National Library of Energy BETA

Sample records for lajos grof-tisza doc

  1. Lajos Grof-Tisza

    Energy.gov [DOE]

    Mr. Lajos Grof-Tisza joined the Department of Energy in 2003 and currently serves as the Director of Corporate Information Systems. As the Director of Corporate Information Systems, Mr. Grof-Tisza...

  2. raising_investment_funds_for_clean_energy_programs.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc Microsoft ...

  3. webinar_innovation_net_metering_interconnection.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    netmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc webinarinnovationnetmeteringinterconnec...

  4. howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc (117.5 KB) More Documents & Publications How to Design and Market Energy Efficiency Programs to Specific Neighborhoods Using Social Media to Engage the Community in Energy Efficiency

  5. highperformanceleasingstrategiesforstateandlocalgovernments.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc (93 KB) More Documents & Publications High Performance Leasing Strategies for State and Local Governments Leveraging Portfolio Manager for Disclosure and Green Leasing Practices

  6. webinar_innovation_organizing_strategizing.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    organizingstrategizing.doc webinarinnovationorganizingstrategizing.doc webinarinnovationorganizingstrategizing.doc webinarinnovationorganizingstrategizing.doc (71 KB) ...

  7. Doc...~En.

    Office of Legacy Management (LM)

    ... ..,,..,.... - .. I&i3:scD .::-:, TO-340 .":: ..' . - ' - -. ' . .." ,.. .;.. Very traly yours;, -' .X :, Doc...En. ' Br.:Re&ng ';;a' : , Div. Reading File ., ,, ., ,.-...

  8. Doc.~:Ru.

    Office of Legacy Management (LM)

    .' , .' c,j .c; Distriblition: ;. <; ..,:L.D.i&%.ay,FiN-OR00 Doc.:Ru. ,.,. 75. ' Br..Reading 'ire' ,lliv. Read&q File ,: '. ,, .-' . ...: - SURNAME.....

  9. exploringpowerpurchaseagreementsthebasicspart1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc (112.5 KB) More Documents & Publications Exploring Power Purchase Agreements - The Basics Part 1

  10. finance_programs.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    financeprograms.doc financeprograms.doc financeprograms.doc Microsoft Office document icon financeprograms.doc More Documents & Publications Tools for Designing & Implementing ...

  11. webinar_innovation_permitting_inspections.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    permittinginspections.doc webinarinnovationpermittinginspections.doc webinarinnovationpermittinginspections.doc webinarinnovationpermittinginspections.doc (70.5 KB) More ...

  12. webinar_innovation_planning_zoning.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    planningzoning.doc webinarinnovationplanningzoning.doc webinarinnovationplanningzoning.doc webinarinnovationplanningzoning.doc (65.5 KB) More Documents & Publications ...

  13. webinar_innovation_financing.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    financing.doc webinarinnovationfinancing.doc webinarinnovationfinancing.doc webinarinnovationfinancing.doc (77 KB) More Documents & Publications webinarinnovationplanningz...

  14. fed_finance_facilities_ee_upgrades_deployment.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc Microsoft Office document icon ...

  15. Microsoft Word - ContractManagementPlanningDRIVERS.doc | Department...

    Energy.gov [DOE] (indexed site)

    ContractManagementPlanningDRIVERS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS.doc Microsoft Word - ARRAMOModelMod.doc...

  16. Category:NEPA Doc | Open Energy Information

    OpenEI (Open Energy Information) [EERE & EIA]

    NEPA Doc Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Category: NEPA Documents Collections Add.png Add a new NEPA Document Collection Pages in category "NEPA Doc"...

  17. spurring_local_economic_development_clean_energy_programs.doc...

    Energy.gov [DOE] (indexed site)

    spurringlocaleconomicdevelopmentcleanenergyprograms.doc spurringlocaleconomicdevelopmentcleanenergyprograms.doc More Documents & Publications Spurring Local Economic...

  18. advanced_biofuels_pathways_webinar_alt_text.doc | Department...

    Energy.gov [DOE] (indexed site)

    advancedbiofuelspathwayswebinaralttext.doc advancedbiofuelspathwayswebinaralttext.doc (113 KB) More Documents & Publications Sustainability for the Global Biofuels ...

  19. Microsoft Word - AL2006-08.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    8.doc Microsoft Word - AL2006-08.doc PDF icon Microsoft Word - AL2006-08.doc More Documents & Publications AL2007-05.doc&0; Microsoft Word - AL2005-14.doc Microsoft Word - ...

  20. Microsoft Word - AL2005-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5-03.doc Microsoft Word - AL2005-03.doc PDF icon Microsoft Word - AL2005-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - AL2006-08.doc ...

  1. Microsoft Word - AL2002-03.doc | Department of Energy

    Office of Environmental Management (EM)

    2-03.doc Microsoft Word - AL2002-03.doc PDF icon Microsoft Word - AL2002-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - FAL2004-01.doc...

  2. Microsoft Word - FAL2004-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - FAL2004-01.doc PDF icon Microsoft Word - FAL2004-01.doc More Documents & Publications Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-02.doc...

  3. Microsoft Word - 98-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    8-11.doc Microsoft Word - 98-11.doc PDF icon Microsoft Word - 98-11.doc More Documents & Publications Microsoft Word - AL2006-08.doc Microsoft Word - AL2005-01.doc Microsoft Word -...

  4. deepenergyretrofitsandstateapplications.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    deepenergyretrofitsandstateapplications.doc deepenergyretrofitsandstateapplications.doc deepenergyretrofitsandstateapplications.doc deepenergyretrofitsandstateapplications.doc (117.5 KB) More Documents & Publications Deep Energy Retrofits & State Applications Sustainable Energy Resources for Consumers Webinar on Residential Geothermal Heat Pump Retrofit Transcript Interior Lighting Efficiency for Municipalities

  5. Engaging Financial Institution Partners Transcript.doc | Department...

    Office of Environmental Management (EM)

    Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Microsoft ...

  6. Microsoft Word - SpecialTermsandConditions0506.doc | Department...

    Energy Saver

    Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc More Documents &...

  7. Microsoft Word - FY2005finaliparhandbook.doc | Department of...

    Energy Saver

    Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc More Documents & Publications...

  8. Microsoft Word - ARRAAttachment2.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAAttachment2.doc Microsoft Word - ARRAAttachment2.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment3.rtf Microsoft Word -...

  9. Microsoft Word - ARRAMOModelMod.doc | Department of Energy

    Energy Saver

    ARRAMOModelMod.doc Microsoft Word - ARRAMOModelMod.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS...

  10. Microsoft Word - ARRAModelWAS.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ARRAModelWAS.doc Microsoft Word - ARRAModelWAS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAMOModelMod...

  11. Microsoft Word - CMPTemplate031307.doc | Department of Energy

    Office of Environmental Management (EM)

    CMPTemplate031307.doc Microsoft Word - CMPTemplate031307.doc PDF icon Microsoft Word - CMPTemplate031307.doc More Documents & Publications Chapter 42 - Contract Administration...

  12. Microsoft Word - August06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    August06.doc Microsoft Word - August06.doc PDF icon Microsoft Word - August06.doc More Documents & Publications Microsoft Word - April

  13. Microsoft Word - FY10PropertyBSCContractor.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor.doc PDF icon Microsoft Word - FY10PropertyBSCContractor.doc More Documents & Publications Microsoft Word - ...

  14. Microsoft Word - GJPPGPracticesDraft.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    GJPPGPracticesDraft.doc Microsoft Word - GJPPGPracticesDraft.doc PDF icon Microsoft Word - GJPPGPracticesDraft.doc More Documents & Publications 1 DOE Purchase Card Policy Natural ...

  15. Microsoft Word - Cross Reference Matrix Introduction.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Cross Reference Matrix Introduction.doc Microsoft Word - Cross Reference Matrix Introduction.doc PDF icon Microsoft Word - Cross Reference Matrix Introduction.doc More Documents & ...

  16. Microsoft Word - April06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    April06.doc Microsoft Word - April06.doc PDF icon Microsoft Word - April06.doc More Documents & Publications Secretary Directs FPO to Prepare Strategic Plan Microsoft Word - August

  17. Ammendment 2.doc | Department of Energy

    Energy.gov [DOE] (indexed site)

    Ammendment 2.doc More Documents & Publications Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&0; RFQ DE-RQ01-04ME90001.doc&0; Attachment 3-Past Performance...

  18. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Doc. No. S06401 June 2010 Page B-2 U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. ...

  19. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page I-3 U n c o n t r o l l e d c o p y Long-Term Surveillance and Maintenance ...

  20. Microsoft Word - AL2005-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    7.doc Microsoft Word - AL2005-07.doc PDF icon Microsoft Word - AL2005-07.doc More Documents & Publications Microsoft Word - AL2006-07.doc OPAM Policy Acquisition Guides Initial ...

  1. Microsoft Word - AL2005-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - AL2005-01.doc PDF icon Microsoft Word - AL2005-01.doc More Documents & Publications Microsoft Word - AL2006-08.doc Acquisition Letter Archive listing ...

  2. Microsoft Word - AL2006-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - AL2006-01.doc PDF icon Microsoft Word - AL2006-01.doc More Documents & Publications Microsoft Word - al2005-06.doc Chapter 19 - Small Business Programs OPAM...

  3. Microsoft Word - Flash2007-43.doc | Department of Energy

    Office of Environmental Management (EM)

    43.doc Microsoft Word - Flash2007-43.doc Microsoft Word - Flash2007-43.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash...

  4. Microsoft Word - AL2005-16.doc | Department of Energy

    Office of Environmental Management (EM)

    6.doc Microsoft Word - AL2005-16.doc PDF icon Microsoft Word - AL2005-16.doc More Documents & Publications Microsoft Word - AL2005-10.doc Audit Report: IG-0860 Microsoft Word -...

  5. Microsoft Word - AL2005-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5-02.doc Microsoft Word - AL2005-02.doc PDF icon Microsoft Word - AL2005-02.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc...

  6. Microsoft Word - AL2006-02.doc | Department of Energy

    Energy Saver

    2.doc Microsoft Word - AL2006-02.doc PDF icon Microsoft Word - AL2006-02.doc More Documents & Publications Microsoft Word - AL2006-03.doc Archived Financial Assistance Letters...

  7. Microsoft Word - AL2006-03.doc | Department of Energy

    Energy Saver

    3.doc Microsoft Word - AL2006-03.doc PDF icon Microsoft Word - AL2006-03.doc More Documents & Publications Microsoft Word - AL2006-02.doc Archived Financial Assistance Letters...

  8. Microsoft Word - al2005-04.doc | Department of Energy

    Energy Saver

    al2005-04.doc Microsoft Word - al2005-04.doc PDF icon Microsoft Word - al2005-04.doc More Documents & Publications AL2005-04ClassDeviation.pdf Microsoft Word - Matrixpart2.doc...

  9. Microsoft Word - AL2005-14.doc | Department of Energy

    Office of Environmental Management (EM)

    4.doc Microsoft Word - AL2005-14.doc PDF icon Microsoft Word - AL2005-14.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc...

  10. al99-06attachment.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    attachment.doc&0; al99-06attachment.doc&0; PDF icon al99-06attachment.doc&0; More Documents & Publications Microsoft Word - AL2000-05Attachment.doc Microsoft Word - NSRC...

  11. Microsoft Word - FWP- Fact Sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FWP- Fact Sheet.doc Microsoft Word - FWP- Fact Sheet.doc PDF icon Microsoft Word - FWP- Fact Sheet.doc More Documents & Publications Microsoft Word - FOA cover sheet.doc Microsoft ...

  12. Microsoft Word - AL2005-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2005-10.doc Microsoft Word - AL2005-10.doc Microsoft Word - AL2005-10.doc (133.11 KB) More Documents & Publications Microsoft Word - AL2005-16.doc Audit Report: IG-0860 Microsoft ...

  13. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    SAR.doc Microsoft Word - PeerReviewSAR.doc Microsoft Word - PeerReviewSAR.doc (13.47 KB) More Documents & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross ...

  14. Index2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Index2.doc Index2.doc Index2.doc (11.46 KB) More Documents & Publications Sylvania Corporation, Hicksville, NY and Bayside, NY - Addendum to July 8, 2004 O:\HOMEPAGE\FOIA\report99.PDF&#0; U.S. Department of Energy 2004 Annual Report

  15. SubcontractingGuidelines.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; (245.71 KB) More Documents & Publications Guidance of the Department of Energy Subcontracting Program Acquisition Guide Chapter 19 Update Chapter 19 - Small Business Programs

  16. Microsoft Word - Matrixpart1.doc | Department of Energy

    Energy.gov [DOE] (indexed site)

    Matrixpart1.doc More Documents & Publications Part 1, Clauses Prescribed in FAR Part 52 Microsoft Word - Matrixpart2.doc...

  17. csep_transcript_arlington.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Office document icon cseptranscriptarlington.doc More Documents & Publications Tools for Designing & Implementing Better Finance Programs financeprograms.doc financeprograms

  18. csep_transcript_aspen.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    aspen.doc csep_transcript_aspen.doc csep_transcript_aspen.doc csep_transcript_aspen.doc (45.5 KB) More Documents & Publications highperformanceleasingstrategiesforstateandlocalgovernments.doc Using Social Media to Engage the Community in Energy Efficiency Projects.doc webinar_innovation_permitting_inspections

  19. csep_transcript_minneapolis.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    minneapolis.doc csep_transcript_minneapolis.doc csep_transcript_minneapolis.doc csep_transcript_minneapolis.doc (60.5 KB) More Documents & Publications newguideforcommunityenergystrategicplanning.doc csep_transcript_aspen.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, 2011 (Text Version)

  20. Microsoft Word - AL2007-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    7-01.doc Microsoft Word - AL2007-01.doc Microsoft Word - AL2007-01.doc (151.65 KB) More Documents & Publications Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc Microsoft Word - Corp Impl 10-05-06.final.doc Microsoft Word - AL2006-11.doc

  1. PIC DOC 01/08/11 ? SOS

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    PIC DOC 010811 - SOS Content Outline 1) Usable Quotes We shouldn't equate public involvement with meetings. Maynard Plahuta Meetings, of many kinds, are probably the most...

  2. Associate Research Physicist (Post Doc, Experimental Research...

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Post Doc, Experimental Research, NSTX-U, Radio Frequency Waves) Department: Research Staff: RM1 Requisition Number: 1500421 The Princeton Plasma Physics Laboratory (PPPL) seeks to...

  3. csep_transcript_transportation.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    transportation.doc csep_transcript_transportation.doc csep_transcript_transportation.doc csep_transcript_transportation.doc (48 KB) More Documents & Publications csep_transcript_minneapolis.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, 2011 (Text Version) Transcript: Biomass Clean Cities Webinar - Workforce Development

  4. Microsoft Word - FAL2004-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAL2004-03.doc Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-03.doc (538.96 KB) More Documents & Publications Microsoft Word - FAL2004-01.doc Financial Assistance Letter No. FAL 2006-04 Microsoft Word - FAL2006-04.doc

  5. Microsoft Word - AL2000-05.doc | Department of Energy

    Energy Saver

    .doc Microsoft Word - AL2000-05.doc PDF icon Microsoft Word - AL2000-05.doc More Documents & Publications al99-06.doc&0; Microsoft Word - AL2000-05Attachment.doc AL2004-01r2.pdf...

  6. transcript_pv_mapper.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    transcript_pv_mapper.doc transcript_pv_mapper.doc transcript_pv_mapper.doc transcript_pv_mapper.doc (74.5 KB) More Documents & Publications PVMapper: A Tool for Energy Siting transcript_jedi_model.doc 2009 National Electric Transmission Congestion Study - San Francisco Workshop

  7. Property:NEPA TieredDoc | Open Energy Information

    OpenEI (Open Energy Information) [EERE & EIA]

    TieredDoc Jump to: navigation, search Property Name NEPA TieredDoc Property Type Page This is a property of type Page. Pages using the property "NEPA TieredDoc" Showing 25 pages...

  8. Microsoft Word - al95-14.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    al95-14.doc Microsoft Word - al95-14.doc PDF icon Microsoft Word - al95-14.doc More Documents & Publications Cooperation with the New Independent States of the Former Soviet Union ...

  9. Microsoft Word - AL2006-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    7.doc Microsoft Word - AL2006-07.doc PDF icon Microsoft Word - AL2006-07.doc More Documents & Publications OPAM Policy Acquisition Guides Personal Property Management Certification ...

  10. Microsoft Word - FAC2005-27.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAC2005-27.doc Microsoft Word - FAC2005-27.doc PDF icon Microsoft Word - FAC2005-27.doc More Documents & Publications Policy Flash 2015-07 - FAC 2005-78 Policy Flash Search Listing ...

  11. Microsoft Word - al96-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    6-09.doc Microsoft Word - al96-09.doc PDF icon Microsoft Word - al96-09.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis Chapter...

  12. Microsoft Word - AL2005-08.doc | Department of Energy

    Office of Environmental Management (EM)

    8.doc Microsoft Word - AL2005-08.doc Microsoft Word - AL2005-08.doc More Documents & Publications OPAM Policy Acquisition Guides Attachment FY2011-28 OPAM Microsoft Word -...

  13. Microsoft Word - FAC2005-19.doc | Department of Energy

    Office of Environmental Management (EM)

    FAC2005-19.doc Microsoft Word - FAC2005-19.doc Microsoft Word - FAC2005-19.doc More Documents & Publications Acquisitlon Letter No. AL 2008-06 AL2008-06.pdf fac2001-27.pdf...

  14. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word -...

  15. Microsoft Word - FORM46002.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    2.doc Microsoft Word - FORM46002.doc Microsoft Word - FORM46002.doc More Documents & Publications DOE F 4600.2 ATTACHMENT FLASH 2011-46(6) Attachment FY2011-63 OPAM...

  16. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc More Documents & Publications Microsoft Word - AL 2010-07 Acquistion Letters Remaining...

  17. Microsoft Word - ARRAAttachment12v1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment12v1.doc More Documents & Publications Microsoft Word - DRAFT CRB Interview Guidance.doc Microsoft Word - ARRAGuideAttachment10v1

  18. Microsoft Word - AL2000-01.doc | Department of Energy

    Office of Environmental Management (EM)

    AL2000-01.doc Microsoft Word - AL2000-01.doc PDF icon Microsoft Word - AL2000-01.doc More Documents & Publications ALFAL 99-01 Department of Energy No Microsoft Word -...

  19. Microsoft Word - AL2008-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2008-06.doc Microsoft Word - AL2008-06.doc PDF icon Microsoft Word - AL2008-06.doc More Documents & Publications Chapter 9 - Contracting Qualifications Microsoft Word - PART...

  20. Microsoft Word - 99-04.doc | Department of Energy

    Energy.gov [DOE] (indexed site)

    Word - 99-04.doc More Documents & Publications Policy Flash 2014-18 Complex-Wide Strategic Sourcing Microsoft Word - AL2000-01.doc Microsoft Word - AL2005-11.doc...

  1. Microsoft Word - AL2006-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    0.doc Microsoft Word - AL2006-10.doc PDF icon AL2006-10 More Documents & Publications Microsoft Word - Matrixpart2.doc Microsoft Word - AcqGuide70pt52Matrixpart2Redo...

  2. Microsoft Word - AL2004-02.doc | Department of Energy

    Energy.gov [DOE] (indexed site)

    Microsoft Word - AL2004-02.doc More Documents & Publications Microsoft Word - AL2005-02.doc Microsoft Word - al2005-04.doc Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all...

  3. Microsoft Word - al95-06.doc | Department of Energy

    Energy Saver

    5-06.doc Microsoft Word - al95-06.doc PDF icon Microsoft Word - al95-06.doc More Documents & Publications ppl970-1.pdf Audit Report: IG-0589 Inspection Report: INS-O-02-01...

  4. Microsoft Word - meritrev.doc | Department of Energy

    Energy Saver

    Microsoft Word - meritrev.doc Microsoft Word - meritrev.doc PDF icon Microsoft Word - meritrev.doc More Documents & Publications Policy Flash 2013-38 Revised Merit Review Guide For...

  5. Operating Guidelines Appendix C D.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Operating Guidelines Appendix C D.DOC&0; Operating Guidelines Appendix C D.DOC&0; PDF icon Operating Guidelines Appendix C D.DOC&0; More Documents & Publications Operating ...

  6. Microsoft Word - AL2006-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2006-11.doc Microsoft Word - AL2006-11.doc PDF icon Microsoft Word - AL2006-11.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis...

  7. Microsoft Word - FAL2006-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAL2006-03.doc Microsoft Word - FAL2006-03.doc PDF icon Microsoft Word - FAL2006-03.doc More Documents & Publications Financial Assistance Letter No. FAL 2006-03 Microsoft Word - ...

  8. Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc |...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Speech 082508 FINAL.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc More Documents & Publications Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc ...

  9. Microsoft Word - 2005 FOIA ANNUAL REPORT.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    2005 FOIA ANNUAL REPORT.doc Microsoft Word - 2005 FOIA ANNUAL REPORT.doc report2005.pdf PDF icon Microsoft Word - 2005 FOIA ANNUAL REPORT.doc More Documents & Publications U.S. ...

  10. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2008-05.doc Microsoft Word - AL2008-05.doc PDF icon Microsoft Word - AL2008-05.doc More Documents & Publications Acquisition Letters Remaining In Effect Acquisition Letters ...

  11. Microsoft Word - Matrixpart2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Matrixpart2.doc Microsoft Word - Matrixpart2.doc PDF icon Microsoft Word - Matrixpart2.doc More Documents & Publications AcqGuide70.52Matrixpart2Redo-OPAM Microsoft Word - ...

  12. Microsoft Word - al2004-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    al2004-03.doc Microsoft Word - al2004-03.doc PDF icon Microsoft Word - al2004-03.doc More Documents & Publications Acquisition Letter: AL2005-08 OPAM Policy Acquisition Guides ...

  13. Microsoft Word - FY09PropertyBSCContractor.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FY09PropertyBSCContractor.doc Microsoft Word - FY09PropertyBSCContractor.doc PDF icon Microsoft Word - FY09PropertyBSCContractor.doc More Documents & Publications FY09 Property ...

  14. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAL2004-05.doc Microsoft Word - FAL2004-05.doc PDF icon Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word - Section ...

  15. Microsoft Word - Brochure_Senior Officials.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    BrochureSenior Officials.doc Microsoft Word - BrochureSenior Officials.doc Microsoft Word - BrochureSenior Officials.doc (29.28 KB) More Documents & Publications Preservation of ...

  16. Microsoft Word - CSATCourseCatalog_02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    CSATCourseCatalog02.doc Microsoft Word - CSATCourseCatalog02.doc classroom-1008856960720.jpg Microsoft Word - CSATCourseCatalog02.doc (554.38 KB) More Documents & Publications ...

  17. Microsoft Word - May2009.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    May2009.doc Microsoft Word - May2009.doc Microsoft Word - May2009.doc (6.77 MB) More Documents & Publications Special Resource StudyEnvironmental Assessment for Manhattan Project ...

  18. Operating Guidelines Appendix A B.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Operating Guidelines Appendix A B.DOC&#0; Operating Guidelines Appendix A B.DOC&#0; Operating Guidelines Appendix A B.DOC&#0; (73.17 KB) More Documents & Publications Operating Guidelines Appendix C D.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; DOE HR Guidebook 12_15_05.DOC&#0;

  19. Microsoft Word - CERFDOE Final Report - 071204.doc | Department...

    Office of Environmental Management (EM)

    Microsoft Word - CERFDOE Final Report - 071204.doc (394.42 KB) More Documents & Publications Integrated Project Team RM DOE EIR FM.doc Independent Oversight Activity Report, ...

  20. DOE EIR FM.doc | Department of Energy

    Office of Environmental Management (EM)

    EIR FM.doc PDF icon DOE EIR FM.doc More Documents & Publications Contractor Statement of Work (SOW) Template (for EIR) External Independent Review (EIR) Standard Operating...

  1. Microsoft Word - ADR-Provisions-FederalAcquisitionReg.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications ADR Provisions in Federal Acquisition Regulation (FAR) Microsoft Word - ACQUISITION LETTER.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc...

  2. Microsoft Word - AL2005-12.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon Microsoft Word - AL2005-12.doc More Documents & Publications Microsoft Word - AL2005-11.doc OPAM Policy Acquisition Guides Chapter 31 - Contract Cost Principles...

  3. expanding_chp_in_your_state.doc | Department of Energy

    Energy.gov [DOE] (indexed site)

    expandingchpinyourstate.doc expandingchpinyourstate.doc (130 KB) More Documents & Publications Combined Heat and Power: Expanding CHP in Your State Sustainable Energy ...

  4. Design Potential of Metal Foil Substrates for Optimized DOC Performanc...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Design Potential of Metal Foil Substrates for Optimized DOC Performance Design Potential of Metal Foil Substrates for Optimized DOC Performance Poster presentation at the 2007 ...

  5. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Energy Saver

    & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross Reference Matrix Introduction.doc Assessment of the Effects of Climate Change on Federal Hydropower...

  6. Edwin Parks (Doc) | Department of Energy

    Office of Environmental Management (EM)

    Doc Parks has over 27 years of active-duty military service with the U.S. Air Force (USAF), serving a broad range of command and staff positions in nuclear operations policy, ...

  7. Microsoft Word - Appendix N_Historical.doc

    Office of Legacy Management (LM)

    N Example Historical Marker and Plaque U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page N-3 Weldon Spring Site LTS&M Plan U.S. Department of...

  8. Form:NEPA Doc | Open Energy Information

    OpenEI (Open Energy Information) [EERE & EIA]

    NEPA Doc Jump to: navigation, search Input the name of a NEPA Document below. If the document already exists, you will be able to edit its information. AddEdit a NEPA Document...

  9. Microsoft Word - 2011_SER.doc

    Office of Legacy Management (LM)

    Fernald Preserve U.S. Department of Energy Office of Legacy Management Issued May 2012 ... U.S. Department of Energy Fernald Preserve 2011 Site Environmental Report May 2012 Doc. ...

  10. Microsoft Word - Chapter 05 a.doc | Department of Energy

    Office of Environmental Management (EM)

    Microsoft Word - Chapter 05 a.doc Microsoft Word - Chapter 05 a.doc Microsoft Word - Chapter 05 a.doc (7.05 MB) More Documents & Publications Microsoft Word - Chapter 01.doc EIS-0426: Record of Decision EIS-0426: Final Environmental Impact Statement

  11. Microsoft Word - AL2003-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2003-04.doc Microsoft Word - AL2003-04.doc Microsoft Word - AL2003-04.doc (254.1 KB) More Documents & Publications AL2004-01r2.pdf City of Tulare Renewable Biogas Fuel Cell Project Microsoft Word - AL2006-08.doc

  12. Microsoft Word - Chapter 01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Microsoft Word - Chapter 01.doc Microsoft Word - Chapter 01.doc Microsoft Word - Chapter 01.doc (10.76 MB) More Documents & Publications Microsoft Word - Chapter 05 a.doc EIS-0426: Record of Decision EIS-0426: Final Environmental Impact Statement

  13. Microsoft Word - DOETTQuestions.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    DOETTQuestions.doc Microsoft Word - DOETTQuestions.doc Microsoft Word - DOETTQuestions.doc (48.9 KB) More Documents & Publications Microsoft Word - 73FR72036_UC signed 1&#0; Microsoft Word - SRNL Fed Register Response.doc Subcontractor Rights Under CRADAs and WFO Agreements

  14. Microsoft Word - FAL2006-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAL2006-04.doc Microsoft Word - FAL2006-04.doc Microsoft Word - FAL2006-04.doc (74.69 KB) More Documents & Publications Financial Assistance Letter No. FAL 2006-04 Microsoft Word - AL2006-03.doc Microsoft Word - FAL2004-01

  15. Microsoft Word - Federal Register Response _Jan09_.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Federal Register Response _Jan09_.doc Microsoft Word - Federal Register Response _Jan09_.doc Microsoft Word - Federal Register Response _Jan09_.doc (13.88 KB) More Documents & Publications Microsoft Word - Document2 Microsoft Word - Intellectual Property Provisions _NRD-1003_.doc Microsoft Word - ARRAAttachment12v1

  16. Microsoft Word - Final Sample Participant Profile November 2008.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Final Sample Participant Profile November 2008.doc Microsoft Word - Final Sample Participant Profile November 2008.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - DRAFT CRB Interview Guidance

  17. AcqGuide70pt5.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    pt5.doc&#0; AcqGuide70pt5.doc&#0; AcqGuide70pt5.doc&#0; (16.21 KB) More Documents & Publications Chapter 70.3102-05-6: Contractor Compensation - Variable Pay Policy Flash 2016-34 AcqGuide41pt1.doc&#0;

  18. Microsoft Word - PART 970.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PART 970.doc Microsoft Word - PART 970.doc Microsoft Word - PART 970.doc (1.03 MB) More Documents & Publications Searchable Electronic Department of Energy Acquisition Regulation Microsoft Word - Matrixpart2.doc AcqGuide70.52Matrixpart2Redo-OPAM

  19. Microsoft Word - al2005-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    al2005-06.doc Microsoft Word - al2005-06.doc Microsoft Word - al2005-06.doc (139.24 KB) More Documents & Publications Microsoft Word - AL2006-01.doc OPAM Policy Acquisition Guides Acquisition Letter: AL2005-08

  20. DOC-DOE Joint China Mission Statement | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Joint China Mission Statement DOC-DOE Joint China Mission Statement DOC-DOE Joint China Mission Statement DOC-DOE Joint China Mission Statement (109.75 KB) More Documents & Publications DOC-DOE China Mission Announcement Press Release FACT SHEET: U.S.-China Clean Energy Cooperation Announcements US-China Clean Energy Cooperation

  1. RetTrendReport1205.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    RetTrendReport1205.doc&#0; RetTrendReport1205.doc&#0; RetTrendReport1205.doc&#0; (2.58 MB) More Documents & Publications Pension Plans for Contractor Workers April 1-10 comments.doc&#0; POLICY GUIDANCE MEMORANDUM #39 Phased Retirement

  2. Microsoft Word - Clay Memo PMC Coburn Obama 11_9_06.doc | Department...

    Office of Environmental Management (EM)

    Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc More Documents & Publications...

  3. Microsoft Word - DP_cover_and_front matter_FINAL1.DOC | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FINAL1.DOC Microsoft Word - DPcoverandfront matterFINAL1.DOC PDF icon Microsoft Word - DPcoverandfront matterFINAL1.DOC More Documents & Publications Microsoft Word - ...

  4. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc PDF icon Microsoft Word - TSLCC 200750508 rev 1.doc More Documents & Publications FY 2007 Total System ...

  5. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of...

    Office of Environmental Management (EM)

    TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc More Documents & Publications FY 2007 Total System Life...

  6. Microsoft Word - Appendix D_LegalDescription.doc

    Office of Legacy Management (LM)

    Site LTS&M Plan July 2005 Doc. No. S0079000 Page D-3 Figure D-1. DOE Property Boundary for the Chemical Plant Area Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. ...

  7. AcqGuide39pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon AcqGuide39pt1.doc&0; More Documents & Publications Chapter 39 - Acquisition of Information Technology AcqGuide38pt1.doc&0; Microsoft Word - AcqGuide16pt1...

  8. AcqGuide70pt31.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon AcqGuide70pt31.doc&0; More Documents & Publications Microsoft Word - AcqGuide70pt31A.doc Policy Flash 2014-26 Acquisition Guide Chapter 70.31A - Costs...

  9. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    22.62 KB) More Documents & Publications Microsoft Word - FOA cover sheet.doc Recovery Act, Office of the Biomass Program,Funding Opportunity Announcements Special Notice Microsoft Word - FOA cover sheet.doc

  10. AcqGuide47pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AcqGuide47pt1.doc&0; PDF icon AcqGuide47pt1.doc&0; More Documents & Publications Chapter 47 - Transportation TEC Working Group Topic Groups Manual Review Key Documents ...

  11. Microsoft Word - N01747_Bldg 100 SAR.doc

    Office of Legacy Management (LM)

    blank U.S. Department of Energy Building 100 Area Site Assessment Report August 2012 Doc. ... 59 Building 100 Area Site Assessment Report U.S. Department of Energy Doc. No. ...

  12. stat_webinar_070913_transcript.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    stat_webinar_070913_transcript.doc stat_webinar_070913_transcript.doc stat_webinar_070913_transcript.doc stat_webinar_070913_transcript.doc (64.5 KB) More Documents & Publications Final Report -Regulatory and Utility Solutions to Advance SunShot Initiative Goals Connecting-to-the-Grid-Guide-6th-edition.pdf Community Renewables: Model Program Rules

  13. 20130226_sunshot_transcript_lbnl.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc (73.5 KB) More Documents & Publications Why Are Resiential PV Prices in Germany So Much Lower Than in the United States? text_alternative_stat_webinar_2012_7_25.docx An Analysis of Residential PV System Price Differences between the United States and Germany

  14. Microsoft Word - ALonEO13423Last.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ALonEO13423Last.doc Microsoft Word - ALonEO13423Last.doc PDF icon Microsoft Word - ALonEO13423Last.doc More Documents & Publications Microsoft Word - AL2008-05.doc Tri-Party ...

  15. Microsoft Word - ITSI award doc 06-D0008 conformed to P00001...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ITSI award doc 06-D0008 conformed to P00001.doc Microsoft Word - ITSI award doc 06-D0008 conformed to P00001.doc More Documents & Publications Policy Flash 2015-02 Acquisition ...

  16. Microsoft Word - Flash2008-09Attachment.doc | Department of Energy

    Energy.gov [DOE] (indexed site)

    9Attachment.doc More Documents & Publications Flash2007-02Attachment.doc&0; Microsoft Word - AL2000-05Attachment.doc Flash2007-03Attachment.doc&0;...

  17. Microsoft Word - Policy Flash 2008-04.doc | Department of Energy

    Office of Environmental Management (EM)

    4.doc Microsoft Word - Policy Flash 2008-04.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  18. Microsoft Word - Policy Flash 2008-06.doc | Department of Energy

    Office of Environmental Management (EM)

    6.doc Microsoft Word - Policy Flash 2008-06.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  19. Microsoft Word - DRAFT CRB Interview Guidance.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    DRAFT CRB Interview Guidance.doc Microsoft Word - DRAFT CRB Interview Guidance.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc Microsoft Word - Document2

  20. Microsoft Word - FY08AnnualReport.doc | Department of Energy

    Office of Environmental Management (EM)

    FY08AnnualReport.doc Microsoft Word - FY08AnnualReport.doc PDF icon Microsoft Word - FY08AnnualReport.doc More Documents & Publications Microsoft Word - FY09AnnualReportv1.doc...

  1. Microsoft Word - AL2005-05Revised.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2005-05Revised.doc Microsoft Word - AL2005-05Revised.doc PDF icon Microsoft Word - AL2005-05Revised.doc More Documents & Publications AL2007-03.doc&0; 2011-31 Attachment...

  2. Microsoft Word - AL2000-05Attachment.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Attachment.doc Microsoft Word - AL2000-05Attachment.doc PDF icon Microsoft Word - AL2000-05Attachment.doc More Documents & Publications al99-06attachment.doc&0; EXHIBIT A: CRADA,...

  3. AL2007-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    7-02.doc&#0; AL2007-02.doc&#0; AL2007-02.doc&#0; (19.72 KB) More Documents & Publications Department of Energy Acquisition Letter 2013-04 on Executive Compensation Acquisition Letter No. AL 2013-04 Acquisition Letter No. AL 2014-07

  4. Microsoft Word - ACQUISITION LETTER.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ACQUISITION LETTER.doc Microsoft Word - ACQUISITION LETTER.doc Microsoft Word - ACQUISITION LETTER.doc (26.03 KB) More Documents & Publications ACQUISITION LETTER DEAR Part 933 Acquisition Guide Chapter 33.214 - Alternative Dispute Resolution OPAM Policy Acquisition Guides

  5. Microsoft Word - AL2005-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - AL2005-11.doc Microsoft Word - AL2005-11.doc (143.52 KB) More Documents & Publications Acquisition Letter No. AL 2012-04 Revisions to FAR Part 17 Special Contracting Methods and Part 35 Research and Development Contracting Audit Report: OAS-L-13-08

  6. Microsoft Word - LibraryofPriorRulemakings.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    LibraryofPriorRulemakings.doc Microsoft Word - LibraryofPriorRulemakings.doc Microsoft Word - LibraryofPriorRulemakings.doc (28.89 KB) More Documents & Publications Solar Background Document 1 Natural Gas Imports and Exports First Quarter Report 2014 Natural Gas Imports and Exports Second Quarter Report 2014

  7. CompleteProject List.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    CompleteProject List.doc&#0; CompleteProject List.doc&#0; CompleteProject List.doc&#0; (9.47 KB) More Documents & Publications Tribal Energy Program February 2012 Award Project Descriptions CX-008525: Categorical Exclusion Determination 2010 Program Review Meeting

  8. AcqGuide41pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1pt1.doc&#0; AcqGuide41pt1.doc&#0; AcqGuide41pt1.doc&#0; (13.23 KB) More Documents & Publications Chapter 41 - Acquisition of Utility Services Policy Flash 2016-31 Chapter 41: Utilities

  9. AcqGuide42pt3.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    2pt3.doc&#0; AcqGuide42pt3.doc&#0; AcqGuide42pt3.doc&#0; (56.38 KB) More Documents & Publications Chapter 42 - Contract Administration Acquisition Guide Chapter 42.1202 - Novation Agreements Chapter 9.2: Performance Guarantees

  10. AcqGuide9pt2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AcqGuide9pt2.doc&#0; AcqGuide9pt2.doc&#0; AcqGuide9pt2.doc&#0; (16.88 KB) More Documents & Publications Chapter 9.2: Performance Guarantees Policy Flash 2016-32 Chapter 9 - Contracting Qualifications

  11. AcqGuide3pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    pt1.doc&0; AcqGuide3pt1.doc&0; PDF icon AcqGuide3pt1.doc&0; More Documents & Publications POLICY FLASH 2016-04 Procurement Integrity PI Brief 6 15 07 final2&0;

  12. Microsoft Word - Political Activity and the Federal Employee.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Political Activity and the Federal Employee.doc Microsoft Word - Political Activity and the Federal Employee.doc Microsoft Word - Political Activity and the Federal Employee.doc (165.92 KB) More Documents & Publications Political Activity at DOE Facilities by DOE Contractors Audit Report: IG-0473 PROCESSING INVITATIONS FOR A PRESIDENTIAL APPOINTEE

  13. Microsoft Word - al2007-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    al2007-11.doc Microsoft Word - al2007-11.doc Microsoft Word - al2007-11.doc (62.82 KB) More Documents & Publications Acquisition Guide Chapter 19 Update Acquisition Letter: AL2005-08 Microsoft Word - al2004-03

  14. Microsoft Word - competitionincontractingguidev2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc (215.28 KB) More Documents & Publications AcqGuide 5.2-OPAM Acquisition Guide, Chapter 6.1, Competition Requirements Microsoft Word - AG Chapter 6 1 Nov 2010

  15. Microsoft Word - fal2004-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    fal2004-04.doc Microsoft Word - fal2004-04.doc Microsoft Word - fal2004-04.doc (132.28 KB) More Documents & Publications U.S. Department of Energy - Guide to Financial Assistance - Audit Requirements for For-Profit Organizations Financial Assistance Guide (2013) Revised Guide for Financial Assistance

  16. Microsoft Word - Policy Flash 2008-07.doc | Department of Energy

    Office of Environmental Management (EM)

    07.doc Microsoft Word - Policy Flash 2008-07.doc More Documents & Publications Microsoft Word - Policy Flash 2008-10...

  17. Microsoft Word - Policy Flash 2008-10.doc | Department of Energy

    Office of Environmental Management (EM)

    10.doc Microsoft Word - Policy Flash 2008-10.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07...

  18. Microsoft Word - S03736_ FMP010609.doc

    Office of Legacy Management (LM)

    Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 LMS/CNT/S03736 This page intentionally left blank LMS/CNT/S03736 Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 This page intentionally left blank U.S. Department of Energy Fluid Management Plan For CAU 443: CNTA, Subsurface, Nevada January 2009 Doc. No. S0373600 Page i Contents Acronyms and Abbreviations

  19. Microsoft Word - S04019_GSB.doc

    Office of Legacy Management (LM)

    Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 LMS/GSB/S04019 This page intentionally left blank LMS/GSB/S04019 Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 This page intentionally left blank U.S. Department of Energy Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009, Rev. 3 Doc. No. S04019 Page i Contents Abbreviations

  20. Microsoft Word - S05094_VMR.doc

    Office of Legacy Management (LM)

    08 May 2009 LMS/RVT/S05094 This page intentionally left blank LMS/RVT/S05094 Verification Monitoring Report for the Riverton, Wyoming, Processing Site Update for 2008 May 2009 This page intentionally left blank U.S. Department of Energy Riverton, Wyoming, Verification Monitoring Report May 2009 Doc. No. S05094 Page i Contents 1.0 Introduction ........................................................................................................................1-1 2.0 Site Conditions

  1. Microsoft Word - S05575_AP.doc

    Office of Legacy Management (LM)

    8 through March 2009 for the Shiprock, New Mexico, Site December 2009 LMS/SHP/S05575 This page intentionally left blank LMS/SHP/S05575 Annual Performance Report April 2008 through March 2009 for the Shiprock, New Mexico, Site December 2009 This page intentionally left blank U.S. Department of Energy Annual Performance Report, Shiprock, New Mexico December 2009 Doc. No. S05575 Page i Contents

  2. Microsoft Word - S05949_IR.doc

    Office of Legacy Management (LM)

    Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2009 LMS/MNT/S05949 This page intentionally left blank LMS/MNT/S05949 2009 Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2009 This page intentionally left blank U.S. Department of Energy 2009 Annual Inspection-Monticello, Utah December 2009 Doc. No. S05949 Page i Contents Executive

  3. Microsoft Word - S06093_VMR.doc

    Office of Legacy Management (LM)

    09 April 2010 LMS/RVT/S06093 This page intentionally left blank LMS/RVT/S06093 Verification Monitoring Report for the Riverton, Wyoming, Processing Site Update for 2009 April 2010 This page intentionally left blank U.S. Department of Energy Riverton, Wyoming, Verification Monitoring Report April 2010 Doc. No. S06093 Page i Contents 1.0 Introduction ........................................................................................................................1-1 2.0 Site Conditions

  4. Microsoft Word - S06178_MP.doc

    Office of Legacy Management (LM)

    Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited LMS/RUL/S06178 This page intentionally left blank LMS/RUL/S06178 Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited This page intentionally left blank U.S. Department of Energy Rulison Monitoring Plan July 2010 Doc. No. S06178 Page i Contents 1.0

  5. Microsoft Word - S06182_GCAP.doc

    Office of Legacy Management (LM)

    Groundwater Compliance Action Plan for the Lakeview, Oregon, Processing Site June 2010 LMS/LKP/S06182 This page intentionally left blank LMS/LKP/S06182 Groundwater Compliance Action Plan for the Lakeview, Oregon, Processing Site June 2010 This page intentionally left blank U.S. Department of Energy Groundwater Compliance Action Plan for the Lakeview, Oregon, Processing Site June 2010 Doc. No.S06182 Page i Contents

  6. Microsoft Word - S06596_GW.doc

    Office of Legacy Management (LM)

    Annual Groundwater Report May 2009 through April 2010 September 2010 LMS/MNT/S06596 This page intentionally left blank LMS/MNT/S06596 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report May 2009 through April 2010 September 2010 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report May 2009-April 2010 September 2010 Doc. No. S06596 Page i Contents

  7. Microsoft Word - aser_rev0.doc

    Office of Legacy Management (LM)

    Weiss Associates Environmental Science, Engineering and Management ANNUAL SITE ENVIRONMENTAL REPORT CALENDAR YEAR 2007 for the LABORATORY FOR ENERGY-RELATED HEALTH RESEARCH UNIVERSITY OF CALIFORNIA, DAVIS Submitted to: S.M. Stoller Corporation 2597 B ¾ Road Grand Junction, Colorado 81503 Prepared by: Weiss Associates 5801 Christie Avenue, Suite 600 Emeryville, California 94608-1827 September 30, 2008 Rev. 0 J:\DOE_STOLLER\4110\137\ASER 2007\REV. 0\ASER_REV0.DOC WEISS ASSOCIATES Project Number:

  8. Microsoft Word - 0918rir.doc

    Office of Legacy Management (LM)

    DOE AREAS REMEDIAL INVESTIGATION REPORT for the LABORATORY FOR ENERGY-RELATED HEALTH RESEARCH UNIVERSITY OF CALIFORNIA, DAVIS Prepared for: United States Department of Energy National Nuclear Security Administration Service Center 1301 Clay Street Oakland, California 94612-5208 Prepared by: Weiss Associates 5801 Christie Avenue, Suite 600 Emeryville, California 94608-1827 September 18, 2003 Rev. 0 DOE Oakland Operations Contract DE-AC03-96SF20686 J:\DOE\4007\110\RI_PLAN\0918_REV0\0918RIR.DOC

  9. Microsoft Word - S0131700_NOV04.doc

    Office of Legacy Management (LM)

    S0131700 DOE-LM/GJ757-2004 Office of Legacy Management Monument Valley Ground Water Remediation: Pilot Study Work Plan November 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy, Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Monument Valley GW Remediation Pilot Study Work Plan November 2004 Doc. No. S0131700 Page 3 Signature Page Authors: J. Waugh, S.

  10. Microsoft Word - S03273_Rev1.doc

    Office of Legacy Management (LM)

    Surface, Hot Creek Valley, Nevada, for Calendar Year 2007 September 2008 Rev. 1 DOE-LM/1558-2007 This page intentionally left blank DOE-LM/1558-2008 Post-Closure Inspection and Monitoring Report for Corrective Action Unit 417: Central Nevada Test Area Surface, Hot Creek Valley, Nevada for Calendar Year 2007 September 2008 Rev. 1 This page intentionally left blank U.S. Department of Energy CY 2007 Post-Closure Inspection & Monitoring Report for CAU 417 September 2008, Rev. 1 Doc. No. S0327300

  11. Microsoft Word - S05069_ROD.doc

    Office of Legacy Management (LM)

    Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 LMS/LEH/S05069 This page intentionally left blank LMS/LEH/S05069 Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 This page intentionally left blank U.S. Department of Energy ROD for DOE Areas for LEHR September 2009 Doc. No. S05069, Rev. 0 Page i Contents Acronyms and Abbreviations

  12. Microsoft Word - U0194500July2005.doc

    Office of Legacy Management (LM)

    4500 GJO-2004-579-TAC Office of Legacy Management Refinement of Conceptual Model and Recommendations for Improving Remediation Efficiency at the Shiprock, New Mexico, Site July 2005 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Conceptual Model Refinement and Efficiency Recommendations July 2005 Doc. No.

  13. Microsoft Word - S06654_ESL.doc

    Office of Environmental Management (EM)

    on Smart Grid RFI RedSeal Systems, Inc. 1 October 29, 2010 Office of Electricity Delivery and Energy Reliability US Department of Energy Room 8H033 1000 Independence Avenue, SW Washington, DC 20585 Re: Comments on "Smart Grid RFI: Addressing Policy and Logistical Challenges" 75 FR 57006 [FR Doc. 2010-23251] From: Steve Dauber Vice-President, Marketing RedSeal Systems 2121 South El Camino Real, Suite 300 San Mateo, CA 94403 Ph: 650-645-6209 sdauber@redseal.net www.redseal.net RedSeal

  14. interiorlightingefficiencyformunicipalities.doc | Department of Energy

    Energy Saver

    Proposed Energy Transport Corridors

    doe.gov/media/Myths_and_Facts.pdf http://www.doe.gov/media/Myths_and_Facts.pdf http://www.doe.gov/media/Myths_and_Facts.pdf (143.91 KB) More Documents & Publications Biofuels & Greenhouse Gas Emissions: Myths versus Facts Microsoft Word - 47C468D4-69BA-281F40.doc Biofuels & Greenhouse Gas Emissions: Myths versus Facts

    of Energy

    energy.gov/media/F...Biofuels_Lower_Gas_Prices.pdf

  15. Microsoft Word - 8E2A4440.doc

    Energy.gov [DOE] (indexed site)

    48D7DF19-707E-28B27A.doc (126.75 KB) More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - GSP_Charter.doc Department of Energy

    564M_Biomass_Project Descriptions FINAL 120409 (100.66 KB) More Documents & Publications 564M_Biomass_Projects.pdf Microsoft Word - 338M_Geothermal_Project_Descriptions ARRA Projects Chart

    NATIONAL PARKS COMMITTEE ON ENERGY AND NATURAL RESOURCES U.S. SENATE

  16. transcript_jedi_model.doc | Department of Energy

    Energy.gov [DOE] (indexed site)

    document icon transcriptjedimodel.doc More Documents & Publications TAP Webcast Transcript July-29, 2009 Scenario Jedi Tools for Designing & Implementing Better Finance Programs

  17. pocforms06a0399.doc | Department of Energy

    Energy.gov [DOE] (indexed site)

    More Documents & Publications fleetappforms04f1298.doc&0; OPC Security Whitepaper 3Hardening Guidelines for OPC Hosts Critical Decision 2 (CD-2) Approval Template...

  18. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    A NRC Concurrence with Completion of Remedial Action This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page A-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No.

  19. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    B Real Estate Documentation This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page B-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page

  20. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    NRC Technical Evaluation Report on Revised LTSP This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page D-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page D-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page D-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No.

  1. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    E Agency Notification Agreements This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page E-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008

  2. Enter the Post-Doc: The Untapped Sourcing Pipeline

    SciTech Connect

    Boscow, Ryan B.

    2011-07-30

    This article addresses the potential formulation and utilization of an industry-based Post-Doc program in order to create workforce candidate pipelines with targeted universities.

  3. Effectiveness of a Diesel Oxidation Catalyst (DOC) to control...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion Effectiveness of a ...

  4. Microsoft Word - AL2006-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon Microsoft Word - AL2006-09.doc More Documents & Publications Microsoft PowerPoint - Executive Order13423rbl Sample Contract Language for Construction Using ...

  5. Microsoft Word - FFATA Memo 30 March 2007.doc | Department of...

    Energy.gov [DOE] (indexed site)

    FFATA Memo 30 March 2007.doc More Documents & Publications Policy Flash 2014-35 Rescission of American Recovery and Reinvestment Act Reporting Requirements. Flash2008-44attachment....

  6. Doc Cambell's Post Greenhouse Low Temperature Geothermal Facility...

    OpenEI (Open Energy Information) [EERE & EIA]

    Low Temperature Geothermal Facility Facility Doc Cambell's Post Sector Geothermal energy Type Greenhouse Location Las Cruces, New Mexico Coordinates 32.3123157,...

  7. Microsoft Word - al2006-12.doc | Department of Energy

    Energy.gov [DOE] (indexed site)

    Microsoft Word - al2006-12.doc More Documents & Publications Acquisition Letter No. AL 2008-02 Department of Energy Special Report: DOEIG-0934...

  8. Microsoft Word - DOE_Staffing_Study_Cover.doc | Department of...

    Office of Environmental Management (EM)

    Word - DOEStaffingStudyCover.doc More Documents & Publications 2010 DOE Strategic Sustainability Performance Plan - Report to the White House Council on Environmental...

  9. Microsoft Word - AcqGuide71pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1pt1.doc Microsoft Word - AcqGuide71pt1.doc PDF icon Microsoft Word - AcqGuide71pt1.doc More Documents & Publications Chapter 71 - Review and Approval of Contract and Financial ...

  10. Microsoft Word - AcqGuide7pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    pt1.doc Microsoft Word - AcqGuide7pt1.doc ACQUISITION PLANNING PDF icon Microsoft Word - AcqGuide7pt1.doc More Documents & Publications ACQUISITION PLANNING Policy Flash 2015-13 ...

  11. Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc | Department...

    Energy Saver

    ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc More Documents & Publications Microsoft Word -...

  12. Microsoft Word - Flash2009dashxxFAC34.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc More Documents & Publications Federal Acquisition Regulation; Federal...

  13. Microsoft Word - Flash2008-08attachmentFAC22.doc | Department...

    Energy Saver

    Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc More Documents & Publications Policy Flash 2013-75...

  14. Microsoft Word - Flash2007-61FACAttachment.doc | Department of...

    Energy Saver

    Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc More Documents & Publications Microsoft Word -...

  15. Microsoft Word - PolicyFlash2007-10Attch2.doc | Department of...

    Energy Saver

    PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc More Documents & Publications Policy Flash 2013-37 Federal...

  16. Microsoft Word - Policy Flash 2008-02.doc | Department of Energy

    Energy Saver

    Microsoft Word - Policy Flash 2008-02.doc Microsoft Word - Policy Flash 2008-02.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  17. Microsoft Word - Policy Flash 2008-03.doc | Department of Energy

    Energy Saver

    Microsoft Word - Policy Flash 2008-03.doc Microsoft Word - Policy Flash 2008-03.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  18. Microsoft Word - ARRAGuideAttachment10v1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ARRAGuideAttachment10v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - DRAFT CRB Interview Guidance

  19. Microsoft Word - NationalPolicyAssurances5-06.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    NationalPolicyAssurances5-06.doc Microsoft Word - NationalPolicyAssurances5-06.doc PDF icon Microsoft Word - NationalPolicyAssurances5-06.doc More Documents & Publications ...

  20. Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc |...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Press Release RECOMP 2-8-08 REV FINAL.doc Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc PDF icon Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc More ...

  1. Microsoft Word - FY10PropertyBSCFed.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PropertyBSCFed.doc Microsoft Word - FY10PropertyBSCFed.doc PDF icon Microsoft Word - FY10PropertyBSCFed.doc More Documents & Publications Microsoft Word - FY09PropertyBSCContractor...

  2. Microsoft Word - DP_cover_and_front matter_R1_Draft_3.DOC | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    R1Draft3.DOC Microsoft Word - DPcoverandfront matterR1Draft3.DOC PDF icon Microsoft Word - DPcoverandfront matterR1Draft3.DOC More Documents & Publications Microsoft ...

  3. Project Summary-TES-SNL.doc. (Conference) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Project Summary-TES-SNL.doc. Citation Details In-Document Search Title: Project Summary-TES-SNL.doc. Abstract not provided. Authors: Siegel, Nathan Phillip Publication Date: ...

  4. Microsoft Word - US_Japan_REE_agenda_ver7.doc | Department of...

    Office of Environmental Management (EM)

    Microsoft Word - USJapanREEagendaver7.doc Microsoft Word - USJapanREEagendaver7.doc U.S. - Japan Roundtable on Rare Earth Elements Research PDF icon Microsoft Word -...

  5. DOE HR Guidebook 12_15_05.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications Operating Guidelines Appendix A B.DOC&0; 2 Jun 03 Roles and Responsibilities CSO Highlighted.doc&0; Operating Guidelines Appendix C...

  6. Microsoft Word - 2007 waste return memoGS.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    2005 FOIA ANNUAL REPORT.doc Microsoft Word - 2005 FOIA ANNUAL REPORT.doc report2005.pdf Microsoft Word - 2005 FOIA ANNUAL REPORT.doc (45.24 KB) More Documents & Publications U.S. Department of Energy 2008 Annual FOIA Report Office of Information Resources (MA-90) ANNUAL FOIA REPORT FOR 2009

    14, 2008 Generators: In the last year there have been several changes in how we handle waste verification failures. A recent memorandum (Policy on compliance of Radioactive Waste Acceptance

  7. Microsoft Word - S08266_App_A-3.doc

    Office of Legacy Management (LM)

    Score 0 Fernald Preserve, Ohio, Wetland Mitigation Monitoring Report U.S. Department of Energy Doc. No. S08266 Appendix A-3, 2011 Amphibian Index of Biotic Integrity Data...

  8. Microsoft Word - VI_12_Degrees Awarded 2015.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    nuclear systems A. Bonasera Post Doc. at INFN - Laboratori Nazionali del Sud, Catania, Italy STUDENTS WHO RECEIVED GRADUATE DEGREES FROM NON-THESIS April 1, 2014 - March 31, 2015 ...

  9. Microsoft Word - Appendix M_ContingencyTrees.doc

    Office of Legacy Management (LM)

    M Groundwater Operable Unit Contingency Trees U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page M-3 Figure M-1. Validation and Statistical...

  10. Microsoft Word - S05993_CY2009 Annual Rpt.doc

    Office of Legacy Management (LM)

    ... Property Utilization and Disposal SEP Solar Evaporation Pond Rocky Flats Annual Report of Site Surveillance and Maintenance Activities-CY 2009 U.S. Department of Energy Doc. No. ...

  11. Microsoft Word - S05993_CY2009 Annual Rpt.doc

    Office of Legacy Management (LM)

    ... of Site Surveillance and Maintenance Activities-CY 2009 U.S. Department of Energy Doc. No. ... Purpose Approval Date Status as of December 31, 2009 Phase II and III Upgrades to Solar ...

  12. Microsoft Word - AL2005-13.doc | Department of Energy

    Energy.gov [DOE] (indexed site)

    Microsoft Word - AL2005-13.doc More Documents & Publications PBA2007 Presentation-short-6-19-07DOE&0; Accident Investigation of the February 7, 2013, Scissor Lift Accident in the...

  13. Microsoft Word - AppendixH_CommentResponse.doc

    Office of Legacy Management (LM)

    S06246 Page H-1 Responsiveness Summary The U.S. Department of Energy (DOE) released the ... NFSS Vicinity Property Report U.S. Department of Energy Doc. No. S06246 October 2010 Page ...

  14. Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

    Energy.gov [DOE]

    Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

  15. Microsoft Word - GC Mediation Evaluation _2-06-09_.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy GC Mediation Evaluation _2-06-09_.doc Microsoft Word - GC Mediation Evaluation _2-06-09_.doc Microsoft Word - GC Mediation Evaluation _2-06-09_.doc (29.87 KB) More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc HQ Mediation Program Brochure Microsoft Word - DRAFT CRB Interview Guidance

  16. Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

    Office of Energy Efficiency and Renewable Energy (EERE)

    Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

  17. Microsoft Word - FAL2003-03R.doc | Department of Energy

    Office of Environmental Management (EM)

    3-03R.doc Microsoft Word - FAL2003-03R.doc PDF icon Microsoft Word - FAL2003-03R.doc More Documents & Publications Microsoft Word - FAL2003-03Rattach.doc FAL2003-03Attachment.pdf...

  18. Microsoft Word - National Science Bowl Fact Sheet.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy National Science Bowl Fact Sheet.doc Microsoft Word - National Science Bowl Fact Sheet.doc Microsoft Word - National Science Bowl Fact Sheet.doc (244.47 KB) More Documents & Publications Microsoft Word - National Science Bowl Fact Sheet.doc Idaho Operations AMWTP Fact Sheet Heating Ventilation and Air Conditioning Efficiency

  19. Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy PPL 970-Materials and Inventory 5-9-05.doc Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc (22.24 KB) More Documents & Publications Microsoft Word - al95-06.doc DOE-HDBK-1139-2006 ppl970-3.pdf

  20. DOC-DOE China Mission Announcement Press Release | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    China Mission Announcement Press Release DOC-DOE China Mission Announcement Press Release DOC-DOE China Mission Announcement Press Release DOC-DOE China Mission Announcement Press Release (34.5 KB) More Documents & Publications DOC-DOE Joint China Mission Statement China 2015 Business Development Mission Marketing Flyer DOE-LPO_Email-Update_001_Through_11

  1. Petascale Post-Doc Project a Supercomputing Success Story

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Petascale Post-Doc Project a Supercomputing Success Story Petascale Post-Doc Project a Supercomputing Success Story ARRA-funded program takes petascale computing researchers to the next level March 24, 2014 Contact: Kathy Kincade, +1 510 495 2124, kkincade@lbl.gov petascalepostdocs.jpg From left: Jihan Kim, Filipe Maia, Alice Koniges, Robert Preissl, Brian Austin, Wangyi (Bobby) Liu , Kirsten Fagnan and Praveen Narayanan. The first post-doctoral research project centered at the Department of

  2. TWP93.0100104 DOC#: TWP-DOC-1.4 SCIENCE AND SITING STRATEGY FOR THE

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    TWP93.0100104 DOC#: TWP-DOC-1.4 SCIENCE AND SITING STRATEGY FOR THE TROPICAL WESTERN PACIFIC ARM CART LOCALE Thomas P. Ackerman The Pennsylvania State University Bill Clements Fairley Barnes Los Alamos National Laboratory David S. Renné National Renewable Energy laboratory Science and Siting Strategy for the Tropical Western Pacific ARM CART Locale Ackennan, T., B. Clements, F. Barnes, and D. Renne DISCLAIMER This is a working document of the Tropical Western Pacific Program of the United

  3. Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy NationalPolicyAssurancesAwardTermsFinal81804.doc Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc (31.13 KB) More Documents & Publications Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc National Policy Assurances to be Incorporated as Award Terms Microsoft Word - NationalPolicyAssurances5-06.doc

  4. First NESAP Post-doc Takes on BoxLib

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    First NESAP Post-doc Takes on BoxLib First NESAP Post-doc Takes on BoxLib Brian Friesen to Work with Ann Almgren's Group in CCSE June 22, 2015 brianfriesenphoto Brian Friesen, PhD The first of eight post-doctoral researchers participating in the NERSC Exascale Science Applications Program (NESAP) is now working full time at NERSC. Brian Friesen, a graduate student in computational astrophysics at the University of Oklahoma, joined the NESAP team May 18. He's been assigned to Ann Almgren's group

  5. Microsoft Word - AL-PO-0001-0007.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Authorized List Doc. ID: OP-AL-0001-007.doc Off-Hours Shift Operator Date: 2001/11/20 This policy is effective 11/20/2001 and denotes those individuals who have been authorized for Off-Hours Shift Operation. 1. Alderman, Steven 2. Aigeldinger, Georg 3. Baethke, Niko 4. Bauer, Benjamin 5. Brendebach, Boris 6. Day, Lorraine 7. Desta, Yohannes 8. Doomes, Edward 9. Dust, Reinhard 10. Farquar, George 11. Fluegge, Michael 12. Goettert, Jost 13. Koch, Kevin 14. Kong, Jong Ren 15. Lian, Kun 16. Ling,

  6. Microsoft Word - FY07AnnualReport.doc | Department of Energy

    Energy.gov [DOE] (indexed site)

    FY07AnnualReport.doc More Documents & Publications Microsoft Word - FY08AnnualReport.doc Audit Report: IG-0857 Attachment 5 Volume II Pricing Matrix.xls...

  7. Property:NEPA LeadAgencyDocNumber | Open Energy Information

    OpenEI (Open Energy Information) [EERE & EIA]

    LeadAgencyDocNumber Jump to: navigation, search Property Name NEPA LeadAgencyDocNumber Property Type String This is a property of type String. Pages using the property "NEPA...

  8. Microsoft Word - 0-PEP-6-14-07.doc | Department of Energy

    Energy Saver

    Word - 0-PEP-6-14-07.doc Microsoft Word - 0-PEP-6-14-07.doc PSF.pdf More Documents & Publications Sample Project Execution Plan Project Execution Plan Review Module (RM) Microsoft...

  9. Microsoft Word - g413.3-10Final5-6-08.doc | Department of Energy

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    g413.3-10Final5-6-08.doc Microsoft Word - g413.3-10Final5-6-08.doc DOEEVMSGoldCardSep2011.pdf More Documents & Publications EVMS and Project Analysis Standard Operating...

  10. V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerabilit...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability June 25, 2013 - 12:41am Addthis PROBLEM: ...

  11. RFQ DE-RQ01-04ME90001.doc | Department of Energy

    Energy Saver

    DE-RQ01-04ME90001.doc&0; More Documents & Publications Ammendment 2.doc Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&0; Operating Guidelines Appendix A B...

  12. Ex Parte Memo - 09 02 Mtg-09.09.10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Parte Memo - 09 02 Mtg-09.09.10.doc Ex Parte Memo - 09 02 Mtg-09.09.10.doc Summary of ex parte meeting on energy efficiency standards PDF icon Ex Parte Memo - 09 02 ...

  13. Application to Export Electric Energy OE Doc No. EA-339-A Shell...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Doc No. EA-339-A Shell Energy North America (US), L.P. Application to Export Electric Energy OE Doc No. EA-339-A Shell Energy North America (US), L.P. Application from Shell Energy ...

  14. Microsoft Word - VI_12_Degrees Awarded 2015.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    4 - March 31, 2015 Name Year Thesis Title Advisor Present Position Hua Zheng 2014 Density and temperature in quantum nuclear systems A. Bonasera Post Doc. at INFN - Laboratori Nazionali del Sud, Catania, Italy STUDENTS WHO RECEIVED GRADUATE DEGREES FROM NON-THESIS April 1, 2014 - March 31, 2015 Name Year Advisor Present Position Issac Sarver 2014 R. Rapp

  15. Microsoft Word - ex15-ITER-sept10.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    5 - Rights in Data-Special Works - ITER UT-B Contracts Div Sept 2010 Page 1 of 1 ex15-ITER-sept10.doc Exhibit 15-ITER Ref: FAR 52.227-17 RIGHTS IN DATA SPECIAL WORKS ITER ...

  16. Microsoft Word - Corp Impl 10-05-06.final.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Corp Impl 10-05-06.final.doc Microsoft Word - Corp Impl 10-05-06.final.doc Microsoft Word - Corp Impl 10-05-06.final.doc (422.79 KB) More Documents & Publications ESTABLISHMENT OF MANAGEMENT DECISIONS ON OFFICE OF INSPECTOR GENERAL REPORTS, DOE O 221.3 Microsoft Word - AL2007-01.doc DOE Systems Engineering Methodology (SEM): Stage Exit V

  17. Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy National Policy AssurancesAwardTermsREVJuly2005.doc Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc (31.87 KB) More Documents & Publications Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc National Policy Assurances to be Incorporated as Award Terms Microsoft Word - NationalPolicyAssurances5-06

  18. Microsoft Word - AcqGuide70pt31A.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AcqGuide70pt31A.doc Microsoft Word - AcqGuide70pt31A.doc Microsoft Word - AcqGuide70pt31A.doc (30.08 KB) More Documents & Publications AcqGuide70pt31.doc&#0; Acquisition Guide Chapter 70.31A - Costs Associated with Whistleblower Actions Acquisition Letter No. AL-2016-06

  19. DOE/Grand Junction Office Bluewater LTSP July 1997 Doc. No. S00012AA...

    Office of Legacy Management (LM)

    DOEGrand Junction Office Bluewater LTSP July 1997 Doc. No. S00012AA, Page iii Contents Page 1.0 Introduction ......

  20. Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion

    Energy.gov [DOE]

    Performance of two commercially available DOCs with different precious metal loadings and Pt:Pd ratios were compared to model DOC containing Pt only

  1. Microsoft Word - Fact Sheet Environment 100808 FINAL.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Environment 100808 FINAL.doc Microsoft Word - Fact Sheet Environment 100808 FINAL.doc Microsoft Word - Fact Sheet Environment 100808 FINAL.doc (56.51 KB) More Documents & Publications Major Communications Report May 5, 2009 Major Communications Report April 30, 2009 Major Communications Report April 28, 2009

  2. Microsoft Word - va_Final3a_06-04-032.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    vaFinal3a06-04-032.doc Microsoft Word - vaFinal3a06-04-032.doc PDF icon Microsoft Word - vaFinal3a06-04-032.doc More Documents & Publications DOE F 473.2 Headquarters ...

  3. Microsoft Word - ADR Revised Policy82508Reformatted.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy ADR Revised Policy82508Reformatted.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc (52.42 KB) More Documents & Publications ADR Policy Federal Register Document 2009 ECR FINAL REPORT 2010

  4. Microsoft Word - CHAP02ESH _REVISED1_3.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    CHAP02ESH _REVISED1_3.doc Microsoft Word - CHAP02ESH _REVISED1_3.doc Microsoft Word - CHAP02ESH _REVISED1_3.doc (183.77 KB) More Documents & Publications Regulatory Aspects of ISM COMMENTS&#0; A:\CHAP05PERFASSM(REVISED).PDF&#0;

  5. AcqGuide35pt1rev2.doc | Department of Energy

    Energy Saver

    AcqGuide35pt1rev2.doc&0; AcqGuide35pt1rev2.doc&0; AcqGuide35pt1rev2.doc&0; More Documents & Publications Attachment FY2011-58 OPAM Chapter 35 - Research and Development...

  6. Microsoft Word - Bill's version 5-20-05.doc | Department of Energy

    Energy Saver

    Bill's version 5-20-05.doc Microsoft Word - Bill's version 5-20-05.doc Microsoft Word - Bill's version 5-20-05.doc (717.91 KB) More Documents & Publications Audit Report: IG-0690 Audit Report: OAS-M-06-04 Audit Report: OAI-M-16-15

  7. NDIA_PMSC_SurveillanceGuide_Oct2004.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    NDIA_PMSC_SurveillanceGuide_Oct2004.doc NDIA_PMSC_SurveillanceGuide_Oct2004.doc NDIA_PMSC_SurveillanceGuide_Oct2004.doc (117.26 KB) More Documents & Publications EVMS Surveillance Standard Operating Procedure (ESSOP) NDIA_PMSC_EVMS_IntentGuide_Nov_2006.pdf Recommendations to Improve EVM and Project Management Integration in the DOE

  8. Microsoft Word - PressRelease_Siting_2-8-06_Final.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PressReleaseSiting2-8-06Final.doc Microsoft Word - PressReleaseSiting2-8-06Final.doc PDF icon Microsoft Word - PressReleaseSiting2-8-06Final.doc More Documents & ...

  9. Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    DOE E-Government Act Report 11.16.06 Final.doc Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc ...

  10. Microsoft Word - NMMSS News DEC 23 08 Update.doc

    National Nuclear Security Administration (NNSA)

    IS SPONSORED BY DOE AND NRC NMMSS news PUBLISHED PERIODICALLY BY & FOR NMMSS USERS December 23, 2008 SPECIAL EDITION NUREG/BR-0007, Rev.6 Published The NRC wishes to inform industry that it has published its update of NUREG/BR-0007. This NUREG was updated to reflect changes to NMMSS reports that become effective January 1, 2009. Link to the updated NUREG: http://www.nrc.gov/reading-rm/doc-collections/nuregs/brochures/br0007/r6/index.html

  11. Microsoft Word - NO1113_Dewatering report.doc

    Office of Legacy Management (LM)

    C Hydrologic Assessment of Dewatering for Installation of the Belcher Road Water Transmission Line This page intentionally left blank U.S. Department of Energy Dewatering Evaluation Report for Road Const. & Water Line Replacement June 2008 Doc. No. N0111300 Page C-3 The rate of pumping resulting from aquifer dewatering for installation of the planned water transmission line beneath Belcher Road is expected be larger than any of the discharge rates associated with drainage infrastructure

  12. Microsoft Word - S04801_Avian2008 _2_ revised.doc

    Office of Legacy Management (LM)

    Final Report Avian Wetland Surveys at Monticello Mill Tailings Site, 2008 November 2008 LMS/MNT/S04801 This page intentionally left blank LMS/MNT/S04801 Final Report Avian Wetland Surveys at Monticello Mill Tailing Site, 2008 November 2008 This page intentionally left blank U.S. Department of Energy Avian Wetland Surveys at Monticello Mill Tailing Site, 2008 November 2008 Doc. No. S0480100 Page i Contents 1.0 Summary

  13. Microsoft Word - S04816_InvestigationPlan.doc

    Office of Legacy Management (LM)

    New Brunswick, New Jersey, Site Investigation Plan to Identify Potential Radiological Contamination in a Sanitary Sewer December 2008 LMS/NBL/S04816 This page intentionally left blank New Brunswick, New Jersey, Site Investigation Plan to Identify Potential Radiological Contamination in a Sanitary Sewer December 2008 This page intentionally left blank U.S. Department of Energy Investigation Plan to Identify Contamination in a Sanitary Sewer December 2008 Doc. No. S0481600 Page i Contents 1.0

  14. Microsoft Word - S04877_AnnInspRpt2008.doc

    Office of Legacy Management (LM)

    Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2008 LMS/MNT/S04877 This page intentionally left blank LMS/MNT/S04877 2008 Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2008 This page intentionally left blank U.S. Department of Energy 2008 Annual Inspection-Monticello, Utah December 2008 Doc. No. S487700 Page i Contents Executive

  15. Microsoft Word - S04929_GW_Mon_NDEP_Final.doc

    Office of Legacy Management (LM)

    8 Groundwater Monitoring Report Central Nevada Test Area, Corrective Action Unit 443 March 2009 Rev. 1 LMS/CNT/S04929 This page intentionally left blank LMS/CNT/S04929 2008 Groundwater Monitoring Report Central Nevada Test Area, Corrective Action Unit 443 March 2009 Rev. 1 This page intentionally left blank U.S. Department of Energy 2008 Groundwater Monitoring Report-CNTA, CAU 443 March 2009 Doc. No. S04929 Rev. 1 Page i Contents 1.0

  16. Microsoft Word - S04932 History final.doc

    Office of Legacy Management (LM)

    FUSRAP History of the Chupadera Mesa, NM, Site December 2008 Doc. No. S0493200 (FUSRAP NM.04-5) Page 1 of 9 FUSRAP History of the Chupadera Mesa, NM, Site The following historical summary is provided to document the inclusion of the Chupadera Mesa, NM, Site into the Formerly Utilized Sites Remedial Action Program (FUSRAP). Although no remedial action was required, the site met eligibility criterion and was included under FUSRAP, under which the final radiological surveys were performed.

  17. Microsoft Word - S05072_WaterQualityComplStrategy.doc

    Office of Legacy Management (LM)

    Water Quality Compliance Strategy December 2009 LMS/MNT/S05072 This page intentionally left blank LMS/MNT/S05072 Monticello Mill Tailings Site Operable Unit III Water Quality Compliance Strategy December 2009 This page intentionally left blank U.S. Department of Energy MMTS Water Quality Compliance Strategy December 2009 Doc. No. S05072 Page i Contents 1.0 Introduction......................................................................................................................... 1 1.1

  18. Microsoft Word - S05378_2009 GW Rpt.doc

    Office of Legacy Management (LM)

    08 through April 2009 October 2009 LMS/MNT/S05378 This page intentionally left blank LMS/MNT/S05378 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report May 2008 through April 2009 October 2009 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report May 2008-April 2009 October 2009 Doc. No. S05378 Page i Contents

  19. Microsoft Word - S05551_1stqtr report.doc

    Office of Legacy Management (LM)

    09 July 2009 LMS/RFS/S05551 This page intentionally left blank LMS/RFS/S05551 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2009 July 2009 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2009 July 2009 Doc. No. S05551 Page i Contents

  20. Microsoft Word - S05837_FFA 4th qtr 09.doc

    Office of Legacy Management (LM)

    July 1-September 30, 2009 October 2009 Doc. No. S05837 Page 1 Monticello National Priorities List Sites Federal Facilities Agreement (FFA) Quarterly Report: July 1-September 30, 2009 This report summarizes project status and activities implemented July through September 2009, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) sites. This report also includes disposal cell and Pond 4 leachate collection data,

  1. Microsoft Word - S06397_Apr09 thru Mar10.doc

    Office of Legacy Management (LM)

    Groundwater Report April 2009 through March 2010 Tuba City, Arizona, Disposal Site July 2010 LMS/TUB/S06397 This page intentionally left blank LMS/TUB/S06397 Annual Groundwater Report April 2009 through March 2010 Tuba City, Arizona, Disposal Site July 2010 This page intentionally left blank U.S. Department of Energy Tuba City Annual Groundwater Report-April 2009 through March 2010 July 2010 Doc. No. S06397 Page i Contents 1.0 Introduction

  2. Microsoft Word - S06430_JanMar.doc

    Office of Legacy Management (LM)

    31, 2010 April 2010 Doc. No. S06430 Page 1 Monticello, Utah, National Priorities List Sites Federal Facilities Agreement (FFA) Quarterly Report: January 1-March 31, 2010 This report summarizes project status and activities implemented January through March 2010, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) Site. This report also includes disposal cell and Pond 4 leachate collection data, quarterly site

  3. Microsoft Word - S06528_1st qtr 2010.doc

    Office of Legacy Management (LM)

    10 July 2010 LMS/RFS/S06528 This page intentionally left blank LMS/RFS/S06528 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2010 July 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2010 July 2010 Doc. No. S06528 Page i Contents

  4. Microsoft Word - S06584StSoil.doc

    Office of Legacy Management (LM)

    Radiological Assessment of Stained Soils at the Monument Valley Processing Site June 2010 LMS/MON/S06584 This page intentionally left blank LMS/MON/S06584 Radiological Assessment of Stained Soils at the Monument Valley Processing Site June 2010 This page intentionally left blank U.S. Department of Energy Radiological Assessment of Stained Soils at the Monument Valley Processing Site June 2010 Doc. No. S06584 Page i Contents

  5. Microsoft Word - S06770_AprJune.doc

    Office of Legacy Management (LM)

    April 1-June 30, 2010 July 2010 Doc. No. S06770 Page 1 Monticello, Utah, National Priorities List Sites Federal Facilities Agreement (FFA) Quarterly Report: April 1-June 30, 2010 This report summarizes project status and activities implemented April through June 2010, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) Site. This report also includes disposal cell and Pond 4 leachate collection data, quarterly

  6. Microsoft Word - S07079_jul_sep_10.doc

    Office of Legacy Management (LM)

    July 1-September 30, 2010 October 2010 Doc. No. S07079 Page 1 Monticello, Utah, National Priorities List (NPL) Sites Federal Facilities Agreement (FFA) Quarterly Report: July 1-September 30, 2010 This report summarizes project status and activities implemented July through September 2010, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) Site. This report also includes disposal cell and Pond 4 leachate

  7. Microsoft Word - S08999_Apr11-Mar12.doc

    Office of Legacy Management (LM)

    1 Through March 2012 Tuba City, Arizona, Disposal Site July 2012 LMS/TUB/S08999 This page intentionally left blank LMS/TUB/S08999 Annual Groundwater Report April 2011 Through March 2012 Tuba City, Arizona, Disposal Site July 2012 This page intentionally left blank U.S. Department of Energy Tuba City Annual Groundwater Report-April 2011 through March 2012 July 2012 Doc. No. S08999 Page i Contents Abbreviations

  8. Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Citrix_2FA_Authentication_12_3_2009.doc Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc (453.3 KB) More Documents & Publications Citrix_2FA_Authentication_09.09 Using Two-Factor RSA Token with WebVPN User guide for remote access to VDI and Workplace using RSA token

  9. Microsoft Word - GNEP Website Glossary 2006-02-03_no_links.doc | Department

    Office of Environmental Management (EM)

    of Energy GNEP Website Glossary 2006-02-03_no_links.doc Microsoft Word - GNEP Website Glossary 2006-02-03_no_links.doc Microsoft Word - GNEP Website Glossary 2006-02-03_no_links.doc (29.63 KB) More Documents & Publications GNEP Glossary Generation-IV Roadmap Report of the Fuel Cycle Crosscut Group DOE-HDBK-1113-2008

  10. Microsoft Word - o435.1Chg1Recertification.doc

    Office of Environmental Management (EM)

    competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc (215.28 KB) More Documents & Publications AcqGuide 5.2-OPAM Acquisition Guide, Chapter 6.1, Competition Requirements Microsoft Word - AG Chapter 6 1 Nov 2010

    CITSS Configurable Item List COTS Software CITSS Configurable Items Page 1 January 1998 CI # CITSS Function Vendor/Version Install Date Location Description/Notes SW-001 Data Base Server

  11. Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc (160.81 KB) More Documents & Publications Notice of Proposed Rulemaking (August 6, 2009) Notice of Proposed Rulemaking (May 16, 2007) Final Rule (December 4, 2009)

  12. Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy NSRC precompetitive User Agreement amended 1-18-07.doc Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc (69.15 KB) More Documents & Publications EXHIBIT A: CRADA, WFO, PUA and NPUA Comparison Table, with suggested changes Class_Waiver_NPUA-2.pdf ClassWaiver-PUA.pdf

  13. Microsoft Word - NO1113_Dewatering report.doc

    Office of Legacy Management (LM)

    Description of Groundwater Modeling This page intentionally left blank U.S. Department of Energy Dewatering Evaluation Report for Road Const. & Water Line Replacement June 2008 Doc. No. N0111300 Page A-3 A1.0 Modeling Codes Groundwater flow in the Building 100 area is simulated with the finite-difference code MODFLOW, as developed by the U.S. Geological Survey (McDonald and Harbaugh 1988, Harbaugh and McDonald 1996). The particle tracking module MODPATH (Pollock 1989) is employed to

  14. Microsoft Word - S01187_RVT LTMP.doc

    Office of Legacy Management (LM)

    Management Plan for the Riverton, Wyoming, Processing Site September 2009 LMS/RVT/S001187-0.0 Formerly DOE-LM/1430-2007 This page intentionally left blank LMS/RVT/S01187-0.0 Formerly DOE-LM/1430-2007 Long-Term Management Plan for the Riverton, Wyoming, Processing Site September 2009 This page intentionally left blank U.S. Department of Energy Long-Term Management Plan for the Riverton, Wyoming, Processing Site September 2009 Doc. No. S01187-0.0 Page i Contents

  15. Microsoft Word - S0162200_VariationHydraulicConductivity-PRB.doc

    Office of Legacy Management (LM)

    DOE-LM/GJ803-2005 ESL-RPT-2005-01 Variation in Hydraulic Conductivity Over Time at the Monticello Permeable Reactive Barrier February 2005 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado U.S. Department of Energy Variation in Hydraulic Conductivity Over Time at the Monticello Permeable Reactive Barrier February 2005 Doc. No. S0162200 Page v Contents Executive

  16. Microsoft Word - ex15-ITER-sept10.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    5 - Rights in Data-Special Works - ITER UT-B Contracts Div Sept 2010 Page 1 of 1 ex15-ITER-sept10.doc Exhibit 15-ITER Ref: FAR 52.227-17 RIGHTS IN DATA í SPECIAL WORKS í ITER (Sept 2010) (a) Definitions. (1) "Data", as used in this clause, means recorded information, regardless of form or the media on which it may be recorded. The term includes technical data and computer software. The term does not include information incidental to contract administration, such as financial,

  17. Microsoft Word - ex1b-ITER-mar07.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    B - Patent Rights - Acquisition by the Government - ITER UT-B Contracts Div March 2007 Page 1 of 6 ex1b-ITER-mar07.doc Exhibit 1B ITER Ref: DEAR 952.227-13 PATENT RIGHTS - ACQUISITION BY THE GOVERNMENT - ITER (Mar 2007) (a) Definitions. (1) "Invention", as used in this clause, means any invention or discovery which is or may be patentable or otherwise protectable under title 35 of the United States Code or any novel variety of plant that is or may be protectable under the Plant Variety

  18. Microsoft Word - ex9-ITER-june11.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    - Technical Data - ITER UT-B Contracts Div June 2011 Page 1 of 5 ex9-ITER-june11.doc Exhibit 9 ITER Ref: DEAR 927.409; FAR 52.227-14, 52.227-14 Alt.V, 52.227-16 TECHNICAL DATA - ITER (June 2011) 1. RIGHTS IN DATA - GENERAL (a) Definitions. (1) "Computer data bases," as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include computer software. (2) "Computer

  19. Microsoft Word - ex9ed-ITER-june11.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    ED - Technical Data - ITER UT-B Contracts Div June 2011 Page 1 of 5 ex9ed-ITER-june11.doc Exhibit 9ED ITER Ref: DEAR 927.409; FAR 52.227-14, 52.227-14 Alt. IV, 52.227-14 Alt. V, 52.227-16 TECHNICAL DATA - ITER (June 2011) 1. RIGHTS IN DATA-GENERAL (a) Definitions. (1) "Computer data bases," as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include computer

  20. Microsoft Word - ex9rdf-ITER-sept09.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    RDF - Technical Data - ITER UT-B Contracts Div Sept 2009 Page 1 of 5 ex9rdf-ITER-sept09.doc Exhibit 9RDF-ITER Ref: DEAR 970.5227-1 TECHNICAL DATA - ITER (Sept 2009) 1. Rights in Data-Facilities. (a) Definitions. (1) "Computer Data Bases", as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include Computer Software. (2) "Computer Software", as used in this

  1. Microsoft Word - 25 May Vienna GTR Fact Sheet_FINAL 1 .doc |...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1 .doc More Documents & Publications Global Threat Reduction Initiative U.S. Global Threat Reduction InitiativeU.S.-Origin Nuclear Fuel Removals Global Threat Reduction Initiative...

  2. OSTIblog Articles in the Adopt-A-Doc Topic | OSTI, US Dept of...

    Office of Scientific and Technical Information (OSTI)

    STIP is a robust and effective collaboration across the DOE... Related Topics: .EDUconnections, Adopt-A-Doc, DOE Green Energy, DOE STI, journal literature, National Library of ...

  3. Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc meeting on Energy Efficiency and Sustainable Design of Federal Buildings Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc (99.54 KB) More Documents & Publications Ex Parte Memo - 09 02 Mtg-09.09.10.doc Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc

  4. Relative importance of multiple factors on terrestrial loading of DOC to Arctic river networks

    SciTech Connect

    Kicklighter, David W.; Hayes, Daniel J; Mcclelland, James W; Peterson, Bruce; Mcguire, David; Melillo, Jerry

    2014-01-01

    Terrestrial carbon dynamics influence the contribution of dissolved organic carbon (DOC) to river networks in addition to controlling carbon fluxes between the land surface and the atmosphere. In this study, we use a biogeochemical process model to simulate the lateral transfer of DOC from land to the Arctic Ocean via riverine transport. We estimate that the pan-arctic watershed has contributed, on average, 32 Tg C/yr of DOC to the Arctic Ocean over the 20th century with most coming from the extensive area of boreal deciduous needle-leaved forests and forested wetlands in Eurasian watersheds. We also estimate that the rate of terrestrial DOC loading has been increasing by 0.037 Tg C/yr2 over the 20th century primarily as a result of increases in air temperatures and precipitation. These increases have been partially compensated by decreases in terrestrial DOC loading caused by wildfires. Other environmental factors (CO2 fertilization, ozone pollution, atmospheric nitrogen deposition, timber harvest, agriculture) are estimated to have relatively small effects on terrestrial DOC loading to arctic rivers. The effects of the various environmental factors on terrestrial carbon dynamics have both compensated and enhanced concurrent effects on hydrology to influence terrestrial DOC loading. Future increases in riverine DOC concentrations and export may occur from warming-induced increases in terrestrial DOC production associated with enhanced microbial metabolism and the exposure of additional organic matter from permafrost degradation along with decreases in water yield associated with warming-induced increases in evapotranspiration. Improvements in simulating terrestrial DOC loading to pan-arctic rivers in the future will require better information on the spatial distribution of precipitation and its temporal trends, carbon dynamics of larch-dominated ecosystems in eastern Siberia, and the role of industrial organic effluents on carbon budgets of rivers in western

  5. Microsoft Word - 48D7DF19-707E-28B27A.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    48D7DF19-707E-28B27A.doc Microsoft Word - 48D7DF19-707E-28B27A.doc PDF icon Microsoft Word - 48D7DF19-707E-28B27A.doc More Documents & Publications Microsoft Word - ...

  6. Microsoft Word - 46ED31B8-1E53-08CF52.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    46ED31B8-1E53-08CF52.doc Microsoft Word - 46ED31B8-1E53-08CF52.doc PDF icon Microsoft Word - 46ED31B8-1E53-08CF52.doc More Documents & Publications Microsoft Word - ...

  7. Microsoft Word - Turbine Manufactures MOU FINAL_5-31-08_.doc | Department

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    of Energy Turbine Manufactures MOU FINAL_5-31-08_.doc Microsoft Word - Turbine Manufactures MOU FINAL_5-31-08_.doc Microsoft Word - Turbine Manufactures MOU FINAL_5-31-08_.doc (65.18 KB) More Documents & Publications Memorandum of Understanding between the U.S. Wind Turbine Manufacturers and the U.S. Department of Energy on Developing a Shared Strategy to Achieve 20% Wind Energy in 2030 Linkages from DOE's Wind Energy Program to Commercial Renewable Power Generation DOE Wind Energy

  8. Find "Hot Docs" at the Geothermal Technologies Legacy Collection | OSTI, US

    Office of Scientific and Technical Information (OSTI)

    Dept of Energy Office of Scientific and Technical Information "Hot Docs" at the Geothermal Technologies Legacy Collection Back to the OSTI News Listing for 2008 The Legacy Collection Now you can get "Hot Docs" from the Geothermal Technologies Legacy Collection. These are documents that have been searched for and downloaded more than any other documents in the collection during the previous month and each preceding month. "Hot Docs" are highlighted for

  9. V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy 5: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability June 25, 2013 - 12:41am Addthis PROBLEM: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability PLATFORM: Apache OpenOffice SDK 3.x ABSTRACT: Apache has acknowledged a vulnerability in Apache OpenOffice SDK REFERENCE LINKS: Apache OpenOffice Secunia Advisory SA53963 Secunia Advisory SA53846 CVE-2013-1571 IMPACT ASSESSMENT:

  10. Application to Export Electric Energy OE Doc No. EA-339-A Shell...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    78, No. 45 - March 7, 2013 Application to Export Electric Energy OE Doc No. EA-339-A Shell Energy North America (US), L.P.: Federal Register Notice, Volume 78, No. 45 - March 7,...

  11. Microsoft Word - FEMP-State MOU pdf version.doc | Department...

    Energy.gov [DOE] (indexed site)

    FEMP-State MOU pdf version.doc (15.06 KB) More Documents & Publications FEMP Peer Review 2001 FEMP Customer Survey Report (Appendices) Federal Utility Partnership Working Group ...

  12. Fact Sheet -- Climate VISION 02-12-031.doc | Department of Energy

    Energy Saver

    Fact Sheet -- Climate VISION 02-12-031.doc&0; (28.89 KB) More Documents & Publications Meeting President Bush's Climate Change Challenge to Business and Industry Climate Vision ...

  13. Microsoft Word - S05516_AttachD1_OrigLndfl_MM_Plan.doc

    Office of Legacy Management (LM)

    ... Energy Doc. No. S05516-1.0 September 2009 Page 3-8 3.4 Soil Cover The cover system at the OLF is designed to meet the minimum soil erosion requirements from both water and wind ...

  14. EIS-0530: DOC Notice of Availability of a Draft Environmental Impact

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Statement | Department of Energy DOC Notice of Availability of a Draft Environmental Impact Statement EIS-0530: DOC Notice of Availability of a Draft Environmental Impact Statement Nationwide Public Safety Broadband Network Programmatic Environmental Impact Statement for the Southern United States The Department of Commerce announces the availability of the Nationwide Public Safety Broadband Network Draft Programmatic Environmental Impact Statement for the Southern United States. For more

  15. An Energy.gov Mini-Doc: 2016 Collegiate Wind Competition | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy An Energy.gov Mini-Doc: 2016 Collegiate Wind Competition An Energy.gov Mini-Doc: 2016 Collegiate Wind Competition Addthis In this short documentary, we follow three student teams who participated in the 2016 U.S. Department of Energy Collegiate Wind Competition in New Orleans. The competition provides undergraduate students real-world skills they need to enter tomorrow's clean energy workforce. The challenge is to: develop and deliver a business plan, establish a deployment strategy,

  16. Deactivation of Accelerated Engine-Aged and Field-Aged SCR Catalysts and the Role of the DOC

    Energy.gov [DOE]

    A technique for accelerated aging of SCR system (DOC -> SCR-> DPF) reveals two deactivation mechanisms and replicates field-aged effects

  17. Application to Export Electric Energy OE Doc No. EA-339-A Shell Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    North America (US), L.P. | Department of Energy Doc No. EA-339-A Shell Energy North America (US), L.P. Application to Export Electric Energy OE Doc No. EA-339-A Shell Energy North America (US), L.P. Application from Shell Energy to export electric energy to Canada. EA-339-A Shell Energy (CN).pdf (423.87 KB) More Documents & Publications EA-339-A Shell Energy North America (US), L.P. EA-339 Shell Energy North America (US), L.P. EA-359-B Castleton Commodities Merchant Trading L.P.

  18. Energy.gov Mini-Doc: Behind the Scenes at the Collegiate Wind Competition |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Energy.gov Mini-Doc: Behind the Scenes at the Collegiate Wind Competition Energy.gov Mini-Doc: Behind the Scenes at the Collegiate Wind Competition July 5, 2016 - 11:15am Addthis Simon Edelman Simon Edelman Chief Creative Officer Paul Lester Paul Lester Digital Content Specialist, Office of Public Affairs In this short documentary, we follow three student teams who participated in the 2016 U.S. Department of Energy Collegiate Wind Competition in New Orleans. The

  19. Microsoft Word - N01716_4_5Acre Dec - May 2012 FINAL DRAFT.doc

    Office of Legacy Management (LM)

    1 Through May 2012 June 2012 LMS/PIN/N01716 U.S. Department of Energy 4.5 Acre Site Semiannual Progress Report for December 2011 Through May 2012 June 2012 Doc. No. N01716 Page i Contents Abbreviations .................................................................................................................................. ii 1.0 Introduction ............................................................................................................................1 1.1 Site Activities

  20. Microsoft Word - N01765_4_5 Acre semiannual june-nov 2012.doc

    Office of Legacy Management (LM)

    June Through November 2012 December 2012 LMS/PIN/N01765 U.S. Department of Energy Pinellas 4.5 Acre Site Semiannual Progress Report for June-November 2012 December 2012 Doc. No. N01765 Page i Contents Abbreviations .................................................................................................................................. ii 1.0 Introduction ............................................................................................................................1 1.1 Site

  1. Microsoft Word - N01797_4_5Acre Semiannual.doc

    Office of Legacy Management (LM)

    2 Through May 2013 June 2013 LMS/PIN/N01797 U.S. Department of Energy Pinellas 4.5 Acre Site Semiannual Progress Report for December 2012-May 2013 June 2013 Doc. No. N01797 Page i Contents Abbreviations .................................................................................................................................. ii 1.0 Introduction ............................................................................................................................1 1.1 Site Activities

  2. Microsoft Word - S08400_2012_MVP_5yrRev.doc

    Office of Legacy Management (LM)

    Report For Monticello Radioactively Contaminated Properties Superfund Site San Juan County Monticello, Utah June 2012 LMS/MNT/S08400 This page intentionally left blank June 18, 2012 This page intentionally left blank This page intentionally left blank U.S. Department of Energy Fourth Five-Year Review Report for MVP June 2012 Doc. No. S08400 Page i Contents Abbreviations

  3. Microsoft Word - N01307_Sitewide semiannual June-Nov08.doc

    Office of Legacy Management (LM)

    Young - Rainey STAR Center June through November 2008 December 2008 LMS/PIN/N01307 LMS/PIN/N01307 Pinellas Environmental Restoration Project Sitewide Environmental Monitoring Semiannual Progress Report for the Young - Rainey STAR Center June through November 2008 December 2008 U.S. Department of Energy Sitewide Semiannual Progress Report for June through November 2008 December 2008 Doc. No. N0130700 Page i Contents Acronyms and Abbreviations

  4. Microsoft Word - N01308_4 5Acre June-Nov08_psd.doc

    Office of Legacy Management (LM)

    Young - Rainey STAR Center's 4.5 Acre Site June through November 2008 December 2008 LMS/PIN/N01308 LMS/PIN/N01308 Pinellas Environmental Restoration Project Semiannual Progress Report for the Young - Rainey STAR Center's 4.5 Acre Site June through November 2008 December 2008 U.S. Department of Energy 4.5 Acre Site Semiannual Progress Report for June through November 2008 December 2008 Doc. No. N0130800 Page i Contents Acronyms and Abbreviations

  5. Microsoft Word - N01347_Sitewide semiannual Dec-May09.doc

    Office of Legacy Management (LM)

    for the Young - Rainey STAR Center December 2008 through May 2009 June 2009 LMS/PIN/N01347 LMS/PIN/N01347 Pinellas Environmental Restoration Project Sitewide Environmental Monitoring Semiannual Progress Report for the Young - Rainey STAR Center December 2008 through May 2009 June 2009 U.S. Department of Energy Sitewide Semiannual Progress Report for December 2008 through May 2009 June 2009 Doc. No. N01347 Page i Contents

  6. Microsoft Word - N01350_4 5Acre Dec-May09.doc

    Office of Legacy Management (LM)

    8 through May 2009 June 2009 LMS/PIN/N01350 LMS/PIN/N01350 Pinellas Environmental Restoration Project Semiannual Progress Report for the 4.5 Acre Site December 2008 through May 2009 June 2009 U.S. Department of Energy 4.5 Acre Site Semiannual Progress Report for December 2008 through May 2009 June 2009 Doc. No. N01350 Page i Contents Abbreviations ................................................................................................................................ iii 1.0 Introduction

  7. Microsoft Word - N01357_NE Site Final LDA Report.doc

    Office of Legacy Management (LM)

    Interim Remedial Action for Source Removal at the Northeast Site Final Report September 2009 LMS/PIN/N01357 This page intentionally left blank LMS/PIN/N01357 Pinellas Environmental Restoration Project Interim Remedial Action for Source Removal at the Northeast Site Final Report September 2009 This page intentionally left blank U.S. Department of Energy Interim Remedial Action for Source Removal at the Northeast Site-Final Report September 2009 Doc. No. N01357 Page i Contents

  8. Microsoft Word - N01440_4 5Acre Jun-Nov09.doc

    Office of Legacy Management (LM)

    June through November 2009 December 2009 LMS/PIN/N01440 LMS/PIN/N01440 Pinellas Environmental Restoration Project Semiannual Progress Report for the 4.5 Acre Site June through November 2009 December 2009 U.S. Department of Energy 4.5 Acre Site Semiannual Progress Report for June through November 2009 December 2009 Doc. No. N01440 Page i Contents Abbreviations.................................................................................................................................. ii 1.0

  9. Microsoft Word - N01514_4 5Acre Dec09-May10.doc

    Office of Legacy Management (LM)

    9 through May 2010 June 2010 LMS/PIN/N01514 LMS/PIN/N01514 Pinellas Environmental Restoration Project Semiannual Progress Report for the 4.5 Acre Site December 2009 through May 2010 June 2010 U.S. Department of Energy 4.5 Acre Site Semiannual Progress Report for December 2009 through May 2010 June 2010 Doc. No. N01514 Page i Contents Abbreviations.................................................................................................................................. ii 1.0 Introduction

  10. Microsoft Word - S05212_2008 Post-Closure InspRpt.doc

    Office of Legacy Management (LM)

    Salmon, Mississippi, Site Calender Year 2008 March 2009 LMS/SAL/S05212 This page intentionally left blank LMS/SAL/S05212 Post-Closure Inspection, Sampling, and Maintenance Report for the Salmon, Mississippi, Site Calendar Year 2008 March 2009 This page intentionally left blank U.S. Department of Energy Post-Closure Inspection, Sampling, and Maintenance Report for Salmon-Calendar Year 2008 March 2009 Doc. No. S05212 Page i Contents

  11. Microsoft Word - Apr-June 2012 Monticello Quarterly_S09178_FFA -final.doc

    Office of Legacy Management (LM)

    2 June 2012 Doc. No. S09178 Page 1 Monticello, Utah, National Priorities List Sites Federal Facility Agreement Quarterly Report: April 1-June 30, 2012 1.0 Introduction This report summarizes the status of the Monticello Vicinity Properties (MVP) and the Monticello Mill Tailings Site (MMTS), located in and near Monticello, Utah, for the period of April through June 2012. The report also includes a summary of projected near-term activity and reporting requirements. Quarterly reports are submitted

  12. Microsoft Word - July-Sept 2012 FFA Monticello Quarterly Report.doc

    Office of Legacy Management (LM)

    2 October 2012 Doc. No. S09401 Page 1 Monticello, Utah, National Priorities List Sites Federal Facility Agreement (FFA) Quarterly Report: July 1-September 30, 2012 1.0 Introduction This report summarizes the status of the Monticello Vicinity Properties (MVP) and the Monticello Mill Tailings Site (MMTS), located in and near Monticello, Utah, for the period of July through September 2012. The report also includes a summary of projected near-term activity and reporting requirements. Quarterly

  13. Microsoft Word - S04516_2008 GW Rpt Cover.doc

    Office of Legacy Management (LM)

    October 2007 through April 2008 September 2008 LMS/MNT/S04516 This page intentionally left blank LMS/MNT/S04516 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report October 2007 through April 2008 September 2008 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report October 2007-April 2008 September 2008 Doc. No. S0451600 Page iii Contents 1.0

  14. Microsoft Word - S04916_2008 Macroinvert Biomonitoring Rpt.doc

    Office of Legacy Management (LM)

    Macroinvertebrate Sampling for 2008 and Summary of Biomonitoring Studies December 2008 LMS/MNT/S04916 This page intentionally left blank LMS/MNT/S04916 Monticello Mill Tailings Site Macroinvertebrate Sampling for 2008 and Summary of Biomonitoring Studies December 2008 This page intentionally left blank U.S. Department of Energy 2008 Macroinvertebrate Sampling-Monticello, Utah December 2008 Doc. No. S0491600 Page i Contents Executive

  15. Microsoft Word - S05037_Trench2_03-02-09.doc

    Office of Legacy Management (LM)

    the Trench 2 Groundwater Remediation System at the Shiprock, New Mexico, Legacy Management Site March 2009 LMS/SHP/S05037 This page intentionally left blank LMS/SHP/S05037 Evaluation of the Trench 2 Groundwater Remediation System at the Shiprock, New Mexico, Legacy Management Site March 2009 This page intentionally left blank U.S. Department of Energy Evaluation of Trench 2 Groundwater Remediation System at Shiprock March 2009 Doc. No. S05037 Page i Contents 1.0 Introduction

  16. Microsoft Word - S05263_2009 Annual IC Assmt Rpt.doc

    Office of Legacy Management (LM)

    Site-Wide Institutional Controls Applied to the Former DOE Mound Site Property June 2009 LMS/MND/S05263 This page intentionally left blank LMS/MND/S05263 Annual Assessment of the Effectiveness of Site-Wide Institutional Controls Applied to the Former DOE Mound Site Property June 2009 This page intentionally left blank U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2009 Doc. No. S05263 Page i Contents

  17. Microsoft Word - S08399_2012 MMTS 5yrRev.doc

    Office of Legacy Management (LM)

    Five-Year Review Report Fourth Five-Year Review Report For Monticello Mill Tailings (USDOE) Site, San Juan County, Monticello, Utah June 2012 LMS/MNT/S08399 This page intentionally left blank June 18, 2012 This page intentionally left blank This page intentionally left blank U.S. Department of Energy Fourth Five-Year Review for MMTS June 2012 Doc. No. S08399 Page i Contents Abbreviations

  18. Microsoft Word - S09615_oct_dec2012 Quarterly Report.doc

    Office of Legacy Management (LM)

    31, 2012 January 2013 LMS/MNT/S09615 This page intentionally left blank LMS/MNT/S09615 Monticello, Utah, National Priorities List Sites Federal Facility Agreement (FFA) Quarterly Report: October 1-December 31, 2012 January 2013 This page intentionally left blank U.S. Department of Energy Monticello NPL Sites FFA Quarterly Report: October-December 2012 January 2013 Doc. No. S09615 Page i Contents Abbreviations

  19. Microsoft Word - S09813_jan_march2013 Quarterly Report AMH2 March 27 2013.doc

    Office of Legacy Management (LM)

    January 1-March 31, 2013 April 2013 LMS/MNT/S09813 This page intentionally left blank LMS/MNT/S09813 Monticello, Utah, National Priorities List Sites Federal Facility Agreement (FFA) Quarterly Report: January 1-March 31, 2013 April 2013 This page intentionally left blank U.S. Department of Energy Monticello NPL Sites FFA Quarterly Report: January-March 2013 April 2013 Doc. No. S09813 Page i Contents Abbreviations

  20. 101907.doc

    Energy Information Administration (EIA) (indexed site)

    ... long term? And 4 secondly, how does the accuracy of the 5 short-term energy outlook price projections? 6 ... is 11 not a forecast, this is a ... 12 things by fuel, this approach ...

  1. 101807.doc

    Energy Information Administration (EIA) (indexed site)

    ... says that since we assume based on 12 engineering data that ... goods, 13 transportation, water pumping, and then cell 14 ... 9 out that the cost of extraction is also 10 problematic ...

  2. Microsoft Word - N01359_4.5AcreLDA Final Report.doc

    Office of Legacy Management (LM)

    Environmental Restoration Project Interim Remedial Action for Source Removal at the 4.5 Acre Site Final Report September 2009 LMS/PIN/N01359 This page intentionally left blank LMS/PIN/N01359 Pinellas Environmental Restoration Project Interim Remedial Action for Source Removal at the 4.5 Acre Site Final Report September 2009 This page intentionally left blank U.S. Department of Energy Interim Remedial Action for Source Removal at the 4.5 Acre Site-Final Report September 2009 Doc. No. N01359 Page

  3. Microsoft Word - S02459_2006Annual GW Rpt.doc

    Office of Legacy Management (LM)

    312-2006 Monticello Mill Tailings Site Operable Unit III Annual Ground Water Report October 2005 through April 2006 September 2006 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Ground Water Report October 2005-April 2006 September 2006 Doc. No. S0245900 Page iii Contents 1.0

  4. Microsoft Word - U0200600-Semi-Annual Report Sept 03 to March 04.doc

    Office of Legacy Management (LM)

    U0200600 DOE-LM/GJ725-2004 Semiannual Performance Report September 2003 through March 2004 for the Shiprock, New Mexico, Site September 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Semi-Annual Performance Report, Shiprock, New Mexico September 2004 Doc. No. U0200600 Page iii Contents 1.0

  5. Associate Research Physicist (Post-doc) - NSTX-U | Princeton Plasma Physics

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Lab (Post-doc) - NSTX-U Department: Experimental Supervisor(s): Dr. Luis F. Delgado-Aparicio Staff: RM 1 Requisition Number: 1600451 The Princeton University Plasma Physics Laboratory (PPPL) seeks to fill a post-doctoral research physicist position at the National Spherical Torus Experiment Upgrade (NSTX-U) in Princeton, NJ. For tokamaks and future facilities to operate safely in a high-pressure long-pulse discharge, it is imperative to address key issues associated with impurity sources,

  6. OSTIblog Articles in the Adopt-A-Doc Topic | OSTI, US Dept of Energy Office

    Office of Scientific and Technical Information (OSTI)

    of Scientific and Technical Information Adopt-A-Doc Topic OSTI Is Re-Focusing and Re-Balancing Its Operations - And Refreshing Its Home Page - to Advance Public Access by Dr. Jeffrey Salmon 03 Mar, 2014 in Products and Content 16895 STIP_slide.jpg OSTI Is Re-Focusing and Re-Balancing Its Operations - And Refreshing Its Home Page - to Advance Public Access Read more about 16895 Let's call it creative destruction, borrowing from a popular term in economics. The idea is that the very essence of

  7. Adopt-A-Doc to help make more research available online | OSTI, US Dept of

    Office of Scientific and Technical Information (OSTI)

    Energy Office of Scientific and Technical Information Adopt-A-Doc to help make more research available online Back to the OSTI News Listing for 2009 Scientists need quick access to important research. But there are many DOE technical reports in need of digitization. In fact, most DOE technical reports from the 1940s to 1991 are still only available in hard copy or microfiche. Now citizens can help make this research available online by adopting documents that are not yet in digital format.

  8. Impact of Biodiesel Impurities on the Performance and Durability of DOC, DPF and SCR Technologies: Preprint

    SciTech Connect

    Williams, A.; McCormick, R.; Luecke, J.; Brezny, R.; Geisselmann, A.; Voss, K.; Hallstrom, K.; Leustek, M.; Parsons, J.; Abi-Akar, H.

    2011-04-01

    An accelerated durability test method determined the potential impact of biodiesel ash impurities, including engine testing with multiple diesel particulate filter substrate types, as well as diesel oxidation catalyst and selective catalyst reduction catalysts. The results showed no significant degradation in the thermo-mechanical properties of a DPF after exposure to 150,000-mile equivalent biodiesel ash and thermal aging. However, exposure to 435,000-mile equivalent aging resulted in a 69% decrease in thermal shock resistance. A decrease in DOC activity was seen after exposure to 150,000-mile equivalent aging, resulting in higher hydrocarbon slip and a reduction in NO2 formation. The SCR catalyst experienced a slight loss in activity after exposure to 435,000-mile equivalent aging. The SCR catalyst, placed downstream of the DPF and exposed to B20 exhaust suffered a 5% reduction in overall NOx conversion activity over the HDDT test cycle. It is estimated that the additional ash from 150,000 miles of biodiesel use would also result in a moderate increases in exhaust backpressure for a DPF. The results of this study suggest that long-term operation with B20 at the current specification limits for alkali and alkaline earth metal impurities will adversely impact the performance of DOC, DPF and SCR systems.

  9. Impact of Biodiesel Impurities on the Performance and Durability of DOC, DPF and SCR Technologies

    SciTech Connect

    Williams, A.; McCormick, R.; Luecke, J.; Brezny, R.; Geisselmann, A.; Voss, K.; Hallstrom, K.; Leustek, M.; Parsons, J.; Abi-Akar, H.

    2011-06-01

    It is estimated that operating continuously on a B20 fuel containing the current allowable ASTM specification limits for metal impurities in biodiesel could result in a doubling of ash exposure relative to lube-oil derived ash. The purpose of this study was to determine if a fuel containing metals at the ASTM limits could cause adverse impacts on the performance and durability of diesel emission control systems. An accelerated durability test method was developed to determine the potential impact of these biodiesel impurities. The test program included engine testing with multiple DPF substrate types as well as DOC and SCR catalysts. The results showed no significant degradation in the thermo-mechanical properties of cordierite, aluminum titanate, or silicon carbide DPFs after exposure to 150,000 mile equivalent biodiesel ash and thermal aging. However, exposure of a cordierite DPF to 435,000 mile equivalent aging resulted in a 69% decrease in the thermal shock resistance parameter. It is estimated that the additional ash from 150,000 miles of biodiesel use would also result in a moderate increases in exhaust backpressure for a DPF. A decrease in DOC activity was seen after exposure to 150,000 mile equivalent aging, resulting in higher HC slip and a reduction in NO{sub 2} formation. The metal-zeolite SCR catalyst experienced a slight loss in activity after exposure to 435,000 mile equivalent aging. This catalyst, placed downstream of the DPF, showed a 5% reduction in overall NOx conversion activity over the HDDT test cycle.

  10. Cycling of DOC and DON by Novel Heterotrophic and Photoheterotrophic Bacteria in the Ocean: Final Report

    SciTech Connect

    Kirchman, David L

    2008-12-09

    The flux of dissolved organic matter (DOM) through aquatic bacterial communities is a major process in carbon cycling in the oceans and other aquatic systems. Our work addressed the general hypothesis that the phylogenetic make-up of bacterial communities and the abundances of key types of bacteria are important factors influencing the processing of DOM in aquatic ecosystems. Since most bacteria are not easily cultivated, the phylogenetic diversity of these microbes has to be assessed using culture-independent approaches. Even if the relevant bacteria were cultivated, their activity in the lab would likely differ from that under environmental conditions. This project found variation in DOM uptake by the major bacterial groups found in coastal waters. In brief, the data suggest substantial differences among groups in the use of high and molecular weight DOM components. It also made key discoveries about the role of light in affecting this uptake especially by cyanobacteria. In the North Atlantic Ocean, for example, over half of the light-stimulated uptake was by the coccoid cyanobacterium, Prochlorococcus, with the remaining uptake due to Synechococcus and other photoheterotrophic bacteria. The project also examined in detail the degradation of one organic matter component, chitin, which is often said to be the second most abundant compound in the biosphere. The findings of this project contribute to our understanding of DOM fluxes and microbial dynamics supported by those fluxes. It is possible that these findings will lead to improvements in models of the carbon cycle that have compartments for dissolved organic carbon (DOC), the largest pool of organic carbon in the oceans.

  11. "V Doc with logo.doc"

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    The Plan's duties with respect to health information about you The Plan is required by law ... health information other than as permitted or required by the Plan documents and by law. ...

  12. Microsoft Word - 07121310 DocProd.doc

    Office of Legacy Management (LM)

    613 2008 - - U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE AM01 07LM00060 - - December 2007 Groundwater Sampling at the Monument Valley, Arizona, Processing Site March 2008 This page intentionally left blank U.S. Department of Energy DVP-December 2007, Monument Valley, Arizona, Processing Site March

  13. Microsoft Word - 08071744_DocProd.doc

    Office of Legacy Management (LM)

    8 Groundwater Sampling at the Shirley Basin South, Wyoming Disposal Site January 2009 LMS/SBS/S00808 This page intentionally left blank This page intentionally left blank U.S. Department of Energy DVP-August 2008, Shirley Basin South, Wyoming, Disposal Site January 2009 RIN 08071744 Page i Contents Sampling Event Summary ...............................................................................................................1 Shirley Basin South, Wyoming, Disposal Site Sample Location Map

  14. Microsoft Word - 08101898_DocProd.doc

    Office of Legacy Management (LM)

    and Surface Water Sampling at the Riverton, Wyoming, Processing Site February 2009 LMS/RVT/S01108 This page intentionally left blank U.S. Department of Energy DVP-November 2008, Riverton, Wyoming, Processing Site February 2009 RIN 08101898 Page i Contents Sampling Event Summary ...............................................................................................................1 Riverton, Wyoming, Processing Site, Sample Locations

  15. Microsoft Word - 08071744_DocProd.doc

    Office of Legacy Management (LM)

    Energy Oflice of Legacy Management Sites. The water level was measured at each sampled well. Monitor wells with an "SC" suffix are completed in the Upper Sand aquifer of the Wind ...

  16. Microsoft Word - 08021395 DocProd.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy ...

  17. Microsoft Word - 08031475_DocProd.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy ...

  18. SPDWRAP#1.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Please notify Aon Hewitt's Your Benefit Resources (YBR) in Appendix G to update your personal information, such as your home address and home telephone number. 2. Eligibility...

  19. Microsoft Word - 10063154.doc

    Office of Legacy Management (LM)

    ... J Less than the determination limit 1006274-13 0741 ... B-04 Duplicate Manganese J Poor field duplicate ... Flex tubing, and a stainless steel inlet weight. ...

  20. SPDWRAP#1.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    March 21, 2014 IMPORTANT This Summary Plan Description (SPD) is intended to provide a summary of the principal features of the LANS Welfare Benefit Plan for Retirees ("Plan"). Additional information about component Benefit Programs is found in the Benefit Program Materials referenced in Appendix C. The documents referred to in Appendix C are hereby incorporated by reference into the SPD and the Plan. This SPD will continue to be updated. Please check back on a regular basis for the

  1. HABAdv#167.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    7 Subject: Stop Work Authority Adopted: November 5, 2004 Page 1 November 5, 2004 Paul Golan, Assistant Secretary of Energy U.S. Department of Energy, Headquarters 1000 Independence Avenue Washington, D.C. 20585 John Shaw, Acting Assistant Secretary Division of Environmental Safety and Health U.S. Department of Energy, Headquarters 1000 Independence Avenue Washington, D.C. 20585 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Roy

  2. HABAdv#1671.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    6 Subject: U Plant Closure Plan Adopted: September 10, 2004 Page 1 September 10, 2004 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Linda Hoffman, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Ron Kreizeneeck, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Subject: U Plant Closure Plan Dear Mssrs. Klein, Kreizeneeck, and Ms.

  3. HABadv-117.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    7 Subject: Low-Level Waste Burial Ground Expansion Adopted: June 8, 2001 Page 1 June 8, 2001 Keith Klein, Manager Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Re: Low-Level Waste Burial Ground Expansion Dear Mr. Klein Hanford continues to face pressure to accept offsite waste while also facing severe challenges in dealing with its own waste. Now the U.S. Department of Energy (DOE) proposes to construct up to four new waste disposal trenches in Hanford's low-

  4. HABadv-118.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    8 Subject: HAMMER Adopted: June 8, 2001 Page 1 June 8, 2001 Keith Klein, Manager Department of Energy P.O. Box 550 (A7-50) Richland, WA 99352 Re: Hazardous Materials Management and Emergency Response Training and Education Center (HAMMER) Dear Mr. Klein Worker, public, and environmental health and safety are a fundamental concern at the Hanford Site. Protection requires prevention of accidents and disease, and prevention requires a work force that is well- trained and drilled in safe work

  5. SPDWRAP#1.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    The Plan is governed by a Federal law (known as ERISA), which provides rights and ... to spouses (as defined under federal law), same-sex domestic partners, and children ...

  6. TsaiFinal.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Characterization of Glass, Carbon, and Hybrid-Fiber SCRIMP Panels Akira Kuraishi, Stephen W. Tsai, and Julie Wang Stanford University Department of Aeronautics and...

  7. HABadv-121.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Manager Department of Energy, Richland Operations P.O. 550 (A7-50) Richland, WA 99352 Harry Boston, Manager Department of Energy, Office of River Protection 2440 Stevens...

  8. Index2.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy _____________________________________________________________________________________________ memorandum Date: October 6, 2004 Reply to Attn of: Department of Energy Headquarters FOIA/Privacy Act Office Subject: Sylvania Corporation, Hicksville, NY and Bayside, NY - Addendum to July 8, 2004 Memo to Reader To: Reader The titles of documents related to the subject matter of this file that are not listed on the July 8, 2004 Memo are listed below. The titles are preceded by the

  9. Environmental Records.doc

    Energy.gov [DOE] (indexed site)

    EIS environmental impact statement EPA U.S. Environmental Protection Agency EPCRA ... Protection Agency (EPA), the DOE, state agencies, the public, or other interested parties. ...

  10. U0083900.doc

    Office of Legacy Management (LM)

    the U.S. Environmental Protection Agency (EPA) to determine the need for notification or ... The purpose of active remediation is to comply with EPA ground water standards defined in ...

  11. 2010sr07.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    February 23, 2010 james-r.giusti@srs.gov Kyle Bryant, EPA-4, (404) 562-9073 bryant.kyle@epa.gov Paivi Nettamo, SRNS, (803) 952-6938 paivi.nettamo@srs.gov SRS Moves Forward With ...

  12. DOEF46001705.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ORGANIZATION LOCAL GOV'T INSTITUTION OF OTHER NONPROFIT C P SP OTHER (Specify) HIGHER EDUCATION ORGANIZATION 14. ACCOUNTING AND APPROPRIATIONS DATA: 15. EMPLOYER I.D. a. TIN: b. ...

  13. Highlights.doc

    Gasoline and Diesel Fuel Update

    ... nuclear, hydroelectric, geothermal, wood, waste, wind and solar power sources. Note: Commercial and industrial categories include electricity output from CHP facilities and ...

  14. 032202ASA.doc

    Energy Information Administration (EIA) (indexed site)

    ... and that there was the possibility also of actions against nuclear power plants and maybe other energy facilities such as refineries within the United States, and uncertainty ...

  15. Microsoft Word - 13045.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    from Environmental Health Risks and Safety Risks By ... as follows: Section 1. Policy. 1-101. A growing body of ... jobs, the environment, public health or safety, or ...

  16. weatherwksht.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Name_______________________________ Date____________________ 1. Copy these two paragraphs, and complete the missing words. Weather refers to changes in atmospheric ________________________ over a very ________________________ time period, such as a minute, an hour, or a ________________________. Atmospheric conditions include ________________________, ________________________, ________________________, ________________________, ________________________, and ________________________. Climate

  17. TentativeAgreement.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Iani, Region 10 Administrator U.S. Environmental Protection Agency CC: R. Jim, YN P. Sobotta, NPT K. Niles, Oregon Energy W. J. Taylor, ORP R. Gay, CTUIR J. H. Swailes, ORP L....

  18. 1B-03.doc

    Office of Environmental Management (EM)

    of the Young-Rainey Science, Technology, and Research Center located in Largo, Florida. ... (STAR) Center, located in Largo, Florida, is the location of a former U.S. ...

  19. Tentative Agreement.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Tentative Agreement on Hanford Federal Facility Agreement and Consent Order (HFFACO) Negotiations for the Management of Hanford RCRA and CERCLA Wastes (HFFACO Milestone Series M-091 and M-016) The U.S. Department of Energy, Richland Operations Office (RL), the State of Washington, Department of Ecology, and the U.S. Environmental Protection Agency (EPA), hereinafter referred to as the Parties, have concluded negotiations for the management of Hanford RCRA and CERCLA wastes under HFFACO Milestone

  20. 2B-05.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5, in: A.R. Gavaskar and A.S.C. Chen (Eds.), Remediation of Chlorinated and Recalcitrant Compounds -2004. Proceedings of the Fourth International Conference on Remediation of Chlorinated and Recalcitrant Compounds (Monterey, CA; May 2004). ISBN 1-57477-145-0, published by Battelle Press, Columbus, OH, www.battelle.org/bookstore. STEAM AND ET-DSP COMBINED FOR DNAPL REMEDIATION: FULL-SCALE SITE RESTORATION AT YOUNG-RAINEY STAR CENTER ABSTRACT: In March of 2003, the United States Department of

  1. win0203.doc

    Gasoline and Diesel Fuel Update

    based on the forecast results obtained for the October 2002 Short-Term Energy ... by generally higher fuel prices, strongly ... As a result, the risk of extreme price runups ...

  2. Highlights.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    ... an exaggerated effect on the spot price of gas. ... Million Barrels Actual Base Case Forecast ... Distillate Fuel Inventories Sources: History: EIA; Projections: Short-Term Energy ...

  3. Highlights.doc

    Gasoline and Diesel Fuel Update

    September 2002 1 Short-Term Energy Outlook September 2002 ... to avoid any serious heating fuel price spikes this winter. ... Actual Actual Base Forecast Natural Gas (Midwest) ...

  4. Highlights.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    ... Energy Information AdministrationShort-Term ... and indicates that fuel demand strength and price pressures early this ... Million Barrels Actual Base Case Forecast Previous ...

  5. 2011_sr_03.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    and operations contractor at SRS, used a 660-ton crane to remove HWCTR's 174,000-pound dome. Over the past two weeks, the crane lifted out two 41,600-pound steam generators and ...

  6. 2011sr01.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    mechanics, engineers, designers and crane operators - guided the project to this day. ... A 660-ton crane with a 200-foot boom was used to lift the 174,000-pound dome by the lugs ...

  7. SEC A.doc

    National Nuclear Security Administration (NNSA)

    ... in the schedule. 13. DISCOUNT FOR PROMPT PAYMENT Not Applicable 10 CALENDAR DAYS % 20 ... BY (If other than Item 7) CODE 25. PAYMENT WILL BE MADE BY CODE See Section G Clause ...

  8. Microsoft Word - 45196.doc

    Office of Legacy Management (LM)

    24 Contaminant Boundary at the Faultless Underground Nuclear Test Prepared by Greg Pohll, Karl Pohlmann, Jeff Daniels, Ahmed Hassan and Jenny Chapman submitted to Nevada Site Office National Nuclear Security Administration U.S. Department of Energy Las Vegas, Nevada APRIL 2003 Publication No. 45196 Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation,

  9. 2010sr15.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    With ARRA Funds, P-Reactor Disassembly Basin Project Moves One Step Closer to Final ... closing the book on the Cold War-era P- Reactor facility at the Savannah River Site (SRS). ...

  10. doeadm-17.doc

    Energy Saver

    ... Researcher's biology notebooks containing all notes pertinent to laboratory experiments, ... monthly, and annually from data recorded in biology notebooks described in item a, above. ...

  11. SPDWRAP#1.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    May 21, 2014 IMPORTANT This Summary Plan Description (SPD) is intended to provide a summary of the principal features of the LANS Welfare Benefit Plan for Retirees ("Plan"). ...

  12. Index2.doc

    Energy Saver

    --- 41664 1. Serious Accidents Issue No. 107, Atomic Energy Commission, dated August 20, 1956. 6 pages. (F2004-00101) 41665 17. Electronic FOIA...

  13. LLNLKEYSFINAL.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Inspections Inspection Report Reporting of Security Incidents at the Lawrence Livermore National Laboratory DOE/IG-0625 November 2003 * Did not take timely compensatory measures to mitigate the potential vulnerabilities resulting from the missing master keys and master Tesa card. During our review we learned that during a May 2003 inventory, Livermore officials identified an additional three master keys and two master Tesa cards that were missing. Although two of the three master keys had been

  14. 102501ASA.doc

    Energy Information Administration (EIA) (indexed site)

    COMMITTEE ON ENERGY STATISTICS + + + + + MEETING + + + + + THURSDAY OCTOBER 25, 2001 + + + ... MS. HUTZLER: Mary Hutzler, Acting Administrator of the Energy Information Administration. ...

  15. Nov08.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    System With more than 300 instrument systems operating at remote sites around the globe, ACRF Instrument Mentors can now use the centralized Operations Support System (OSS)...

  16. 022996A.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Mike Zuteck MDZ Consulting 601 Clear Lake Road Clear Lake Shores, TX Abstract Improving wind turbine blades via bend-twist coupling confronts two difficult challenges. ...

  17. 2010sr21.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Wednesday July 7, 2010 james-r.giusti@srs.gov DOE and NRC to Hold Public Meeting on SRS F Tank Farm Waste Determination Draft Basis Document Aiken, SC - The U.S. Department of...

  18. 1146627_7.DOC

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    PacifiCorp; NextEra Energy Resources, LLC; Invenergy Wind North America LLC; and Horizon Wind Energy LLC Complainants, v. Bonneville Power Administration Respondent. ) ) ) ) ) ) )...

  19. sr0930.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    CONTACTS FOR IMMEDIATE RELEASE Julie Petersen, (803) 952-7690 Monday, October 26, 2009 julie.petersen@srs.gov Kelly Ling, (803) 952-9172 kelly.ling@srs.gov DOE to Honor Nuclear...

  20. craig_IAEA.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    CA USA 3) University of Texas, Austin, TX USA 4) Consorzio RFX, Associazione EURATOM-ENEA sulla Fusione, Padova, Italy e-mail contact of main author: dcraig@wisc.edu Abstract. ...

  1. 2010sr25.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Act Project at SRS Aiken, SC -- Moving radioactive salt safely, closing liquid waste tanks ... This Recovery Act project installed a Water Addition Skid and two 3,000 gallon water tanks ...

  2. 2010SR05.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Big Top Tent Keeps TRU Waste Trucks, Tanks Dry before Inspection and Shipping Big Top Aids Solid Waste Management in Shipping Protocol Aiken, S.C. - Important projects for the ...

  3. N0057000.doc

    Office of Legacy Management (LM)

    ... Progress Report October 2002 Page 4 containment was installed later for the NAPL tanks. ... and vapor carbon primary and polishing tanks, treated water effluent tank, light ...

  4. sr0801.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    closing the Site's 49 high-level waste tanks that currently contain about 36 million ... era salt waste out of the waste storage tanks," said DOE Assistant Secretary for ...

  5. 2010sr20.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Tizzy will remove high- level solid radioactive material from the floor of SRS waste tanks ... to cost effectively close waste tanks and enhances the safety margin for our workers." ...

  6. U0004500.DOC

    Office of Legacy Management (LM)

    155 Environmental Assessment of Ground-Water Compliance Activities at the Uranium Mill Tailings Site, Spook, Wyoming February 1997 DOE/EA-1155 Uranium Mill Tailing Remedial Action Project Environmental Assessment of Ground-Water Compliance Activities At the Uranium Mill Tailings Site Spook, Wyoming February 1997 Prepared by U.S. Department of Energy Albuquerque Operations Office Grand Junction Office Environmental Assessment of Ground-Water Compliance Activities at the Uranium Mill Tailings Site

  7. titlepg.doc

    Gasoline and Diesel Fuel Update

    6.1 27.7 26.0 17.6 10.0 7 7.8 11.6 No Main Space Heating Equipment............. 1.2 N N N N N N N Have Main Space Heating Equipment.......... 109.8 6.1 27.7 26.0 17.6 10.0 7 7.8 11.6 Use Main Space Heating Equipment........... 109.1 6.1 27.7 26.0 17.6 10.0 7 7.8 11.6 Have Equipment But Do Not Use it.............. 0.8 N N N N N N N Main Space Heating Usage During 2005 Total Number of Rooms (Excluding Bathrooms) None........................................................ 2.1 N Q Q N N N N 1 or

  8. Microsoft Word - 20.doc

    Office of Scientific and Technical Information (OSTI)

    ... resistance due to the reported formation of a layer of SiO 2 at the surface. (9-11) It has been suggested this film can ... favoring the formation of a thin, adherent chromia layer. ...

  9. Fonsi.Leo.DOC

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    assess environmental impacts associated with the disposition of surplus Hanford Site uranium. DOE has identified 1,866 metric tons of uranium (MTU) on the Hanford Site as surplus. ...

  10. DOC182.PDF

    Energy Saver

    line item. This fee is similar to those paid by commercial firms to belong to trade and industry associations related to their government contracts, and is considered an...

  11. Sep08.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    measurements, three scanning, compact microwave radiometers were deployed, each 10 kilometers (6.2 miles) apart, to form a triangle. One of the radiometers was based at the SGP...

  12. 032102ASA.doc

    Energy Information Administration (EIA) (indexed site)

    ... break, grab a drink of water, use the restrooms. ... In electricity, the financial instruments based upon spot ... that it comes into the system through imports or extraction. ...

  13. shprkEA.doc

    Office of Legacy Management (LM)

    ... the remediation plan using solar evaporation with side drip. General Comments (Page 1) 5 1: What method was used to determine dewatering from the disposal cell...please elaborate. ...

  14. Microsoft Word - 1111062.doc

    Office of Scientific and Technical Information (OSTI)

    ... feedstock availability and cost for fueling ethanol production in South Dakota counties. ... Rawls, W. J., D. L. Brakensiek, and K. E. Saxton. 1982. Estimation of soil water ...

  15. Feb09.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Donna J. Holdridge Contributor: Lynne Roeder Website: http:www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago...

  16. Microsoft Word - ~2432658.doc

    Office of Scientific and Technical Information (OSTI)

    ... Salt Thermocline Thermal Storage System for Parabolic Trough Plants", Journal of Solar Energy Engineering, Proof Copy 002202SLE, May 2002 DE-FG36-08GO18149 Revision: - Date: 06...

  17. Microsoft Word - 033302.doc

    Office of Scientific and Technical Information (OSTI)

    processes coupled with special enzymes. This combination could be used to design a solar panel to capture solar energy for use in carbon fixing reactions aimed at the...

  18. Dec08.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    SPL, which will provide measurements of cloud microphysics and cloud-aerosol chemistry. ... will play an important role in the coordination of deployment and operational logistics. ...

  19. U0174100.doc

    Office of Legacy Management (LM)

    ... The State of Colorado is presently planning to convey a 50-year renewable easement to the Bureau of Reclamation for the land needed for the pumping plant. Although the land use ...

  20. fftf ea 05292001.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    EA - 0993 ENVIRONMENTAL ASSESSMENT SHUTDOWN OF THE FAST FLUX TEST FACILITY HANFORD SITE, RICHLAND, WASHINGTON U.S. DEPARTMENT OF ENERGY MAY 1995 This page intentionally left blank. U.S. Department of Energy Glossary Environmental Assessment G-1 May 1995 Glossary Acronyms and Initialisms ALARA As Low As Reasonably Achievable CCC Core Component Container CFR Code of Federal Regulations CY Calendar Year D&D decontamination and decommissioning DOE U.S. Department of Energy DOT U.S. Department of

  1. fftf ea 05292001.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

  2. Microsoft Word - 1897.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    ... include personal information):... LANL Occupational Medicine's Verification: This device is required for the continued wellbeing of the ...

  3. Highlights.doc

    Annual Energy Outlook

    The West Texas Intermediate price in February was 20.72 per ... move up gradually through the forecast period (Figure 1). ... season have lowered heating fuel demand and contributed to ...

  4. Brooks - administrator.doc

    National Nuclear Security Administration (NNSA)

    maintains the U.S. nuclear weapons stockpile, promotes international nuclear non-proliferation and safety, reduces global danger from weapons of mass destruction, provides the ...

  5. Oct08.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    and Economic Development | Department of Energy Oct. 26 Webinar to Explore Available Financing Mechanisms for Tribal Energy and Economic Development Oct. 26 Webinar to Explore Available Financing Mechanisms for Tribal Energy and Economic Development October 20, 2016 - 5:58pm Addthis The U.S. Department of Energy (DOE) Office of Indian Energy, in partnership with Western Area Power Administration, is hosting a free webinar entitled "Accessing Capital for Tribal Energy and Economic

  6. Highlights.doc

    Gasoline and Diesel Fuel Update

    May 2002 1 Short-Term Energy Outlook May 2002 Overview World Oil Markets: World oil prices ... OPEC countries increase their production significantly in the latter half of this year. ...

  7. Highlights.doc

    Gasoline and Diesel Fuel Update

    Energy Outlook August 2002 Overview World Oil Markets: Oil prices remained relatively ... International Oil Supply and Demand. OPEC 10 production in July is estimated to have ...

  8. Highlights.doc

    Gasoline and Diesel Fuel Update

    Short-Term Energy Outlook April 2002 Overview World Oil Markets: Average crude oil prices ... A stronger sentiment on the side of OPEC production discipline, a growing sense by the ...

  9. 2010sr14.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    John Lindsay, SRR, (803) 208-6253 john02lindsay@srs.gov Regional Businesses Benefit as Recovery Act Funding Flows into the Economy at SRS More than $11 million in local and small business contracts awarded Aiken, SC -- Local and small businesses in the Central Savannah River Area (CSRA) have benefited from more than $11 million worth of new business since last October, as part of the Department of Energy's (DOE) American Recovery and Reinvestment Act projects at the Savannah River Site (SRS).

  10. 2010sr16.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Recovery Act Funds Put Aiken Technical College Rad Con Graduates to Work Early Aiken, S.C. - Using $200,000 in American Recovery and Reinvestment Act funds from the U.S. Department of Energy's Savannah River Site (SRS), the Aiken Technical College's (ATC) Radiation Protection Technology Program will be able to catapult 16 graduates into the local work force nearly six months ahead of schedule. "The program's first graduates are a success story that has come to life in a short period of

  11. 2010sr18.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Tuesday, May 25, 2010 james-r.giusti@srs.gov Paivi Nettamo, SRNS, (803) 292-2484 paivi.nettamo@srs.gov SRS Demolishes Massive Cooling Tower, Continues Progress on Environmental Footprint Reduction (Aiken, S.C.) - The Savannah River Site's (SRS) massive K Cooling Tower was safely demolished today as part of the Site-wide Footprint Reduction Initiative funded by the American Recovery and Reinvestment Act (ARRA). As the second-largest cooling tower to be demolished worldwide, the 450 foot-tall and

  12. 2010sr22.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Tuesday, August 10, 2010 james-r.giusti@srs.gov Paivi Nettamo, SRNS, (803) 292-2484 paivi.nettamo@srs.gov Use of Successful Decontamination Technology Expanded at Savannah River Site, Accelerates Cleanup High Heat Removes Tritium from Contaminated D-Area Soil and Concrete Aiken, S.C. - After a successful pilot project, DOE's Savannah River Site (SRS) will expand the use of new decontamination technology funded by the American Recovery and Reinvestment Act. The process will rid soil and concrete

  13. 2010sr23.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    11, 2010 james-r.giusti@srs.gov Paivi Nettamo, SRNS, (803) 952-6938 paivi.nettamo@srs.gov Recovery Act Funding Improves Stormwater Drainage at the Largest Closed Seepage Basins on SRS Aiken, S.C. - Preventing the migration of contamination from rainwater runoff at a closed seepage basin at the Department of Energy's (DOE) Savannah River Site (SRS) can be as simple as a new concrete ditch and as complicated as making sure the runoff flows correctly. The American Recovery and Reinvestment Act is

  14. 2010sr24.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    25, 2010 james-r.giusti@srs.gov DOE Presents "Star of Excellence" Award to Savannah River Site Contractor AIKEN, S.C. - U.S. Department of Energy (DOE) recently awarded its Voluntary Protection Program "Star of Excellence" to Savannah River Nuclear Solutions for 2010. "Time and again Savannah River Nuclear Solutions has proven how highly they value employee safety," said Inés Triay, Ph.D., DOE Assistant Secretary for Environmental Management. "We recognize

  15. 2010sr26.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Thursday, September 2, 2010 james-r.giusti@srs.gov SRS Federal Employees Give to Area Food Bank Aiken, SC -- Representatives of the U.S. Department of Energy's Savannah River Operations Office (DOE-SR) at the Savannah River Site delivered the sixth and final truckload of food and non perishables to the Golden Harvest Food Bank today. The 335 federal employees at SRS donated 66,292 pounds of goods in just over 30 days to feed the needy in Georgia and South Carolina. If one does the math, the

  16. SWPPPMH1.doc

    National Nuclear Security Administration (NNSA)

    ... and where detergents are not used * air conditioning condensate * uncontaminated ... Members of the Storm Water Pollution Prevention Team conducted a walk-down of ...

  17. 2B-01.doc

    Energy Saver

    ... performed under DOE contract number DE-AC01-02GJ79491 by the S.M. Stoller Corporation for the U.S. Department of Energy, Office of Legacy Man- agement, Grand Junction, Colorado. ...

  18. FIBDLFinal.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    1-0018 - In the Matter of Robert M. Balick FIA-11-0018 - In the Matter of Robert M. Balick On January 12, 2012, the Department of Energy's (DOE) Office of Hearings and Appeals (OHA) denied a Freedom of Information Act (FOIA) Appeal filed by Robert M. Balick (Appellant). The DOE's Office of Information Resources (OIR) denied the Appellant's request for a fee waiver, claiming that the Appellant had not indicated how he would disseminate the information to the public. OHA found that the Appellant

  19. Microsoft Word - 1938.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    personal information is revealed in a LANS record: Education, salary, medical history, employment history, social security number, date and place of birth, or mother's maiden name. Form 1938 (3/14) Page 1 of 3 Form 1938 Universal Beneficiary Designation/Change Form Instructions: The information on this form will replace any prior beneficiary designation. You may name anyone or any entity as your beneficiary and you may change your beneficiary at any time by completing a new Universal Beneficiary

  20. Microsoft Word - 64490001.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    M.L.M. Palma et al. (Eds.): VECPAR 2010, LNCS 6449, pp. 1-25, 2011. © Springer-Verlag Berlin Heidelberg 2011 Exascale Computing Technology Challenges John Shalf 1 , Sudip Dosanjh 2 , and John Morrison 3 1 NERSC Division, Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Berkeley, California 94611 2 Sandia National Laboratories, New Mexico 87185 3 Los Alamos National Laboratory, Los Alamos, New Mexico 87544 jshalf@lbl.gov, sudip@sandia.gov, jfm@lanl.gov Abstract. High Performance

  1. SubcontractingGuidelines.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Table of Contents ABBREVIATIONS AND ACRONYMS.................................................................3 1. INTRODUCTION................................................................................................................. 4 1.1. PURPOSE .......................................................................................................................................................................4 1.2.

  2. Annual Report 2008.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    ... the ACHP regulations and Executive Order 13287: "Preserve ... War FY08 Annual Summary Report Page 4 of 14 Register of ... Table 6 Theme FY 2008 Accomplishments Overall Status as of ...

  3. 2010sr32.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    The in-situ, or in-place deactivation and decommissioning of the SRS P and R Reactors is precedent-setting in the nuclear industry." Dr. Christine Langton, SRNL's advisory ...

  4. Activation.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    as it becomes available. The Joint Information Center (JIC), located at 4021 National Parks Highway, has been activated to provide public information. For updated information,...

  5. Jan09.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    9 ANL/EVS/NL-09-01 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Routine AVP Clouds with Low Optical Water Depths (CLOWD) Optical Radiative Observations (RACORO) Field Campaign Scheduled at SGP

  6. June08.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    8 ANL/EVS/NL-08-06 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Interagency Effort Will Measure Carbon Dioxide Profiles Beginning in June, the ARM Climate Research Facility (ACRF) is supporting an

  7. Report2003.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    III. Definitions of Terms and Acronyms Used in the Report. ... current fiscal year 1013 (Enter this number also in Line ... (some records involved search adequacy) 5: Remand: 9 7 ...

  8. 2010sr13.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    April 13, 2010 james-r.giusti@srs.gov DOE Announces Intention to Offer State of Georgia Additional Enviromental Monitoring Funds AIKEN, SC - The Department of Energy (DOE) today...

  9. 2010sr17.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Thursday, May 13, 2010 james-r.giusti@srs.gov DOE to Host Public Education Forum on Use of Performance Assessments Aiken, SC -- The U.S. Department of Energy (DOE) will host a...

  10. 2010sr19.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Wednesday, June 2, 2010 james-r.giusti@srs.gov John Lindsay, SRR, (803) 208-6253 john02lindsay@srs.gov Blowing Bubbles Using Recovery Act Funds, SRS Looks to Apply Novel Solutions...

  11. Highlights.doc

    Annual Energy Outlook

    (Energy Information AdministrationShort-Term Energy Outlook -- February 2002) 1 Short-Term Energy Outlook February 2002 Overview World Oil Markets. OPEC's stated intention to ...

  12. May08.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    to be minor, but solving them was critical to ensuring the quality of data obtained in past and future field campaigns. With their high sensitivity for detecting cloud...

  13. TecnaiDLFinal.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Instrument Preparation Show how to check basic vacuum functionality and target pressure values Demonstrate the proper settings of FEG, gun lens, and monochromator Show which ...

  14. 3010DLFinal.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Instrument Preparation Set from "DP" to "Normal" mode. Check gun and column IGP ... Carry out alignments Find beam Eucentric height Gun alignment C2 aperture, ...

  15. LibraDLFinal.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Start filament Open the column valve Check Gun Valve closed and CCD in cooling ... E to zero, and reset Ill Shift Close gun valve Reset center X & Y and tilts of ...

  16. Habadv-115.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    115 Subject: Proposed River Corridor and Performance Measures Adopted: April 6, 2001 Page 1 April 6, 2001 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 999352 Subject: Proposed River Corridor Contract and Performance Measures Dear Mr. Klein, Clean- up of the River Corridor is important. The proposed River Corridor contract should authorize and direct the contractor to perform the full scope of work of the Hanford Clean-Up Agreement more

  17. Habadv-119.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    9 Subject: B Reactor Engineering Evaluation and Cost Analysis Adopted: June 8, 2001 Page 1 June 8, 2001 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Chuck Findley, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Re: B Reactor Engineering Evaluation and Cost Analysis Dear

  18. Habadv-120.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    20 Subject: Fiscal Year 2002 and 2003 Budgets Adopted: June 8, 2001 Page 1 June 8, 2001 Keith Klein, Manager Department of Energy, Richland Operations P.O. 550 (A7-50) Richland, WA 99352 Harry Boston, Manager Department of Energy, Office of River Protection 2440 Stevens Richland, WA 99352 Re: Fiscal Year 2002 and 2003 Budgets Dear Messrs Klein and Boston, The U.S. Department of Energy (DOE) proposed fiscal year (FY) 2002 and preliminary FY 2003 budgets signal an intent to slow Hanford cleanup

  19. energydisclosureandleasingstandardsbestpractices.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Leveraging Portfolio Manager for Disclosure and Green Leasing Practices Communicating Success, Measuring Improvements, Sharing Results Communicating Success, Measuring ...

  20. guide.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    (2006) 1. Deadline: send you review article before February the 14 th , 2006 to the editorial committee of your section. 2. Length: papers should not exceed 14 pages using the...

  1. Aug08.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    National Aeronautics and Space Administration (NASA) ... OCO science team's ground-based solar-viewing Fourier transform ... To minimize safety concerns caused by power and data ...

  2. Chakrapani-V.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    Cloud Thickness Estimation from GOES-8 Satellite Data Over the ARM-SGP Site V. Chakrapani, D. R. Doelling, and A. D. Rapp Analytical Services and Materials, Inc. Hampton, Virginia P. Minnis National Aeronautics and Space Administration Langley Research Center Hampton, Virginia Introduction The effects of clouds on radiative forcing are topics of intense interest and of direct relevance to climate change. They remain the greatest source of uncertainty in global climate models. There are many

  3. sr0905.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    The 795 million project replaces a deteriorating, inefficient coal powerhouse and oil-fired boilers ... Ameresco is constructing a steam cogeneration plant and installing two steam ...

  4. sr0934.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    a deteriorating, inefficient coal powerhouse and oil-fired boilers at a savings of ... support 125 permanent positions in plant operations and maintenance and in ...

  5. Microsoft Word - Final Transportation Doc _7-13-06_.doc

    Gasoline and Diesel Fuel Update

    cost changes due to production volume economies of scale and potential scientific, manufacturing, and design advances. Manufacturing advances can generally be thought of as...

  6. Microsoft Word - Final AEO2007 Commercial Doc.doc

    Gasoline and Diesel Fuel Update

    the State Energy Data System (SEDS) historical commercial sector consumption, applying an additive correction term to ensure that simulated model results correspond to published...

  7. Microsoft Word - RIN 08071743 DocProd.doc

    Office of Legacy Management (LM)

    ... elevated in sediments of the Mancos Shale in the area. * No large variations in ... All calibration checks met the acceptance criteria for all analytes on both gas ...

  8. Microsoft Word - RIN07050889_ DocProd.doc

    Office of Legacy Management (LM)

    ... All Mill Tailings Area and Bodo Canyon locations X Nickel Nickel-63 Nitrate + Nitrite as N (NO3+NO2)-N PCBs Phosphate Polonium-210 Potassium DUR03 only Constituent Sampling ...

  9. Microsoft Word - 08041519_08051593_DocProd.doc

    Office of Legacy Management (LM)

    ... Result Qualifiers Lab Data QA Detection Limit Uncertainty Manganese mgL 06102008 N001 - 0.1 0.00013 Oxidation Reduction Potential mV 06102008 N001 - 90.9 pH s.u. 0610...

  10. Microsoft Word - RIN 08051595 DocProd.doc

    Office of Legacy Management (LM)

    ...2008 N001 14 - 29 436 F Manganese mgL 06032008 N001 14 - 29 0.0087 F 0.00013 Molybdenum mgL 06032008 N001 14 - 29 0.0016 F 0.001 Oxidation Reduction Potential mV 06...

  11. Microsoft Word - RIN 06110582_DocProd.doc

    Office of Legacy Management (LM)

    448 2007 - - U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE-AC01-02GJ79491 December 2006, Monument Valley, Arizona This page intentionally left blank U.S. Department of Energy DVP⎯December 2006, Monument Valley, Arizona March 2007 RIN 06110582 Page iii Contents Sampling Event Summary

  12. Microsoft Word - RIN 08061655 DocProd.doc

    Office of Legacy Management (LM)

    8 Groundwater Sampling at the Monument Valley, Arizona, Processing Site November 2008 LMS/MON/S00608 This page intentionally left blank U.S. Department of Energy DVP-June 2008, Monument Valley, Arizona, Processing Site November 2008 RIN 08061655 Page i Contents Sampling Event Summary ...............................................................................................................1 Monument Valley, Arizona, Processing Site Sample Locations

  13. "V Doc with logo.doc"

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    LANL HIPAA Privacy Notice: This notice describes how medical information about you may be used and disclosed and how you can get access to this information. Please review it carefully. The Health Insurance Portability and Accountability Act of 1996 (HIPAA) imposes numerous requirements on employer health Plans concerning the use and disclosure of individual health information. This information, known as protected health information, includes virtually all individually identifiable health

  14. Microsoft Word - RIN 07081119 DocProd.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy ...

  15. Microsoft Word - RIN 07040836 DocProd.doc

    Office of Legacy Management (LM)

    ... Data Result Lab Data Result Lab Data N N Below Detect GUN01 0005 05032007 Uranium 0.076 F 0.044 F 0.0033 5 0 No No GUN01 0105 05032007 Manganese 1.6 F 18.5 2 F 6 0 Yes No ...

  16. Microsoft Word - cover.doc

    Office of Legacy Management (LM)

    ... Paragraph B states "All developments shall be served by the City water treatment and distribution system, unless such requirement is deemed unreasonable or impracticable, as ...

  17. Microsoft Word - draft2.doc

    U.S. Department of Energy (DOE) - all webpages (Extended Search)

    several features of the mode, the high-frequency companions, a geodesic- acoustic wave and an Alfvenic mode have clearly not been observed. Improvements to the optical arrays...

  18. Microsoft Word - LLNLHRPfinal062606.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    HUMAN RELIABILITY PROGRAM AT LAWRENCE LIVERMORE NATIONAL LABORATORY U.S. Department of Energy Office of Inspector General Office of Inspections and Special Inquiries Inspection Report The Human Reliability Program at Lawrence Livermore National Laboratory DOE/IG-0732 June 2006 THE HUMAN RELIABILITY PROGRAM AT LAWRENCE LIVERMORE NATIONAL LABORATORY TABLE OF CONTENTS OVERVIEW Introduction and Objective 1 Observations and Conclusions 2 DETAILS OF FINDINGS Drug and Alcohol Test Random Selection

  19. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    f ro m t h e d a ily a v e ra g e h ig h te m p e ra tu re s f o r t h e la s t 1 0 y e a rs a n a m o u n t e q u a l to tw ic e a n e s t im a te o f th e s ta n d a rd d e v ia...

  20. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    b trac ting fro m th e da ily a ve rag e hig h te m p e ra tu res fo r th e la st 10 y ea rs a n am o un t e qu al to tw ice a n estim ate o f the stan da rd de via tion for h igh...

  1. Microsoft Word - winter.doc

    Energy Information Administration (EIA) (indexed site)

    1.762 305 1.71-1.75 1.853 Working Gas Volume as of 22699 BCF % Full EAST 795 44 WEST 284 58 Prod Area 795 61 U. S. 1662 51 Source: AGA Average Temperature for Four Major...

  2. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    2, 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 . 7 5 3 . 0 0 3 . 2 5 3 . 5 0 3 ....

  3. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    7, 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 . 7 5 3 . 0 0 3 . 2 5 3 . 5 0 3 ....

  4. Microsoft Word - winter.doc

    Energy Information Administration (EIA) (indexed site)

    5, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  5. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    9, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  6. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    5, 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 . 7 5 3 . 0 0 3 . 2 5 3 . 5 0 3 ....

  7. Microsoft Word - winter.doc

    Energy Information Administration (EIA) (indexed site)

    9, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  8. Microsoft Word - winter.doc

    Energy Information Administration (EIA) (indexed site)

    4, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  9. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    6, 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 . 7 5 3 . 0 0 3 . 2 5 3 . 5 0 3 ....

  10. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    8, 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 . 7 5 3 . 0 0 3 . 2 5 3 . 5 0 3 ....

  11. Microsoft Word - winter.doc

    Energy Information Administration (EIA) (indexed site)

    1, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  12. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    8, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  13. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    0, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  14. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    4, 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 . 7 5 3 . 0 0 Dollars Per Million...

  15. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    8 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 . 7 5 3 . 0 0 3 . 2 5 3 . 5 0 3 . 7 5 4...

  16. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    26, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  17. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    5, 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 . 7 5 Dollars Per Million...

  18. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    4, 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 . 7 5 Dollars Per Million...

  19. Microsoft Word - winter.doc

    Energy Information Administration (EIA) (indexed site)

    3, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  20. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    3, 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 . 7 5 Dollars Per Million...

  1. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    08, 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 . 7 5 Dollars Per...

  2. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    4, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  3. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    0, 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 . 7 5 3 . 0 0 3 . 2 5 3 . 5 0 3 ....

  4. Microsoft Word - winter.doc

    Energy Information Administration (EIA) (indexed site)

    1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  5. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    9, 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 . 7 5 3 . 0 0 3 . 2 5 3 . 5 0 3 ....

  6. Microsoft Word - winter.doc

    Energy Information Administration (EIA) (indexed site)

    , 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  7. Microsoft Word - winter.doc

    Energy Information Administration (EIA) (indexed site)

    1, 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  8. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    3, 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 . 7 5 3 . 0 0 3 . 2 5 3 . 5 0 3 ....

  9. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    9, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 ....

  10. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    1, 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 . 7 5 Dollars Per Million...

  11. Microsoft Word - winter.doc

    Energy Information Administration (EIA) (indexed site)

    , 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r ic e s v s H e n r y H u b S p o t P r i c e s 1 .2 5 1 .5 0 1 .7 5 2 .0 0 2 .2 5 2 .5 0 2 .7 5 Dollars Per Million BTU N Y...

  12. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    7, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  13. Microsoft Word - winter.doc

    Energy Information Administration (EIA) (indexed site)

    2, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  14. Microsoft Word - winter.doc

    Energy Information Administration (EIA) (indexed site)

    6, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  15. Microsoft Word - winter.doc

    Energy Information Administration (EIA) (indexed site)

    4, 1998 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  16. Microsoft Word - winter.doc

    Energy Information Administration (EIA) (indexed site)

    8, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  17. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    1, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  18. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    6, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 ....

  19. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    6, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0...

  20. Microsoft Word - summer.doc

    Energy Information Administration (EIA) (indexed site)

    3, 1999 http:www.eia.doe.gov N Y M E X F u t u r e P r i c e s v s H e n r y H u b S p o t P r i c e s 0 . 5 0 0 . 7 5 1 . 0 0 1 . 2 5 1 . 5 0 1 . 7 5 2 . 0 0 2 . 2 5 2 . 5 0 2 ....