National Library of Energy BETA

Sample records for doc number serial

  1. Property:NEPA SerialNumber | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    SerialNumber Jump to: navigation, search Property Name NEPA SerialNumber Property Type String This is a property of type String. Pages using the property "NEPA SerialNumber"...

  2. Property:NEPA LeadAgencyDocNumber | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    LeadAgencyDocNumber Jump to: navigation, search Property Name NEPA LeadAgencyDocNumber Property Type String This is a property of type String. Pages using the property "NEPA...

  3. System and method for simultaneously collecting serial number information from numerous identity tags

    DOE Patents [OSTI]

    Doty, Michael A.


    A system and method for simultaneously collecting serial number information reports from numerous colliding coded-radio-frequency identity tags. Each tag has a unique multi-digit serial number that is stored in non-volatile RAM. A reader transmits an ASCII coded "D" character on a carrier of about 900 MHz and a power illumination field having a frequency of about 1.6 Ghz. A one MHz tone is modulated on the 1.6 Ghz carrier as a timing clock for a microprocessor in each of the identity tags. Over a thousand such tags may be in the vicinity and each is powered-up and clocked by the 1.6 Ghz power illumination field. Each identity tag looks for the "D" interrogator modulated on the 900 MHz carrier, and each uses a digit of its serial number to time a response. Clear responses received by the reader are repeated for verification. If no verification or a wrong number is received by any identity tag, it uses a second digital together with the first to time out a more extended period for response. Ultimately, the entire serial number will be used in the worst case collision environments; and since the serial numbers are defined as being unique, the final possibility will be successful because a clear time-slot channel will be available.

  4. System and method for simultaneously collecting serial number information from numerous identity tags

    DOE Patents [OSTI]

    Doty, M.A.


    A system and method are disclosed for simultaneously collecting serial number information reports from numerous colliding coded-radio-frequency identity tags. Each tag has a unique multi-digit serial number that is stored in non-volatile RAM. A reader transmits an ASCII coded ``D`` character on a carrier of about 900 MHz and a power illumination field having a frequency of about 1.6 Ghz. A one MHz tone is modulated on the 1.6 Ghz carrier as a timing clock for a microprocessor in each of the identity tags. Over a thousand such tags may be in the vicinity and each is powered-up and clocked by the 1.6 Ghz power illumination field. Each identity tag looks for the ``D`` interrogator modulated on the 900 MHz carrier, and each uses a digit of its serial number to time a response. Clear responses received by the reader are repeated for verification. If no verification or a wrong number is received by any identity tag, it uses a second digital together with the first to time out a more extended period for response. Ultimately, the entire serial number will be used in the worst case collision environments; and since the serial numbers are defined as being unique, the final possibility will be successful because a clear time-slot channel will be available. 5 figs.

  5. Property:NEPA SerialRegisterPage | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    SerialRegisterPage Jump to: navigation, search Property Name NEPA SerialRegisterPage Property Type Page Description Serial Register Page files for NEPA Docs. Related Serial...

  6. Introduction Yucca Lady, a World War II Boeing-17G Flying Fortress Army Air Force serial number

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Yucca Lady, a World War II Boeing-17G Flying Fortress Army Air Force serial number 44-83575, was flown to the Nevada Test Site (now known as the Nevada National Security Site - NNSS) in 1952, where she was instrumented and subjected to three atmospheric nuclear tests as part of the Operation Tumbler-Snapper -- Vulnerability of Parked Aircraft to Atomic Bombs series, conducted in April and May 1952. The project would determine the effects of a nuclear device detonated above an airfield,

  7. Associate Research Physicist (Post Doc, Experimental Research...

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Post Doc, Experimental Research, NSTX-U, Radio Frequency Waves) Department: Research Staff: RM1 Requisition Number: 1500421 The Princeton Plasma Physics Laboratory (PPPL) seeks to...

  8. raising_investment_funds_for_clean_energy_programs.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc Microsoft ...

  9. howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc (117.5 KB) More Documents & Publications How to Design and Market Energy Efficiency Programs to Specific Neighborhoods Using Social Media to Engage the Community in Energy Efficiency

  10. highperformanceleasingstrategiesforstateandlocalgovernments.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc (93 KB) More Documents & Publications High Performance Leasing Strategies for State and Local Governments Leveraging Portfolio Manager for Disclosure and Green Leasing Practices

  11. Doc...~En.

    Office of Legacy Management (LM)

    ' : ,:#;: .' :.' . ,.:: :,; ..,' ... ..,,..,.... - .~~._ I&i3:scD .::-:, TO-340 .":: ..' . - ' - -. ' . .." ,.. .;.. Very traly yours;, -' .~X :, Doc...~En. ' Br.:Re&ng ';;a' : _, Div. Reading File ., ,, .~, ,.~-

  12. exploringpowerpurchaseagreementsthebasicspart1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc (112.5 KB) More Documents & Publications Exploring Power Purchase Agreements - The Basics Part 1

  13. finance_programs.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    financeprograms.doc financeprograms.doc financeprograms.doc Microsoft Office document icon financeprograms.doc More Documents & Publications Tools for Designing & Implementing ...

  14. Doc.~:Ru.

    Office of Legacy Management (LM)

    .' , .' c,j .c; Distriblition:~ ;. <; ~..,:L.D.i&%.ay,FiN-OR00 Doc.~:Ru. ,.,. 75. ' Br..Reading 'ire' ,lliv. Read&q File ,: '. ~ ,, .-' . ...: - SURNAME..

  15. partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc (129.5 KB) More Documents & Publications Partnering With Utilities to Offer Energy Efficiency Programs Webinar Transcript Partnering with Utilities Part 2 - Advanced Topics for Local Governments in Creating

  16. webinar_innovation_financing.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    financing.doc webinarinnovationfinancing.doc webinarinnovationfinancing.doc Microsoft Office document icon webinarinnovationfinancing.doc More Documents & Publications ...

  17. webinar_innovation_planning_zoning.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    planningzoning.doc webinarinnovationplanningzoning.doc webinarinnovationplanningzoning.doc Microsoft Office document icon webinarinnovationplanningzoning.doc More ...

  18. webinar_innovation_organizing_strategizing.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    organizingstrategizing.doc webinarinnovationorganizingstrategizing.doc webinarinnovationorganizingstrategizing.doc Microsoft Office document icon webinarinnovationorganizi...

  19. webinar_innovation_net_metering_interconnection.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    netmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc Microsoft Office document icon ...

  20. fed_finance_facilities_ee_upgrades_deployment.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc Microsoft Office document icon ...

  1. Microsoft Word - FAL2003-03R.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    3-03R.doc Microsoft Word - FAL2003-03R.doc Microsoft Word - FAL2003-03R.doc (198.25 KB) More Documents & Publications WPN 06-8: Dun and Bradstreet Universal Numbering System (DUNS) and Central Contractor Registration (CCR) and Grants.Gov Reminder Microsoft Word - FAL2003-03Rattach.doc WPN 03-7: Grants.Gov: Dun and Bradstreet Universal Numbering System (Duns) and Central Contractor Registration (CCR)

  2. Serial Queue Available on Hopper and Edison

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Queue Available on Hopper and Edison Serial Queue Available on Hopper and Edison November 12, 2014 by Francesca Verdier The new serial queue on Hopper and Edison allows multiple serial jobs from different users to share a compute node. it is implemented via Cray's Cluster Compatibility Mode and uses wrapper commands such as qsub.serial. See Serial Queue on the Crays. Subscribe via RSS Subscribe Browse by Date August 2016 June 2016 May 2016 April 2016 January 2016 December 2015 November 2015

  3. Microsoft Word - S0244800.doc

    Office of Legacy Management (LM)

    ... ground water from the interceptor drains and extraction wells is solar evaporation. ... Annual Performance Report, Shiprock, New Mexico U.S. Department of Energy Doc. No. ...

  4. Microsoft Word - 08071744_DocProd.doc

    Office of Legacy Management (LM)

    ... Location Specific Information: Ticket Number Location Sample Date Description GIS 005 40-SC 812008 Cat. I GIS 006 5-SC 8122008 Cat. I GIS 007 51-SC 8132008 Cat. II; ...

  5. Microsoft Word - ContractManagementPlanningDRIVERS.doc | Department... (indexed) [DOE]

    ContractManagementPlanningDRIVERS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS.doc Microsoft Word - ARRAMOModelMod.doc...

  6. energydisclosureandleasingstandardsbestpractices.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    energydisclosureandleasingstandardsbestpractices.doc energydisclosureandleasingstandardsbestpractices.doc energydisclosureandleasingstandardsbestpractices.doc (100.5 KB) More Documents & Publications Leveraging Portfolio Manager for Disclosure and Green Leasing Practices Communicating Success, Measuring Improvements, Sharing Results Communicating Success, Measuring Improvements, Sharing Results

  7. Serial Queue Available on Hopper and Edison

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Queue Available on Hopper and Edison Serial Queue Available on Hopper and Edison November 12, 2014 by Francesca Verdier The new serial queue on Hopper and Edison allows multiple...

  8. Category:NEPA Doc | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    NEPA Doc Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Category: NEPA Documents Collections Add.png Add a new NEPA Document Collection Pages in category "NEPA Doc"...

  9. spurring_local_economic_development_clean_energy_programs.doc... (indexed) [DOE]

    spurringlocaleconomicdevelopmentcleanenergyprograms.doc spurringlocaleconomicdevelopmentcleanenergyprograms.doc More Documents & Publications Spurring Local Economic...

  10. webinar_innovation_permitting_inspections.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications webinarinnovationfinancing.doc raisinginvestmentfundsforcleanenergyprograms.doc Communicating Success, Measuring Improvements, Sharing Results

  11. Microsoft Word - AL2002-03.doc | Department of Energy

    Office of Environmental Management (EM)

    2-03.doc Microsoft Word - AL2002-03.doc PDF icon Microsoft Word - AL2002-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - FAL2004-01.doc...

  12. Microsoft Word - FAL2004-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - FAL2004-01.doc PDF icon Microsoft Word - FAL2004-01.doc More Documents & Publications Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-02.doc...

  13. Microsoft Word - AL2006-08.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    8.doc Microsoft Word - AL2006-08.doc PDF icon Microsoft Word - AL2006-08.doc More Documents & Publications AL2007-05.doc&0; Microsoft Word - AL2005-14.doc Microsoft Word - ...

  14. Microsoft Word - AL2005-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5-03.doc Microsoft Word - AL2005-03.doc PDF icon Microsoft Word - AL2005-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - AL2006-08.doc ...

  15. Microsoft Word - 98-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    8-11.doc Microsoft Word - 98-11.doc PDF icon Microsoft Word - 98-11.doc More Documents & Publications Microsoft Word - AL2006-08.doc Microsoft Word - AL2005-01.doc Microsoft Word -...

  16. SPDWRAP#1.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Please notify Aon Hewitt's Your Benefit Resources (YBR) in Appendix G to update your personal information, such as your home address and home telephone number. 2. Eligibility...

  17. N0057000.doc

    Office of Legacy Management (LM)

    000 GJO- 2002-380- TAC GJO-PIN 13.5.1-1 Pinellas Environmental Restoration Project Northeast Site Non-Aqueous Phase Liquids Interim Measures Progress Report July through September 2002 October 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-02GJ79491 Task Order Number ST03-107 Document Number N0057000 Contents DOE/Grand Junction Office Northeast Site NAPL Interim Measures Progress Report October 2002 Page

  18. 2B-01.doc

    Energy Savers

    ... performed under DOE contract number DE-AC01-02GJ79491 by the S.M. Stoller Corporation for the U.S. Department of Energy, Office of Legacy Man- agement, Grand Junction, Colorado. ...

  19. Report2003.doc (indexed) [DOE]

    III. Definitions of Terms and Acronyms Used in the Report. ... current fiscal year 1013 (Enter this number also in Line ... (some records involved search adequacy) 5: Remand: 9 7 ...

  20. LibraDLFinal.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    To reserve a Libra session, go to, click on "Microscope Scheduling", use proposal number and password to log in.You may only sign up for 1 Core sessions and 1 Flex ...

  1. FIBDLFinal.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    To reserve a FIB session, go to, click on "Microscope Scheduling", use proposal number and password to log in.You may only sign up for 2 Core sessions and 2 Flex ...

  2. 3010DLFinal.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    go to, click on "Microscope Scheduling", use proposal number and password to log in. You may only sign up for 2 Core sessions and 1 Flex session at a time. ...

  3. TecnaiDLFinal.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    To reserve a Tecnai session, go to, click on "Microscope Scheduling", use proposal number and password to log in. You may only sign up for 1 Core session and 1 ...

  4. Microsoft Word - CMPTemplate031307.doc | Department of Energy

    Office of Environmental Management (EM)

    CMPTemplate031307.doc Microsoft Word - CMPTemplate031307.doc PDF icon Microsoft Word - CMPTemplate031307.doc More Documents & Publications Chapter 42 - Contract Administration...

  5. Microsoft Word - ACQUISITION LETTER.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ACQUISITION LETTER.doc Microsoft Word - ACQUISITION LETTER.doc PDF icon Microsoft Word - ACQUISITION LETTER.doc More Documents & Publications ACQUISITION LETTER DEAR Part 933 OPAM ...

  6. Microsoft Word - SpecialTermsandConditions0506.doc | Department...

    Energy Savers

    Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc More Documents &...

  7. Microsoft Word - FY2005finaliparhandbook.doc | Department of...

    Energy Savers

    Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc More Documents & Publications...

  8. Microsoft Word - ARRAAttachment2.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAAttachment2.doc Microsoft Word - ARRAAttachment2.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment3.rtf Microsoft Word -...

  9. Microsoft Word - ARRAMOModelMod.doc | Department of Energy

    Energy Savers

    ARRAMOModelMod.doc Microsoft Word - ARRAMOModelMod.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS...

  10. Microsoft Word - ARRAModelWAS.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ARRAModelWAS.doc Microsoft Word - ARRAModelWAS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAMOModelMod...

  11. Microsoft Word - August06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    August06.doc Microsoft Word - August06.doc PDF icon Microsoft Word - August06.doc More Documents & Publications Microsoft Word - April

  12. Microsoft Word - FY10PropertyBSCContractor.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor.doc PDF icon Microsoft Word - FY10PropertyBSCContractor.doc More Documents & Publications Microsoft Word - ...

  13. Microsoft Word - GJPPGPracticesDraft.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    GJPPGPracticesDraft.doc Microsoft Word - GJPPGPracticesDraft.doc PDF icon Microsoft Word - GJPPGPracticesDraft.doc More Documents & Publications 1 DOE Purchase Card Policy Natural ...

  14. Microsoft Word - Cross Reference Matrix Introduction.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Cross Reference Matrix Introduction.doc Microsoft Word - Cross Reference Matrix Introduction.doc PDF icon Microsoft Word - Cross Reference Matrix Introduction.doc More Documents & ...

  15. Microsoft Word - April06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    April06.doc Microsoft Word - April06.doc PDF icon Microsoft Word - April06.doc More Documents & Publications Secretary Directs FPO to Prepare Strategic Plan Microsoft Word - August

  16. Engaging Financial Institution Partners Transcript.doc | Department...

    Office of Environmental Management (EM)

    Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Microsoft ...

  17. NVN-89276 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89276 Proposed Action Geochemical survey Documents Serial Register Page:...

  18. NVN-89275 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89275 Proposed Action Geophysical surveys. Documents Serial Register Page:...

  19. NVN-89278 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89278 Proposed Action Geophysical survey. Documents Serial Register Page:...

  20. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page I-3 U n c o n t r o l l e d c o p y Long-Term Surveillance and Maintenance ...

  1. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Doc. No. S06401 June 2010 Page B-2 U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. ...

  2. Ammendment 2.doc | Department of Energy (indexed) [DOE]

    Ammendment 2.doc More Documents & Publications Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&0; RFQ DE-RQ01-04ME90001.doc&0; Attachment 3-Past Performance...

  3. Microsoft Word - 1938.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    personal information is revealed in a LANS record: Education, salary, medical history, employment history, social security number, date and place of birth, or mother's maiden name. Form 1938 (3/14) Page 1 of 3 Form 1938 Universal Beneficiary Designation/Change Form Instructions: The information on this form will replace any prior beneficiary designation. You may name anyone or any entity as your beneficiary and you may change your beneficiary at any time by completing a new Universal Beneficiary

  4. Oct08.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    8 ANL/EVS/NL-08-10 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: Editor: Donna J. Holdridge Contributor: John Schatz Website: ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Leadership Noble County Members Tour SGP Site Members of the non-profit organization Leadership Noble County

  5. Dec08.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    8 ANL/EVS/NL-08-12 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. AMF2 Team Surveys Storm Peak Area The U.S. Department of Energy recently announced the initial deployment of the second ARM Mobile

  6. Jan09.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    9 ANL/EVS/NL-09-01 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Routine AVP Clouds with Low Optical Water Depths (CLOWD) Optical Radiative Observations (RACORO) Field Campaign Scheduled at SGP

  7. June08.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    8 ANL/EVS/NL-08-06 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Interagency Effort Will Measure Carbon Dioxide Profiles Beginning in June, the ARM Climate Research Facility (ACRF) is supporting an

  8. Sep08.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    8 ANL/EVS/NL-08-09 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: Editor: Donna J. Holdridge Website: ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. 3D Water Vapor Field Campaign Concludes Researchers from the Colorado State University recently concluded a week-long field experiment at the SGP (August

  9. Index2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Index2.doc Index2.doc Index2.doc (11.46 KB) More Documents & Publications Sylvania Corporation, Hicksville, NY and Bayside, NY - Addendum to July 8, 2004 O:\HOMEPAGE\FOIA\report99.PDF&#0; U.S. Department of Energy 2004 Annual Report

  10. SubcontractingGuidelines.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; (245.71 KB) More Documents & Publications Guidance of the Department of Energy Subcontracting Program Acquisition Guide Chapter 19 Update Chapter 19 - Small Business Programs

  11. Microsoft Word - AL2005-16.doc | Department of Energy

    Office of Environmental Management (EM)

    6.doc Microsoft Word - AL2005-16.doc PDF icon Microsoft Word - AL2005-16.doc More Documents & Publications Microsoft Word - AL2005-10.doc Audit Report: IG-0860 Microsoft Word -...

  12. Microsoft Word - AL2005-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5-02.doc Microsoft Word - AL2005-02.doc PDF icon Microsoft Word - AL2005-02.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc...

  13. Microsoft Word - AL2005-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - AL2005-11.doc PDF icon Microsoft Word - AL2005-11.doc More Documents & Publications Audit Report: OAS-L-13-08 Microsoft Word - AL2005-12.doc CHAPTER 7...

  14. Microsoft Word - AL2006-02.doc | Department of Energy

    Energy Savers

    2.doc Microsoft Word - AL2006-02.doc PDF icon Microsoft Word - AL2006-02.doc More Documents & Publications Microsoft Word - AL2006-03.doc Archived Financial Assistance Letters...

  15. Microsoft Word - AL2006-03.doc | Department of Energy

    Energy Savers

    3.doc Microsoft Word - AL2006-03.doc PDF icon Microsoft Word - AL2006-03.doc More Documents & Publications Microsoft Word - AL2006-02.doc Archived Financial Assistance Letters...

  16. Microsoft Word - al2005-04.doc | Department of Energy

    Energy Savers

    al2005-04.doc Microsoft Word - al2005-04.doc PDF icon Microsoft Word - al2005-04.doc More Documents & Publications AL2005-04ClassDeviation.pdf Microsoft Word - Matrixpart2.doc...

  17. Microsoft Word - AL2005-14.doc | Department of Energy

    Office of Environmental Management (EM)

    4.doc Microsoft Word - AL2005-14.doc PDF icon Microsoft Word - AL2005-14.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc...

  18. Microsoft Word - AL2005-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    7.doc Microsoft Word - AL2005-07.doc PDF icon Microsoft Word - AL2005-07.doc More Documents & Publications Microsoft Word - AL2006-07.doc OPAM Policy Acquisition Guides Initial ...

  19. Microsoft Word - AL2005-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - AL2005-01.doc PDF icon Microsoft Word - AL2005-01.doc More Documents & Publications Microsoft Word - AL2006-08.doc Acquisition Letter Archive listing ...

  20. Microsoft Word - AL2006-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - AL2006-01.doc PDF icon Microsoft Word - AL2006-01.doc More Documents & Publications Microsoft Word - al2005-06.doc Chapter 19 - Small Business Programs OPAM...

  1. Microsoft Word - Flash2007-43.doc | Department of Energy

    Office of Environmental Management (EM)

    43.doc Microsoft Word - Flash2007-43.doc Microsoft Word - Flash2007-43.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash...

  2. al99-06attachment.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    attachment.doc&0; al99-06attachment.doc&0; PDF icon al99-06attachment.doc&0; More Documents & Publications Microsoft Word - AL2000-05Attachment.doc Microsoft Word - NSRC...

  3. Microsoft Word - FWP- Fact Sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FWP- Fact Sheet.doc Microsoft Word - FWP- Fact Sheet.doc PDF icon Microsoft Word - FWP- Fact Sheet.doc More Documents & Publications Microsoft Word - FOA cover sheet.doc Microsoft ...

  4. Microsoft Word - AL2005-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2005-10.doc Microsoft Word - AL2005-10.doc Microsoft Word - AL2005-10.doc (133.11 KB) More Documents & Publications Microsoft Word - AL2005-16.doc Audit Report: IG-0860 Microsoft ...

  5. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    SAR.doc Microsoft Word - PeerReviewSAR.doc Microsoft Word - PeerReviewSAR.doc (13.47 KB) More Documents & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross ...

  6. Microsoft Word - al2007-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    al2007-11.doc Microsoft Word - al2007-11.doc PDF icon Microsoft Word - al2007-11.doc More Documents & Publications Acquisition Letter: AL2005-08 Microsoft Word - al2004-03.doc OPAM...

  7. Microsoft Word - Matrixpart1.doc | Department of Energy (indexed) [DOE]

    Matrixpart1.doc More Documents & Publications Part 1, Clauses Prescribed in FAR Part 52 Microsoft Word - Matrixpart2.doc...

  8. csep_transcript_aspen.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications highperformanceleasingstrategiesforstateandlocalgovernments.doc Using Social Media to Engage the Community in Energy Efficiency Projects.doc ...

  9. csep_transcript_minneapolis.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications newguideforcommunityenergystrategicplanning.doc cseptranscriptaspen.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, ...

  10. csep_transcript_arlington.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Office document icon cseptranscriptarlington.doc More Documents & Publications Tools for Designing & Implementing Better Finance Programs financeprograms.doc financeprograms

  11. Serial and Westmere Queues on Carver

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    and Westmere Queues on Carver Serial and Westmere Queues on Carver September 20, 2011 by Francesca Verdier NERSC has replaced 80 8-core Intel Nehalem nodes on Carver with 80...

  12. Microcrystallization techniques for serial femtosecond crystallography

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    using Photosystem II from Thermosynechococcus elongatus as a model system Microcrystallization techniques for serial femtosecond crystallography using Photosystem II from Thermosynechococcus elongatus as a model system Authors: Kupitz, C., Grotjohann, I., Conrad, C.E., Roy-Chowdhury, S., Fromme, R., and Fromme, P. Title: Microcrystallization techniques for serial femtosecond crystallography using Photosystem II from Thermosynechococcus elongatus as a model system Source: Phil. Trans. R. Soc.

  13. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    F Radiological Survey Procedures U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page F-3 F.1 Radiological Survey Procedures This section describes the actions and method used by the Monticello Legacy Management (LM) Representative when conducting radiological surveys for the purpose of identifying radiologically contaminated material and determining the Radium-226

  14. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    G Uranium Scanning Procedure U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page G-3 Uranium Scanning Procedure for Property MP-00211 1. Select a Ludlum Model 12 ratemeter with a 44-9 pancake Geiger-Mueller beta-gamma detector or equivalent instrument capable of meeting detection limit criteria. 2. Check that the ratemeter and the detector have calibration

  15. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Appendix H Procedures for the Transportation of Radioactive Materials U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page H-3 H1.0 Purpose The purpose of this procedure is to ensure that radioactive material is transported (1) using best management practices, (2) in compliance with U.S. Department of Transportation (DOT) requirements, and (3) with minimal risk to

  16. Microsoft Word - S05575_AP.doc

    Office of Legacy Management (LM)

    ... Department of Energy Annual Performance Report, Shiprock, New Mexico December 2009 Doc. ... groundwater from the interceptor drains and extraction wells is solar evaporation. ...

  17. Microsoft Word - Appendix-B.doc

    Office of Legacy Management (LM)

    1 Site Environmental Report May 2012 Doc. No. S08629 Page B-i Contents Abbreviations ................................................................................................................................. iii Measurement Abbreviations .......................................................................................................... iii References

  18. PIC DOC 01/08/11 ? SOS

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    PIC DOC 010811 - SOS Content Outline 1) Usable Quotes We shouldn't equate public involvement with meetings. Maynard Plahuta Meetings, of many kinds, are probably the most...

  19. Microsoft Word - S05527_VMR 2009.DOC

    Office of Legacy Management (LM)

    ... Wells - Golf Course and Residential, Near the Gunnison Site U.S. Department of Energy 2009 Verification Monitoring Report-Gunnison, Colorado, Processing Site August 2009 Doc. ...

  20. Microsoft Word - S06692_VMR.doc

    Office of Legacy Management (LM)

    ... DOE Monitoring Wells - Golf Course and Residential, Near the Gunnison Site ... Monitoring Report-Gunnison, Colorado, Processing Site U.S. Department of Energy Doc. No. ...

  1. Microsoft Word - S05914_MR.doc

    Office of Legacy Management (LM)

    ... Energy 2009 Groundwater Monitoring Report Project Shoal Area, CAU 447 March 2010 Doc. No. ... The contaminant boundary (Figure 2) is a probabilistic forecast of the maximum extent over ...

  2. Microsoft Word - S07050_WM.doc

    Office of Legacy Management (LM)

    ... NI), Setaria viridis (green foxtail, UPL), Xanthium strumarium (cocklebur, FAC) Naturita-Monitoring Report for Wetland Area U.S. Department of Energy Doc. No. S07050 September ...

  3. Microsoft Word - AL2000-05.doc | Department of Energy

    Energy Savers

    .doc Microsoft Word - AL2000-05.doc PDF icon Microsoft Word - AL2000-05.doc More Documents & Publications al99-06.doc&0; Microsoft Word - AL2000-05Attachment.doc AL2004-01r2.pdf...

  4. transcript_pv_mapper.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    transcript_pv_mapper.doc transcript_pv_mapper.doc transcript_pv_mapper.doc transcript_pv_mapper.doc (74.5 KB) More Documents & Publications PVMapper: A Tool for Energy Siting transcript_jedi_model.doc 2009 National Electric Transmission Congestion Study - San Francisco Workshop

  5. Microsoft Word - AL2007-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    7-01.doc Microsoft Word - AL2007-01.doc Microsoft Word - AL2007-01.doc (151.65 KB) More Documents & Publications Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc Microsoft Word - Corp Impl Microsoft Word - AL2006-11

  6. Microsoft Word - FAL2004-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    4-03.doc Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-03.doc (538.96 KB) More Documents & Publications Microsoft Word - FAL2004-01.doc Financial Assistance Letter No. FAL 2006-04 Microsoft Word - FAL2006-04.doc

  7. Microsoft Word - Appendix N_Historical.doc

    Office of Legacy Management (LM)

    N Example Historical Marker and Plaque U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page N-3 Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page N-4

  8. Microsoft Word - AL2000-01.doc | Department of Energy

    Office of Environmental Management (EM)

    AL2000-01.doc Microsoft Word - AL2000-01.doc PDF icon Microsoft Word - AL2000-01.doc More Documents & Publications ALFAL 99-01 Department of Energy No Microsoft Word -...

  9. Microsoft Word - AL2008-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2008-06.doc Microsoft Word - AL2008-06.doc PDF icon Microsoft Word - AL2008-06.doc More Documents & Publications Chapter 9 - Contracting Qualifications Microsoft Word - PART...

  10. Microsoft Word - 99-04.doc | Department of Energy (indexed) [DOE]

    Word - 99-04.doc More Documents & Publications Policy Flash 2014-18 Complex-Wide Strategic Sourcing Microsoft Word - AL2000-01.doc Microsoft Word - AL2005-11.doc...

  11. Microsoft Word - AL2006-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    0.doc Microsoft Word - AL2006-10.doc PDF icon AL2006-10 More Documents & Publications Microsoft Word - Matrixpart2.doc Microsoft Word - AcqGuide70pt52Matrixpart2Redo...

  12. Microsoft Word - AL2004-02.doc | Department of Energy (indexed) [DOE]

    Microsoft Word - AL2004-02.doc More Documents & Publications Microsoft Word - AL2005-02.doc Microsoft Word - al2005-04.doc Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all...

  13. Microsoft Word - al95-06.doc | Department of Energy

    Energy Savers

    5-06.doc Microsoft Word - al95-06.doc PDF icon Microsoft Word - al95-06.doc More Documents & Publications ppl970-1.pdf Audit Report: IG-0589 Inspection Report: INS-O-02-01...

  14. Microsoft Word - meritrev.doc | Department of Energy

    Energy Savers

    Microsoft Word - meritrev.doc Microsoft Word - meritrev.doc PDF icon Microsoft Word - meritrev.doc More Documents & Publications Policy Flash 2013-38 Revised Merit Review Guide For...

  15. Microsoft Word - al95-14.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    al95-14.doc Microsoft Word - al95-14.doc PDF icon Microsoft Word - al95-14.doc More Documents & Publications Cooperation with the New Independent States of the Former Soviet Union ...

  16. Microsoft Word - AL2006-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    7.doc Microsoft Word - AL2006-07.doc PDF icon Microsoft Word - AL2006-07.doc More Documents & Publications OPAM Policy Acquisition Guides Personal Property Management Certification ...

  17. Microsoft Word - FAC2005-27.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAC2005-27.doc Microsoft Word - FAC2005-27.doc PDF icon Microsoft Word - FAC2005-27.doc More Documents & Publications Policy Flash 2015-07 - FAC 2005-78 Policy Flash Search Listing ...

  18. Microsoft Word - al2005-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    - al2005-06.doc PDF icon Microsoft Word - al2005-06.doc More Documents & Publications Microsoft Word - AL2006-01.doc OPAM Policy Acquisition Guides Acquisition Letter: AL2005-08...

  19. Microsoft Word - al96-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    6-09.doc Microsoft Word - al96-09.doc PDF icon Microsoft Word - al96-09.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis Chapter...

  20. Microsoft Word - AL2005-08.doc | Department of Energy

    Office of Environmental Management (EM)

    8.doc Microsoft Word - AL2005-08.doc Microsoft Word - AL2005-08.doc More Documents & Publications OPAM Policy Acquisition Guides Attachment FY2011-28 OPAM Microsoft Word -...

  1. Microsoft Word - FAC2005-19.doc | Department of Energy

    Office of Environmental Management (EM)

    FAC2005-19.doc Microsoft Word - FAC2005-19.doc Microsoft Word - FAC2005-19.doc More Documents & Publications Acquisitlon Letter No. AL 2008-06 AL2008-06.pdf fac2001-27.pdf...

  2. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word -...

  3. Microsoft Word - FORM46002.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    2.doc Microsoft Word - FORM46002.doc Microsoft Word - FORM46002.doc More Documents & Publications DOE F 4600.2 ATTACHMENT FLASH 2011-46(6) Attachment FY2011-63 OPAM...

  4. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc More Documents & Publications Microsoft Word - AL 2010-07 Acquistion Letters Remaining...

  5. Operating Guidelines Appendix C D.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Operating Guidelines Appendix C D.DOC&0; Operating Guidelines Appendix C D.DOC&0; PDF icon Operating Guidelines Appendix C D.DOC&0; More Documents & Publications Operating ...

  6. Microsoft Word - FAL2006-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAL2006-03.doc Microsoft Word - FAL2006-03.doc PDF icon Microsoft Word - FAL2006-03.doc More Documents & Publications Financial Assistance Letter No. FAL 2006-03 Microsoft Word - ...

  7. Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc |...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Speech 082508 FINAL.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc More Documents & Publications Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc ...

  8. Microsoft Word - 2005 FOIA ANNUAL REPORT.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    2005 FOIA ANNUAL REPORT.doc Microsoft Word - 2005 FOIA ANNUAL REPORT.doc report2005.pdf PDF icon Microsoft Word - 2005 FOIA ANNUAL REPORT.doc More Documents & Publications U.S. ...

  9. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2008-05.doc Microsoft Word - AL2008-05.doc PDF icon Microsoft Word - AL2008-05.doc More Documents & Publications Acquisition Letters Remaining In Effect Acquisition Letters ...

  10. Microsoft Word - Matrixpart2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Matrixpart2.doc Microsoft Word - Matrixpart2.doc PDF icon Microsoft Word - Matrixpart2.doc More Documents & Publications AcqGuide70.52Matrixpart2Redo-OPAM Microsoft Word - ...

  11. Microsoft Word - al2004-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    al2004-03.doc Microsoft Word - al2004-03.doc PDF icon Microsoft Word - al2004-03.doc More Documents & Publications Acquisition Letter: AL2005-08 OPAM Policy Acquisition Guides ...

  12. Microsoft Word - FY09PropertyBSCContractor.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FY09PropertyBSCContractor.doc Microsoft Word - FY09PropertyBSCContractor.doc PDF icon Microsoft Word - FY09PropertyBSCContractor.doc More Documents & Publications FY09 Property ...

  13. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAL2004-05.doc Microsoft Word - FAL2004-05.doc PDF icon Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word - Section ...

  14. Microsoft Word - Brochure_Senior Officials.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    BrochureSenior Officials.doc Microsoft Word - BrochureSenior Officials.doc Microsoft Word - BrochureSenior Officials.doc (29.28 KB) More Documents & Publications Preservation of ...

  15. Microsoft Word - CSATCourseCatalog_02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    CSATCourseCatalog02.doc Microsoft Word - CSATCourseCatalog02.doc classroom-1008856960720.jpg Microsoft Word - CSATCourseCatalog02.doc (554.38 KB) More Documents & Publications ...

  16. Microsoft Word - May2009.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    May2009.doc Microsoft Word - May2009.doc Microsoft Word - May2009.doc (6.77 MB) More Documents & Publications Special Resource StudyEnvironmental Assessment for Manhattan Project ...

  17. Property:NEPA TieredDoc | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    TieredDoc Jump to: navigation, search Property Name NEPA TieredDoc Property Type Page This is a property of type Page. Pages using the property "NEPA TieredDoc" Showing 25 pages...

  18. Microsoft Word - ARRAAttachment12v1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment12v1.doc More Documents & Publications Microsoft Word - DRAFT CRB Interview Guidance.doc Microsoft Word - ARRAGuideAttachment10v1

  19. Microsoft Word - AL2006-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2006-11.doc Microsoft Word - AL2006-11.doc PDF icon Microsoft Word - AL2006-11.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis...

  20. Operating Guidelines Appendix A B.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Operating Guidelines Appendix A B.DOC&#0; Operating Guidelines Appendix A B.DOC&#0; Operating Guidelines Appendix A B.DOC&#0; (73.17 KB) More Documents & Publications Operating Guidelines Appendix C D.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; DOE HR Guidebook 12_15_05.DOC&#0;

  1. Microsoft Word - CERFDOE Final Report - 071204.doc | Department...

    Office of Environmental Management (EM)

    Microsoft Word - CERFDOE Final Report - 071204.doc (394.42 KB) More Documents & Publications Integrated Project Team RM DOE EIR FM.doc Independent Oversight Activity Report, ...

  2. Microsoft Word - ADR-Provisions-FederalAcquisitionReg.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications ADR Provisions in Federal Acquisition Regulation (FAR) Microsoft Word - ACQUISITION LETTER.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc...

  3. Microsoft Word - AL2005-12.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon Microsoft Word - AL2005-12.doc More Documents & Publications Microsoft Word - AL2005-11.doc OPAM Policy Acquisition Guides Chapter 31 - Contract Cost Principles...

  4. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Energy Savers

    & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross Reference Matrix Introduction.doc Assessment of the Effects of Climate Change on Federal Hydropower...

  5. Design Potential of Metal Foil Substrates for Optimized DOC Performanc...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Design Potential of Metal Foil Substrates for Optimized DOC Performance Design Potential of Metal Foil Substrates for Optimized DOC Performance Poster presentation at the 2007 ...

  6. DOE EIR FM.doc | Department of Energy

    Office of Environmental Management (EM)

    EIR FM.doc PDF icon DOE EIR FM.doc More Documents & Publications Contractor Statement of Work (SOW) Template (for EIR) External Independent Review (EIR) Standard Operating...

  7. Microsoft Word - EODchecklist1.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    New Employee Orientation FORMS CHECKLIST EOD Date: Employee Name: Organization: HR Specialist: Phone Number: Admin Contact: Phone Number: New Employee Orientation Forms to be ...

  8. Serial Femtosecond Crystallography of G Protein-Coupled Receptors

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Liu, Liu


    Serial femtosecond crystallography data on microcrystals of 5-HT2B receptor bound to ergotamine grown in lipidic cubic phase.

  9. Microsoft Word - S05949_IR.doc

    Office of Legacy Management (LM)

    ... erosion. 2.1.4 Pond 4 Pond 4 is a lined solar evaporation pond that collects water ... store U.S. Department of Energy 2009 Annual Inspection-Monticello, Utah December 2009 Doc. ...

  10. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    and Recovery Act Cleanups This page intentionally left blank U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. ...

  11. Form:NEPA Doc | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    NEPA Doc Jump to: navigation, search Input the name of a NEPA Document below. If the document already exists, you will be able to edit its information. AddEdit a NEPA Document...

  12. Microsoft Word - Appendix A_Background.doc

    Office of Legacy Management (LM)

    ... and Maintenance (LTSM) Program records at the DOE Grand ... Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. ... (DOE 2003c). The two communities closest to the Chemical ...

  13. Microsoft Word - Appendix A.doc

    Office of Legacy Management (LM)

    ... and Maintenance (LTSM) Program records at the DOE Grand ... Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. ... (DOE 2003c). The two communities closest to the Chemical ...

  14. Edwin Parks (Doc) | Department of Energy

    Office of Environmental Management (EM)

    Doc Parks has over 27 years of active-duty military service with the U.S. Air Force (USAF), serving a broad range of command and staff positions in nuclear operations policy, ...

  15. RetTrendReport1205.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    RetTrendReport1205.doc&#0; RetTrendReport1205.doc&#0; RetTrendReport1205.doc&#0; (2.58 MB) More Documents & Publications Pension Plans for Contractor Workers April 1-10 comments.doc&#0; POLICY GUIDANCE MEMORANDUM #39 Phased Retirement

  16. AcqGuide70pt5.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AcqGuide70pt5.doc&#0; AcqGuide70pt5.doc&#0; AcqGuide70pt5.doc&#0; (16.21 KB) More Documents & Publications Chapter 70.3102-05-6: Contractor Compensation - Variable Pay Policy Flash 2016-34 AcqGuide41pt1.doc&#0;

  17. Microsoft Word - Chapter 05 a.doc | Department of Energy

    Office of Environmental Management (EM)

    Microsoft Word - Chapter 05 a.doc Microsoft Word - Chapter 05 a.doc Microsoft Word - Chapter 05 a.doc (7.05 MB) More Documents & Publications Microsoft Word - Chapter 01.doc EIS-0426: Record of Decision EIS-0426: Final Environmental Impact Statement

  18. Microsoft Word - Chapter 01.doc | Department of Energy

    Office of Environmental Management (EM)

    Microsoft Word - Chapter 01.doc Microsoft Word - Chapter 01.doc Microsoft Word - Chapter 01.doc (10.76 MB) More Documents & Publications Microsoft Word - Chapter 05 a.doc EIS-0426: Record of Decision EIS-0426: Final Environmental Impact Statement

  19. DOC-DOE Joint China Mission Statement | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Joint China Mission Statement DOC-DOE Joint China Mission Statement DOC-DOE Joint China Mission Statement DOC-DOE Joint China Mission Statement (109.75 KB) More Documents & Publications DOC-DOE China Mission Announcement Press Release FACT SHEET: U.S.-China Clean Energy Cooperation Announcements US-China Clean Energy Cooperation

  20. expanding_chp_in_your_state.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc (130 KB) More Documents & Publications Combined Heat and Power: Expanding CHP in Your State Sustainable Energy Resources for Consumers (SERC) - Solar Hot Water Sustainable Energy Resources for Consumers (SERC) - Geothermal/Ground-Source Heat Pumps

  1. Microsoft Word - DOETTQuestions.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    DOETTQuestions.doc Microsoft Word - DOETTQuestions.doc Microsoft Word - DOETTQuestions.doc (48.9 KB) More Documents & Publications Microsoft Word - 73FR72036_UC signed 1&#0; Microsoft Word - SRNL Fed Register Response.doc Subcontractor Rights Under CRADAs and WFO Agreements

  2. Microsoft Word - FAL2006-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAL2006-04.doc Microsoft Word - FAL2006-04.doc Microsoft Word - FAL2006-04.doc (74.69 KB) More Documents & Publications Financial Assistance Letter No. FAL 2006-04 Microsoft Word - AL2006-03.doc Microsoft Word - FAL2004-01

  3. Microsoft Word - Federal Register Response _Jan09_.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Federal Register Response _Jan09_.doc Microsoft Word - Federal Register Response _Jan09_.doc Microsoft Word - Federal Register Response _Jan09_.doc (13.88 KB) More Documents & Publications Microsoft Word - Document2 Microsoft Word - Intellectual Property Provisions _NRD-1003_.doc Microsoft Word - ARRAAttachment12v1

  4. Microsoft Word - Final Sample Participant Profile November 2008.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Final Sample Participant Profile November 2008.doc Microsoft Word - Final Sample Participant Profile November 2008.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - DRAFT CRB Interview Guidance

  5. Microsoft Word - PART 970.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PART 970.doc Microsoft Word - PART 970.doc Microsoft Word - PART 970.doc (1.03 MB) More Documents & Publications Searchable Electronic Department of Energy Acquisition Regulation Microsoft Word - Matrixpart2.doc AcqGuide70.52Matrixpart2Redo-OPAM

  6. Microsoft Word - meritrev.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ... Preference: In merit reviewer selection, there should be no preference based on race, ethnic identity, gender, religion, region, age, or institutional affiliation. 3 Number of ...

  7. AL2007-05.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL 2007-05 Acquisition Regulation Date 03292007 ACQUISITION LETTER This Acquisition ... LETTERS REMAINING IN EFFECT NUMBER DATE SUBJECT 93-4 040793 Displaced Workers ...

  8. Microsoft Word - U0186500.doc

    Office of Legacy Management (LM)

    New Mexico, UMTRA Site September 2003 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number ...

  9. Microsoft Word - Highlights.doc

    Gasoline and Diesel Fuel Update

    ... Source: National Oceanic and Atmospheric Administration, ... or commercial-sector generators to third parties, ... number in this table is net of re-injection and water cut. ...

  10. Microsoft Word - lesht.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Relative Humidity Climatology at the ARM NSA, SGP, and TWP Climate Research Facility ... ACRF Site Start Date End Date Number of Soundings NSA 04282002 11302003 402 SGP 0501...

  11. Microsoft Word - IG-0648.doc

    Energy Savers

    ... Further, although the Department's Environment, Safety and Health personnel investigate ... to either OSHA logs or CAIRS. Safety Statistics For a number of years, the Department ...

  12. Microsoft Word - TP22135.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Sandia National Laboratories will not be liable for any loss ... Although ferrite is typically not observed in bar stock, ... of deuterium in a number of austenitic stainless ...

  13. Lipidic phase membrane protein serial femtosecond crystallography

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Lipidic phase membrane protein serial femtosecond crystallography Authors: Johansson LC, Arnlund D, White TA, Katona G, Deponte DP, Weierstall U, Doak RB, Shoeman RL, Lomb L, Malmerberg E, Davidsson J, Nass K, Liang M, Andreasson J, Aquila A, Bajt S, Barthelmess M, Barty A, Bogan MJ, Bostedt C, Bozek JD, Caleman C, Coffee R, Coppola N, Ekeberg T, Epp SW, Erk B, Fleckenstein H, Foucar L, Graafsma H, Gumprecht L, Hajdu J, Hampton CY, Hartmann R, Hartmann A, Hauser G, Hirsemann H, Holl P, Hunter

  14. Serial and Westmere Queues on Carver

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    and Westmere Queues on Carver Serial and Westmere Queues on Carver September 20, 2011 by Francesca Verdier NERSC has replaced 80 8-core Intel Nehalem nodes on Carver with 80 12-core Intel Westmere nodes. The new processors run at the same frequency as those they replace, but have slightly larger caches. Also, the Westmere nodes are populated with 48GB of memory; the memory runs at 1333MHz. This new hardware serves two purposes. First, it provides access to more memory (48GB) than is available on

  15. State Energy Program - Program Year 2014 - Formula Award - Administrative and Legal Requirement Doc (indexed) [DOE]

    Weatherization and Intergovernmental Programs Office (WIPO) STATE: Mult PROJECT TITLE : State Energy Program - Program Year 2014 - Formula Award - Administrative and Legal Requirement Doc (ALRD) Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number SEP-ALRD-2014 GFO-SEP-ALRD-2014 Based on my review of the information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 451.1A), I have made the following

  16. Microsoft Word - N0049800.doc

    Office of Legacy Management (LM)

    49800 GJO-2002-306-TAR MAC-PIN 14.5.2 Pinellas Environmental Restoration Project at the Young-Rainey STAR Center Building 100 Area Plume Control Technology Selection Report February 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-96GJ87335 Task Order Number MAC02-10 This page intentionally left blank Document Number N0049800 Contents DOE/Grand Junction Office Building 100 Area Plume Control Technology

  17. Microsoft Word - M084.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  18. LATEST_m_93.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    3 AM Change Number M-93-01-02 Federal Facility Agreement and Consent Order Change Control Form Do not use blue ink. Type or print using black ink. Date 123101 Originator Phone H....

  19. CM300DLFinal.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    To reserve a CM300 session, go to, click on "Microscope Scheduling", use proposal number and password to log in. You may only sign up for 2 sessions per month, ...

  20. Microsoft Word - U0195900.doc

    Office of Legacy Management (LM)

    GJO-2004-589-TAC ESL-RPT-2004-02 ESL-RPT-2004-02 U0195900 Office of Legacy Management ... Number U0195900 Contents DOEOffice of Legacy Management Diffusion Multilayer Sampling ...

  1. Microsoft Word - U0127400.doc

    Office of Legacy Management (LM)

    12-TAR MAC-GWMON 1.8 Chemistry of Phase I Phytoremediation Soils: Work Plan for the Monument Valley, Arizona, UMTRA Project Site September 2001 This page intentionally left blank UMTRA Ground Water Project Chemistry of Phase I Phytoremediation Soils: Work Plan for the Monument Valley, Arizona, UMTRA Project Site September 2001 Prepared for U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Project Number UGW-511-0015-37-000 Document Number U0127400 Work Performed Under DOE

  2. AcqGuide42pt3.doc | Department of Energy

    Office of Environmental Management (EM)

    1pt1.doc&#0; AcqGuide41pt1.doc&#0; AcqGuide41pt1.doc&#0; (13.23 KB) More Documents & Publications Chapter 41 - Acquisition of Utility Services Policy Flash 2016-31 Chapter 41: Utilities

    2pt3.doc&#0; AcqGuide42pt3.doc&#0; AcqGuide42pt3.doc&#0; (56.38 KB) More Documents & Publications Chapter 42 - Contract Administration Acquisition Guide Chapter 42.1202 - Novation Agreements Chapter 9.2: Performance Guarantees

  3. Microsoft Word - Clay Memo PMC Coburn Obama 11_9_06.doc | Department...

    Office of Environmental Management (EM)

    Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc More Documents & Publications...

  4. Microsoft Word - DP_cover_and_front matter_FINAL1.DOC | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FINAL1.DOC Microsoft Word - DPcoverandfront matterFINAL1.DOC PDF icon Microsoft Word - DPcoverandfront matterFINAL1.DOC More Documents & Publications Microsoft Word - ...

  5. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc PDF icon Microsoft Word - TSLCC 200750508 rev 1.doc More Documents & Publications FY 2007 Total System ...

  6. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of...

    Office of Environmental Management (EM)

    TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc More Documents & Publications FY 2007 Total System Life...

  7. Microsoft Word - table_21.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    9 Table 21. Number of natural gas commercial consumers by type of service and state, 2013-2014 R Revised data. Note: Totals may not equal sum of components due to independent rounding. Source: Energy Information Administration (EIA), Form EIA-176, "Annual Report of Natural and Supplemental Gas Supply and Disposition." Please see the cautionary note regarding the number of residential and commercial customers located on the second page of Appendix A of this report. Alabama 67,006 130

  8. NVN-086287 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20081203 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086287 Lease Numbers NVN-074855 Proposed Action Installation and sampling...

  9. NVN-087930 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Decision Document Date 20090916 Relevant Numbers Lead Agency Doc Number NVN-087930 Serial Number NVN-087930 Lease Numbers NVN-018423 NVN-076291 NVN-083928 NVN-085708 NVN-085709...

  10. NVN-087809 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Decision Document Date 20090612 Relevant Numbers Lead Agency Doc Number NV-087809 Serial Number NV-087809 Lease Numbers NVN-085710 NVN-085711 Proposed Action A Gravity...

  11. NVN-086761 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20090224 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086761 Lease Numbers NVN-079305 NVN-079306 NVN-079307 Proposed Action...

  12. NVN-086286 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    NOI, POO Decision Document Date 20081201 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086286 Lease Numbers NVN-085722 NVN-085723 NVN-085724 Proposed Action The...

  13. NVN-087791 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20090721 Relevant Numbers Lead Agency Doc Number Serial Number NVN-087791 Lease Numbers NVN-074854 NVN-076298 NVN-076299 NVN-076300 NVN-076301...

  14. NVN-086285 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20081201 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086285 Lease Numbers NVN-083928 NVN-085708 NVN-085709 Proposed Action The...

  15. NVN-088259 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20100317 Relevant Numbers Lead Agency Doc Number Serial Number NVN-088259 Lease Numbers NVN-074308 NVN-074309 Proposed Action Closely spaced...

  16. NVN-087812 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20090721 Relevant Numbers Lead Agency Doc Number Serial Number NVN-087812 Lease Numbers NVN-074854 NVN-076298 NVN-076299 NVN-076300 NVN-076301...

  17. NVN-89274 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89274 Lease Numbers NVN-085716 NVN-086893 NVN-088920 Proposed Action...

  18. NVN-087811 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20090721 Relevant Numbers Lead Agency Doc Number Serial Number NVN-087811 Lease Numbers NVN-074854 NVN-076298 NVN-076299 NVN-076300 NVN-076301...

  19. NVN-89534 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Date 20110302 Application Document Type NOI Relevant Numbers Lead Agency Doc Number Serial Number NVN-089534 Lease Numbers NVN-083928 NVN-077668 Proposed Action Two thermal...

  20. NVN-89292 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-089292 Lease Numbers NVN-088435 NVN-088436 NVN-088437 Proposed Action...

  1. Microsoft Word - n0021500.doc

    Office of Legacy Management (LM)

    PIN 16.2 Environmental Restoration Program Wastewater Neutralization Area/Building 200 Area Corrective Measures Implementation Plan Addendum January 2000 Environmental Restoration Program Wastewater Neutralization Area/Building 200 Area Corrective Measures Implementation Plan Addendum January 2000 Prepared for U.S. Department of Energy Albuquerque Operations Office Grand Junction Office Prepared by MACTEC Environmental Restoration Services, LLC Grand Junction, Colorado Project Number

  2. Data Exploration Toolkit for serial diffraction experiments


    Zeldin, Oliver B.; Brewster, Aaron S.; Hattne, Johan; Uervirojnangkoorn, Monarin; Lyubimov, Artem Y.; Zhou, Qiangjun; Zhao, Minglei; Weis, William I.; Sauter, Nicholas K.; Brunger, Axel T.


    Ultrafast diffraction at X-ray free-electron lasers (XFELs) has the potential to yield new insights into important biological systems that produce radiation-sensitive crystals. An unavoidable feature of the 'diffraction before destruction' nature of these experiments is that images are obtained from many distinct crystals and/or different regions of the same crystal. Combined with other sources of XFEL shot-to-shot variation, this introduces significant heterogeneity into the diffraction data, complicating processing and interpretation. To enable researchers to get the most from their collected data, a toolkit is presented that provides insights into the quality of, and the variation present in, serial crystallography datamore » sets. These tools operate on the unmerged, partial intensity integration results from many individual crystals, and can be used on two levels: firstly to guide the experimental strategy during data collection, and secondly to help users make informed choices during data processing.« less

  3. AcqGuide39pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon AcqGuide39pt1.doc&0; More Documents & Publications Chapter 39 - Acquisition of Information Technology AcqGuide38pt1.doc&0; Microsoft Word - AcqGuide16pt1...

  4. AcqGuide70pt31.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon AcqGuide70pt31.doc&0; More Documents & Publications Microsoft Word - AcqGuide70pt31A.doc Policy Flash 2014-26 Acquisition Guide Chapter 70.31A - Costs...

  5. AcqGuide47pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AcqGuide47pt1.doc&0; PDF icon AcqGuide47pt1.doc&0; More Documents & Publications Chapter 47 - Transportation TEC Working Group Topic Groups Manual Review Key Documents ...

  6. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    22.62 KB) More Documents & Publications Microsoft Word - FOA cover sheet.doc Recovery Act, Office of the Biomass Program,Funding Opportunity Announcements Special Notice Microsoft Word - FOA cover sheet.doc

  7. Microsoft Word - e0399102.doc

    Office of Legacy Management (LM)

    UNCONTROLLED IF PRINTED E0399101 GJO-2003-493-TAC MNT 015.20 REV. 06 Copy No. ______ Draft-Final Monticello Site Management Plan October 2003 UNCONTROLLED IF PRINTED Prepared by U.S. Department of Energy Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-02GJ79491 UNCONTROLLED IF PRINTED Contents October 2003 Site Management Plan Page iii Contents Acronyms and Abbreviations

  8. Microsoft Word - U01866.doc

    Office of Legacy Management (LM)

    186600 GJO-2003-489-TAC GJO-GWDUR 2.0 UMTRA Ground Water Project Verification Monitoring Report for the Durango, Colorado, UMTRA Project Site September 2003 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract No. DE-AC13-02GJ79491 Document Number U0186600 Contents DOE/Grand Junction Office Verification Monitoring Report-Durango, Colorado September 2003 Page iii Contents 1.0

  9. Microsoft Word - August06.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    August 2006 Office of History and Heritage Resources Volume 2, Number 2 In This Issue * B-Reactor Study for Deputy Secretary * Museum and Visitor Center Conference * National Park Service Manhattan Project Resource Study * DOE Headquarters Museum/Visitor Center * Want to Receive Partners in Preservation? * 2007 DOE Cultural Resources Forum: Hanford, Washington * 2006 DOE Cultural Resources Forum: Oak Ridge, Tennessee * K-25 Racetrack? * FPO Funds Field Office Preservation * Pantex Donates Cold

  10. csep_transcript_transportation.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications cseptranscriptminneapolis.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, 2011 (Text Version) Transcript: Biomass ...

  11. comm_pace_updates_field_resources_prog_design_implementation.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy comm_pace_updates_field_resources_prog_design_implementation.doc comm_pace_updates_field_resources_prog_design_implementation.doc comm_pace_updates_field_resources_prog_design_implementation.doc comm_pace_updates_field_resources_prog_design_implementation.doc (126.5 KB) More Documents & Publications Commercial PACE: Updates from the Field & New Resources for Design and Implementation Combined Heat and Power: Expanding CHP in Your State expanding_chp_in_your_state

  12. 20130226_sunshot_transcript_lbnl.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc (73.5 KB) More Documents & Publications Why Are Resiential PV Prices in Germany So Much Lower Than in the United States? text_alternative_stat_webinar_2012_7_25.docx An Analysis of Residential PV System Price Differences between the United States and Germany

  13. DOCS System Configuration Management Plan | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    DOCS System Configuration Management Plan DOCS System Configuration Management Plan The DOCS Systems Configuration Management Plan (SCMP), from an actual DOE systems engineering project, can be used as a template to facilitate the creation of the CMP for your particular project. DOCS System Configuration Management Plan (654.98 KB) More Documents & Publications OPC Security Whitepaper #3Hardening Guidelines for OPC Hosts NMMSS Software Quality Assurance Plan ABB SCADA/EMS System INEEL

  14. chap4_3.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    CALORIMETRY V.E. Viola and R. Bougault In any attempt to describe a system in terms of thermodynamic variables, a knowledge of heat content is fundamental. For hot nuclei, this energetic factor is usually expressed in terms of excitation energy per nucleon, E*/A. Because nuclei are finite systems, size is important. Thus, it is necessary to determine both the heat content E* and the number of nucleons A that characterize the disintegrating ensemble. In this chapter we examine the methods by

  15. word2pdf43408.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    YOUR BENEFIT PLAN LOS ALAMOS NATIONAL SECURITY, LLC Retiree Voluntary Accidental Death and Dismemberment Plan (ADD) Questions about Your Coverage In the event You have questions regarding any aspect of Your coverage, You should contact Your Employee Benefits Manager or You may write to us at: The Hartford Group Benefits Division, Customer Service P.O. Box 2999 Hartford, CT 06104-2999 Or call Us at: 1-800-523-2233 When calling, please give Us the following information: 1) the policy number; and

  16. CompleteProject List.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    CompleteProject List.doc&#0; CompleteProject List.doc&#0; CompleteProject List.doc&#0; (9.47 KB) More Documents & Publications Tribal Energy Program February 2012 Award Project Descriptions CX-008525: Categorical Exclusion Determination 2010 Program Review Meeting

  17. AcqGuide41pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1pt1.doc&#0; AcqGuide41pt1.doc&#0; AcqGuide41pt1.doc&#0; (13.23 KB) More Documents & Publications Chapter 41 - Acquisition of Utility Services Policy Flash 2016-31 Chapter 41: Utilities

  18. AcqGuide9pt2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AcqGuide9pt2.doc&#0; AcqGuide9pt2.doc&#0; AcqGuide9pt2.doc&#0; (16.88 KB) More Documents & Publications Chapter 9.2: Performance Guarantees Policy Flash 2016-32 Chapter 9 - Contracting Qualifications

  19. Microsoft Word - AL2003-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    3-04.doc Microsoft Word - AL2003-04.doc Microsoft Word - AL2003-04.doc (254.1 KB) More Documents & Publications AL2004-01r2.pdf City of Tulare Renewable Biogas Fuel Cell Project

  20. Microsoft Word - LibraryofPriorRulemakings.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    LibraryofPriorRulemakings.doc Microsoft Word - LibraryofPriorRulemakings.doc Microsoft Word - LibraryofPriorRulemakings.doc (28.89 KB) More Documents & Publications Solar Background Document 1 Natural Gas Imports and Exports First Quarter Report 2014 Natural Gas Imports and Exports Second Quarter Report 2014

  1. Microsoft Word - Political Activity and the Federal Employee.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Political Activity and the Federal Employee.doc Microsoft Word - Political Activity and the Federal Employee.doc Microsoft Word - Political Activity and the Federal Employee.doc (165.92 KB) More Documents & Publications Political Activity at DOE Facilities by DOE Contractors Audit Report: IG-0473 PROCESSING INVITATIONS FOR A PRESIDENTIAL APPOINTEE

  2. Microsoft Word - competitionincontractingguidev2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc (215.28 KB) More Documents & Publications AcqGuide 5.2-OPAM Acquisition Guide, Chapter 6.1, Competition Requirements Microsoft Word - AG Chapter 6 1 Nov 2010

  3. Microsoft Word - fal2004-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    fal2004-04.doc Microsoft Word - fal2004-04.doc Microsoft Word - fal2004-04.doc (132.28 KB) More Documents & Publications U.S. Department of Energy - Guide to Financial Assistance - Audit Requirements for For-Profit Organizations Financial Assistance Guide (2013) Revised Guide for Financial Assistance

  4. AcqGuide3pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    pt1.doc&0; AcqGuide3pt1.doc&0; PDF icon AcqGuide3pt1.doc&0; More Documents & Publications POLICY FLASH 2016-04 Procurement Integrity PI Brief 6 15 07 final2&0;

  5. Microsoft Word - FY08AnnualReport.doc | Department of Energy

    Office of Environmental Management (EM)

    FY08AnnualReport.doc Microsoft Word - FY08AnnualReport.doc PDF icon Microsoft Word - FY08AnnualReport.doc More Documents & Publications Microsoft Word - FY09AnnualReportv1.doc...

  6. Microsoft Word - AL2005-05Revised.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2005-05Revised.doc Microsoft Word - AL2005-05Revised.doc PDF icon Microsoft Word - AL2005-05Revised.doc More Documents & Publications AL2007-03.doc&0; 2011-31 Attachment...

  7. Microsoft Word - ALonEO13423Last.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ALonEO13423Last.doc Microsoft Word - ALonEO13423Last.doc PDF icon Microsoft Word - ALonEO13423Last.doc More Documents & Publications Microsoft Word - AL2008-05.doc Tri-Party ...

  8. Microsoft Word - ITSI award doc 06-D0008 conformed to P00001...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ITSI award doc 06-D0008 conformed to P00001.doc Microsoft Word - ITSI award doc 06-D0008 conformed to P00001.doc More Documents & Publications Policy Flash 2015-02 Acquisition ...

  9. Microsoft Word - Flash2008-09Attachment.doc | Department of Energy (indexed) [DOE]

    9Attachment.doc More Documents & Publications Flash2007-02Attachment.doc&0; Microsoft Word - AL2000-05Attachment.doc Flash2007-03Attachment.doc&0;...

  10. Microsoft Word - Policy Flash 2008-04.doc | Department of Energy

    Office of Environmental Management (EM)

    4.doc Microsoft Word - Policy Flash 2008-04.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  11. Microsoft Word - Policy Flash 2008-06.doc | Department of Energy

    Office of Environmental Management (EM)

    6.doc Microsoft Word - Policy Flash 2008-06.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  12. Microsoft Word - AL2000-05Attachment.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Attachment.doc Microsoft Word - AL2000-05Attachment.doc PDF icon Microsoft Word - AL2000-05Attachment.doc More Documents & Publications al99-06attachment.doc&0; EXHIBIT A: CRADA,...

  13. Microsoft Word - DRAFT CRB Interview Guidance.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    DRAFT CRB Interview Guidance.doc Microsoft Word - DRAFT CRB Interview Guidance.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc Microsoft Word - Document2

  14. Microsoft Word - Policy Flash 2008-07.doc | Department of Energy

    Office of Environmental Management (EM)

    07.doc Microsoft Word - Policy Flash 2008-07.doc More Documents & Publications Microsoft Word - Policy Flash 2008-10...

  15. Microsoft Word - Policy Flash 2008-10.doc | Department of Energy

    Office of Environmental Management (EM)

    10.doc Microsoft Word - Policy Flash 2008-10.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07...

  16. Microsoft Word - table_20.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    8 Table 20. Number of natural gas residential consumers by type of service and state, 2013-2014 Alabama 765,957 0 765,957 769,418 0 769,418 Alaska 124,411 0 124,411 126,416 0 126,416 Arizona 1,171,997 6 1,172,003 1,186,788 6 1,186,794 Arkansas R 549,764 0 R 549,764 549,034 0 549,034 California 10,471,814 283,094 10,754,908 10,372,973 408,747 10,781,720 Colorado 1,672,307 5 1,672,312 1,690,576 5 1,690,581 Connecticut 512,110 1,382 513,492 521,460 1,198 522,658 Delaware 155,627 0 155,627 158,502 0

  17. Microsoft Word - table_22.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    0 Table 22. Number of natural gas industrial consumers by type of service and state, 2013-2014 Alabama 2,876 267 3,143 2,973 271 3,244 Alaska 2 1 3 1 0 1 Arizona 257 126 383 256 130 386 Arkansas 513 507 1,020 531 478 1,009 California 32,662 5,334 37,996 32,266 5,282 37,548 Colorado 946 6,347 7,293 986 6,837 7,823 Connecticut 3,360 1,094 4,454 3,340 877 4,217 Delaware 28 110 138 28 113 141 Florida 166 362 528 165 355 520 Georgia 984 1,258 2,242 887 1,594 2,481 Hawaii 22 0 22 23 0 23 Idaho 109 R

  18. Microsoft Word - table_05.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    3 Table 5. Number of producing gas wells by state and the Gulf of Mexico, December 31, 2010-2014 Alabama 7,026 7,063 6,327 R 6,165 6,118 Alaska 269 277 185 R 159 170 Arizona 5 5 5 5 5 Arkansas 7,397 8,388 8,538 R 9,843 10,150 California 1,580 1,308 1,423 R 1,335 1,118 Colorado 28,813 30,101 32,000 R 32,468 38,346 Gulf of Mexico 1,852 1,559 1,474 R 1,146 1,400 Illinois 50 40 40 R 34 36 Indiana 620 914 819 R 921 895 Kansas 22,145 25,758 24,697 R 23,792 24,354 Kentucky 17,670 14,632 17,936 R 19,494

  19. Switch for serial or parallel communication networks

    DOE Patents [OSTI]

    Crosette, D.B.


    A communication switch apparatus and a method for use in a geographically extensive serial, parallel or hybrid communication network linking a multi-processor or parallel processing system has a very low software processing overhead in order to accommodate random burst of high density data. Associated with each processor is a communication switch. A data source and a data destination, a sensor suite or robot for example, may also be associated with a switch. The configuration of the switches in the network are coordinated through a master processor node and depends on the operational phase of the multi-processor network: data acquisition, data processing, and data exchange. The master processor node passes information on the state to be assumed by each switch to the processor node associated with the switch. The processor node then operates a series of multi-state switches internal to each communication switch. The communication switch does not parse and interpret communication protocol and message routing information. During a data acquisition phase, the communication switch couples sensors producing data to the processor node associated with the switch, to a downlink destination on the communications network, or to both. It also may couple an uplink data source to its processor node. During the data exchange phase, the switch couples its processor node or an uplink data source to a downlink destination (which may include a processor node or a robot), or couples an uplink source to its processor node and its processor node to a downlink destination. 9 figs.

  20. Switch for serial or parallel communication networks

    DOE Patents [OSTI]

    Crosette, Dario B.


    A communication switch apparatus and a method for use in a geographically extensive serial, parallel or hybrid communication network linking a multi-processor or parallel processing system has a very low software processing overhead in order to accommodate random burst of high density data. Associated with each processor is a communication switch. A data source and a data destination, a sensor suite or robot for example, may also be associated with a switch. The configuration of the switches in the network are coordinated through a master processor node and depends on the operational phase of the multi-processor network: data acquisition, data processing, and data exchange. The master processor node passes information on the state to be assumed by each switch to the processor node associated with the switch. The processor node then operates a series of multi-state switches internal to each communication switch. The communication switch does not parse and interpret communication protocol and message routing information. During a data acquisition phase, the communication switch couples sensors producing data to the processor node associated with the switch, to a downlink destination on the communications network, or to both. It also may couple an uplink data source to its processor node. During the data exchange phase, the switch couples its processor node or an uplink data source to a downlink destination (which may include a processor node or a robot), or couples an uplink source to its processor node and its processor node to a downlink destination.

  1. NVN-091277 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Relevant Numbers Lead Agency Doc Number Serial Number NVN-091277 Proposed Action Conduct water sampling, archaeological surveys, and shallow temperature surveys. Data Completion...

  2. NVN-91276 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Mineral Manager none provided Selected Dates Relevant Numbers Lead Agency Doc Number Serial Number NVN-091276 Data Completion Notes No documents from which to populate page. 9...

  3. Microsoft Word - S03736_ FMP010609.doc

    Office of Legacy Management (LM)

    Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 LMS/CNT/S03736 This page intentionally left blank LMS/CNT/S03736 Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 This page intentionally left blank U.S. Department of Energy Fluid Management Plan For CAU 443: CNTA, Subsurface, Nevada January 2009 Doc. No. S0373600 Page i Contents Acronyms and Abbreviations

  4. Microsoft Word - S04019_GSB.doc

    Office of Legacy Management (LM)

    Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 LMS/GSB/S04019 This page intentionally left blank LMS/GSB/S04019 Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 This page intentionally left blank U.S. Department of Energy Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009, Rev. 3 Doc. No. S04019 Page i Contents Abbreviations

  5. Microsoft Word - S06178_MP.doc

    Office of Legacy Management (LM)

    Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited LMS/RUL/S06178 This page intentionally left blank LMS/RUL/S06178 Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited This page intentionally left blank U.S. Department of Energy Rulison Monitoring Plan July 2010 Doc. No. S06178 Page i Contents 1.0

  6. Microsoft Word - S06596_GW.doc

    Office of Legacy Management (LM)

    Annual Groundwater Report May 2009 through April 2010 September 2010 LMS/MNT/S06596 This page intentionally left blank LMS/MNT/S06596 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report May 2009 through April 2010 September 2010 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report May 2009-April 2010 September 2010 Doc. No. S06596 Page i Contents

  7. Microsoft Word - S05428_VMR.doc

    Office of Legacy Management (LM)

    Slick Rock, Colorado, Processing Sites 2008 and 2009 Update July 2010 LMS/SRE-SRW/S05428 This page intentionally left blank LMS/SRE-SRW/S05428 Verification Monitoring Report for the Slick Rock, Colorado, Processing Sites 2008 and 2009 Update July 2010 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report-Slick Rock, Colorado, 2008 and 2009 Update July 2010 Doc. No. S05428 Page i Contents

  8. NVN-088208 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    6 months earlier; BLM NOI was just a formality Relevant Numbers Lead Agency Doc Number Serial Number NVN-088208 Lease Numbers NVN-074249 NVN-074250 NVN-074253 NVN-074254 Tiered Doc...

  9. NVN-091276 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20121025 Relevant Numbers Lead Agency Doc Number Serial Number NVN-091276 Lease Numbers NVN-083928 NVN-085708 Tiered Doc DOI-NV-W010-2012-0061...

  10. Microsoft Word - 6-19-06 TEC NOTES.doc

    Office of Environmental Management (EM)

    48D7DF19-707E-28B27A.doc Microsoft Word - 48D7DF19-707E-28B27A.doc Microsoft Word - 48D7DF19-707E-28B27A.doc (126.75 KB) More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - GSP_Charter.doc Department of Energy

    564M_Biomass_Project Descriptions FINAL 120409 Microsoft Word - 564M_Biomass_Project Descriptions FINAL 120409 Microsoft Word - 564M_Biomass_Project Descriptions FINAL 120409 (100.66

  11. Microsoft Word - S03273_Rev1.doc

    Office of Legacy Management (LM)

    Surface, Hot Creek Valley, Nevada, for Calendar Year 2007 September 2008 Rev. 1 DOE-LM/1558-2007 This page intentionally left blank DOE-LM/1558-2008 Post-Closure Inspection and Monitoring Report for Corrective Action Unit 417: Central Nevada Test Area Surface, Hot Creek Valley, Nevada for Calendar Year 2007 September 2008 Rev. 1 This page intentionally left blank U.S. Department of Energy CY 2007 Post-Closure Inspection & Monitoring Report for CAU 417 September 2008, Rev. 1 Doc. No. S0327300

  12. Microsoft Word - S05069_ROD.doc

    Office of Legacy Management (LM)

    Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 LMS/LEH/S05069 This page intentionally left blank LMS/LEH/S05069 Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 This page intentionally left blank U.S. Department of Energy ROD for DOE Areas for LEHR September 2009 Doc. No. S05069, Rev. 0 Page i Contents Acronyms and Abbreviations

  13. Microsoft Word - U0194500July2005.doc

    Office of Legacy Management (LM)

    4500 GJO-2004-579-TAC Office of Legacy Management Refinement of Conceptual Model and Recommendations for Improving Remediation Efficiency at the Shiprock, New Mexico, Site July 2005 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Conceptual Model Refinement and Efficiency Recommendations July 2005 Doc. No.

  14. Microsoft Word - Report Cover.doc

    Office of Environmental Management (EM)

    on Smart Grid RFI RedSeal Systems, Inc. 1 October 29, 2010 Office of Electricity Delivery and Energy Reliability US Department of Energy Room 8H033 1000 Independence Avenue, SW Washington, DC 20585 Re: Comments on "Smart Grid RFI: Addressing Policy and Logistical Challenges" 75 FR 57006 [FR Doc. 2010-23251] From: Steve Dauber Vice-President, Marketing RedSeal Systems 2121 South El Camino Real, Suite 300 San Mateo, CA 94403 Ph: 650-645-6209 RedSeal

  15. NVN-085710 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Decision Document Date 20080818 Relevant Numbers Lead Agency Doc Number NV-08-08-006 Serial Number NVN-085710 Documents Serial Register Page: NVN-085710 - SRP.pdf Retrieved from...

  16. NVN-085711 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Decision Document Date 20080818 Relevant Numbers Lead Agency Doc Number NV-08-08-007 Serial Number NVN-085711 Documents Serial Register Page: NVN-085711 - SRP.pdf Retrieved from...

  17. pocforms06a0399.doc | Department of Energy (indexed) [DOE]

    More Documents & Publications fleetappforms04f1298.doc&0; OPC Security Whitepaper 3Hardening Guidelines for OPC Hosts Critical Decision 2 (CD-2) Approval Template...

  18. transcript_jedi_model.doc | Department of Energy (indexed) [DOE]

    document icon transcriptjedimodel.doc More Documents & Publications TAP Webcast Transcript July-29, 2009 Scenario Jedi Tools for Designing & Implementing Better Finance Programs

  19. Microsoft Word - al2006-12.doc | Department of Energy (indexed) [DOE]

    Microsoft Word - al2006-12.doc More Documents & Publications Acquisition Letter No. AL 2008-02 Department of Energy Special Report: DOEIG-0934...

  20. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    A NRC Concurrence with Completion of Remedial Action This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page A-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No.

  1. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    Real Estate Documentation This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page B-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page B-6

  2. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    Agency Notification Agreements This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page E-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008

  3. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    09 Doc. No. S05767 Page A-1 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page A-2 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page A-3 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page A-4 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009

  4. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    Response to Comments This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page G-1 Well Completion Report for CAU 443 CNTA U.S. Department of Energy Doc. No. S05827 December 2009 Page G-2 U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page G-3 Well Completion Report for CAU 443 CNTA U.S. Department of Energy Doc. No. S05827 December 2009 Page G-4

  5. Enter the Post-Doc: The Untapped Sourcing Pipeline

    SciTech Connect (OSTI)

    Boscow, Ryan B.


    This article addresses the potential formulation and utilization of an industry-based Post-Doc program in order to create workforce candidate pipelines with targeted universities.

  6. Effectiveness of a Diesel Oxidation Catalyst (DOC) to control...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion Effectiveness of a ...

  7. Microsoft Word - 8E2A4440.doc (indexed) [DOE]

    48D7DF19-707E-28B27A.doc (126.75 KB) More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - GSP_Charter.doc

    Grant Amount Non-Fed Amount Project Location (City) Project Location (State) Description 1) Pilot and Demonstration Scale FOA - Pilot Scale Algenol Biofuels Inc. $25,000,000 $33,915,478 Freeport TX This project will make ethanol directly from carbon dioxide and seawater using algae. The

  8. Microsoft Word - AL2006-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon Microsoft Word - AL2006-09.doc More Documents & Publications Microsoft PowerPoint - Executive Order13423rbl Sample Contract Language for Construction Using ...

  9. Microsoft Word - S05837_FFA 4th qtr 09.doc

    Office of Legacy Management (LM)

    ... - - - -- - -- -- ,Additional Quarterly Sun*cillancc RcquircHcnts Note: All ... Sites FFA Quarterly Report: July 1-September 30, 2009 U.S. Department of Energy Doc. No. ...

  10. Microsoft Word - DOE_Staffing_Study_Cover.doc | Department of...

    Office of Environmental Management (EM)

    Word - DOEStaffingStudyCover.doc More Documents & Publications 2010 DOE Strategic Sustainability Performance Plan - Report to the White House Council on Environmental...

  11. Microsoft Word - FFATA Memo 30 March 2007.doc | Department of... (indexed) [DOE]

    FFATA Memo 30 March 2007.doc More Documents & Publications Policy Flash 2014-35 Rescission of American Recovery and Reinvestment Act Reporting Requirements. Flash2008-44attachment....

  12. Microsoft Word - S04268_Mar07 thru Mar08.doc

    Office of Legacy Management (LM)

    ... molybdenum, nitrate, selenium, sulfate, and uranium (DOE 1999). Restoration standards (see Table 1) for these Tuba City Annual Performance Evaluation U.S. Department of Energy Doc. ...

  13. Doc Cambell's Post Greenhouse Low Temperature Geothermal Facility...

    Open Energy Information (Open El) [EERE & EIA]

    Low Temperature Geothermal Facility Facility Doc Cambell's Post Sector Geothermal energy Type Greenhouse Location Las Cruces, New Mexico Coordinates 32.3123157,...

  14. Microsoft Word - AcqGuide71pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1pt1.doc Microsoft Word - AcqGuide71pt1.doc PDF icon Microsoft Word - AcqGuide71pt1.doc More Documents & Publications Chapter 71 - Review and Approval of Contract and Financial ...

  15. Microsoft Word - AcqGuide7pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    pt1.doc Microsoft Word - AcqGuide7pt1.doc ACQUISITION PLANNING PDF icon Microsoft Word - AcqGuide7pt1.doc More Documents & Publications ACQUISITION PLANNING Policy Flash 2015-13 ...

  16. Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc | Department...

    Energy Savers

    ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc More Documents & Publications Microsoft Word -...

  17. Microsoft Word - Flash2009dashxxFAC34.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc More Documents & Publications Federal Acquisition Regulation; Federal...

  18. Microsoft Word - Flash2008-08attachmentFAC22.doc | Department...

    Energy Savers

    Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc More Documents & Publications Policy Flash 2013-75...

  19. Microsoft Word - Flash2007-61FACAttachment.doc | Department of...

    Energy Savers

    Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc More Documents & Publications Microsoft Word -...

  20. Microsoft Word - PolicyFlash2007-10Attch2.doc | Department of...

    Energy Savers

    PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc More Documents & Publications Policy Flash 2013-37 Federal...

  1. Microsoft Word - Policy Flash 2008-02.doc | Department of Energy

    Energy Savers

    Microsoft Word - Policy Flash 2008-02.doc Microsoft Word - Policy Flash 2008-02.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  2. Microsoft Word - Policy Flash 2008-03.doc | Department of Energy

    Energy Savers

    Microsoft Word - Policy Flash 2008-03.doc Microsoft Word - Policy Flash 2008-03.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  3. Microsoft Word - NationalPolicyAssurances5-06.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    NationalPolicyAssurances5-06.doc Microsoft Word - NationalPolicyAssurances5-06.doc PDF icon Microsoft Word - NationalPolicyAssurances5-06.doc More Documents & Publications ...

  4. Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc |...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Press Release RECOMP 2-8-08 REV FINAL.doc Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc PDF icon Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc More ...

  5. Microsoft Word - FY10PropertyBSCFed.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PropertyBSCFed.doc Microsoft Word - FY10PropertyBSCFed.doc PDF icon Microsoft Word - FY10PropertyBSCFed.doc More Documents & Publications Microsoft Word - FY09PropertyBSCContractor...

  6. Microsoft Word - DP_cover_and_front matter_R1_Draft_3.DOC | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    R1Draft3.DOC Microsoft Word - DPcoverandfront matterR1Draft3.DOC PDF icon Microsoft Word - DPcoverandfront matterR1Draft3.DOC More Documents & Publications Microsoft ...

  7. Microsoft Word - ARRAGuideAttachment10v1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ARRAGuideAttachment10v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - DRAFT CRB Interview Guidance

  8. T-527: OpenSC Smart Card Serial Number Multiple Buffer Overflow Vulnerabilities [DOE]

    OpenSC is prone to multiple buffer-overflow vulnerabilities because the application fails to perform adequate boundary checks on user-supplied input. Attackers may leverage these issues to execute arbitrary code in the context of the application. Failed attacks will cause denial-of-service conditions.

  9. DOE HR Guidebook 12_15_05.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    HR Guidebook 12_15_05.DOC&#0; DOE HR Guidebook 12_15_05.DOC&#0; DOE HR Guidebook 12_15_05.DOC&#0; (8.6 MB) More Documents & Publications Operating Guidelines Appendix A B.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; Operating Guidelines Appendix C D.DOC&#0;

  10. Project Summary-TES-SNL.doc. (Conference) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Project Summary-TES-SNL.doc. Citation Details In-Document Search Title: Project Summary-TES-SNL.doc. Abstract not provided. Authors: Siegel, Nathan Phillip Publication Date: ...

  11. Microsoft Word - US_Japan_REE_agenda_ver7.doc | Department of...

    Office of Environmental Management (EM)

    Microsoft Word - USJapanREEagendaver7.doc Microsoft Word - USJapanREEagendaver7.doc U.S. - Japan Roundtable on Rare Earth Elements Research PDF icon Microsoft Word -...

  12. Microsoft Word - FY11 DNWD Budget CJ_Draft_20100124.doc

    Energy Savers

    PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor.doc (59.07 KB) More Documents & Publications Microsoft Word - FY09PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCFed

    PropertyBSCFed.doc Microsoft Word - FY10PropertyBSCFed.doc Microsoft Word - FY10PropertyBSCFed.doc (59.02 KB) More Documents & Publications Microsoft Word - FY09PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor


  13. A component analysis based on serial results analyzing performance of parallel iterative programs

    SciTech Connect (OSTI)

    Richman, S.C.


    This research is concerned with the parallel performance of iterative methods for solving large, sparse, nonsymmetric linear systems. Most of the iterative methods are first presented with their time costs and convergence rates examined intensively on sequential machines, and then adapted to parallel machines. The analysis of the parallel iterative performance is more complicated than that of serial performance, since the former can be affected by many new factors, such as data communication schemes, number of processors used, and Ordering and mapping techniques. Although the author is able to summarize results from data obtained after examining certain cases by experiments, two questions remain: (1) How to explain the results obtained? (2) How to extend the results from the certain cases to general cases? To answer these two questions quantitatively, the author introduces a tool called component analysis based on serial results. This component analysis is introduced because the iterative methods consist mainly of several basic functions such as linked triads, inner products, and triangular solves, which have different intrinsic parallelisms and are suitable for different parallel techniques. The parallel performance of each iterative method is first expressed as a weighted sum of the parallel performance of the basic functions that are the components of the method. Then, one separately examines the performance of basic functions and the weighting distributions of iterative methods, from which two independent sets of information are obtained when solving a given problem. In this component approach, all the weightings require only serial costs not parallel costs, and each iterative method for solving a given problem is represented by its unique weighting distribution. The information given by the basic functions is independent of iterative method, while that given by weightings is independent of parallel technique, parallel machine and number of processors.

  14. Microsoft Word - Appendix M_ContingencyTrees.doc

    Office of Legacy Management (LM)

    M Groundwater Operable Unit Contingency Trees U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page M-3 Figure M-1. Validation and Statistical Evaluation Scheme Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page M-4 Figure M-2. Decision Tree for Objective 1 Data U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page M-5 Figure M-3. Decision Tree for Objective 2 Data Weldon

  15. Microsoft Word - Annual Report 2006_Final.doc (indexed) [DOE]

    AcqGuide37pt1 binney Nov 2010 (201 KB) More Documents & Publications Chapter 37 - Service Contracting AcqGuide37pt1.doc&#0; Special Review: OAS-M-15-05

    AcqGuide70pt31A.doc (30.08 KB) More Documents & Publications AcqGuide70pt31.doc&#0; Acquisition Guide Chapter 70.31A - Costs Associated with Whistleblower Actions Acquisition Letter No. AL-2016-06

    0, Small Business Programs - An Overview Guiding Principles It is the policy of the Department of Energy to provide maximum

  16. Microsoft Word - 2007 NESHAP Final with Signature page.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    2005 FOIA ANNUAL REPORT.doc Microsoft Word - 2005 FOIA ANNUAL REPORT.doc report2005.pdf Microsoft Word - 2005 FOIA ANNUAL REPORT.doc (45.24 KB) More Documents & Publications U.S. Department of Energy 2008 Annual FOIA Report Office of Information Resources (MA-90) ANNUAL FOIA REPORT FOR 2009

    trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation, or favoring by the U.S. Government or any agency thereof. Available for sale to the

  17. Microsoft Word - frm-1901rev1.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Form FRM-1901 ASBESTIFORM SHIPMENT NOTIFICATION Fax to (702) 295-1153 02/14/08 Rev. 01 Page 1 of 1 The generator signed below shall submit this notification to NNSA/NSO at least seven days in advance of arrival of shipment of Asbestiform low-level waste to the Area 5 Radioactive Waste Management Site (RWMS). Generator: Generator Address: Generator Telephone Number: Fax Number: Transporter Name: Transporter Address: Transporter Telephone Number: Fax Number: Waste Stream Identification Number:

  18. In meso in situ serial X-ray crystallography of soluble and membrane...

    Office of Scientific and Technical Information (OSTI)

    In meso in situ serial X-ray crystallography of soluble and membrane proteins Citation Details In-Document Search Title: In meso in situ serial X-ray crystallography of soluble and ...

  19. Microsoft Word - S05993_CY2009 Annual Rpt.doc

    Office of Legacy Management (LM)

    ... of Site Surveillance and Maintenance Activities-CY 2009 U.S. Department of Energy Doc. No. ... Purpose Approval Date Status as of December 31, 2009 Phase II and III Upgrades to Solar ...

  20. Microsoft Word - ex1b-ITER-mar07.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    B - Patent Rights - Acquisition by the Government - ITER UT-B Contracts Div March 2007 Page 1 of 6 ex1b-ITER-mar07.doc Exhibit 1B ITER Ref: DEAR 952.227-13 PATENT RIGHTS - ...

  1. Microsoft Word - AL2005-13.doc | Department of Energy (indexed) [DOE]

    Microsoft Word - AL2005-13.doc More Documents & Publications PBA2007 Presentation-short-6-19-07DOE&0; Accident Investigation of the February 7, 2013, Scissor Lift Accident in the...

  2. Microsoft Word - S08266_App_A-3.doc

    Office of Legacy Management (LM)

    Score 0 Fernald Preserve, Ohio, Wetland Mitigation Monitoring Report U.S. Department of Energy Doc. No. S08266 Appendix A-3, 2011 Amphibian Index of Biotic Integrity Data...

  3. Microsoft Word - Appendix B_RiskAssessmenr.doc

    Office of Legacy Management (LM)

    ... U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page ... if ingested at frequencies and amounts similar to those of residential use (DOE 1997). ...

  4. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    NRC Technical Evaluation Report on Revised LTSP This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. ...

  5. Microsoft Word - N01058_LTSM Plan.doc

    Office of Legacy Management (LM)

    ... for the Pinellas Site U.S. Department of Energy Doc. No. ... replaced by an aboveground system that currently is in use (DOE 1997b). The Old Drum Storage Site is located at the ...

  6. Microsoft Word - VI_12_Degrees Awarded 2015.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    nuclear systems A. Bonasera Post Doc. at INFN - Laboratori Nazionali del Sud, Catania, Italy STUDENTS WHO RECEIVED GRADUATE DEGREES FROM NON-THESIS April 1, 2014 - March 31, 2015 ...

  7. Microsoft Word - Appendix D_LegalDescription.doc

    Office of Legacy Management (LM)

    for the Chemical Plant Area Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page D-4 Legal Description for the Chemical Plant Area All that ...

  8. Microsoft Word - Appendix G_DistributionList.doc

    Office of Legacy Management (LM)

    ... Jefferson City, MO 65102-0180 Ms. Cynthia Green, Realty Specialist Missouri Department of ... Jefferson City, MO 65102 Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. ...

  9. Microsoft Word - S04801_Avian2008 _2_ revised.doc

    Office of Legacy Management (LM)

    ... Swallows were observed throughout the spring and summer. Violet-green, Barn, and Cliff ... Avian Wetland Surveys at Monticello Mill Tailing Site, 2008 U.S. Department of Energy Doc. ...

  10. Petascale Post-Doc Project a Supercomputing Success Story

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Petascale Post-Doc Project a Supercomputing Success Story Petascale Post-Doc Project a Supercomputing Success Story ARRA-funded program takes petascale computing researchers to the next level March 24, 2014 Contact: Kathy Kincade, +1 510 495 2124, petascalepostdocs.jpg From left: Jihan Kim, Filipe Maia, Alice Koniges, Robert Preissl, Brian Austin, Wangyi (Bobby) Liu , Kirsten Fagnan and Praveen Narayanan. The first post-doctoral research project centered at the Department of

  11. FAQs Docs for the Buy American Provision | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAQs Docs for the Buy American Provision FAQs Docs for the Buy American Provision These documents answer the most frequently asked questions about the Buy American Provision. International Trade Agreements and the Recovery Act Buy American Provisions: Frequently Asked Questions (57.16 KB) Computer Hardware and Software: Frequently Asked Questions (50.6 KB) More Documents & Publications Questions and Answers for the Smart Grid Investment Grant Program: Buy American Buy American Guidance

  12. Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc [DOE]

    Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

  13. Microsoft Word - AcqGuide70pt31A.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AcqGuide70pt31A.doc Microsoft Word - AcqGuide70pt31A.doc PDF icon Microsoft Word - AcqGuide70pt31A.doc More Documents & Publications AcqGuide70pt31.doc&0; Policy Flash 2014-26...

  14. DOC-DOE China Mission Announcement Press Release | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    China Mission Announcement Press Release DOC-DOE China Mission Announcement Press Release DOC-DOE China Mission Announcement Press Release DOC-DOE China Mission Announcement Press Release (34.5 KB) More Documents & Publications DOC-DOE Joint China Mission Statement China 2015 Business Development Mission Marketing Flyer DOE-LPO_Email-Update_001_Through_11

  15. Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

    Office of Energy Efficiency and Renewable Energy (EERE)

    Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

  16. Microsoft Word - GC Mediation Evaluation _2-06-09_.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy GC Mediation Evaluation _2-06-09_.doc Microsoft Word - GC Mediation Evaluation _2-06-09_.doc Microsoft Word - GC Mediation Evaluation _2-06-09_.doc (29.87 KB) More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc HQ Mediation Program Brochure Microsoft Word - DRAFT CRB Interview Guidance

  17. Microsoft Word - National Science Bowl Fact Sheet.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy National Science Bowl Fact Sheet.doc Microsoft Word - National Science Bowl Fact Sheet.doc Microsoft Word - National Science Bowl Fact Sheet.doc (244.47 KB) More Documents & Publications Microsoft Word - National Science Bowl Fact Sheet.doc Idaho Operations AMWTP Fact Sheet Heating Ventilation and Air Conditioning Efficiency

  18. Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy PPL 970-Materials and Inventory 5-9-05.doc Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc (22.24 KB) More Documents & Publications Microsoft Word - al95-06.doc DOE-HDBK-1139-2006 ppl970-3.pdf

  19. Accounting for partiality in serial crystallography using ray-tracing principles

    SciTech Connect (OSTI)

    Kroon-Batenburg, Loes M. J. Schreurs, Antoine M. M.; Ravelli, Raimond B. G.; Gros, Piet


    Serial crystallography generates partial reflections from still diffraction images. Partialities are estimated with EVAL ray-tracing simulations, thereby improving merged reflection data to a similar quality as conventional rotation data. Serial crystallography generates ‘still’ diffraction data sets that are composed of single diffraction images obtained from a large number of crystals arbitrarily oriented in the X-ray beam. Estimation of the reflection partialities, which accounts for the expected observed fractions of diffraction intensities, has so far been problematic. In this paper, a method is derived for modelling the partialities by making use of the ray-tracing diffraction-integration method EVAL. The method estimates partialities based on crystal mosaicity, beam divergence, wavelength dispersion, crystal size and the interference function, accounting for crystallite size. It is shown that modelling of each reflection by a distribution of interference-function weighted rays yields a ‘still’ Lorentz factor. Still data are compared with a conventional rotation data set collected from a single lysozyme crystal. Overall, the presented still integration method improves the data quality markedly. The R factor of the still data compared with the rotation data decreases from 26% using a Monte Carlo approach to 12% after applying the Lorentz correction, to 5.3% when estimating partialities by EVAL and finally to 4.7% after post-refinement. The merging R{sub int} factor of the still data improves from 105 to 56% but remains high. This suggests that the accuracy of the model parameters could be further improved. However, with a multiplicity of around 40 and an R{sub int} of ∼50% the merged still data approximate the quality of the rotation data. The presented integration method suitably accounts for the partiality of the observed intensities in still diffraction data, which is a critical step to improve data quality in serial crystallography.

  20. Microsoft Word - AAFS_Proposal_VB.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    PROPOSAL FACT SHEET PAC cycle: (Do not complete) Date: Assigned Experiment Number Title: Experiment Spokesperson and Alternate: Telephone and...

  1. Request Number:

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    3023307 Name: Madeleine Brown Organization: nJa Address: --- -------- -------- -- Country: Phone Number: United States Fax Number: n/a E-mail: --- -------- --------_._------ --- Reasonably Describe Records Description: Please send me a copy of the emails and records relating to the decision to allow the underage son of Bill Gates to tour Hanford in June 2010. Please also send the emails and records that justify the Department of Energy to prevent other minors from visiting B Reactor. Optional

  2. Request Number:

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    1074438 Name: Gayle Cooper Organization: nla Address: _ Country: United States Phone Number: Fax Number: nla E-mail: . ~===--------- Reasonably Describe Records Description: Information pertaining to the Department of Energy's cost estimate for reinstating pension benefit service years to the Enterprise Company (ENCO) employees who are active plan participants in the Hanford Site Pension Plan. This cost estimate was an outcome of the DOE's Worker Town Hall Meetings held on September 17-18, 2009.

  3. Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy NationalPolicyAssurancesAwardTermsFinal81804.doc Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc (31.13 KB) More Documents & Publications Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc National Policy Assurances to be Incorporated as Award Terms Microsoft Word - NationalPolicyAssurances5-06.doc

  4. Fixed target matrix for femtosecond time-resolved and in situ serial micro-crystallography


    Mueller, C.; Marx, A.; Epp, S. W.; Zhong, Y.; Kuo, A.; Balo, A. R.; Soman, J.; Schotte, F.; Lemke, H. T.; Owen, R. L.; et al


    We present a crystallography chip enabling in situ room temperature crystallography at microfocus synchrotron beamlines and X-ray free-electron laser (X-FEL) sources. Compared to other in situ approaches, we observe extremely low background and high diffraction data quality. The chip design is robust and allows fast and efficient loading of thousands of small crystals. The ability to load a large number of protein crystals, at room temperature and with high efficiency, into prescribed positions enables high throughput automated serial crystallography with microfocus synchrotron beamlines. In addition, we demonstrate the application of this chip for femtosecond time-resolved serial crystallography at the Linacmore » Coherent Light Source (LCLS, Menlo Park, California, USA). As a result, the chip concept enables multiple images to be acquired from each crystal, allowing differential detection of changes in diffraction intensities in order to obtain high signal-to-noise and fully exploit the time resolution capabilities of XFELs.« less

  5. An automated voxelized dosimetry tool for radionuclide therapy based on serial quantitative SPECT/CT imaging

    SciTech Connect (OSTI)

    Jackson, Price A.; Kron, Tomas; Beauregard, Jean-Mathieu; Hofman, Michael S.; Hogg, Annette; Hicks, Rodney J.


    Purpose: To create an accurate map of the distribution of radiation dose deposition in healthy and target tissues during radionuclide therapy.Methods: Serial quantitative SPECT/CT images were acquired at 4, 24, and 72 h for 28 {sup 177}Lu-octreotate peptide receptor radionuclide therapy (PRRT) administrations in 17 patients with advanced neuroendocrine tumors. Deformable image registration was combined with an in-house programming algorithm to interpolate pharmacokinetic uptake and clearance at a voxel level. The resultant cumulated activity image series are comprised of values representing the total number of decays within each voxel's volume. For PRRT, cumulated activity was translated to absorbed dose based on Monte Carlo-determined voxel S-values at a combination of long and short ranges. These dosimetric image sets were compared for mean radiation absorbed dose to at-risk organs using a conventional MIRD protocol (OLINDA 1.1).Results: Absorbed dose values to solid organs (liver, kidneys, and spleen) were within 10% using both techniques. Dose estimates to marrow were greater using the voxelized protocol, attributed to the software incorporating crossfire effect from nearby tumor volumes.Conclusions: The technique presented offers an efficient, automated tool for PRRT dosimetry based on serial post-therapy imaging. Following retrospective analysis, this method of high-resolution dosimetry may allow physicians to prescribe activity based on required dose to tumor volume or radiation limits to healthy tissue in individual patients.

  6. Microsoft Word - AL2006-08.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    (071206) NUMBER DATE SUBJECT 2002-06 081402 Domestic and Foreign Procurement Preference Rules 2002-08 120202 Project Labor Agreements 2005-04 110204 Class Deviation to ...

  7. Microsoft Word - Appendix G.doc

    Office of Legacy Management (LM)

    ... to batch release (unless an emergency release is warranted). ... As a practical matter, the planning and design work will ... conditions would present a number of logistical problems. ...

  8. Microsoft Word - fellows_nomination_reworked.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    for each individual nomination Candidate Last Name: First Name: Middle Initial: Z Number: Organization: Phone: Mail Stop: Email Address: Nominator Last Name: First Name:...

  9. Microsoft Word - Highlights Bullets.doc

    Gasoline and Diesel Fuel Update

    ... or commercial-sector generators to third parties, ... National Oceanic and Atmospheric Administration; Federal ... number in this table is net of re-injection and water cut. ...

  10. Microsoft Word - U0192600_January 2004.doc

    Office of Legacy Management (LM)

    Number U0192600 Contents DOEOffice of Legacy Management Tuba City Semi-Annual ... Performance Evaluation DOEOffice of Legacy Management Page iv January 2004 Figure 11a. ...

  11. Microsoft Word - 20050821_Appendix_A.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    0. U.S. Number of Vehicles, Vehicle-Kilometers, Motor Fuel Consumption and Expenditures, 2001 ENERGY INFORMATION ADMINISTRATION HOUSEHOLD VEHICLES ENERGY USE: LATEST A N D TRENDS...

  12. Microsoft Word - pfam5000_revised.doc

    Office of Scientific and Technical Information (OSTI)

    ... The mean subfamily size is 8, and the largest subfamily, from the Pfam family HVCcapsid (hepatitis C virus capsid protein), contains 1236 sequences. 15 Figure 7: Number of ...

  13. (Document Number)

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    A TA-53 TOUR FORM/RADIOLOGICAL LOG (Send completed form to MS H831) _____________ _____________________________ _________________________________ Tour Date Purpose of Tour or Tour Title Start Time and Approximate Duration ___________________________ ______________ _______________________ _________________ Tour Point of Contact/Requestor Z# (if applicable) Organization/Phone Number Signature Locations Visited: (Check all that apply, and list any others not shown. Prior approval must be obtained

  14. Property:NEPA FundingAgencyDocNumber | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    + DOEEA-1676 + N NV-020-03-26 + DE-PS07-02ID14264 + O One Nevada + NA + S Sigurd Red Butte No2 + NA + Retrieved from "http:en.openei.orgwindex.php?titleProperty:NEPAF...

  15. Associate Research Physicist (Post-doc) - NSTX-U | Princeton Plasma Physics

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Lab (Post-doc) - NSTX-U Department: Experimental Supervisor(s): Dr. Luis F. Delgado-Aparicio Staff: RM 1 Requisition Number: 1600451 The Princeton University Plasma Physics Laboratory (PPPL) seeks to fill a post-doctoral research physicist position at the National Spherical Torus Experiment Upgrade (NSTX-U) in Princeton, NJ. For tokamaks and future facilities to operate safely in a high-pressure long-pulse discharge, it is imperative to address key issues associated with impurity sources,

  16. Microsoft Word - 090713HanfordARRAupdate.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Backgrounder Contacts: July 13, 2009 Geoff Tyree, DOE (509) 376-4171, Cameron Hardy, DOE (509) 376-5365, Update on Hiring and Recovery Act Funding at the Hanford Site, Richland Operations Office Projects Total Number of Jobs Saved/Created The total number of jobs saved to date with Recovery Act funding for DOE Richland Operations Office projects is approximately 300. The total number of jobs created to date is approximately 900. New Hires in June

  17. Microsoft Word - M088.SF30.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  18. Microsoft Word - M093.SF30.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  19. Microsoft Word - SF30 A062.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  20. Microsoft Word - M117 Melter.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  1. Microsoft Word - SF30 A056.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  2. Microsoft Word - SF30 A064.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  3. Microsoft Word - SF30 A061.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  4. Microsoft Word - M092.SF30.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  5. Microsoft Word - SF30 A070.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  6. Microsoft Word - SF30 A072.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  7. Microsoft Word - M128 Word _2_.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  8. Microsoft Word - SF30 A060.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  9. Microsoft Word - M068 SF 30.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  10. Microsoft Word - M071 SF 30.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  11. Microsoft Word - M069 SF 30.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  12. Microsoft Word - SF30 A058.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  13. Microsoft Word - SF30 A059.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  14. Microsoft Word - SF30 A074.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  15. Microsoft Word - M090.SF30.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  16. Microsoft Word - M091.SF30.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  17. Microsoft Word - M066 SF 30.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  18. Microsoft Word - ISDAC_orientation_pkt.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    If you have any questions please feel free to contact Debbie at 509.392.1854. Contents Cell Phone Numbers Fairbanks * Campaign Info Site Locations in Fairbanks Badging and Access ...

  19. Microsoft Word - M073 SF 30.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    history and information, etc.), which can be used to distinguish or trace an individual's identity, (e.g. name, social security numbers, date and place of birth, mother's maiden...

  20. Microsoft Word - Attachment A3.doc

    Office of Environmental Management (EM)

    A3 DRAWING NUMBER 51-W-214-W UNDERGROUND FACILITIES TYPICAL DISPOSAL PANEL Waste Isolation ... A3 Page A3-1 of 1 Drawing 51-W-214-W Underground Facilities Typical Disposal Panel 1

  1. M_16_01_05.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    0, 2402,11:26 AM Change Number M-16-01-05 Federal Facility Agreement and Consent Order Change Control Form Do not use blue ink. Type or print using black ink. Date 12312001...

  2. M_016_01_06.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    5 AM Change Number M-016-01-06 Federal Facility Agreement and Consent Order Change Control Form Do not use blue ink. Type or print using black ink. Date 123101 Originator Phone...

  3. CM200DL-Final.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    To reserve a CM200 session, go to, click on "Microscope Scheduling", use proposal number and password to log in. You may only sign up for one Core session at a ...

  4. Microsoft Word - knuteson-ro.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    ... The number of AERI observations used in the monthly statistics is shown in Figure 4 as a ... The opposite is true for the monthly statistics of the 10 m observed brightness ...

  5. Serial femtosecond X-ray diffraction of enveloped virus microcrystals


    Lawrence, Robert M.; Conrad, Chelsie E.; Zatsepin, Nadia A.; Grant, Thomas D.; Liu, Haiguang; James, Daniel; Nelson, Garrett; Subramanian, Ganesh; Aquila, Andrew; Hunter, Mark S.; et al


    Serial femtosecond crystallography (SFX) using X-ray free-electron lasers has produced high-resolution, room temperature, time-resolved protein structures. We report preliminary SFX of Sindbis virus, an enveloped icosahedral RNA virus with ~700 Å diameter. Microcrystals delivered in viscous agarose medium diffracted to ~40 Å resolution. Small-angle diffuse X-ray scattering overlaid Bragg peaks and analysis suggests this results from molecular transforms of individual particles. Viral proteins undergo structural changes during entry and infection, which could, in principle, be studied with SFX. This is a pertinent step toward determining room temperature structures from virus microcrystals that may enable time-resolved studies of enveloped viruses.

  6. Serial femtosecond X-ray diffraction of enveloped virus microcrystals

    SciTech Connect (OSTI)

    Lawrence, Robert M.; Conrad, Chelsie E.; Zatsepin, Nadia A.; Grant, Thomas D.; Liu, Haiguang; James, Daniel; Nelson, Garrett; Subramanian, Ganesh; Aquila, Andrew; Hunter, Mark S.; Liang, Mengning; Boutet, Sbastien; Coe, Jesse; Spence, John C. H.; Weierstall, Uwe; Liu, Wei; Fromme, Petra; Cherezov, Vadim; Hogue, Brenda G.


    Serial femtosecond crystallography (SFX) using X-ray free-electron lasers has produced high-resolution, room temperature, time-resolved protein structures. We report preliminary SFX of Sindbis virus, an enveloped icosahedral RNA virus with ~700 diameter. Microcrystals delivered in viscous agarose medium diffracted to ~40 resolution. Small-angle diffuse X-ray scattering overlaid Bragg peaks and analysis suggests this results from molecular transforms of individual particles. Viral proteins undergo structural changes during entry and infection, which could, in principle, be studied with SFX. This is a pertinent step toward determining room temperature structures from virus microcrystals that may enable time-resolved studies of enveloped viruses.

  7. Hi-speed versatile serial crate controller for CAMAC

    SciTech Connect (OSTI)

    Horelick, D.


    A serial crate controller, primarily for use in the SLC CAMAC control system, has been designed, and has been in use for about 2 years. The design supports a party line approach, with up to 16 crates on a single twisted pair for data transfers, plus another pair for prompt L response. The bit rate is 5 megabits/s, and complete transaction times of about 10 are achieved for 16-bit data transfers over cables up to 1000 feet long. One of the primary objects of the design was simplicity - there are approximately 60 chips in the two-board unit.

  8. First NESAP Post-doc Takes on BoxLib

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    First NESAP Post-doc Takes on BoxLib First NESAP Post-doc Takes on BoxLib Brian Friesen to Work with Ann Almgren's Group in CCSE June 22, 2015 brianfriesenphoto Brian Friesen, PhD The first of eight post-doctoral researchers participating in the NERSC Exascale Science Applications Program (NESAP) is now working full time at NERSC. Brian Friesen, a graduate student in computational astrophysics at the University of Oklahoma, joined the NESAP team May 18. He's been assigned to Ann Almgren's group

  9. Microsoft Word - AL-PO-0001-0007.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Authorized List Doc. ID: OP-AL-0001-007.doc Off-Hours Shift Operator Date: 2001/11/20 This policy is effective 11/20/2001 and denotes those individuals who have been authorized for Off-Hours Shift Operation. 1. Alderman, Steven 2. Aigeldinger, Georg 3. Baethke, Niko 4. Bauer, Benjamin 5. Brendebach, Boris 6. Day, Lorraine 7. Desta, Yohannes 8. Doomes, Edward 9. Dust, Reinhard 10. Farquar, George 11. Fluegge, Michael 12. Goettert, Jost 13. Koch, Kevin 14. Kong, Jong Ren 15. Lian, Kun 16. Ling,

  10. Microsoft Word - 1751a.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    This form shall be protected as LANS Employment Sensitive and/or LANS Employment Sensitive/PII when one or a combination of the following personal information is revealed in a LANS record: Education, salary, medical history, employment history, social security number, date and place of birth, or mother's maiden name. Form 1751a Revision Date: 1/14 Page 1 of 2 Section I: Employee Information Employee Name Z Number Date of Qualifying Event Mailing Address (New Hires or Change of Address Only)

  11. Microsoft Word - Append E waterlevels.doc

    Office of Legacy Management (LM)

    Groundwater Level Data Since 2000 This page intentionally left blank Groundwater Levels a ______________________________________________________________________________________________________ a Numbers in parentheses indicate elevation of bottom of well for dry measurements. ______________________________________________________________________________________________________ Well Id Collect Depth to Water Well Id Collect Depth to Water Date Water Elevation Date Water Elevation

  12. Microsoft Word - ex15-ITER-sept10.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    5 - Rights in Data-Special Works - ITER UT-B Contracts Div Sept 2010 Page 1 of 1 ex15-ITER-sept10.doc Exhibit 15-ITER Ref: FAR 52.227-17 RIGHTS IN DATA SPECIAL WORKS ITER ...

  13. Microsoft Word - FY07AnnualReport.doc | Department of Energy (indexed) [DOE]

    FY07AnnualReport.doc More Documents & Publications Microsoft Word - FY08AnnualReport.doc Audit Report: IG-0857 Attachment 5 Volume II Pricing Matrix.xls...

  14. Microsoft Word - 0-PEP-6-14-07.doc | Department of Energy

    Energy Savers

    Word - 0-PEP-6-14-07.doc Microsoft Word - 0-PEP-6-14-07.doc PSF.pdf More Documents & Publications Sample Project Execution Plan Project Execution Plan Review Module (RM) Microsoft...

  15. Microsoft Word - g413.3-10Final5-6-08.doc | Department of Energy

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    g413.3-10Final5-6-08.doc Microsoft Word - g413.3-10Final5-6-08.doc DOEEVMSGoldCardSep2011.pdf More Documents & Publications EVMS and Project Analysis Standard Operating...

  16. V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerabilit...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability June 25, 2013 - 12:41am Addthis PROBLEM: ...

  17. RFQ DE-RQ01-04ME90001.doc | Department of Energy

    Energy Savers

    DE-RQ01-04ME90001.doc&0; More Documents & Publications Ammendment 2.doc Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&0; Operating Guidelines Appendix A B...

  18. Ex Parte Memo - 09 02 Mtg-09.09.10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Parte Memo - 09 02 Mtg-09.09.10.doc Ex Parte Memo - 09 02 Mtg-09.09.10.doc Summary of ex parte meeting on energy efficiency standards PDF icon Ex Parte Memo - 09 02 ...

  19. Application to Export Electric Energy OE Doc No. EA-339-A Shell...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Doc No. EA-339-A Shell Energy North America (US), L.P. Application to Export Electric Energy OE Doc No. EA-339-A Shell Energy North America (US), L.P. Application from Shell Energy ...

  20. Microsoft Word - Actinin_Safinya.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    3 Structure of Actin Cross-linked with α-Actinin: A Network of Bundles Olivier Pelletier, Elena Pokidysheva, Linda S. Hirst, Nate Bouxsein, Youli Li and Cyrus R. Safinya Materials and Physics Departments, Biomolecular Science & Engineering Program, Materials Research Laboratory, University of California, Santa Barbara, California 93106 With the emerging proteomics era, the biosciences community is now challenged to elucidate the structures and functions of a large number of interacting

  1. Microsoft Word - CSC Scorecard.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Fee Determination Posting Requirements Office of Environmental Management Attachment 2 Award Fee Determination Scorecard Contractor: Computer Sciences Corporation (CSC) Contract: Occupational Health Services Contract Number: DE-AC06-04RL14383 Award Period: 10/01/2011 to 09/30/2012 Basis of Evaluation: Performance and Evaluation Plan (PEMP) for Period FY 2012 Award Fee Available: $916,130.00 Award Fee Earned: $824,517.00 (90%) Award Fee Area Adjectival Ratings: Performance Incentive Allocated

  2. Microsoft Word - FIA-12-0061.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    John P. Newton ) ) Filing Date: October 9, 2012 ) Case No.: FIA-12-0061 ) ) Issued: October 31, 2012 _______________ Decision and Order _______________ On October 9, 2012, John P. Newton ("Appellant") filed an Appeal from determinations issued to him on September 6, 2012, and September 12, 2012, by the Office of Information Resources (OIR) of the Department of Energy (DOE) (FOIA Request Numbers HQ-2012-01768-F & HQ-2012-01835-F). In those determinations, OIR responded to two

  3. Microsoft Word - UPDATE 4 - Unit 4.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    4 to: A Dispersion Modeling Analysis of Downwash from Mirant's Potomac River Power Plant Modeling Unit 4 Emissions at Maximum and Minimum Loads ENSR Corporation December 23, 2005 Document Number 10350-002-410 (Update 4) December, 2005 1-1 1.0 INTRODUCTION This report describes dispersion modeling performed for Unit 4 at Mirant's Potomac River Generating Station. The modeling was performed according to the Protocol approved by the Virginia Department of Environmental Quality. The purpose of the

  4. Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy National Policy AssurancesAwardTermsREVJuly2005.doc Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc (31.87 KB) More Documents & Publications Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc National Policy Assurances to be Incorporated as Award Terms Microsoft Word - NationalPolicyAssurances5-06

  5. Microsoft Word - Corp Impl | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Corp Impl Microsoft Word - Corp Impl Microsoft Word - Corp Impl (422.79 KB) More Documents & Publications ESTABLISHMENT OF MANAGEMENT DECISIONS ON OFFICE OF INSPECTOR GENERAL REPORTS, DOE O 221.3 Microsoft Word - AL2007-01.doc DOE Systems Engineering Methodology (SEM): Stage Exit V

  6. DOE/Grand Junction Office Bluewater LTSP July 1997 Doc. No. S00012AA...

    Office of Legacy Management (LM)

    DOEGrand Junction Office Bluewater LTSP July 1997 Doc. No. S00012AA, Page iii Contents Page 1.0 Introduction ......

  7. advanced_biofuels_pathways_webinar_alt_text.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    advanced_biofuels_pathways_webinar_alt_text.doc advanced_biofuels_pathways_webinar_alt_text.doc advanced_biofuels_pathways_webinar_alt_text.doc advanced_biofuels_pathways_webinar_alt_text.doc (113 KB) More Documents & Publications Sustainability for the Global Biofuels Industry: Minimizing Risks and Maximizing Opportunities Webinar Transcript "The Promise and Challenge of Algae as Renewable Sources of Biofuels" 9-8-2010 - Transcript NABC Webinar

  8. Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion [DOE]

    Performance of two commercially available DOCs with different precious metal loadings and Pt:Pd ratios were compared to model DOC containing Pt only

  9. NDRPProtocolTechBasisCompiled020705.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Basis Document for the Neutron Dose Reconstruction Project NEUTRON DOSE RECONSTRUCTION PROTOCOL Roger B. Falk, Joe M. Aldrich, Jerry Follmer, Nancy M. Daugherty, and Dr. Duane E. Hilmas Oak Ridge Institute of Science and Education and Dr. Phillip L. Chapman Department of Statistics, Colorado State University February 7, 2005 ORISE 05-0199 This document was produced under contract number DE-AC05-00OR22750 between the U.S. Department of Energy and Oak Ridge Associated Universities The authors of

  10. Microsoft Word - FAL2004-01.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Financial Assistance Letters (FALs) that remain in effect are identified below. All other previously issued FALs have been superseded by a formal rulemaking, incorporated into other guidance, and/or canceled. *************** Financial Assistance Letters Remaining in Effect Number Date Subject 96-01 03/08/96 Implementation Guidance on Sections 3001 and 3002 of EPAct 96-02 08/01/96 Implementation Guidance on Section 2306 of EPAct 97-05 12/18/97 Merit Review/Lobbying 2001-02 07/30/01 Preservation

  11. AcqGuide70pt5.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Acquisition Guide Chapter 70.3102-05-6 July 2016 Contractor Compensation - Variable Pay [Reference: FAR 31.205-6, DEAR 970.3102 -05-6, DOE Order 350.1] 1.0 Summary of Latest Changes This update: (1) changes the chapter number from 70.5 to 70.3102-05-6 to reflect the applicable FAR part, and (2) includes administrative changes. 2.0 Discussion This chapter supplements other more primary acquisition regulations and policies contained in the references above and should be considered in the context

  12. Microsoft Word - Q0032900-Aug-2004.doc

    Office of Legacy Management (LM)

    Q0032900 DOE-LM/GJ684-2004 Monticello Mill Tailings Site Operable Unit III Post-Record of Decision Monitoring Plan Draft Final August 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado Document Number Q0032900 Contents U.S. Department of Energy MMTS OU III Post-ROD Monitoring Plan August 2004 Draft Final Page iii Contents Page

  13. Microsoft Word - S06010_Ltr.doc

    Office of Legacy Management (LM)

    6010 Task Order LM00-502 Control Number 10-0184 January 21, 2010 U.S. Department of Energy Office of Legacy Management ATTN: Jack Craig Site Manager 3600 Collins Ferry Road Morgantown, WV 26505 SUBJECT: Rulison Long-Term Hydrologic Monitoring Program Sampling and Analysis Results for 2009 Dear Mr. Craig: The U.S. Department of Energy (DOE) Office of Legacy Management conducted annual sampling at the Rulison, Colorado, Site for the Long-Term Hydrologic Monitoring Program (LTHMP) on May 11 and 12,

  14. Microsoft Word - U0199700_August 2004.doc

    Office of Legacy Management (LM)

    9700 DOE-EM/GJ708-2004 Tuba City, Arizona, Land Management Project Site Semi-Annual Performance Evaluation September 2003 through February 2004 August 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy, Grand Junction, Colorado This page intentionally left blank Document Number U0199700 Contents U.S. Department of Energy Tuba City Semi-Annual Performance Evaluation August 2004 Page iii Contents 1.0 Introduction

  15. Microsoft Word - RNA_folding_Herschlag.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    March 2003 Exploring the Folding Landscape of a Structured RNA by SAXS Rick Russell, Ian S. Millett, Sebastian Doniach and Daniel Herschlag Stanford University One goal of genome projects is to systematically identify genes (1,2). The best current knowledge indicates that humans carry approximately 35000 genes. This number is an estimate that varies from expert to expert and range up to 100,000 (3-5). To anyone who has taken an elementary biology class, this ambiguity must seem strange. How hard

  16. Microsoft Word - Hurricane Analysis v11.doc

    Gasoline and Diesel Fuel Update

    The Impact of Tropical Cyclones on Gulf of Mexico Crude Oil and Natural Gas Production Table of Contents 1. Summary 2. Tropical Cyclones in the Gulf of Mexico 3. Tropical Cyclone Impacts on Gulf of Mexico Oil and Natural Gas Production and Refinery Operations 4. Forecasting Shut-In Production A. Model 1: Using the NOAA Forecast of the Atlantic ACE Index to Estimate Shut- In Production B. Model 2: Using the NOAA Forecast of the Number of Atlantic Tropical Cyclones to Estimate Shut-In Production

  17. Microsoft Word - ATVMLP template.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Advanced Technology Vehicles Manufacturing Loan Program 1 CORRECTION TO ATVMLP INTERIM FINAL RULE: The ATVM Loan Program would like to make note of the following error in the Interim Final Rule published in the Federal Register (Vol. 73, No. 219) on November 12, 2008: - On page 66728 Cargo Van fuel economy figures are incorrectly identified as: - 24.2 miles per gallon (mpg) for 2005 fuel economy average - 30.2 mpg for 2005 mpg x 125%. - The correct numbers are: - 19.9 mpg for 2005 fuel economy

  18. Microsoft Word - UPDATE 2 - Unit 1.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    2 to: A Dispersion Modeling Analysis of Downwash from Mirant's Potomac River Power Plant Modeling Unit 1 Emissions at Maximum and Minimum Loads ENSR Corporation December 20, 2005 Document Number 10350-002-410 (Update 2) December, 2005 1-1 1.0 INTRODUCTION This report describes AERMOD modeling results performed for Unit 1 at Mirant's Potomac River Generating Station. The purpose of these runs was to demonstrate that operation of Unit 1 for 24 hours a day at loads from 35 MW to 88 MW with the use

  19. Microsoft Word - Fact Sheet Environment 100808 FINAL.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Environment 100808 FINAL.doc Microsoft Word - Fact Sheet Environment 100808 FINAL.doc Microsoft Word - Fact Sheet Environment 100808 FINAL.doc (56.51 KB) More Documents & Publications Major Communications Report May 5, 2009 Major Communications Report April 30, 2009 Major Communications Report April 28, 2009

  20. Microsoft Word - va_Final3a_06-04-032.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    vaFinal3a06-04-032.doc Microsoft Word - vaFinal3a06-04-032.doc PDF icon Microsoft Word - vaFinal3a06-04-032.doc More Documents & Publications DOE F 473.2 Headquarters ...

  1. Microsoft Word - Bill's version 5-20-05.doc | Department of Energy

    Office of Environmental Management (EM)

    Bill's version 5-20-05.doc Microsoft Word - Bill's version 5-20-05.doc Microsoft Word - Bill's version 5-20-05.doc (717.91 KB) More Documents & Publications Audit Report: IG-0690 Audit Report: OAS-M-06-04 Audit Report: OAI-M-16-15

  2. Fact Sheet -- Climate VISION 02-12-031.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Fact Sheet -- Climate VISION 02-12-031.doc&#0; Fact Sheet -- Climate VISION 02-12-031.doc&#0; Fact Sheet -- Climate VISION 02-12-031.doc&#0; (28.89 KB) More Documents & Publications Meeting President Bush's Climate Change Challenge to Business and Industry Climate Vision Progress Report 2007 Climate VISION Progress Report 2007

  3. Microsoft Word - PressRelease_Siting_2-8-06_Final.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PressReleaseSiting2-8-06Final.doc Microsoft Word - PressReleaseSiting2-8-06Final.doc PDF icon Microsoft Word - PressReleaseSiting2-8-06Final.doc More Documents & ...

  4. Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    DOE E-Government Act Report 11.16.06 Final.doc Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc ...

  5. AcqGuide35pt1rev2.doc | Department of Energy

    Energy Savers

    AcqGuide35pt1rev2.doc&0; AcqGuide35pt1rev2.doc&0; AcqGuide35pt1rev2.doc&0; More Documents & Publications Attachment FY2011-58 OPAM Chapter 35 - Research and Development...

  6. Microsoft Word - ADR Revised Policy82508Reformatted.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy ADR Revised Policy82508Reformatted.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc (52.42 KB) More Documents & Publications ADR Policy Federal Register Document 2009 ECR FINAL REPORT 2010

  7. Microsoft Word - CHAP02ESH _REVISED1_3.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    CHAP02ESH _REVISED1_3.doc Microsoft Word - CHAP02ESH _REVISED1_3.doc Microsoft Word - CHAP02ESH _REVISED1_3.doc (183.77 KB) More Documents & Publications Regulatory Aspects of ISM COMMENTS&#0; A:\CHAP05PERFASSM(REVISED).PDF&#0;

  8. Serially connected solid oxide fuel cells having monolithic cores

    DOE Patents [OSTI]

    Herceg, Joseph E. (Naperville, IL)


    A solid oxide fuel cell for electrochemically combining fuel and oxidant for generating galvanic output, wherein the cell core has an array of cell segments electrically serially connected in the flow direction, each segment consisting of electrolyte walls and interconnect that are substantially devoid of any composite inert materials for support. Instead, the core is monolithic, where each electrolyte wall consists of thin layers of cathode and anode materials sandwiching a thin layer of electrolyte material therebetween. Means direct the fuel to the anode-exposed core passageways and means direct the oxidant to the cathode-exposed core passageways; and means also direct the galvanic output to an exterior circuit. Each layer of the electrolyte composite materials is of the order of 0.002-0.01 cm thick; and each layer of the cathode and anode materials is of the order of 0.002-0.05 cm thick. Between 2 and 50 cell segments may be connected in series.

  9. Serial femtosecond crystallography of soluble proteins in lipidic cubic phase


    Fromme, Raimund; Ishchenko, Andrii; Metz, Markus; Chowdhury, Shatabdi Roy; Basu, Shibom; Boutet, Sébastien; Fromme, Petra; White, Thomas A.; Barty, Anton; Spence, John C. H.; et al


    Serial femtosecond crystallography (SFX) at X-ray free-electron lasers (XFELs) enables high-resolution protein structure determination using micrometre-sized crystals at room temperature with minimal effects from radiation damage. SFX requires a steady supply of microcrystals intersecting the XFEL beam at random orientations. An LCP–SFX method has recently been introduced in which microcrystals of membrane proteins are grown and delivered for SFX data collection inside a gel-like membrane-mimetic matrix, known as lipidic cubic phase (LCP), using a special LCP microextrusion injector. Here, it is shown enabling a dramatic reduction in the amount of crystallized protein required for data collection compared with crystals deliveredmore » by liquid injectors. High-quality LCP–SFX data sets were collected for two soluble proteins, lysozyme and phycocyanin, using less than 0.1 mg of each protein.« less

  10. Microsoft Word - NMMSS News DEC 23 08 Update.doc

    National Nuclear Security Administration (NNSA)

    IS SPONSORED BY DOE AND NRC NMMSS news PUBLISHED PERIODICALLY BY & FOR NMMSS USERS December 23, 2008 SPECIAL EDITION NUREG/BR-0007, Rev.6 Published The NRC wishes to inform industry that it has published its update of NUREG/BR-0007. This NUREG was updated to reflect changes to NMMSS reports that become effective January 1, 2009. Link to the updated NUREG:

  11. Microsoft Word - Appendix E_InstiControls.doc

    Office of Legacy Management (LM)

    Institutional Control Documentation U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page E-iii Appendix E Institutional Control Documentation Notation on Ownership Record for Notification to Potential Owners of Contaminated Groundwater and Applied Restrictions Chemical Plant Site and Quarry Areas (Recorded Book 3754, Pages 419-424, St. Charles County, Missouri)................................E-1 Real Estate License, Groundwater Wells and Sampling on

  12. Microsoft Word - NO1113_Dewatering report.doc

    Office of Legacy Management (LM)

    Hydrologic Assessment of Dewatering for Installation of the Belcher Road Water Transmission Line This page intentionally left blank U.S. Department of Energy Dewatering Evaluation Report for Road Const. & Water Line Replacement June 2008 Doc. No. N0111300 Page C-3 The rate of pumping resulting from aquifer dewatering for installation of the planned water transmission line beneath Belcher Road is expected be larger than any of the discharge rates associated with drainage infrastructure

  13. Microsoft Word - S04877_AnnInspRpt2008.doc

    Office of Legacy Management (LM)

    Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2008 LMS/MNT/S04877 This page intentionally left blank LMS/MNT/S04877 2008 Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2008 This page intentionally left blank U.S. Department of Energy 2008 Annual Inspection-Monticello, Utah December 2008 Doc. No. S487700 Page i Contents Executive

  14. Microsoft Word - S04929_GW_Mon_NDEP_Final.doc

    Office of Legacy Management (LM)

    Groundwater Monitoring Report Central Nevada Test Area, Corrective Action Unit 443 March 2009 Rev. 1 LMS/CNT/S04929 This page intentionally left blank LMS/CNT/S04929 2008 Groundwater Monitoring Report Central Nevada Test Area, Corrective Action Unit 443 March 2009 Rev. 1 This page intentionally left blank U.S. Department of Energy 2008 Groundwater Monitoring Report-CNTA, CAU 443 March 2009 Doc. No. S04929 Rev. 1 Page i Contents 1.0

  15. Microsoft Word - S04932 History final.doc

    Office of Legacy Management (LM)

    FUSRAP History of the Chupadera Mesa, NM, Site December 2008 Doc. No. S0493200 (FUSRAP NM.04-5) Page 1 of 9 FUSRAP History of the Chupadera Mesa, NM, Site The following historical summary is provided to document the inclusion of the Chupadera Mesa, NM, Site into the Formerly Utilized Sites Remedial Action Program (FUSRAP). Although no remedial action was required, the site met eligibility criterion and was included under FUSRAP, under which the final radiological surveys were performed.

  16. Microsoft Word - S05378_2009 GW Rpt.doc

    Office of Legacy Management (LM)

    08 through April 2009 October 2009 LMS/MNT/S05378 This page intentionally left blank LMS/MNT/S05378 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report May 2008 through April 2009 October 2009 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report May 2008-April 2009 October 2009 Doc. No. S05378 Page i Contents

  17. Microsoft Word - S05551_1stqtr report.doc

    Office of Legacy Management (LM)

    09 July 2009 LMS/RFS/S05551 This page intentionally left blank LMS/RFS/S05551 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2009 July 2009 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2009 July 2009 Doc. No. S05551 Page i Contents

  18. Microsoft Word - S06528_1st qtr 2010.doc

    Office of Legacy Management (LM)

    10 July 2010 LMS/RFS/S06528 This page intentionally left blank LMS/RFS/S06528 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2010 July 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2010 July 2010 Doc. No. S06528 Page i Contents

  19. Microsoft Word - S07079_jul_sep_10.doc

    Office of Legacy Management (LM)

    July 1-September 30, 2010 October 2010 Doc. No. S07079 Page 1 Monticello, Utah, National Priorities List (NPL) Sites Federal Facilities Agreement (FFA) Quarterly Report: July 1-September 30, 2010 This report summarizes project status and activities implemented July through September 2010, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) Site. This report also includes disposal cell and Pond 4 leachate

  20. Microsoft Word - S08999_Apr11-Mar12.doc

    Office of Legacy Management (LM)

    1 Through March 2012 Tuba City, Arizona, Disposal Site July 2012 LMS/TUB/S08999 This page intentionally left blank LMS/TUB/S08999 Annual Groundwater Report April 2011 Through March 2012 Tuba City, Arizona, Disposal Site July 2012 This page intentionally left blank U.S. Department of Energy Tuba City Annual Groundwater Report-April 2011 through March 2012 July 2012 Doc. No. S08999 Page i Contents Abbreviations

  1. Microsoft Word - AppendixH_CommentResponse.doc

    Office of Legacy Management (LM)

    NFSS Vicinity Property Report October 2010 Doc. No. S06246 Page H-1 Responsiveness Summary The U.S. Department of Energy (DOE) released the Formerly Utilized Sites Remedial Action Program Niagara Falls Storage Site Vicinity Properties, New York: Review of Radiological Conditions at Six Vicinity Properties and Two Drainage Ditches on April 23, 2010, for public comment. Report availability was announced through a message to stakeholders sent on behalf of DOE by USACE. The announcement provided a

  2. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    2009 Revegetation Success Monitoring This page intentionally left blank 2009 Revegetation Success Monitoring Central Nevada Test Area Corrective Action Unit 417 UC-1 Central Mud Pit This page intentionally left blank U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc No. S05767 Page C-i Contents 1.0 Introduction and Purpose ..................................................................................................C-1 2.0 Monitoring

  3. Microsoft Word - S05775_2009 VMR.doc

    Office of Legacy Management (LM)

    Report for the Old and New Rifle, Colorado, Processing Sites September 2009 LMS/RFO/RFN/S05775 This page intentionally left blank LMS/RFO/RFN/S05775 2009 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2009 This page intentionally left blank U.S. Department of Energy 2009 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2009 Doc. No. S05775 Page i Contents

  4. Microsoft Word - S07012_RFL_2010_VMR_LEC.doc

    Office of Legacy Management (LM)

    Old and New Rifle, Colorado, Processing Sites September 2010 LMS/RFO/RFN/S07012 This page intentionally left blank LMS/RFO/RFN/S07012 2010 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2010 This page intentionally left blank U.S. Department of Energy 2010 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2010 Doc. No. S07012 Page i Contents

  5. Microsoft Word - S07033_2nd qtr 2010.doc

    Office of Legacy Management (LM)

    Second Quarter Calendar Year 2010 October 2010 LMS/RFS/S07033 This page intentionally left blank LMS/RFS/S07033 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities Second Quarter Calendar Year 2010 October 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-2nd Quarter CY 2010 October 2010 Doc. No. S07033 Page i Contents

  6. A novel inert crystal delivery medium for serial femtosecond crystallography

    SciTech Connect (OSTI)

    Conrad, Chelsie E.; Basu, Shibom; James, Daniel; Wang, Dingjie; Schaffer, Alexander; Roy-Chowdhury, Shatabdi; Zatsepin, Nadia A.; Aquila, Andrew; Coe, Jesse; Gati, Cornelius; Hunter, Mark S.; Koglin, Jason E.; Kupitz, Christopher; Nelson, Garrett; Subramanian, Ganesh; White, Thomas A.; Zhao, Yun; Zook, James; Boutet, Sébastien; Cherezov, Vadim; Spence, John C. H.; Fromme, Raimund; Weierstall, Uwe; Fromme, Petra


    Serial femtosecond crystallography (SFX) has opened a new era in crystallography by permitting nearly damage-free, room-temperature structure determination of challenging proteins such as membrane proteins. In SFX, femtosecond X-ray free-electron laser pulses produce diffraction snapshots from nanocrystals and microcrystals delivered in a liquid jet, which leads to high protein consumption. A slow-moving stream of agarose has been developed as a new crystal delivery medium for SFX. It has low background scattering, is compatible with both soluble and membrane proteins, and can deliver the protein crystals at a wide range of temperatures down to 4°C. Using this crystal-laden agarose stream, the structure of a multi-subunit complex, phycocyanin, was solved to 2.5 Å resolution using 300 µg of microcrystals embedded into the agarose medium post-crystallization. The agarose delivery method reduces protein consumption by at least 100-fold and has the potential to be used for a diverse population of proteins, including membrane protein complexes.

  7. A novel inert crystal delivery medium for serial femtosecond crystallography


    Conrad, Chelsie E.; Basu, Shibom; James, Daniel; Wang, Dingjie; Schaffer, Alexander; Roy-Chowdhury, Shatabdi; Zatsepin, Nadia A.; Aquila, Andrew; Coe, Jesse; Gati, Cornelius; et al


    Serial femtosecond crystallography (SFX) has opened a new era in crystallography by permitting nearly damage-free, room-temperature structure determination of challenging proteins such as membrane proteins. In SFX, femtosecond X-ray free-electron laser pulses produce diffraction snapshots from nanocrystals and microcrystals delivered in a liquid jet, which leads to high protein consumption. A slow-moving stream of agarose has been developed as a new crystal delivery medium for SFX. It has low background scattering, is compatible with both soluble and membrane proteins, and can deliver the protein crystals at a wide range of temperatures down to 4°C. Using this crystal-laden agarose stream, themore » structure of a multi-subunit complex, phycocyanin, was solved to 2.5 Å resolution using 300 µg of microcrystals embedded into the agarose medium post-crystallization. The agarose delivery method reduces protein consumption by at least 100-fold and has the potential to be used for a diverse population of proteins, including membrane protein complexes.« less

  8. Implications of the focal beam profile in serial femtosecond crystallography

    SciTech Connect (OSTI)

    Galli, Lorenzo; Chapman, Henry N.; Metcalf, Peter


    The photon density profile of an X-ray free-electron laser (XFEL) beam at the focal position is a critical parameter for serial femtosecond crystallography (SFX), but is difficult to measure because of the destructive power of the beam. A novel high intensity radiation induced phasing method (HIRIP) has been proposed as a general experimental approach for protein structure determination, but has proved to be sensitive to variations of the X-ray intensity, with uniform incident fluence desired for best performance. Here we show that experimental SFX data collected at the nano-focus chamber of the Coherent X-ray Imaging end-station at the Linac Coherent Light Source using crystals with a limited size distribution suggests an average profile of the X-ray beam that has a large variation of intensity. We propose a new method to improve the quality of high fluence data for HI-RIP, by identifying and removing diffraction patterns from crystals exposed to the low intensity region of the beam. The method requires crystals of average size comparable to the width of the focal spot.

  9. Serially connected solid oxide fuel cells having monolithic cores

    DOE Patents [OSTI]

    Herceg, J.E.


    Disclosed is a solid oxide fuel cell for electrochemically combining fuel and oxidant for generating galvanic output. The cell core has an array of cell segments electrically serially connected in the flow direction, each segment consisting of electrolyte walls and interconnect that are substantially devoid of any composite inert materials for support. Instead, the core is monolithic, where each electrolyte wall consists of thin layers of cathode and anode materials sandwiching a thin layer of electrolyte material therebetween. Means direct the fuel to the anode-exposed core passageways and means direct the oxidant to the cathode-exposed core passageways; and means also direct the galvanic output to an exterior circuit. Each layer of the electrolyte composite materials is of the order of 0.002 to 0.01 cm thick; and each layer of the cathode and anode materials is of the order of 0.002 to 0.05 cm thick. Between 2 and 50 cell segments may be connected in series.

  10. Automated matching and segmentation of lymphoma on serial CT examinations

    SciTech Connect (OSTI)

    Yan Jiayong; Zhao Binsheng; Curran, Sean; Zelenetz, Andrew; Schwartz, Lawrence H.


    In patients with lymphoma, identification and quantification of the tumor extent on serial CT examinations is critical for assessing tumor response to therapy. In this paper, we present a computer method to automatically match and segment lymphomas in follow-up CT images. The method requires that target lymph nodes in baseline CT images be known. A fast, approximate alignment technique along the x, y, and axial directions is developed to provide a good initial condition for the subsequent fast free form deformation (FFD) registration of the baseline and the follow-up images. As a result of the registration, the deformed lymph node contours from the baseline images are used to automatically determine internal and external markers for the marker-controlled watershed segmentation performed in the follow-up images. We applied this automated registration and segmentation method retrospectively to 29 lymph nodes in 9 lymphoma patients treated in a clinical trial at our cancer center. A radiologist independently delineated all lymph nodes on all slices in the follow-up images and his manual contours served as the ''gold standard'' for evaluation of the method. Preliminary results showed that 26/29 (89.7%) lymph nodes were correctly matched; i.e., there was a geometrical overlap between the deformed lymph node from the baseline and its corresponding mass in the follow-up images. Of the matched 26 lymph nodes, 22 (84.6%) were successfully segmented; for these 22 lymph nodes, several metrics were calculated to quantify the method's performance. Among them, the average distance and the Hausdorff distance between the contours generated by the computer and those generated by the radiologist were 0.9 mm (stdev. 0.4 mm) and 3.9 mm (stdev. 2.1 mm), respectively.

  11. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    MV-4 Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page B-1 Table B-1. MV-4 Chronology Date Time Depth (ft bgs) Activity 04/16/09 through 04/22/09 NA NA Mobilization to CNTA and rig-up to drill 04/22/09 15:45 0 Rig inspection and drill pad walk through inspection, continue with preparations for drilling. 04/22/09 21:50 0 Begin drilling 31-inch diameter conductor casing borehole 04/23/09 10:10 100 Advanced

  12. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    MV-5 Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page C-1 Table C-1. MV-5 Chronology Date Time Depth (ft bgs) Activity 05/09/09 through 05/10/09 NA NA Move rig and equipment from MV-4 pad to MV-5 pad and prepare to drill MV-5. 05/10/09 12:10 0 Rig inspection and drill pad walk through inspection, continue with preparations for drilling. 05/10/09 14:00 0 Begin drilling 31-inch diameter conductor casing

  13. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    UC-1-P-1SRC Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page D-1 Table D-1. UC-1-P-1SRC Chronology Date Time Depth (ft bgs) Activity 05/23/09 13:30 - 18:30 NA Position workover rig over the hole and pulled out about 50 ft of 4.5-in. casing. A steel die fell into hole and indications were that casing had separated during initial pulling. 05/24/09 06:00 - 09:00 NA Workover rig moves off the hole after

  14. Microsoft Word - ex15-ITER-sept10.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    5 - Rights in Data-Special Works - ITER UT-B Contracts Div Sept 2010 Page 1 of 1 ex15-ITER-sept10.doc Exhibit 15-ITER Ref: FAR 52.227-17 RIGHTS IN DATA í SPECIAL WORKS í ITER (Sept 2010) (a) Definitions. (1) "Data", as used in this clause, means recorded information, regardless of form or the media on which it may be recorded. The term includes technical data and computer software. The term does not include information incidental to contract administration, such as financial,

  15. Microsoft Word - ex1b-ITER-mar07.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    B - Patent Rights - Acquisition by the Government - ITER UT-B Contracts Div March 2007 Page 1 of 6 ex1b-ITER-mar07.doc Exhibit 1B ITER Ref: DEAR 952.227-13 PATENT RIGHTS - ACQUISITION BY THE GOVERNMENT - ITER (Mar 2007) (a) Definitions. (1) "Invention", as used in this clause, means any invention or discovery which is or may be patentable or otherwise protectable under title 35 of the United States Code or any novel variety of plant that is or may be protectable under the Plant Variety

  16. Microsoft Word - ex9-ITER-june11.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    - Technical Data - ITER UT-B Contracts Div June 2011 Page 1 of 5 ex9-ITER-june11.doc Exhibit 9 ITER Ref: DEAR 927.409; FAR 52.227-14, 52.227-14 Alt.V, 52.227-16 TECHNICAL DATA - ITER (June 2011) 1. RIGHTS IN DATA - GENERAL (a) Definitions. (1) "Computer data bases," as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include computer software. (2) "Computer

  17. Microsoft Word - ex9ed-ITER-june11.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    ED - Technical Data - ITER UT-B Contracts Div June 2011 Page 1 of 5 ex9ed-ITER-june11.doc Exhibit 9ED ITER Ref: DEAR 927.409; FAR 52.227-14, 52.227-14 Alt. IV, 52.227-14 Alt. V, 52.227-16 TECHNICAL DATA - ITER (June 2011) 1. RIGHTS IN DATA-GENERAL (a) Definitions. (1) "Computer data bases," as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include computer

  18. Microsoft Word - ex9rdf-ITER-sept09.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    RDF - Technical Data - ITER UT-B Contracts Div Sept 2009 Page 1 of 5 ex9rdf-ITER-sept09.doc Exhibit 9RDF-ITER Ref: DEAR 970.5227-1 TECHNICAL DATA - ITER (Sept 2009) 1. Rights in Data-Facilities. (a) Definitions. (1) "Computer Data Bases", as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include Computer Software. (2) "Computer Software", as used in this

  19. Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Citrix_2FA_Authentication_12_3_2009.doc Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc (453.3 KB) More Documents & Publications Citrix_2FA_Authentication_09.09 Using Two-Factor RSA Token with WebVPN User guide for remote access to VDI and Workplace using RSA token

  20. Microsoft Word - GNEP Website Glossary 2006-02-03_no_links.doc | Department

    Office of Environmental Management (EM)

    of Energy GNEP Website Glossary 2006-02-03_no_links.doc Microsoft Word - GNEP Website Glossary 2006-02-03_no_links.doc Microsoft Word - GNEP Website Glossary 2006-02-03_no_links.doc (29.63 KB) More Documents & Publications GNEP Glossary Generation-IV Roadmap Report of the Fuel Cycle Crosscut Group DOE-HDBK-1113-2008

  1. Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc (160.81 KB) More Documents & Publications Notice of Proposed Rulemaking (August 6, 2009) Notice of Proposed Rulemaking (May 16, 2007) Final Rule (December 4, 2009)

  2. Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy NSRC precompetitive User Agreement amended 1-18-07.doc Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc (69.15 KB) More Documents & Publications EXHIBIT A: CRADA, WFO, PUA and NPUA Comparison Table, with suggested changes Class_Waiver_NPUA-2.pdf ClassWaiver-PUA.pdf

  3. Fixed target matrix for femtosecond time-resolved and in situ serial micro-crystallography

    SciTech Connect (OSTI)

    Mueller, C.; Marx, A.; Epp, S. W.; Zhong, Y.; Kuo, A.; Balo, A. R.; Soman, J.; Schotte, F.; Lemke, H. T.; Owen, R. L.; Pai, E. F.; Pearson, A. R.; Olson, J. S.; Anfinrud, P. A.; Ernst, O. P.; Miller, R. J. Dwayne


    We present a crystallography chip enabling in situ room temperature crystallography at microfocus synchrotron beamlines and X-ray free-electron laser (X-FEL) sources. Compared to other in situ approaches, we observe extremely low background and high diffraction data quality. The chip design is robust and allows fast and efficient loading of thousands of small crystals. The ability to load a large number of protein crystals, at room temperature and with high efficiency, into prescribed positions enables high throughput automated serial crystallography with microfocus synchrotron beamlines. In addition, we demonstrate the application of this chip for femtosecond time-resolved serial crystallography at the Linac Coherent Light Source (LCLS, Menlo Park, California, USA). As a result, the chip concept enables multiple images to be acquired from each crystal, allowing differential detection of changes in diffraction intensities in order to obtain high signal-to-noise and fully exploit the time resolution capabilities of XFELs.

  4. NV-020-08-CX-65 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Document Date 20080911 Relevant Numbers Lead Agency Doc Number NV-020-08-CX-65 Serial Number NVN-085777 CX Authorization 516 DM 11.9 Proposed Action Ormat Nevada has...

  5. USDA-FS-EA-NV-030-06-025 2007 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Document Date 20070417 Relevant Numbers Lead Agency Doc Number EA-NV-030-06-025 Serial Number NVN-088208 Proposed Action See US Department of Agriculture Forest Service...

  6. USDA-FS-EA-NV-030-06-025 2012 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Document Date 20120216 Relevant Numbers Lead Agency Doc Number EA-NV-030-06-025 Serial Number NVN-088208 Proposed Action See US Department of Agriculture Forest Service...

  7. NDIA_PMSC_SurveillanceGuide_Oct2004.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon NDIAPMSCSurveillanceGuideOct2004.doc More Documents & Publications EVMS Surveillance Standard Operating Procedure (ESSOP) NDIAPMSCEVMSIntentGuideNov2006.pdf ...

  8. Microsoft Word - S02459_2006Annual GW Rpt.doc

    Office of Legacy Management (LM)

    Site Operable Unit III Annual Ground Water Report October 2005 through April 2006 ... Site OU III Annual Ground Water Report October 2005-April 2006 September 2006 Doc. ...

  9. Microsoft Word - S05212_2008 Post-Closure InspRpt.doc

    Office of Legacy Management (LM)

    ... and maintenance program * Communicate with ... Salmon-Calendar Year 2008 U.S. Department of Energy Doc. No. ... businesses from nearby communities. * Continue the ...

  10. OSTIblog Articles in the Adopt-A-Doc Topic | OSTI, US Dept of...

    Office of Scientific and Technical Information (OSTI)

    STIP is a robust and effective collaboration across the DOE... Related Topics: .EDUconnections, Adopt-A-Doc, DOE Green Energy, DOE STI, journal literature, National Library of ...

  11. Microsoft Word - S04916_2008 Macroinvert Biomonitoring Rpt.doc

    Office of Legacy Management (LM)

    ... retention pond are cliff swallows, violet-green swallows, song sparrows, and black phoebes. 2008 Macroinvertebrate Sampling-Monticello, Utah U.S. Department of Energy Doc. No. ...


    SciTech Connect (OSTI)

    Jambovane, Sachin R.; Prost, Spencer A.; Sheen, Allison M.; Magnuson, Jon K.; Kelly, Ryan T.


    This paper describes a fully automated droplet-based microfluidic device for on-demand serial dilution that is capable of achieving a dilution ratio of >6000 (concentration ranges from 1 mM to 160nM) over 35 nanoliter-scale droplets. This serial diluter can be applied to high throughput and label-free kinetic assays by integrating with our previously developed on-demand droplet-based microfluidic with mass spectrometry detection.

  13. Microsoft Word - DOE-ID-14-016 Arizona State EC B3-6.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    6 SECTION A. Project Title: Serial Sectioning Equipment for 3-D Characterization of Microstructure and Composition Effects on Mechanical Behavior of Enhanced Uranium Oxide Fuels -...

  14. PRESSURE RELIEF DEVICE DATA SHEET FORM PS-5 Pressure System Number: Date:

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    RELIEF DEVICE DATA SHEET FORM PS-5 Pressure System Number: Date: Pressure System Name: Pressure Vessel Number (if Applicable): Device installed directly on vessel?: __Yes __No Code: System Fluid: Code Year: Fluid State: Fluid Category: RELIEF DEVICE DATA Device Type ___Safety Relief Valve ____Rupture Disk ___Other (specify) Certification Type: ___ASME ___CE/PED ___Other (specify) Manufacturer Rated Flow Capacity: Part Number Converted Flow Capacity: Serial Number Set Pressure Inspection/Test

  15. Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc meeting on Energy Efficiency and Sustainable Design of Federal Buildings Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc (99.54 KB) More Documents & Publications Ex Parte Memo - 09 02 Mtg-09.09.10.doc Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc

  16. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page B-1 Table 1. UC-1 Monument Elevations and Subsidence Elevation at Top of Monument a,b Subsidence (m) Date SM-1 N 6,430,874.2869 E 539,588.2339 SM-2 N 6,430,863.3239 E 539,644.8195 SM-3 N 6,430,855.2553 E 539,684.3327 SM-4 N 6,430,849.7763 E 539,715.7991 SM-5 N 6,430,852.0243 E 539,585.4651 SM-6 N 6,430,841.7590 E 539,641.4674 SM-7 N 6,430,834.5289 E 539,680.5243 SM-8 N

  17. Relative importance of multiple factors on terrestrial loading of DOC to Arctic river networks

    SciTech Connect (OSTI)

    Kicklighter, David W.; Hayes, Daniel J; Mcclelland, James W; Peterson, Bruce; Mcguire, David; Melillo, Jerry


    Terrestrial carbon dynamics influence the contribution of dissolved organic carbon (DOC) to river networks in addition to controlling carbon fluxes between the land surface and the atmosphere. In this study, we use a biogeochemical process model to simulate the lateral transfer of DOC from land to the Arctic Ocean via riverine transport. We estimate that the pan-arctic watershed has contributed, on average, 32 Tg C/yr of DOC to the Arctic Ocean over the 20th century with most coming from the extensive area of boreal deciduous needle-leaved forests and forested wetlands in Eurasian watersheds. We also estimate that the rate of terrestrial DOC loading has been increasing by 0.037 Tg C/yr2 over the 20th century primarily as a result of increases in air temperatures and precipitation. These increases have been partially compensated by decreases in terrestrial DOC loading caused by wildfires. Other environmental factors (CO2 fertilization, ozone pollution, atmospheric nitrogen deposition, timber harvest, agriculture) are estimated to have relatively small effects on terrestrial DOC loading to arctic rivers. The effects of the various environmental factors on terrestrial carbon dynamics have both compensated and enhanced concurrent effects on hydrology to influence terrestrial DOC loading. Future increases in riverine DOC concentrations and export may occur from warming-induced increases in terrestrial DOC production associated with enhanced microbial metabolism and the exposure of additional organic matter from permafrost degradation along with decreases in water yield associated with warming-induced increases in evapotranspiration. Improvements in simulating terrestrial DOC loading to pan-arctic rivers in the future will require better information on the spatial distribution of precipitation and its temporal trends, carbon dynamics of larch-dominated ecosystems in eastern Siberia, and the role of industrial organic effluents on carbon budgets of rivers in western

  18. Microsoft Word - 48D7DF19-707E-28B27A.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    48D7DF19-707E-28B27A.doc Microsoft Word - 48D7DF19-707E-28B27A.doc PDF icon Microsoft Word - 48D7DF19-707E-28B27A.doc More Documents & Publications Microsoft Word - ...

  19. Microsoft Word - 46ED31B8-1E53-08CF52.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    46ED31B8-1E53-08CF52.doc Microsoft Word - 46ED31B8-1E53-08CF52.doc PDF icon Microsoft Word - 46ED31B8-1E53-08CF52.doc More Documents & Publications Microsoft Word - ...

  20. A serial-kinematic nanopositioner for high-speed atomic force microscopy

    SciTech Connect (OSTI)

    Wadikhaye, Sachin P. Yong, Yuen Kuan; Reza Moheimani, S. O.


    A flexure-guided serial-kinematic XYZ nanopositioner for high-speed Atomic Force Microscopy is presented in this paper. Two aspects influencing the performance of serial-kinematic nanopositioners are studied in this work. First, mass reduction by using tapered flexures is proposed to increased the natural frequency of the nanopositioner. 25% increase in the natural frequency is achieved due to reduced mass with tapered flexures. Second, a study of possible sensor positioning in a serial-kinematic nanopositioner is presented. An arrangement of sensors for exact estimation of cross-coupling is incorporated in the proposed design. A feedforward control strategy based on phaser approach is presented to mitigate the dynamics and nonlinearity in the system. Limitations in design approach and control strategy are discussed in the Conclusion.

  1. Microsoft Word - Second_ ITER Council Press Release.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Second_ ITER Council Press Release.doc Microsoft Word - Second_ ITER Council Press Release.doc Microsoft Word - Second_ ITER Council Press Release.doc (123.14 KB) More Documents & Publications Before the House Subcommittee on Energy - Committee on Science, Space, and Technology Joint Statement by Energy Ministers of G8, The People's Republic of China, India and The Republic of Korea (June 2008) Joint Statement by Energy Ministers of G8, The People's Republic of China, India and

  2. V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy 85: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability June 25, 2013 - 12:41am Addthis PROBLEM: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability PLATFORM: Apache OpenOffice SDK 3.x ABSTRACT: Apache has acknowledged a vulnerability in Apache OpenOffice SDK REFERENCE LINKS: Apache OpenOffice Secunia Advisory SA53963 Secunia Advisory SA53846 CVE-2013-1571 IMPACT ASSESSMENT:

  3. Microsoft Word - Turbine Manufactures MOU FINAL_5-31-08_.doc | Department

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    of Energy Turbine Manufactures MOU FINAL_5-31-08_.doc Microsoft Word - Turbine Manufactures MOU FINAL_5-31-08_.doc Microsoft Word - Turbine Manufactures MOU FINAL_5-31-08_.doc (65.18 KB) More Documents & Publications Memorandum of Understanding between the U.S. Wind Turbine Manufacturers and the U.S. Department of Energy on Developing a Shared Strategy to Achieve 20% Wind Energy in 2030 Linkages from DOE's Wind Energy Program to Commercial Renewable Power Generation DOE Wind Energy

  4. Number | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Property:NumOfPlants Property:NumProdWells Property:NumRepWells Property:Number of Color Cameras Property:Number of Devices Deployed Property:Number of Plants included in...

  5. Coupled Serial and Parallel Non-uniform SQUIDs

    SciTech Connect (OSTI)

    Longhini, Patrick; In, Visarath; Berggren, Susan; Palacios, Antonio; Leese de Escobar, Anna


    In this work we numerical model series and parallel non-uniform superconducting quantum interference device (SQUID) array. Previous work has shown that series SQUID array constructed with a random distribution of loop sizes, (i.e. different areas for each SQUID loop) there exists a unique 'anti-peak' at the zero magnetic field for the voltage versus applied magnetic field (V-B). Similar results extend to a parallel SQUID array where the difference lies in the arrangement of the Josephson junctions. Other system parameter such as bias current, the number of loops, and mutual inductances are varied to demonstrate the change in dynamic range and linearity of the V-B response. Application of the SQUID array as a low noise amplifier (LNA) would increase link margins and affect the entire communication system. For unmanned aerial vehicles (UAVs), size, weight and power are limited, the SQUID array would allow use of practical 'electrically small' antennas that provide acceptable gain.

  6. Apparatus and method for nanoflow liquid jet and serial femtosecond x-ray protein crystallography

    DOE Patents [OSTI]

    Bogan, Michael J.; Laksmono, Hartawan; Sierra, Raymond G.


    Techniques for nanoflow serial femtosecond x-ray protein crystallography include providing a sample fluid by mixing a plurality of a first target of interest with a carrier fluid and injecting the sample fluid into a vacuum chamber at a rate less than about 4 microliters per minute. In some embodiments, the carrier fluid has a viscosity greater than about 3 centipoise.

  7. Application to Export Electric Energy OE Doc No. EA-339-A Shell...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    78, No. 45 - March 7, 2013 Application to Export Electric Energy OE Doc No. EA-339-A Shell Energy North America (US), L.P.: Federal Register Notice, Volume 78, No. 45 - March 7,...

  8. Microsoft Word - FEMP-State MOU pdf version.doc | Department... (indexed) [DOE]

    FEMP-State MOU pdf version.doc (15.06 KB) More Documents & Publications FEMP Peer Review 2001 FEMP Customer Survey Report (Appendices) Federal Utility Partnership Working Group ...

  9. Microsoft Word - S04516_2008 GW Rpt Cover.doc

    Office of Legacy Management (LM)

    ... along the bank, and the pond becomes nearly choked with green algae in late summer. ... III Annual Groundwater Report October 2007-April 2008 U.S. Department of Energy Doc. No. ...

  10. Microsoft Word - DOE-ID-12-013 Colorado School of Mines.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    School of Mines SECTION B. Project Description The Colorado School of Mines will purchase a Robo-Met.3D automated polishing, serial-sectioning, and image acquisition station. ...

  11. An Mini-Doc: 2016 Collegiate Wind Competition | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy An Mini-Doc: 2016 Collegiate Wind Competition An Mini-Doc: 2016 Collegiate Wind Competition Addthis In this short documentary, we follow three student teams who participated in the 2016 U.S. Department of Energy Collegiate Wind Competition in New Orleans. The competition provides undergraduate students real-world skills they need to enter tomorrow's clean energy workforce. The challenge is to: develop and deliver a business plan, establish a deployment strategy,

  12. Sulfur Effect and Performance Recovery of a DOC + CSF + Cu-Zeolite SCR

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    System | Department of Energy Sulfur Effect and Performance Recovery of a DOC + CSF + Cu-Zeolite SCR System Sulfur Effect and Performance Recovery of a DOC + CSF + Cu-Zeolite SCR System effect and performance recovery studies at system level with typical diesel emission control consisting of diesel oxidation catalyst, catalyzed soot filter, and selective catalytic reduction deer11_tang.pdf (504.68 KB) More Documents & Publications Investigation of Sulfur Deactivation on Cu/Zeolite SCR

  13. Microsoft Word - Deposition Request Form Rev10-12.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Deposition Request Form rev10/12-sm Personal Contact Information Date: ____/____/______ Name:_________________________________ Phone #__________________ E-Mail_____________________________ Project Reference Number: _________________________ Dept _________________ Professor _____________________________ Professor Email ________________________________ Substrate Description ( substrate provided by user) Total Number of Substrates: ________ Deposition Specifications Film

  14. NSR Key Number Retrieval

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    NSR Key Number Retrieval Pease enter key in the box Submit

  15. n0052300-4_5 acre.doc

    Office of Legacy Management (LM)

    Site January through March 2002 April 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number ...

  16. Microsoft Word - CAMD Facility Work Request Form.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Facility Work Request Form (Provide 2 copies of this form) Requestor's Name______________________________________________________________ Requestor's Phone Number_______________________________________________________ Requestor's Initials/Supervisor's initials_____________________________________________ Brief Description of work to be completed ______________________________________________________________________________

  17. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    - Legacy Management Type of Review Technical Document Title andor Number and Revision Post-Closure Inspection and Monitoring Report for Corrective Action Unit 417: Central ...

  18. Parallel processing data network of master and slave transputers controlled by a serial control network

    DOE Patents [OSTI]

    Crosetto, Dario B.


    The present device provides for a dynamically configurable communication network having a multi-processor parallel processing system having a serial communication network and a high speed parallel communication network. The serial communication network is used to disseminate commands from a master processor (100) to a plurality of slave processors (200) to effect communication protocol, to control transmission of high density data among nodes and to monitor each slave processor's status. The high speed parallel processing network is used to effect the transmission of high density data among nodes in the parallel processing system. Each node comprises a transputer (104), a digital signal processor (114), a parallel transfer controller (106), and two three-port memory devices. A communication switch (108) within each node (100) connects it to a fast parallel hardware channel (70) through which all high density data arrives or leaves the node.

  19. Application of three-dimensional digital image processing for reconstruction of microstructural volume from serial sections

    SciTech Connect (OSTI)

    Tewari, A.; Gokhale, A.M.


    Three-dimensional digital image processing is useful for reconstruction of microstructural volume from a stack of serial sections. Application of this technique is demonstrated via reconstruction of a volume segment of the liquid-phase sintered microstructure of a tungsten heavy alloy processed in the microgravity environment of NASA's space shuttle, Columbia. Ninety serial sections (approximately one micrometer apart) were used for reconstruction of the three-dimensional microstructure. The three-dimensional microstructural reconstruction clearly revealed that the tungsten grains are almost completely connected in three-dimensional space. Both the matrix and the grains are topologically co-continuous, although the alloy was liquid-phase sintered in microgravity. Therefore, absence of gravity did not produced a microstructure consisting of discrete isolated W grains uniformly dispersed in the liquid Ni-Fe alloy matrix at the sintering temperature.

  20. Parallel processing data network of master and slave transputers controlled by a serial control network

    DOE Patents [OSTI]

    Crosetto, D.B.


    The present device provides for a dynamically configurable communication network having a multi-processor parallel processing system having a serial communication network and a high speed parallel communication network. The serial communication network is used to disseminate commands from a master processor to a plurality of slave processors to effect communication protocol, to control transmission of high density data among nodes and to monitor each slave processor`s status. The high speed parallel processing network is used to effect the transmission of high density data among nodes in the parallel processing system. Each node comprises a transputer, a digital signal processor, a parallel transfer controller, and two three-port memory devices. A communication switch within each node connects it to a fast parallel hardware channel through which all high density data arrives or leaves the node. 6 figs.

  1. NR Pu SEIS Advisory 07152010 _final_.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    NPT Compliance Maintaining the safety, security and effectiveness of the nuclear deterrent without nuclear testing - especially at lower numbers - requires increased investments across the nuclear security enterprise. Maintaining the safety, security and effectiveness of the nuclear deterrent without nuclear testing - especially at lower numbers - requires increased investments across the nuclear security enterprise. Maintaining the safety, security and effectiveness of a smaller nuclear

  2. Microsoft Word - CROSWLK-3-27-2014.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    CROSSWALK OF CURRENT OLD DIRECTIVES NUMBERING SERIES TO NEW DIRECTIVES NUMBERING SERIES 100 LEADERSHIP/MANAGEMENT PLANNING 110 Organization and Structure. Includes directives on authorities, functions, and internal relationships. 120 Planning. Includes processes for determining how best to do work, including strategic planning, institutional and program planning, implementation planning, and economic analysis and forecasting. 120 General 121 Strategic Planning 122 Institutional Planning 123

  3. Serial time-resolved crystallography of photosystem II using a femtosecond

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    X-ray laser Serial time-resolved crystallography of photosystem II using a femtosecond X-ray laser Authors: Kupitz, Christopher; Basu, Shibom; Grotjohann, Ingo; Fromme, Raimund; Zatsepin, Nadia A.; Rendek, Kimberly N.; Hunter, Mark; Shoeman, Robert L.; White, Thomas A.; Wang, Dingjie; James, Daniel; Yang, Jay-How; Cobb, Danielle E.; Brenda, Reeder; Raymond, G. Sierra; Liu, Haiguang; Barty, Anton; Aquila, Andrew L.; Deponte, Daniel; Kirian, Richard A.; Bari, Sadia; Bergkamp, Jesse J.;

  4. Deactivation of Accelerated Engine-Aged and Field-Aged SCR Catalysts and the Role of the DOC [DOE]

    A technique for accelerated aging of SCR system (DOC -> SCR-> DPF) reveals two deactivation mechanisms and replicates field-aged effects

  5. Microsoft Word - Energy and Emissions Benefit Table Instructions.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    amendment replaces the Energy Benefits and Emissions Table on page 52 of Solicitation DE-FOA-0000005 and page 44 of Solicitation Number DE-FOA-0000008 with the following data request form. In order to conduct a more thorough lifecycle emissions analysis consistent with statutory requirements set forth in Title XVII of the Energy Policy Act of 2005, DOE is replacing the Energy and Emissions Benefits table provided in Solicitation Number DE-FOA-0000005 and Solicitation Number DE-FOA-0000008 with

  6. Serial Queue

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    also be compiled with Cray compiler wrappers, such as ftn, cc, or CC; or with native compilers, such as ifort, icc, gcc, crayftn, pgf90, etc after loading the compilers directly,...

  7. Microsoft Word - M123- Word Version.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  8. Microsoft Word - M124- Word Version.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  9. Microsoft Word - SF30 TEMPLATE A078.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  10. Microsoft Word - M103 Section G.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  11. Microsoft Word - M115 Conceptual Design.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  12. Microsoft Word - M107 $10 million Consent.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  13. Microsoft Word - SF30 TEMPLATE A075.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  14. Microsoft Word - SF30 template M079 .DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  15. Microsoft Word - M099 No Cost.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  16. Microsoft Word - Mod M085 SF-30.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  17. Microsoft Word - SF30 TEMPLATE A081.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  18. Microsoft Word - M118 $25 million Consent.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  19. Microsoft Word - M086, Referal Bonus.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  20. Microsoft Word - M140 _10-7-08_.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...