Freedom of Information Act (FOIA) request that you sent to this office requesting agency records relating to or generated in connection with classifying Hanford tank waste as transuranic, or TRU, waste that could be sent to the Waste Isolation Pilot Plant (WIPP) in New

  13. Microsoft Word - Final EA for HARC Battleground.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    9 FINAL ENVIRONMENTAL ASSESSMENT BATTLEGROUND ENERGY RECOVERY PROJECT HARRIS COUNTY, TEXAS U.S. DEPARTMENT OF ENERGY National Energy Technology Laboratory OCTOBER 2011 THIS PAGE INTENTIONALLY LEFT BLANK COVER SHEET Responsible Agency: U.S. Department of Energy Title: Final Environmental Assessment for the Battleground Energy Recovery Project (DOE/EA-1769) Location: Deer Park, Harris County, Texas Contact: William J. Gwilliam, Document Manager National Energy Technology Laboratory U.S. Department

  14. Microsoft Word - NovemberHighlights v7.doc

    Gasoline and Diesel Fuel Update

    Updated Buildings Sector Appliance and Equipment Costs and Efficiencies April 2015 Independent Statistics & Analysis U.S. Department of Energy Washington, DC 20585 U.S. Energy Information Administration | Updated Buildings Sector Appliance and Equipment Costs and Efficiencies i This report was prepared by the U.S. Energy Information Administration (EIA), the statistical and analytical agency within the U.S. Department of Energy. By law, EIA's data, analyses, and forecasts are

  15. Microsoft Word - CQA2007W_FINAL.doc

    Gasoline and Diesel Fuel Update

    7) Distribution Category UC-950 Cost and Quality of Fuels for Electric Plants 2006 and 2007 December 2008 Energy Information Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. Department of Energy Washington DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the Department of Energy. The information contained herein should not be construed as advocating or reflecting any policy position of

  16. Microsoft Word - Brochure_Senior Officials.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Preservation of Department of Energy Federal Records __________________________________________ A Reminder for Senior Officials Office of IT Planning, Architecture and E-Government March 2009 Office of the Chief Information Officer 2 Purpose & Scope The Federal Records Act requires the Department of Energy (DOE) to preserve records that reflect the agency functions, policies, decisions, procedures, and operations, as well as documents and datasets that serve as evidence of the

  17. Microsoft Word - National Report 05-02-03.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    May 2003 United States of America National Report Joint Convention on the Safety of Spent Fuel Management and on the Safety of Radioactive Waste Management United States Department of Energy In Cooperation with the United States Nuclear Regulatory Commission United States Environmental Protection Agency United States Department of State -ii- ABSTRACT AND ACKNOWLEDGEMENT The United States of America ratified the "Joint Convention on the Safety of Spent Fuel Management and on the Safety of

  18. Microsoft Word - Second National Report -- Final Rev 30.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    , Rev. 1 October 2005 United States of America Second National Report for the Joint Convention on the Safety of Spent Fuel Management and on the Safety of Radioactive Waste Management United States Department of Energy In Cooperation with the United States Nuclear Regulatory Commission United States Environmental Protection Agency United States Department of State U.S. Second National Report-Joint Convention on the Safety of Spent Fuel Management and on the Safety of Radioactive Waste Management

  19. International Energy Agency

    SciTech Connect (OSTI)

    Claudy, D.E.


    The International Energy Agency (IEA) responded to the 1973-1974 oil embargo with an emergency allocation program outlined in the Agreement on an International Energy Program (IEP), viewed by the US as an executive agreement and by most participants as a treaty. The IEA's four standing groups on Relations with Producer and other Consumer Countries, on Long-Term Cooperation, on the Oil Market, and on Emergency Questions are organized to accommodate co041869flicting interests through voting rights and to allow constructive interaction among intergovernmental bodies. A description of the allocation system and industry's role in emergencies is followed by a summary of US legal requirements relating to these activities. Four appendices reproduce the IEP Agreement and diagram the IEA organizational structure, the IEA emergency allocation system, and the Emergency Management Organization. (DCK)

  20. International energy agency

    SciTech Connect (OSTI)

    Not Available


    The International Energy Agency's emergency oil sharing system is designed to enable member nations to share oil supplied during an oil supply disruption equal to or exceeding 7 percent or more of members' oil supplies. However, participation could have anticompetitive consequences and under U.S. antitrust laws could result in suits against U.S. companies. To ensure participation of major U.S. oil companies, legislation provides a statutory defense against any civil or criminal suit brought under federal or state antitrust laws for some actions. This report describes efforts to expand the antitrust and breach of contract defenses for oil company supply transactions during an oil emergency and to resolve the problem of foreign blockage of information critical to U.S. antitrust review of oil transactions involving foreign affiliates of U.S. companies.

  1. International Energy Agency

    SciTech Connect (OSTI)

    Not Available


    The International Energy Agency's emergency oil sharing system is designed to enable member nations to share oil supplies during an oil supply disruption equal to or exceeding 7 percent or more of members' oil supplies. However, participation could have anticompetitive consequences and under U.S. antitrust laws could result in suits against U.S. companies. To ensure participation of major U.S. oil companies, legislation provides a statutory defense against any civil or criminal suit brought under federal or state antitrust laws for some actions. This report describes efforts to expand the antitrust and breach of contract defenses for oil company supply transactions during an oil emergency and to resolve the problem of foreign blockage of information critical to U.S. antitrust review of oil transactions involving foreign affilitates of U.S. companies.

  2. Assam Energy Development Agency | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Energy Development Agency Jump to: navigation, search Name: Assam Energy Development Agency Place: Guwahati, Assam, India Zip: 781005 Sector: Renewable Energy Product: Nodal agency...

  3. Goa Energy Development Agency | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Goa Energy Development Agency Jump to: navigation, search Name: Goa Energy Development Agency Place: Bardez, Goa, India Zip: 403511 Sector: Renewable Energy Product: Nodal agency...

  4. California Environmental Protection Agency | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Agency Jump to: navigation, search Logo: California Environmental Protection Agency Name: California Environmental Protection Agency Address: 1001 I Street, PO Box 2815 Place:...

  5. Federal Agency NEPA Procedures | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Federal Agency NEPA Procedures Federal Agency NEPA Procedures Each Federal agency is required to develop NEPA procedures that supplement the CEQ Regulations. Developed in...

  6. London Climate Change Agency | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Climate Change Agency Jump to: navigation, search Name: London Climate Change Agency Place: London, Greater London, United Kingdom Zip: SE1 8AA Product: Agency responsible for...

  7. Microsoft Word - part_1_1070307_11.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    to the upper null also leads to excellent heat-flux handling via increased flux expansion. We will commission the cryopump during the 2007 campaign. First we will assess its...

  8. Microsoft Word - PPPL 5-year plan final.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    of the Disruption For the tokamak to succeed as the embodiment of a Fusion Power Plant, we will need a much better understanding of the mechanisms that lead to major...

  9. AcqGuideChapter39pt2.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    --- ------------------------------Chapter 39.2 (June 2005) 1 Guidance on Electronic and Information Technology (EIT) Accessibility - Section 508 References: FAR 2.101 Definitions. FAR 7.103 Agency-head responsibilities. FAR 10.001 Policy. FAR 11.002 Policy. FAR 39.000 Scope of part. FAR 39.2 Electronic and Information Technology. FAR 39.201 Scope of subpart. FAR 39.202 Definition. FAR 39.203 Applicability. FAR 39.204 Exceptions. 36 CFR 1194 Electronic and Information Technology Accessibility

  10. Microsoft Word - HABAdv #169 Budgets Workshop.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    69 Subject: Budget Workshops Adopted: March 4, 2005 Page 1 March 4, 2005 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Roy Schepens, Manager U.S. Department of Energy, Office of River Protection P.O. Box 450 (H6-60) Richland, WA 99352 Re: Budget Workshops Dear Messrs. Klein and Schepens, Background The Tri Party Agreement (TPA) requires that the budget be shared with the regulatory agencies and the public with the intent that there be

  11. Microsoft Word - HABAdv #170 Hanford Buried Waste.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    70 Subject: Hanford Buried Waste Adopted: March 4, 2005 Page 1 March 4, 2005 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Roy Schepens, Manager U.S. Department of Energy, Office of River Protection P.O. Box 450 (H6-60) Richland, WA 99352 Ron Kreizenbeck, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Jay Manning, Director Washington State Department of Ecology P.O. Box 47600

  12. Microsoft Word - 2012_0307_RAP_flipcharts.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    March 7, 2012 200 UP-1 1. Provide Dale with any issues on 200 UP-1 (thru Susan H.) -Dale w/track 2. Wait until RI/FS released to determine how issues were addressed and need for advice (potentially June Board mtg) 3. HAB provided a letter to EPA to provide to R.R.B. - referenced HAB advice relevant to this. Page 1 200 UP-1 (cont'd) 4. HAB members should keep an eye on budget support for GW cleanup 5. Look for agencies to make commitment to add more wells as needed (such a commitment could be

  13. Microsoft Word - FOI 2014-01706.Final.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    CERTIFIED MAIL August 25, 2014 Mr. Scott MacFarlane NBC 4 4001 Nebraska Avenue, NW Washington, D.C. 20016 Dear Mr. MacFarlane: FREEDOM OF INFORMATION ACT REQUEST (FOI 2014-01706) This office is in receipt of your request dated July 31, 2014, that you submitted to the U.S. Department of Energy (DOE), Headquarters Freedom of Information Act (FOIA) office. In that letter you requested "copies of all employee handbook references to dress codes or proper dress at agency offices in the United

  14. Cycling of DOC and DON by Novel Heterotrophic and Photoheterotrophic Bacteria in the Ocean: Final Report

    SciTech Connect (OSTI)

    Kirchman, David L


    The flux of dissolved organic matter (DOM) through aquatic bacterial communities is a major process in carbon cycling in the oceans and other aquatic systems. Our work addressed the general hypothesis that the phylogenetic make-up of bacterial communities and the abundances of key types of bacteria are important factors influencing the processing of DOM in aquatic ecosystems. Since most bacteria are not easily cultivated, the phylogenetic diversity of these microbes has to be assessed using culture-independent approaches. Even if the relevant bacteria were cultivated, their activity in the lab would likely differ from that under environmental conditions. This project found variation in DOM uptake by the major bacterial groups found in coastal waters. In brief, the data suggest substantial differences among groups in the use of high and molecular weight DOM components. It also made key discoveries about the role of light in affecting this uptake especially by cyanobacteria. In the North Atlantic Ocean, for example, over half of the light-stimulated uptake was by the coccoid cyanobacterium, Prochlorococcus, with the remaining uptake due to Synechococcus and other photoheterotrophic bacteria. The project also examined in detail the degradation of one organic matter component, chitin, which is often said to be the second most abundant compound in the biosphere. The findings of this project contribute to our understanding of DOM fluxes and microbial dynamics supported by those fluxes. It is possible that these findings will lead to improvements in models of the carbon cycle that have compartments for dissolved organic carbon (DOC), the largest pool of organic carbon in the oceans.

  15. Lead carbonate scintillator materials

    DOE Patents [OSTI]

    Derenzo, Stephen E.; Moses, William W.


    Improved radiation detectors containing lead carbonate or basic lead carbonate as the scintillator element are disclosed. Both of these scintillators have been found to provide a balance of good stopping power, high light yield and short decay constant that is superior to other known scintillator materials. The radiation detectors disclosed are favorably suited for use in general purpose detection and in medical uses.

  16. Deactivation of Accelerated Engine-Aged and Field-Aged SCR Catalysts and the Role of the DOC [DOE]

    A technique for accelerated aging of SCR system (DOC -> SCR-> DPF) reveals two deactivation mechanisms and replicates field-aged effects

  17. NVN-088208 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    6 months earlier; BLM NOI was just a formality Relevant Numbers Lead Agency Doc Number Serial Number NVN-088208 Lease Numbers NVN-074249 NVN-074250 NVN-074253 NVN-074254 Tiered Doc...

  18. NVN-091276 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20121025 Relevant Numbers Lead Agency Doc Number Serial Number NVN-091276 Lease Numbers NVN-083928 NVN-085708 Tiered Doc DOI-NV-W010-2012-0061...

  19. Bush Administration Plays Leading Role in Studying and Addressing Global

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Climate Change | Department of Energy Plays Leading Role in Studying and Addressing Global Climate Change Bush Administration Plays Leading Role in Studying and Addressing Global Climate Change February 27, 2007 - 3:49pm Addthis Washington, DC - Continuing to take the lead in addressing global climate change, Energy Secretary Samuel Bodman, Environmental Protection Agency (EPA) Administrator Stephen Johnson, and National Oceanic and Atmospheric Administration (NOAA) Administrator Vice

  20. lead paint chart

    Office of Environmental Management (EM)

    1930 Assume Lead Will WX Disturb Paint? No Yes Will WX Disturb More than 2 ft 2 . per Room? Yes HUD Housing or Using HUD ? Yes More than 50ugm 3 ? No LSW & HUD Rule 35.900 **...

  1. Lead carbonate scintillator materials

    DOE Patents [OSTI]

    Derenzo, S.E.; Moses, W.W.


    Improved radiation detectors containing lead carbonate or basic lead carbonate as the scintillator element are disclosed. Both of these scintillators have been found to provide a balance of good stopping power, high light yield and short decay constant that is superior to other known scintillator materials. The radiation detectors disclosed are favorably suited for use in general purpose detection and in medical uses. 3 figures.

  2. Application of a Turbulent Metal Foil Substrate for a PGM optimized DOC on

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    a U.S. HD Diesel Engine | Department of Energy a Turbulent Metal Foil Substrate for a PGM optimized DOC on a U.S. HD Diesel Engine Application of a Turbulent Metal Foil Substrate for a PGM optimized DOC on a U.S. HD Diesel Engine Lower platinum-metal group catalysts can be used to save money while offering equivalent or better hydrocarbon performanc and longer life and durability. deer08_kramer.pdf (131.83 KB) More Documents & Publications Design Potential of Metal Foil Substrates for

  3. Application to Export Electric Energy OE Doc No. EA-339-A Shell Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    North America (US), L.P. | Department of Energy Doc No. EA-339-A Shell Energy North America (US), L.P. Application to Export Electric Energy OE Doc No. EA-339-A Shell Energy North America (US), L.P. Application from Shell Energy to export electric energy to Canada. EA-339-A Shell Energy (CN).pdf (423.87 KB) More Documents & Publications EA-339-A Shell Energy North America (US), L.P. EA-339 Shell Energy North America (US), L.P. EA-359-B Castleton Commodities Merchant Trading L.P.

  4. Mini-Doc: Behind the Scenes at the Collegiate Wind Competition |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Mini-Doc: Behind the Scenes at the Collegiate Wind Competition Mini-Doc: Behind the Scenes at the Collegiate Wind Competition July 5, 2016 - 11:15am Addthis Simon Edelman Simon Edelman Chief Creative Officer Paul Lester Paul Lester Digital Content Specialist, Office of Public Affairs In this short documentary, we follow three student teams who participated in the 2016 U.S. Department of Energy Collegiate Wind Competition in New Orleans. The

  5. Microsoft Word - RL14788-Section_J-1 Acronym.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    ... Package HWIS Hanford Well Information System IAEA International Atomic Energy Agency IAMIT Inter-Agency Management Integration Team IBR Initial Baseline Review IDF Integrated ...

  6. Microsoft Word - AR OU III April 09 subject.doc

    Office of Legacy Management (LM)

    Administrative Record, Monticello Mill Tailings Site Operable Unit III, Subject Index April 2009 File Index: MRAP 1.11 page 1 of 10 Administrative Record for the U.S. Department of Energy Monticello Mill Tailings Site (MMTS), Operable Unit III (OU III), Monticello Ground Water Remedial Action Project (MSGRAP) Monticello, Utah Subject Index Note: This Administrative Record contains documents specifically relevant to Operable Unit III leading up to the Record of Decision in October 2004. Later

  7. Microsoft Word - NTS Security Upgrades-Article _2_.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    NTS Security Upgrades in Full Swing NTS takes 21 st century technology lead From 1992 to 2004 the Nevada Test Site (NTS) sat underutilized. A moratorium had eliminated the primary mission of the NTS - underground nuclear testing. The stringent security requirements needed to safeguard operations would go a decade without upgrades or improvements. But in 2004, the National Nuclear Security Administration (NNSA) tasked the Nevada Site Office with a new nuclear materials mission. "Our security


    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PROJECTS AGENCY - ENERGY Jan Feb Mar Apr May Jun July Aug Sep Oct Nov Dec Jan Feb Mar Apr May Jun July Aug Sep Oct Nov Dec Jan Feb Mar Apr May Jun July Aug Sep Oct Nov Dec ...

  9. TPA Agency Contacts - Hanford Site

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    WA 99352 Phone: 509-376-5803 Fax: 509-376-1563 E-mail: Emerald Laija U.S. Environmental Protection Agency 825 Jadwin Ave Suite 210 Richland, WA...


    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5 - 2013 2014 2015 2016 ADVANCED RESEARCH PROJECTS AGENCY - ENERGY Jan Feb Mar Apr May Jun July Aug Sep Oct Nov Dec Jan Feb Mar Apr May Jun July Aug Sep Oct Nov Dec Jan Feb Mar Apr...

  11. Energy Standards for State Agencies [DOE]

    In May 2006 the governor of Alabama issued Executive Order 33 mandating that state departments and agencies encourage and promote the conservation of energy in state-owned buildings. In November...

  12. Microsoft Word - S05773_2009 VerifMonRpt.doc

    Office of Legacy Management (LM)

    September 2009 LMS/DUP/S05773 This page intentionally left blank LMS/DUP/S05773 Office of Legacy Management Verification Monitoring Report for the Durango, Colorado, Processing Site September 2009 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report-Durango, Colorado, Processing Site September 2009 Doc. No. S05773 Page i Contents

  13. Microsoft Word - S07693_5-yr review rpt.doc

    Office of Legacy Management (LM)

    Third Five-Year Review Report for the Rocky Flats Site Jefferson and Boulder Counties, Colorado July 2012 LMS/RFS/S07693 This page intentionally left blank U.S. Department of Energy Third Five-Year Review Report for the Rocky Flats, Colorado, Site July 2012 Doc. No. S07693 Page i Contents Abbreviations ................................................................................................................................. iv Executive Summary

  14. NVN-091277 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Relevant Numbers Lead Agency Doc Number Serial Number NVN-091277 Proposed Action Conduct water sampling, archaeological surveys, and shallow temperature surveys. Data Completion...

  15. NVN-086287 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20081203 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086287 Lease Numbers NVN-074855 Proposed Action Installation and sampling...

  16. NVN-91276 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Mineral Manager none provided Selected Dates Relevant Numbers Lead Agency Doc Number Serial Number NVN-091276 Data Completion Notes No documents from which to populate page. 9...

  17. NVN-087930 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Decision Document Date 20090916 Relevant Numbers Lead Agency Doc Number NVN-087930 Serial Number NVN-087930 Lease Numbers NVN-018423 NVN-076291 NVN-083928 NVN-085708 NVN-085709...

  18. NVN-89276 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89276 Proposed Action Geochemical survey Documents Serial Register Page:...

  19. NVN-087809 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Decision Document Date 20090612 Relevant Numbers Lead Agency Doc Number NV-087809 Serial Number NV-087809 Lease Numbers NVN-085710 NVN-085711 Proposed Action A Gravity...

  20. NVN-086761 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20090224 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086761 Lease Numbers NVN-079305 NVN-079306 NVN-079307 Proposed Action...

  1. NVN-086286 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    NOI, POO Decision Document Date 20081201 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086286 Lease Numbers NVN-085722 NVN-085723 NVN-085724 Proposed Action The...

  2. NVN-087791 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20090721 Relevant Numbers Lead Agency Doc Number Serial Number NVN-087791 Lease Numbers NVN-074854 NVN-076298 NVN-076299 NVN-076300 NVN-076301...

  3. NVN-086285 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20081201 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086285 Lease Numbers NVN-083928 NVN-085708 NVN-085709 Proposed Action The...

  4. NVN-088259 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20100317 Relevant Numbers Lead Agency Doc Number Serial Number NVN-088259 Lease Numbers NVN-074308 NVN-074309 Proposed Action Closely spaced...

  5. NVN-89275 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89275 Proposed Action Geophysical surveys. Documents Serial Register Page:...

  6. NVN-087812 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20090721 Relevant Numbers Lead Agency Doc Number Serial Number NVN-087812 Lease Numbers NVN-074854 NVN-076298 NVN-076299 NVN-076300 NVN-076301...

  7. NVN-89278 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89278 Proposed Action Geophysical survey. Documents Serial Register Page:...

  8. NVN-89274 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89274 Lease Numbers NVN-085716 NVN-086893 NVN-088920 Proposed Action...

  9. NVN-087811 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20090721 Relevant Numbers Lead Agency Doc Number Serial Number NVN-087811 Lease Numbers NVN-074854 NVN-076298 NVN-076299 NVN-076300 NVN-076301...

  10. NVN-89534 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Date 20110302 Application Document Type NOI Relevant Numbers Lead Agency Doc Number Serial Number NVN-089534 Lease Numbers NVN-083928 NVN-077668 Proposed Action Two thermal...

  11. NVN-89292 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-089292 Lease Numbers NVN-088435 NVN-088436 NVN-088437 Proposed Action...


    DOE Patents [OSTI]

    Widmaier, W.


    A means for breaking an electrical circuit within an electronic tube during the process of manufacture is described. Frequently such circuits must be employed for gettering or vapor coating purposes, however, since an external pair of corector pins having no use after manufacture, is undesirable, this invention permits the use of existing leads to form a temporary circuit during manufacture, and severing it thereafter. One portion of the temporary circuit, made from a springy material such as tungsten, is spot welded to a fusable member. To cut the circuit an external radiant heat source melts the fusable member, allowing the tensed tungsten spring to contract and break the circuit. This inexpensive arrangement is particularly useful when the tube has a great many external leads crowded into the tube base.

  13. Utah Municipal Power Agency | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Municipal Power Agency Place: Utah Phone Number: (801) 798-7489 Website: Facebook: https:www.facebook.compagesUtah-Municipal-Power-Agency152219714819535 Outage...

  14. Federal Energy Management: Helping Agencies Achieve Savings [DOE]

    The Federal Energy Management Program guides and advises agencies on how to use funding more effectively in meeting federal and agency-specific energy goals.

  15. Energy Agency Coordinators for Energy Action Month [DOE]

    Agency coordinators serve as primary Federal agency points of contact for Energy Action Month. Contact them if you have questions about implementing an Energy Action Month campaign.

  16. European Space Agency | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Space Agency Jump to: navigation, search Name: European Space Agency Place: Paris, France Zip: 75738 Sector: Services, Solar Product: String representation "ESAs job is ......

  17. Minnesota Pollution Control Agency | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Pollution Control Agency Jump to: navigation, search Name: Minnesota Pollution Control Agency Place: St. Paul, Minnesota Zip: 55155-4194 Product: Focused on reducing and preventing...

  18. Chhattisgarh Renewable Energy Development Agency CREDA | Open...

    Open Energy Information (Open El) [EERE & EIA]

    Chhattisgarh Renewable Energy Development Agency CREDA Jump to: navigation, search Name: Chhattisgarh Renewable Energy Development Agency (CREDA) Place: Raipur, Chhattisgarh, India...

  19. Uttaranchal Renewable Energy Development Agency UREDA | Open...

    Open Energy Information (Open El) [EERE & EIA]

    Uttaranchal Renewable Energy Development Agency UREDA Jump to: navigation, search Name: Uttaranchal Renewable Energy Development Agency (UREDA) Place: Dehradun, Uttaranchal, India...

  20. Greenspan Agency Ltd | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Greenspan Agency Ltd Jump to: navigation, search Name: Greenspan Agency Ltd Place: Edinburgh, United Kingdom Zip: EH1 3LH Sector: Renewable Energy Product: Edinburgh-based...