National Library of Energy BETA

Sample records for agency doc number

  1. Property:NEPA LeadAgencyDocNumber | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    LeadAgencyDocNumber Jump to: navigation, search Property Name NEPA LeadAgencyDocNumber Property Type String This is a property of type String. Pages using the property "NEPA...

  2. Property:NEPA FundingAgencyDocNumber | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    + DOEEA-1676 + N NV-020-03-26 + DE-PS07-02ID14264 + O One Nevada + NA + S Sigurd Red Butte No2 + NA + Retrieved from "http:en.openei.orgwindex.php?titleProperty:NEPAF...

  3. Associate Research Physicist (Post Doc, Experimental Research...

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Post Doc, Experimental Research, NSTX-U, Radio Frequency Waves) Department: Research Staff: RM1 Requisition Number: 1500421 The Princeton Plasma Physics Laboratory (PPPL) seeks to...

  4. raising_investment_funds_for_clean_energy_programs.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc Microsoft ...

  5. webinar_innovation_net_metering_interconnection.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    netmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc webinarinnovationnetmeteringinterconnec...

  6. howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc (117.5 KB) More Documents & Publications How to Design and Market Energy Efficiency Programs to Specific Neighborhoods Using Social Media to Engage the Community in Energy Efficiency

  7. highperformanceleasingstrategiesforstateandlocalgovernments.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc (93 KB) More Documents & Publications High Performance Leasing Strategies for State and Local Governments Leveraging Portfolio Manager for Disclosure and Green Leasing Practices

  8. webinar_innovation_organizing_strategizing.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    organizingstrategizing.doc webinarinnovationorganizingstrategizing.doc webinarinnovationorganizingstrategizing.doc webinarinnovationorganizingstrategizing.doc (71 KB) ...

  9. Doc...~En.

    Office of Legacy Management (LM)

    ... ..,,..,.... - .. I&i3:scD .::-:, TO-340 .":: ..' . - ' - -. ' . .." ,.. .;.. Very traly yours;, -' .X :, Doc...En. ' Br.:Re&ng ';;a' : , Div. Reading File ., ,, ., ,.-...

  10. Doc.~:Ru.

    Office of Legacy Management (LM)

    .' , .' c,j .c; Distriblition: ;. <; ..,:L.D.i&%.ay,FiN-OR00 Doc.:Ru. ,.,. 75. ' Br..Reading 'ire' ,lliv. Read&q File ,: '. ,, .-' . ...: - SURNAME.....

  11. exploringpowerpurchaseagreementsthebasicspart1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc (112.5 KB) More Documents & Publications Exploring Power Purchase Agreements - The Basics Part 1

  12. finance_programs.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    financeprograms.doc financeprograms.doc financeprograms.doc Microsoft Office document icon financeprograms.doc More Documents & Publications Tools for Designing & Implementing ...

  13. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    E Agency Notification Agreements This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page E-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008

  14. Key Agency Targets Summary _FY 2012_.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    all projects in the capital work plan; and 3) At least 80% of Capital Allocation Board (CAB) approved "major capital investment" projectprogram elements of cost, schedule, and...

  15. Weatherization Beyond the Numbers: Case Studies of Fifteen High-performing Weatherization Agencies - Conducted May 2011 through July 2012

    SciTech Connect (OSTI)

    Tonn, Bruce Edward; Rose, Erin M.; Hawkins, Beth A.

    2014-09-01

    The report presents fifteen individual case studies of high-performing and unique local weatherization agencies. This research was one component of the retrospective evaluation of the U.S. Department of Energy s Weatherization Assistance Program. The agencies were chosen to represent a range of contexts and approaches to weatherization. For example, the set of agencies includes a mix of urban and rural agencies, those that mainly use in-house crews to weatherize homes versus those that use contractor crews, and a mix of locations, from very cold climates to moderate to hot humid and dry climates. The case studies were mainly based on site visits to the agencies that encompassed interviews with program directors, weatherization crews, and recipients of weatherization. This information was supplemented by secondary materials. The cases document the diversity of contexts and challenges faced by the agencies and how they operate on a day-by-day basis. The cases also high common themes found throughout the agencies, such as their focus on mission and respect for their clients.

  16. Environmental Records.doc

    Energy.gov (indexed) [DOE]

    EIS environmental impact statement EPA U.S. Environmental Protection Agency EPCRA ... Protection Agency (EPA), the DOE, state agencies, the public, or other interested parties. ...

  17. webinar_innovation_permitting_inspections.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    permittinginspections.doc webinarinnovationpermittinginspections.doc webinarinnovationpermittinginspections.doc webinarinnovationpermittinginspections.doc (70.5 KB) More ...

  18. webinar_innovation_planning_zoning.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    planningzoning.doc webinarinnovationplanningzoning.doc webinarinnovationplanningzoning.doc webinarinnovationplanningzoning.doc (65.5 KB) More Documents & Publications ...

  19. webinar_innovation_financing.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    financing.doc webinarinnovationfinancing.doc webinarinnovationfinancing.doc webinarinnovationfinancing.doc (77 KB) More Documents & Publications webinarinnovationplanningz...

  20. fed_finance_facilities_ee_upgrades_deployment.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc Microsoft Office document icon ...

  1. Advanced Research Projects Agency - Energy Program Specific Recovery...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Advanced Research Projects Agency - Energy Program Specific Recovery Plan PDF icon Microsoft Word - 44F1801D.doc More Documents & Publications Microsoft Word - PSRP Updates ...

  2. Microsoft Word - ContractManagementPlanningDRIVERS.doc | Department...

    Energy.gov (indexed) [DOE]

    ContractManagementPlanningDRIVERS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS.doc Microsoft Word - ARRAMOModelMod.doc...

  3. Microsoft Word - aser_rev0.doc

    Office of Legacy Management (LM)

    Weiss Associates Environmental Science, Engineering and Management ANNUAL SITE ENVIRONMENTAL REPORT CALENDAR YEAR 2007 for the LABORATORY FOR ENERGY-RELATED HEALTH RESEARCH UNIVERSITY OF CALIFORNIA, DAVIS Submitted to: S.M. Stoller Corporation 2597 B ¾ Road Grand Junction, Colorado 81503 Prepared by: Weiss Associates 5801 Christie Avenue, Suite 600 Emeryville, California 94608-1827 September 30, 2008 Rev. 0 J:\DOE_STOLLER\4110\137\ASER 2007\REV. 0\ASER_REV0.DOC WEISS ASSOCIATES Project Number:

  4. U0083900.doc

    Office of Legacy Management (LM)

    the U.S. Environmental Protection Agency (EPA) to determine the need for notification or ... The purpose of active remediation is to comply with EPA ground water standards defined in ...

  5. TentativeAgreement.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Iani, Region 10 Administrator U.S. Environmental Protection Agency CC: R. Jim, YN P. Sobotta, NPT K. Niles, Oregon Energy W. J. Taylor, ORP R. Gay, CTUIR J. H. Swailes, ORP L....

  6. Category:NEPA Doc | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    NEPA Doc Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Category: NEPA Documents Collections Add.png Add a new NEPA Document Collection Pages in category "NEPA Doc"...

  7. spurring_local_economic_development_clean_energy_programs.doc...

    Energy.gov (indexed) [DOE]

    spurringlocaleconomicdevelopmentcleanenergyprograms.doc spurringlocaleconomicdevelopmentcleanenergyprograms.doc More Documents & Publications Spurring Local Economic...

  8. advanced_biofuels_pathways_webinar_alt_text.doc | Department...

    Energy.gov (indexed) [DOE]

    advancedbiofuelspathwayswebinaralttext.doc advancedbiofuelspathwayswebinaralttext.doc (113 KB) More Documents & Publications Sustainability for the Global Biofuels ...

  9. Microsoft Word - AL2006-08.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    8.doc Microsoft Word - AL2006-08.doc PDF icon Microsoft Word - AL2006-08.doc More Documents & Publications AL2007-05.doc&0; Microsoft Word - AL2005-14.doc Microsoft Word - ...

  10. Microsoft Word - AL2005-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5-03.doc Microsoft Word - AL2005-03.doc PDF icon Microsoft Word - AL2005-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - AL2006-08.doc ...

  11. Microsoft Word - AL2002-03.doc | Department of Energy

    Office of Environmental Management (EM)

    2-03.doc Microsoft Word - AL2002-03.doc PDF icon Microsoft Word - AL2002-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - FAL2004-01.doc...

  12. Microsoft Word - FAL2004-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - FAL2004-01.doc PDF icon Microsoft Word - FAL2004-01.doc More Documents & Publications Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-02.doc...

  13. Microsoft Word - 98-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    8-11.doc Microsoft Word - 98-11.doc PDF icon Microsoft Word - 98-11.doc More Documents & Publications Microsoft Word - AL2006-08.doc Microsoft Word - AL2005-01.doc Microsoft Word -...

  14. deepenergyretrofitsandstateapplications.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    deepenergyretrofitsandstateapplications.doc deepenergyretrofitsandstateapplications.doc deepenergyretrofitsandstateapplications.doc deepenergyretrofitsandstateapplications.doc (117.5 KB) More Documents & Publications Deep Energy Retrofits & State Applications Sustainable Energy Resources for Consumers Webinar on Residential Geothermal Heat Pump Retrofit Transcript Interior Lighting Efficiency for Municipalities

  15. Tentative Agreement.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Tentative Agreement on Hanford Federal Facility Agreement and Consent Order (HFFACO) Negotiations for the Management of Hanford RCRA and CERCLA Wastes (HFFACO Milestone Series M-091 and M-016) The U.S. Department of Energy, Richland Operations Office (RL), the State of Washington, Department of Ecology, and the U.S. Environmental Protection Agency (EPA), hereinafter referred to as the Parties, have concluded negotiations for the management of Hanford RCRA and CERCLA wastes under HFFACO Milestone

  16. SPDWRAP#1.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Please notify Aon Hewitt's Your Benefit Resources (YBR) in Appendix G to update your personal information, such as your home address and home telephone number. 2. Eligibility...

  17. HABAdv#1671.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    6 Subject: U Plant Closure Plan Adopted: September 10, 2004 Page 1 September 10, 2004 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Linda Hoffman, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Ron Kreizeneeck, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Subject: U Plant Closure Plan Dear Mssrs. Klein, Kreizeneeck, and Ms.

  18. Habadv-119.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    9 Subject: B Reactor Engineering Evaluation and Cost Analysis Adopted: June 8, 2001 Page 1 June 8, 2001 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Chuck Findley, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Re: B Reactor Engineering Evaluation and Cost Analysis Dear

  19. Engaging Financial Institution Partners Transcript.doc | Department...

    Office of Environmental Management (EM)

    Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Microsoft ...

  20. Microsoft Word - SpecialTermsandConditions0506.doc | Department...

    Energy Savers

    Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc More Documents &...

  1. Microsoft Word - FY2005finaliparhandbook.doc | Department of...

    Energy Savers

    Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc More Documents & Publications...

  2. Microsoft Word - ARRAAttachment2.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAAttachment2.doc Microsoft Word - ARRAAttachment2.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment3.rtf Microsoft Word -...

  3. Microsoft Word - ARRAMOModelMod.doc | Department of Energy

    Energy Savers

    ARRAMOModelMod.doc Microsoft Word - ARRAMOModelMod.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS...

  4. Microsoft Word - ARRAModelWAS.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ARRAModelWAS.doc Microsoft Word - ARRAModelWAS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAMOModelMod...

  5. Microsoft Word - CMPTemplate031307.doc | Department of Energy

    Office of Environmental Management (EM)

    CMPTemplate031307.doc Microsoft Word - CMPTemplate031307.doc PDF icon Microsoft Word - CMPTemplate031307.doc More Documents & Publications Chapter 42 - Contract Administration...

  6. Microsoft Word - August06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    August06.doc Microsoft Word - August06.doc PDF icon Microsoft Word - August06.doc More Documents & Publications Microsoft Word - April

  7. Microsoft Word - FY10PropertyBSCContractor.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor.doc PDF icon Microsoft Word - FY10PropertyBSCContractor.doc More Documents & Publications Microsoft Word - ...

  8. Microsoft Word - GJPPGPracticesDraft.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    GJPPGPracticesDraft.doc Microsoft Word - GJPPGPracticesDraft.doc PDF icon Microsoft Word - GJPPGPracticesDraft.doc More Documents & Publications 1 DOE Purchase Card Policy Natural ...

  9. Microsoft Word - Cross Reference Matrix Introduction.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Cross Reference Matrix Introduction.doc Microsoft Word - Cross Reference Matrix Introduction.doc PDF icon Microsoft Word - Cross Reference Matrix Introduction.doc More Documents & ...

  10. Microsoft Word - April06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    April06.doc Microsoft Word - April06.doc PDF icon Microsoft Word - April06.doc More Documents & Publications Secretary Directs FPO to Prepare Strategic Plan Microsoft Word - August

  11. 2B-01.doc

    Energy Savers

    ... performed under DOE contract number DE-AC01-02GJ79491 by the S.M. Stoller Corporation for the U.S. Department of Energy, Office of Legacy Man- agement, Grand Junction, Colorado. ...

  12. Report2003.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    III. Definitions of Terms and Acronyms Used in the Report. ... current fiscal year 1013 (Enter this number also in Line ... (some records involved search adequacy) 5: Remand: 9 7 ...

  13. AL2007-03.doc

    Energy.gov (indexed) [DOE]

    from GAO and Inspector General (IG) reports of other federal agencies. Introduction The IA relationship involves two Federal agencies that enter into a relationship for the...

  14. Ammendment 2.doc | Department of Energy

    Energy.gov (indexed) [DOE]

    Ammendment 2.doc More Documents & Publications Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&0; RFQ DE-RQ01-04ME90001.doc&0; Attachment 3-Past Performance...

  15. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Doc. No. S06401 June 2010 Page B-2 U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. ...

  16. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page I-3 U n c o n t r o l l e d c o p y Long-Term Surveillance and Maintenance ...

  17. Microsoft Word - AL2005-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    7.doc Microsoft Word - AL2005-07.doc PDF icon Microsoft Word - AL2005-07.doc More Documents & Publications Microsoft Word - AL2006-07.doc OPAM Policy Acquisition Guides Initial ...

  18. Microsoft Word - AL2005-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - AL2005-01.doc PDF icon Microsoft Word - AL2005-01.doc More Documents & Publications Microsoft Word - AL2006-08.doc Acquisition Letter Archive listing ...

  19. Microsoft Word - AL2006-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - AL2006-01.doc PDF icon Microsoft Word - AL2006-01.doc More Documents & Publications Microsoft Word - al2005-06.doc Chapter 19 - Small Business Programs OPAM...

  20. Microsoft Word - Flash2007-43.doc | Department of Energy

    Office of Environmental Management (EM)

    43.doc Microsoft Word - Flash2007-43.doc Microsoft Word - Flash2007-43.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash...

  1. Microsoft Word - AL2005-16.doc | Department of Energy

    Office of Environmental Management (EM)

    6.doc Microsoft Word - AL2005-16.doc PDF icon Microsoft Word - AL2005-16.doc More Documents & Publications Microsoft Word - AL2005-10.doc Audit Report: IG-0860 Microsoft Word -...

  2. Microsoft Word - AL2005-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5-02.doc Microsoft Word - AL2005-02.doc PDF icon Microsoft Word - AL2005-02.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc...

  3. Microsoft Word - AL2006-02.doc | Department of Energy

    Energy Savers

    2.doc Microsoft Word - AL2006-02.doc PDF icon Microsoft Word - AL2006-02.doc More Documents & Publications Microsoft Word - AL2006-03.doc Archived Financial Assistance Letters...

  4. Microsoft Word - AL2006-03.doc | Department of Energy

    Energy Savers

    3.doc Microsoft Word - AL2006-03.doc PDF icon Microsoft Word - AL2006-03.doc More Documents & Publications Microsoft Word - AL2006-02.doc Archived Financial Assistance Letters...

  5. Microsoft Word - al2005-04.doc | Department of Energy

    Energy Savers

    al2005-04.doc Microsoft Word - al2005-04.doc PDF icon Microsoft Word - al2005-04.doc More Documents & Publications AL2005-04ClassDeviation.pdf Microsoft Word - Matrixpart2.doc...

  6. Microsoft Word - AL2005-14.doc | Department of Energy

    Office of Environmental Management (EM)

    4.doc Microsoft Word - AL2005-14.doc PDF icon Microsoft Word - AL2005-14.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc...

  7. al99-06attachment.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    attachment.doc&0; al99-06attachment.doc&0; PDF icon al99-06attachment.doc&0; More Documents & Publications Microsoft Word - AL2000-05Attachment.doc Microsoft Word - NSRC...

  8. Microsoft Word - FWP- Fact Sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FWP- Fact Sheet.doc Microsoft Word - FWP- Fact Sheet.doc PDF icon Microsoft Word - FWP- Fact Sheet.doc More Documents & Publications Microsoft Word - FOA cover sheet.doc Microsoft ...

  9. Microsoft Word - AL2005-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2005-10.doc Microsoft Word - AL2005-10.doc Microsoft Word - AL2005-10.doc (133.11 KB) More Documents & Publications Microsoft Word - AL2005-16.doc Audit Report: IG-0860 Microsoft ...

  10. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    SAR.doc Microsoft Word - PeerReviewSAR.doc Microsoft Word - PeerReviewSAR.doc (13.47 KB) More Documents & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross ...

  11. Microsoft Word - 1938.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    personal information is revealed in a LANS record: Education, salary, medical history, employment history, social security number, date and place of birth, or mother's maiden name. Form 1938 (3/14) Page 1 of 3 Form 1938 Universal Beneficiary Designation/Change Form Instructions: The information on this form will replace any prior beneficiary designation. You may name anyone or any entity as your beneficiary and you may change your beneficiary at any time by completing a new Universal Beneficiary

  12. Index2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Index2.doc Index2.doc Index2.doc (11.46 KB) More Documents & Publications Sylvania Corporation, Hicksville, NY and Bayside, NY - Addendum to July 8, 2004 O:\HOMEPAGE\FOIA\report99.PDF&#0; U.S. Department of Energy 2004 Annual Report

  13. SubcontractingGuidelines.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; (245.71 KB) More Documents & Publications Guidance of the Department of Energy Subcontracting Program Acquisition Guide Chapter 19 Update Chapter 19 - Small Business Programs

  14. Microsoft Word - Matrixpart1.doc | Department of Energy

    Energy.gov (indexed) [DOE]

    Matrixpart1.doc More Documents & Publications Part 1, Clauses Prescribed in FAR Part 52 Microsoft Word - Matrixpart2.doc...

  15. csep_transcript_arlington.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Office document icon cseptranscriptarlington.doc More Documents & Publications Tools for Designing & Implementing Better Finance Programs financeprograms.doc financeprograms

  16. Jan09.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    9 ANL/EVS/NL-09-01 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Routine AVP Clouds with Low Optical Water Depths (CLOWD) Optical Radiative Observations (RACORO) Field Campaign Scheduled at SGP

  17. June08.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    8 ANL/EVS/NL-08-06 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: brad.orr@anl.gov Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: http://www.arm.gov ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Interagency Effort Will Measure Carbon Dioxide Profiles Beginning in June, the ARM Climate Research Facility (ACRF) is supporting an

  18. Flash2007-33DomesticDeliveryParticipatingAgencies.doc

    Energy Savers

    Securities and Exchange Commission 900,500.00 13 Department of TransportationFederal Motor Carrier Safety Administration 252,027.08 14 Pension Benefit Guaranty Corporation ...

  19. Microsoft Word - FOIA NOT AGENCY RECORD RESPONSE.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    April 11, 2013 CERTIFIED MAIL Mr. Ryan Henry Law Offices of Ryan Henry, P.L.L.C. 1380 Pantheon Way, Suite 215 San Antonio, Texas 78232 Dear Mr. Henry: FREEDOM OF INFORMATION ACT REQUEST (FOI 2013-00782) This letter is in response to your electronic Freedom of Information Act (FOIA) request that you sent to the Department of Energy (DOE), Richland Operations Office (RL) requesting documents relating to the jobs performed by Dritherm International, Inc., from January 1, 1995, to present, including

  20. csep_transcript_aspen.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    aspen.doc csep_transcript_aspen.doc csep_transcript_aspen.doc csep_transcript_aspen.doc (45.5 KB) More Documents & Publications highperformanceleasingstrategiesforstateandlocalgovernments.doc Using Social Media to Engage the Community in Energy Efficiency Projects.doc webinar_innovation_permitting_inspections

  1. csep_transcript_minneapolis.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    minneapolis.doc csep_transcript_minneapolis.doc csep_transcript_minneapolis.doc csep_transcript_minneapolis.doc (60.5 KB) More Documents & Publications newguideforcommunityenergystrategicplanning.doc csep_transcript_aspen.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, 2011 (Text Version)

  2. Microsoft Word - AL2007-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    7-01.doc Microsoft Word - AL2007-01.doc Microsoft Word - AL2007-01.doc (151.65 KB) More Documents & Publications Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc Microsoft Word - Corp Impl 10-05-06.final.doc Microsoft Word - AL2006-11.doc

  3. titlepg.doc

    Gasoline and Diesel Fuel Update

    6.1 27.7 26.0 17.6 10.0 7 7.8 11.6 No Main Space Heating Equipment............. 1.2 N N N N N N N Have Main Space Heating Equipment.......... 109.8 6.1 27.7 26.0 17.6 10.0 7 7.8 11.6 Use Main Space Heating Equipment........... 109.1 6.1 27.7 26.0 17.6 10.0 7 7.8 11.6 Have Equipment But Do Not Use it.............. 0.8 N N N N N N N Main Space Heating Usage During 2005 Total Number of Rooms (Excluding Bathrooms) None........................................................ 2.1 N Q Q N N N N 1 or

  4. Microsoft Word - BEPA.doc

    National Nuclear Security Administration (NNSA)

    ... or other agreement pursuant to U.S. Fish and Wildlife Service Office of Law ... into cooperative agreements with State fish and wildlife agencies or other appropriate ...

  5. Microsoft Word - Chapter 11.doc

    National Nuclear Security Administration (NNSA)

    ... Continued Operation of the Department of EnergyNational Nuclear Security Administration ... Protection Agency), 2010c, The Green Book Nonattainment Areas for Criteria ...

  6. PIC DOC 01/08/11 ? SOS

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    PIC DOC 010811 - SOS Content Outline 1) Usable Quotes We shouldn't equate public involvement with meetings. Maynard Plahuta Meetings, of many kinds, are probably the most...

  7. csep_transcript_transportation.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    transportation.doc csep_transcript_transportation.doc csep_transcript_transportation.doc csep_transcript_transportation.doc (48 KB) More Documents & Publications csep_transcript_minneapolis.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, 2011 (Text Version) Transcript: Biomass Clean Cities Webinar - Workforce Development

  8. Microsoft Word - FAL2004-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAL2004-03.doc Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-03.doc (538.96 KB) More Documents & Publications Microsoft Word - FAL2004-01.doc Financial Assistance Letter No. FAL 2006-04 Microsoft Word - FAL2006-04.doc

  9. Microsoft Word - AL2000-05.doc | Department of Energy

    Energy Savers

    .doc Microsoft Word - AL2000-05.doc PDF icon Microsoft Word - AL2000-05.doc More Documents & Publications al99-06.doc&0; Microsoft Word - AL2000-05Attachment.doc AL2004-01r2.pdf...

  10. transcript_pv_mapper.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    transcript_pv_mapper.doc transcript_pv_mapper.doc transcript_pv_mapper.doc transcript_pv_mapper.doc (74.5 KB) More Documents & Publications PVMapper: A Tool for Energy Siting transcript_jedi_model.doc 2009 National Electric Transmission Congestion Study - San Francisco Workshop

  11. Property:NEPA TieredDoc | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    TieredDoc Jump to: navigation, search Property Name NEPA TieredDoc Property Type Page This is a property of type Page. Pages using the property "NEPA TieredDoc" Showing 25 pages...

  12. Microsoft Word - al95-14.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    al95-14.doc Microsoft Word - al95-14.doc PDF icon Microsoft Word - al95-14.doc More Documents & Publications Cooperation with the New Independent States of the Former Soviet Union ...

  13. Microsoft Word - AL2006-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    7.doc Microsoft Word - AL2006-07.doc PDF icon Microsoft Word - AL2006-07.doc More Documents & Publications OPAM Policy Acquisition Guides Personal Property Management Certification ...

  14. Microsoft Word - FAC2005-27.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAC2005-27.doc Microsoft Word - FAC2005-27.doc PDF icon Microsoft Word - FAC2005-27.doc More Documents & Publications Policy Flash 2015-07 - FAC 2005-78 Policy Flash Search Listing ...

  15. Microsoft Word - al96-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    6-09.doc Microsoft Word - al96-09.doc PDF icon Microsoft Word - al96-09.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis Chapter...

  16. Microsoft Word - AL2005-08.doc | Department of Energy

    Office of Environmental Management (EM)

    8.doc Microsoft Word - AL2005-08.doc Microsoft Word - AL2005-08.doc More Documents & Publications OPAM Policy Acquisition Guides Attachment FY2011-28 OPAM Microsoft Word -...

  17. Microsoft Word - FAC2005-19.doc | Department of Energy

    Office of Environmental Management (EM)

    FAC2005-19.doc Microsoft Word - FAC2005-19.doc Microsoft Word - FAC2005-19.doc More Documents & Publications Acquisitlon Letter No. AL 2008-06 AL2008-06.pdf fac2001-27.pdf...

  18. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word -...

  19. Microsoft Word - FORM46002.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    2.doc Microsoft Word - FORM46002.doc Microsoft Word - FORM46002.doc More Documents & Publications DOE F 4600.2 ATTACHMENT FLASH 2011-46(6) Attachment FY2011-63 OPAM...

  20. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc More Documents & Publications Microsoft Word - AL 2010-07 Acquistion Letters Remaining...

  1. Microsoft Word - ARRAAttachment12v1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment12v1.doc More Documents & Publications Microsoft Word - DRAFT CRB Interview Guidance.doc Microsoft Word - ARRAGuideAttachment10v1

  2. Microsoft Word - AL2000-01.doc | Department of Energy

    Office of Environmental Management (EM)

    AL2000-01.doc Microsoft Word - AL2000-01.doc PDF icon Microsoft Word - AL2000-01.doc More Documents & Publications ALFAL 99-01 Department of Energy No Microsoft Word -...

  3. Microsoft Word - AL2008-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2008-06.doc Microsoft Word - AL2008-06.doc PDF icon Microsoft Word - AL2008-06.doc More Documents & Publications Chapter 9 - Contracting Qualifications Microsoft Word - PART...

  4. Microsoft Word - 99-04.doc | Department of Energy

    Energy.gov (indexed) [DOE]

    Word - 99-04.doc More Documents & Publications Policy Flash 2014-18 Complex-Wide Strategic Sourcing Microsoft Word - AL2000-01.doc Microsoft Word - AL2005-11.doc...

  5. Microsoft Word - AL2006-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    0.doc Microsoft Word - AL2006-10.doc PDF icon AL2006-10 More Documents & Publications Microsoft Word - Matrixpart2.doc Microsoft Word - AcqGuide70pt52Matrixpart2Redo...

  6. Microsoft Word - AL2004-02.doc | Department of Energy

    Energy.gov (indexed) [DOE]

    Microsoft Word - AL2004-02.doc More Documents & Publications Microsoft Word - AL2005-02.doc Microsoft Word - al2005-04.doc Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all...

  7. Microsoft Word - al95-06.doc | Department of Energy

    Energy Savers

    5-06.doc Microsoft Word - al95-06.doc PDF icon Microsoft Word - al95-06.doc More Documents & Publications ppl970-1.pdf Audit Report: IG-0589 Inspection Report: INS-O-02-01...

  8. Microsoft Word - meritrev.doc | Department of Energy

    Energy Savers

    Microsoft Word - meritrev.doc Microsoft Word - meritrev.doc PDF icon Microsoft Word - meritrev.doc More Documents & Publications Policy Flash 2013-38 Revised Merit Review Guide For...

  9. Operating Guidelines Appendix C D.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Operating Guidelines Appendix C D.DOC&0; Operating Guidelines Appendix C D.DOC&0; PDF icon Operating Guidelines Appendix C D.DOC&0; More Documents & Publications Operating ...

  10. Microsoft Word - AL2006-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2006-11.doc Microsoft Word - AL2006-11.doc PDF icon Microsoft Word - AL2006-11.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis...

  11. Microsoft Word - FAL2006-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAL2006-03.doc Microsoft Word - FAL2006-03.doc PDF icon Microsoft Word - FAL2006-03.doc More Documents & Publications Financial Assistance Letter No. FAL 2006-03 Microsoft Word - ...

  12. Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc |...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Speech 082508 FINAL.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc More Documents & Publications Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc ...

  13. Microsoft Word - 2005 FOIA ANNUAL REPORT.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    2005 FOIA ANNUAL REPORT.doc Microsoft Word - 2005 FOIA ANNUAL REPORT.doc report2005.pdf PDF icon Microsoft Word - 2005 FOIA ANNUAL REPORT.doc More Documents & Publications U.S. ...

  14. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2008-05.doc Microsoft Word - AL2008-05.doc PDF icon Microsoft Word - AL2008-05.doc More Documents & Publications Acquisition Letters Remaining In Effect Acquisition Letters ...

  15. Microsoft Word - Matrixpart2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Matrixpart2.doc Microsoft Word - Matrixpart2.doc PDF icon Microsoft Word - Matrixpart2.doc More Documents & Publications AcqGuide70.52Matrixpart2Redo-OPAM Microsoft Word - ...

  16. Microsoft Word - al2004-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    al2004-03.doc Microsoft Word - al2004-03.doc PDF icon Microsoft Word - al2004-03.doc More Documents & Publications Acquisition Letter: AL2005-08 OPAM Policy Acquisition Guides ...

  17. Microsoft Word - FY09PropertyBSCContractor.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FY09PropertyBSCContractor.doc Microsoft Word - FY09PropertyBSCContractor.doc PDF icon Microsoft Word - FY09PropertyBSCContractor.doc More Documents & Publications FY09 Property ...

  18. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAL2004-05.doc Microsoft Word - FAL2004-05.doc PDF icon Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word - Section ...

  19. Microsoft Word - Brochure_Senior Officials.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    BrochureSenior Officials.doc Microsoft Word - BrochureSenior Officials.doc Microsoft Word - BrochureSenior Officials.doc (29.28 KB) More Documents & Publications Preservation of ...

  20. Microsoft Word - CSATCourseCatalog_02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    CSATCourseCatalog02.doc Microsoft Word - CSATCourseCatalog02.doc classroom-1008856960720.jpg Microsoft Word - CSATCourseCatalog02.doc (554.38 KB) More Documents & Publications ...

  1. Microsoft Word - May2009.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    May2009.doc Microsoft Word - May2009.doc Microsoft Word - May2009.doc (6.77 MB) More Documents & Publications Special Resource StudyEnvironmental Assessment for Manhattan Project ...

  2. Operating Guidelines Appendix A B.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Operating Guidelines Appendix A B.DOC&#0; Operating Guidelines Appendix A B.DOC&#0; Operating Guidelines Appendix A B.DOC&#0; (73.17 KB) More Documents & Publications Operating Guidelines Appendix C D.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; DOE HR Guidebook 12_15_05.DOC&#0;

  3. Microsoft Word - figure_03.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    Oil and Gas Reserves"; PointLogic Energy; Ventyx; and the Bureau of Safety and Environmental Enforcement, and predecessor agencies. IN OH TN WV VA KY MD PA NY VT NH MA CT ME RI ...

  4. Microsoft Word - CERFDOE Final Report - 071204.doc | Department...

    Office of Environmental Management (EM)

    Microsoft Word - CERFDOE Final Report - 071204.doc (394.42 KB) More Documents & Publications Integrated Project Team RM DOE EIR FM.doc Independent Oversight Activity Report, ...

  5. DOE EIR FM.doc | Department of Energy

    Office of Environmental Management (EM)

    EIR FM.doc PDF icon DOE EIR FM.doc More Documents & Publications Contractor Statement of Work (SOW) Template (for EIR) External Independent Review (EIR) Standard Operating...

  6. Microsoft Word - ADR-Provisions-FederalAcquisitionReg.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications ADR Provisions in Federal Acquisition Regulation (FAR) Microsoft Word - ACQUISITION LETTER.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc...

  7. Microsoft Word - AL2005-12.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon Microsoft Word - AL2005-12.doc More Documents & Publications Microsoft Word - AL2005-11.doc OPAM Policy Acquisition Guides Chapter 31 - Contract Cost Principles...

  8. expanding_chp_in_your_state.doc | Department of Energy

    Energy.gov (indexed) [DOE]

    expandingchpinyourstate.doc expandingchpinyourstate.doc (130 KB) More Documents & Publications Combined Heat and Power: Expanding CHP in Your State Sustainable Energy ...

  9. Design Potential of Metal Foil Substrates for Optimized DOC Performanc...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Design Potential of Metal Foil Substrates for Optimized DOC Performance Design Potential of Metal Foil Substrates for Optimized DOC Performance Poster presentation at the 2007 ...

  10. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Energy Savers

    & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross Reference Matrix Introduction.doc Assessment of the Effects of Climate Change on Federal Hydropower...

  11. Microsoft Word - EODchecklist1.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    New Employee Orientation FORMS CHECKLIST EOD Date: Employee Name: Organization: HR Specialist: Phone Number: Admin Contact: Phone Number: New Employee Orientation Forms to be ...

  12. AcqGuide9pt3.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    taken by one agency are recognized and effective for all Executive Branch agencies. ... While in many agencies, the debarment and suspension function resides within the Office of ...

  13. Utah Municipal Power Agency | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Municipal Power Agency Place: Utah Phone Number: (801) 798-7489 Website: www.umpa.cc Facebook: https:www.facebook.compagesUtah-Municipal-Power-Agency152219714819535 Outage...

  14. Edwin Parks (Doc) | Department of Energy

    Office of Environmental Management (EM)

    Doc Parks has over 27 years of active-duty military service with the U.S. Air Force (USAF), serving a broad range of command and staff positions in nuclear operations policy, ...

  15. Microsoft Word - Appendix N_Historical.doc

    Office of Legacy Management (LM)

    N Example Historical Marker and Plaque U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page N-3 Weldon Spring Site LTS&M Plan U.S. Department of...

  16. Form:NEPA Doc | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    NEPA Doc Jump to: navigation, search Input the name of a NEPA Document below. If the document already exists, you will be able to edit its information. AddEdit a NEPA Document...

  17. Microsoft Word - 2011_SER.doc

    Office of Legacy Management (LM)

    Fernald Preserve U.S. Department of Energy Office of Legacy Management Issued May 2012 ... U.S. Department of Energy Fernald Preserve 2011 Site Environmental Report May 2012 Doc. ...

  18. Microsoft Word - Chapter 05 a.doc | Department of Energy

    Office of Environmental Management (EM)

    Microsoft Word - Chapter 05 a.doc Microsoft Word - Chapter 05 a.doc Microsoft Word - Chapter 05 a.doc (7.05 MB) More Documents & Publications Microsoft Word - Chapter 01.doc EIS-0426: Record of Decision EIS-0426: Final Environmental Impact Statement

  19. Microsoft Word - AL2003-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2003-04.doc Microsoft Word - AL2003-04.doc Microsoft Word - AL2003-04.doc (254.1 KB) More Documents & Publications AL2004-01r2.pdf City of Tulare Renewable Biogas Fuel Cell Project Microsoft Word - AL2006-08.doc

  20. Microsoft Word - Chapter 01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Microsoft Word - Chapter 01.doc Microsoft Word - Chapter 01.doc Microsoft Word - Chapter 01.doc (10.76 MB) More Documents & Publications Microsoft Word - Chapter 05 a.doc EIS-0426: Record of Decision EIS-0426: Final Environmental Impact Statement

  1. Microsoft Word - DOETTQuestions.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    DOETTQuestions.doc Microsoft Word - DOETTQuestions.doc Microsoft Word - DOETTQuestions.doc (48.9 KB) More Documents & Publications Microsoft Word - 73FR72036_UC signed 1&#0; Microsoft Word - SRNL Fed Register Response.doc Subcontractor Rights Under CRADAs and WFO Agreements

  2. Microsoft Word - FAL2006-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAL2006-04.doc Microsoft Word - FAL2006-04.doc Microsoft Word - FAL2006-04.doc (74.69 KB) More Documents & Publications Financial Assistance Letter No. FAL 2006-04 Microsoft Word - AL2006-03.doc Microsoft Word - FAL2004-01

  3. Microsoft Word - Federal Register Response _Jan09_.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Federal Register Response _Jan09_.doc Microsoft Word - Federal Register Response _Jan09_.doc Microsoft Word - Federal Register Response _Jan09_.doc (13.88 KB) More Documents & Publications Microsoft Word - Document2 Microsoft Word - Intellectual Property Provisions _NRD-1003_.doc Microsoft Word - ARRAAttachment12v1

  4. Microsoft Word - Final Sample Participant Profile November 2008.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Final Sample Participant Profile November 2008.doc Microsoft Word - Final Sample Participant Profile November 2008.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - DRAFT CRB Interview Guidance

  5. AcqGuide70pt5.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    pt5.doc&#0; AcqGuide70pt5.doc&#0; AcqGuide70pt5.doc&#0; (16.21 KB) More Documents & Publications Chapter 70.3102-05-6: Contractor Compensation - Variable Pay Policy Flash 2016-34 AcqGuide41pt1.doc&#0;

  6. Microsoft Word - PART 970.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PART 970.doc Microsoft Word - PART 970.doc Microsoft Word - PART 970.doc (1.03 MB) More Documents & Publications Searchable Electronic Department of Energy Acquisition Regulation Microsoft Word - Matrixpart2.doc AcqGuide70.52Matrixpart2Redo-OPAM

  7. Microsoft Word - al2005-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    al2005-06.doc Microsoft Word - al2005-06.doc Microsoft Word - al2005-06.doc (139.24 KB) More Documents & Publications Microsoft Word - AL2006-01.doc OPAM Policy Acquisition Guides Acquisition Letter: AL2005-08

  8. DOC-DOE Joint China Mission Statement | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Joint China Mission Statement DOC-DOE Joint China Mission Statement DOC-DOE Joint China Mission Statement DOC-DOE Joint China Mission Statement (109.75 KB) More Documents & Publications DOC-DOE China Mission Announcement Press Release FACT SHEET: U.S.-China Clean Energy Cooperation Announcements US-China Clean Energy Cooperation

  9. RetTrendReport1205.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    RetTrendReport1205.doc&#0; RetTrendReport1205.doc&#0; RetTrendReport1205.doc&#0; (2.58 MB) More Documents & Publications Pension Plans for Contractor Workers April 1-10 comments.doc&#0; POLICY GUIDANCE MEMORANDUM #39 Phased Retirement

  10. Microsoft Word - table_15.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    0 Table 15. Consumption of natural gas by state, 2011-2015 (million cubic feet) a Lease fuel quantities available directly from state agencies' websites or reports are used. For states where these data are not available, lease fuel quantities were estimated by applying an average of the state's historical ratio of lease fuel to gross withdrawals. See Appendix A for further discussion. b Pipeline and Distribution Use volumes include Line Loss, defined as known volumes of natural gas that were the

  11. Microsoft Word - master.doc

    Gasoline and Diesel Fuel Update

    9 (Released January 8, 1999) Energy Information Administration DOE/EIA-0202(99/1Q) Distribution Category UC-950 Short-Term Energy Outlook January 1999 Energy Information Administration Office of Energy Markets and End Use U.S. Department of Energy Washington, DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the U.S. Department of Energy. The information contained herein should be attributed to the Energy

  12. Microsoft Word - CQA2003.doc

    Gasoline and Diesel Fuel Update

    3) Distribution Category UC-950 Cost and Quality of Fuels for Electric Plants 2002 and 2003 June 29, 2006 Energy Information Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. Department of Energy Washington DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the Department of Energy. The information contained herein should not be construed as advocating or reflecting any policy position of

  13. 20NESHAP.fnl.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    ... of meteorological data) TRU Transuranic - (nuclides with atomic numbers greater than uranium) UCC Yucca Flat ... B-2 where E evaporation rate, gs P s equilibrium water ...

  14. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    ... Date: June 25, 2007 Creates, revises, and maintains the content of project documents ... Assigns a unique document number and formatsedits documents Creates PDF files and obtains ...

  15. Microsoft Word - Highlights.doc

    Annual Energy Outlook

    The flow of investment money into commodities markets and ongoing geopolitical concerns in a number of producing countries, including Nigeria, Iraq, and Venezuela, have contributed ...

  16. Microsoft Word - meritrev.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ... Preference: In merit reviewer selection, there should be no preference based on race, ethnic identity, gender, religion, region, age, or institutional affiliation. 3 Number of ...

  17. Microsoft Word - lesht.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Relative Humidity Climatology at the ARM NSA, SGP, and TWP Climate Research Facility ... ACRF Site Start Date End Date Number of Soundings NSA 04282002 11302003 402 SGP 0501...

  18. AL2007-05.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL 2007-05 Acquisition Regulation Date 03292007 ACQUISITION LETTER This Acquisition ... LETTERS REMAINING IN EFFECT NUMBER DATE SUBJECT 93-4 040793 Displaced Workers ...

  19. Microsoft Word - S0171500.doc

    Office of Legacy Management (LM)

    DOE-LM/GJ850-2005 ESL-RPT-2005-03 Alternatives for Mending a Permeable Reactive Barrier at a Former Uranium Milling Site: Monticello, Utah April 2005 Prepared for U. S. Environmental Protection Agency Region 8, Denver, Colorado Under Interagency Agreement DW89953767018 By U. S. Department of Energy Grand Junction, Colorado Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado

  20. n0053200-sitewide.doc

    Office of Legacy Management (LM)

    3200 GJO-PIN 11.6.2 Pinellas Environmental Restoration Project Sitewide Environmental Monitoring Quarterly Progress Report for the Young-Rainey STAR Center April through June 2002 July 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-02GJ79491 Task Order Number ST02-107 Document Number N0053200 Contents DOE/Grand Junction Office Pinellas Environmental Restoration Project July 2002 Page iii Contents Page

  1. Microsoft Word - Clay Memo PMC Coburn Obama 11_9_06.doc | Department...

    Office of Environmental Management (EM)

    Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc More Documents & Publications...

  2. Microsoft Word - DP_cover_and_front matter_FINAL1.DOC | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FINAL1.DOC Microsoft Word - DPcoverandfront matterFINAL1.DOC PDF icon Microsoft Word - DPcoverandfront matterFINAL1.DOC More Documents & Publications Microsoft Word - ...

  3. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc PDF icon Microsoft Word - TSLCC 200750508 rev 1.doc More Documents & Publications FY 2007 Total System ...

  4. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of...

    Office of Environmental Management (EM)

    TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc More Documents & Publications FY 2007 Total System Life...

  5. LATEST_m_93.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    3 AM Change Number M-93-01-02 Federal Facility Agreement and Consent Order Change Control Form Do not use blue ink. Type or print using black ink. Date 123101 Originator Phone H....

  6. Microsoft Word - U0195900.doc

    Office of Legacy Management (LM)

    GJO-2004-589-TAC ESL-RPT-2004-02 ESL-RPT-2004-02 U0195900 Office of Legacy Management ... Number U0195900 Contents DOEOffice of Legacy Management Diffusion Multilayer Sampling ...

  7. Microsoft Word - U0127400.doc

    Office of Legacy Management (LM)

    12-TAR MAC-GWMON 1.8 Chemistry of Phase I Phytoremediation Soils: Work Plan for the Monument Valley, Arizona, UMTRA Project Site September 2001 This page intentionally left blank UMTRA Ground Water Project Chemistry of Phase I Phytoremediation Soils: Work Plan for the Monument Valley, Arizona, UMTRA Project Site September 2001 Prepared for U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Project Number UGW-511-0015-37-000 Document Number U0127400 Work Performed Under DOE

  8. Microsoft Word - APPENDIX E flysheet.doc

    National Nuclear Security Administration (NNSA)

    ... and potential impacts of these activities were assessed using standard methods endorsed by the U.S. Environmental Protection Agency (EPA) and local air pollution control agencies. ...

  9. Microsoft Word - U0186500.doc

    Office of Legacy Management (LM)

    500 GJO-2003-487-TAC GJO-GWSHP 11.7 UMTRA Ground Water Project Wildlife Management Plan for the Evaporation Pond at the Shiprock, New Mexico, UMTRA Site September 2003 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC-13-02GJ79491 Document Number U0186500 DOE/Grand Junction Office Wildlife Management PlanShiprock Evaporation Pond September 2003 Page 1 1.0 Introduction The Proposed Action in the Environmental

  10. Microsoft Word - table_21.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    9 Table 21. Number of natural gas commercial consumers by type of service and state, 2014-2015 R Revised data. Note: Totals may not equal sum of components due to independent rounding. Source: Energy Information Administration (EIA), Form EIA-176, "Annual Report of Natural and Supplemental Gas Supply and Disposition." Please see the cautionary note regarding the number of residential and commercial customers located on the second page of Appendix A of this report. Alabama R 67,718 129

  11. Microsoft Word - Appendix D_LegalDescription.doc

    Office of Legacy Management (LM)

    Site LTS&M Plan July 2005 Doc. No. S0079000 Page D-3 Figure D-1. DOE Property Boundary for the Chemical Plant Area Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. ...

  12. AcqGuide39pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon AcqGuide39pt1.doc&0; More Documents & Publications Chapter 39 - Acquisition of Information Technology AcqGuide38pt1.doc&0; Microsoft Word - AcqGuide16pt1...

  13. AcqGuide70pt31.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon AcqGuide70pt31.doc&0; More Documents & Publications Microsoft Word - AcqGuide70pt31A.doc Policy Flash 2014-26 Acquisition Guide Chapter 70.31A - Costs...

  14. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    22.62 KB) More Documents & Publications Microsoft Word - FOA cover sheet.doc Recovery Act, Office of the Biomass Program,Funding Opportunity Announcements Special Notice Microsoft Word - FOA cover sheet.doc

  15. AcqGuide47pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AcqGuide47pt1.doc&0; PDF icon AcqGuide47pt1.doc&0; More Documents & Publications Chapter 47 - Transportation TEC Working Group Topic Groups Manual Review Key Documents ...

  16. Microsoft Word - N01747_Bldg 100 SAR.doc

    Office of Legacy Management (LM)

    blank U.S. Department of Energy Building 100 Area Site Assessment Report August 2012 Doc. ... 59 Building 100 Area Site Assessment Report U.S. Department of Energy Doc. No. ...

  17. stat_webinar_070913_transcript.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    stat_webinar_070913_transcript.doc stat_webinar_070913_transcript.doc stat_webinar_070913_transcript.doc stat_webinar_070913_transcript.doc (64.5 KB) More Documents & Publications Final Report -Regulatory and Utility Solutions to Advance SunShot Initiative Goals Connecting-to-the-Grid-Guide-6th-edition.pdf Community Renewables: Model Program Rules

  18. 20130226_sunshot_transcript_lbnl.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc (73.5 KB) More Documents & Publications Why Are Resiential PV Prices in Germany So Much Lower Than in the United States? text_alternative_stat_webinar_2012_7_25.docx An Analysis of Residential PV System Price Differences between the United States and Germany

  19. Microsoft Word - ALonEO13423Last.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ALonEO13423Last.doc Microsoft Word - ALonEO13423Last.doc PDF icon Microsoft Word - ALonEO13423Last.doc More Documents & Publications Microsoft Word - AL2008-05.doc Tri-Party ...

  20. Microsoft Word - ITSI award doc 06-D0008 conformed to P00001...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ITSI award doc 06-D0008 conformed to P00001.doc Microsoft Word - ITSI award doc 06-D0008 conformed to P00001.doc More Documents & Publications Policy Flash 2015-02 Acquisition ...

  1. Microsoft Word - Flash2008-09Attachment.doc | Department of Energy

    Energy.gov (indexed) [DOE]

    9Attachment.doc More Documents & Publications Flash2007-02Attachment.doc&0; Microsoft Word - AL2000-05Attachment.doc Flash2007-03Attachment.doc&0;...

  2. Microsoft Word - Policy Flash 2008-04.doc | Department of Energy

    Office of Environmental Management (EM)

    4.doc Microsoft Word - Policy Flash 2008-04.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  3. Microsoft Word - Policy Flash 2008-06.doc | Department of Energy

    Office of Environmental Management (EM)

    6.doc Microsoft Word - Policy Flash 2008-06.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  4. Microsoft Word - DRAFT CRB Interview Guidance.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    DRAFT CRB Interview Guidance.doc Microsoft Word - DRAFT CRB Interview Guidance.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc Microsoft Word - Document2

  5. Microsoft Word - FY08AnnualReport.doc | Department of Energy

    Office of Environmental Management (EM)

    FY08AnnualReport.doc Microsoft Word - FY08AnnualReport.doc PDF icon Microsoft Word - FY08AnnualReport.doc More Documents & Publications Microsoft Word - FY09AnnualReportv1.doc...

  6. Microsoft Word - AL2005-05Revised.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2005-05Revised.doc Microsoft Word - AL2005-05Revised.doc PDF icon Microsoft Word - AL2005-05Revised.doc More Documents & Publications AL2007-03.doc&0; 2011-31 Attachment...

  7. Microsoft Word - AL2000-05Attachment.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Attachment.doc Microsoft Word - AL2000-05Attachment.doc PDF icon Microsoft Word - AL2000-05Attachment.doc More Documents & Publications al99-06attachment.doc&0; EXHIBIT A: CRADA,...

  8. Microsoft Word - e0399102.doc

    Office of Legacy Management (LM)

    UNCONTROLLED IF PRINTED E0399101 GJO-2003-493-TAC MNT 015.20 REV. 06 Copy No. ______ Draft-Final Monticello Site Management Plan October 2003 UNCONTROLLED IF PRINTED Prepared by U.S. Department of Energy Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-02GJ79491 UNCONTROLLED IF PRINTED Contents October 2003 Site Management Plan Page iii Contents Acronyms and Abbreviations

  9. Microsoft Word - August06.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    August 2006 Office of History and Heritage Resources Volume 2, Number 2 In This Issue * B-Reactor Study for Deputy Secretary * Museum and Visitor Center Conference * National Park Service Manhattan Project Resource Study * DOE Headquarters Museum/Visitor Center * Want to Receive Partners in Preservation? * 2007 DOE Cultural Resources Forum: Hanford, Washington * 2006 DOE Cultural Resources Forum: Oak Ridge, Tennessee * K-25 Racetrack? * FPO Funds Field Office Preservation * Pantex Donates Cold

  10. Microsoft Word - May2009.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    009 Volume 4, Number 1 IN THIS ISSUE  DOE Wins ACHP Chairman's Award  Oak Ridge Hosts Energy Communities Alliance for Meeting and Secret Cities Festival  Hanford's B Reactor Named National Historic Landmark  National Trust Awards National Preservation Award for V-Site Restoration  Want to Receive Partners in Preservation?  Public Tours at Savannah River  Remember the ACHP  Status of National Park Service Manhattan Project Study  Touring the B Reactor at Hanford 

  11. Microsoft Word - P450.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Understanding the Role of Thiolate Ligation in Nature's Hydroxylating Heme Enzymes Michael T. Green, 1 John H. Dawson, 2 Harry B. Gray 3 1 Department of Chemistry, The Pennsylvania State University, PA 16802 2 Department of Chemistry and Biochemistry, The University of South Carolina, SC 29208 3 Beckman Institute, California Institute of Technology, Pasadena, CA 91125 Cytochromes P450 are thiolate-ligated heme enzymes that play critical roles in a number of important physiological processes.

  12. AL2007-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    7-02.doc&#0; AL2007-02.doc&#0; AL2007-02.doc&#0; (19.72 KB) More Documents & Publications Department of Energy Acquisition Letter 2013-04 on Executive Compensation Acquisition Letter No. AL 2013-04 Acquisition Letter No. AL 2014-07

  13. Microsoft Word - ACQUISITION LETTER.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ACQUISITION LETTER.doc Microsoft Word - ACQUISITION LETTER.doc Microsoft Word - ACQUISITION LETTER.doc (26.03 KB) More Documents & Publications ACQUISITION LETTER DEAR Part 933 Acquisition Guide Chapter 33.214 - Alternative Dispute Resolution OPAM Policy Acquisition Guides

  14. Microsoft Word - AL2005-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - AL2005-11.doc Microsoft Word - AL2005-11.doc (143.52 KB) More Documents & Publications Acquisition Letter No. AL 2012-04 Revisions to FAR Part 17 Special Contracting Methods and Part 35 Research and Development Contracting Audit Report: OAS-L-13-08

  15. Microsoft Word - LibraryofPriorRulemakings.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    LibraryofPriorRulemakings.doc Microsoft Word - LibraryofPriorRulemakings.doc Microsoft Word - LibraryofPriorRulemakings.doc (28.89 KB) More Documents & Publications Solar Background Document 1 Natural Gas Imports and Exports First Quarter Report 2014 Natural Gas Imports and Exports Second Quarter Report 2014

  16. CompleteProject List.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    CompleteProject List.doc&#0; CompleteProject List.doc&#0; CompleteProject List.doc&#0; (9.47 KB) More Documents & Publications Tribal Energy Program February 2012 Award Project Descriptions CX-008525: Categorical Exclusion Determination 2010 Program Review Meeting

  17. AcqGuide41pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1pt1.doc&#0; AcqGuide41pt1.doc&#0; AcqGuide41pt1.doc&#0; (13.23 KB) More Documents & Publications Chapter 41 - Acquisition of Utility Services Policy Flash 2016-31 Chapter 41: Utilities

  18. AcqGuide42pt3.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    2pt3.doc&#0; AcqGuide42pt3.doc&#0; AcqGuide42pt3.doc&#0; (56.38 KB) More Documents & Publications Chapter 42 - Contract Administration Acquisition Guide Chapter 42.1202 - Novation Agreements Chapter 9.2: Performance Guarantees

  19. AcqGuide9pt2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AcqGuide9pt2.doc&#0; AcqGuide9pt2.doc&#0; AcqGuide9pt2.doc&#0; (16.88 KB) More Documents & Publications Chapter 9.2: Performance Guarantees Policy Flash 2016-32 Chapter 9 - Contracting Qualifications

  20. AcqGuide3pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    pt1.doc&0; AcqGuide3pt1.doc&0; PDF icon AcqGuide3pt1.doc&0; More Documents & Publications POLICY FLASH 2016-04 Procurement Integrity PI Brief 6 15 07 final2&0;

  1. Microsoft Word - Political Activity and the Federal Employee.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Political Activity and the Federal Employee.doc Microsoft Word - Political Activity and the Federal Employee.doc Microsoft Word - Political Activity and the Federal Employee.doc (165.92 KB) More Documents & Publications Political Activity at DOE Facilities by DOE Contractors Audit Report: IG-0473 PROCESSING INVITATIONS FOR A PRESIDENTIAL APPOINTEE

  2. Microsoft Word - al2007-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    al2007-11.doc Microsoft Word - al2007-11.doc Microsoft Word - al2007-11.doc (62.82 KB) More Documents & Publications Acquisition Guide Chapter 19 Update Acquisition Letter: AL2005-08 Microsoft Word - al2004-03

  3. Microsoft Word - competitionincontractingguidev2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc (215.28 KB) More Documents & Publications AcqGuide 5.2-OPAM Acquisition Guide, Chapter 6.1, Competition Requirements Microsoft Word - AG Chapter 6 1 Nov 2010

  4. Microsoft Word - fal2004-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    fal2004-04.doc Microsoft Word - fal2004-04.doc Microsoft Word - fal2004-04.doc (132.28 KB) More Documents & Publications U.S. Department of Energy - Guide to Financial Assistance - Audit Requirements for For-Profit Organizations Financial Assistance Guide (2013) Revised Guide for Financial Assistance

  5. Microsoft Word - Policy Flash 2008-07.doc | Department of Energy

    Office of Environmental Management (EM)

    07.doc Microsoft Word - Policy Flash 2008-07.doc More Documents & Publications Microsoft Word - Policy Flash 2008-10...

  6. Microsoft Word - Policy Flash 2008-10.doc | Department of Energy

    Office of Environmental Management (EM)

    10.doc Microsoft Word - Policy Flash 2008-10.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07...

  7. word2pdf43408.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    YOUR BENEFIT PLAN LOS ALAMOS NATIONAL SECURITY, LLC Retiree Voluntary Accidental Death and Dismemberment Plan (ADD) Questions about Your Coverage In the event You have questions regarding any aspect of Your coverage, You should contact Your Employee Benefits Manager or You may write to us at: The Hartford Group Benefits Division, Customer Service P.O. Box 2999 Hartford, CT 06104-2999 Or call Us at: 1-800-523-2233 When calling, please give Us the following information: 1) the policy number; and

  8. Microsoft Word - U0197800.doc

    Office of Legacy Management (LM)

    Contaminant Rebound in Ground Water in Extraction Wells at the Tuba City, Arizona, Site April 2004 DOE-LM/GJ625-2004 ESL-RPT-2004-04 ESL-RPT-2004-04 U0197800 Analysis of Contaminant Rebound in Ground Water in Extraction Wells at the Tuba City, Arizona, Site April 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado Signature Page Document Number U0197800 Analysis of

  9. CM300DLFinal.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    CM300 Core Status: new users must complete 2 trouble-free training sessions, pass the Core driver's test and execute a sample exchange exam to to work independently during Core sessions. Flex Status: core users must complete 5 trouble-free sessions and pass the FLEX driver's test to work during Flex sessions. To reserve a CM300 session, go to www/ncem.lbl.gov, click on "Microscope Scheduling", use proposal number and password to log in. You may only sign up for 2 sessions per month,

  10. Microsoft Word - table_20.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    8 Table 20. Number of natural gas residential consumers by type of service and state, 2014-2015 Alabama R 769,900 0 R 769,900 768,568 0 768,568 Alaska 126,416 0 126,416 128,605 0 128,605 Arizona 1,186,788 6 1,186,794 1,200,777 6 1,200,783 Arkansas 549,034 0 549,034 550,108 0 550,108 California 10,372,973 408,747 10,781,720 10,539,966 429,631 10,969,597 Colorado 1,690,576 5 1,690,581 1,712,150 3 1,712,153 Connecticut 521,460 1,198 522,658 530,309 1,071 531,380 Delaware 158,502 0 158,502 161,607 0

  11. Microsoft Word - table_22.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    0 Table 22. Number of natural gas industrial consumers by type of service and state, 2014-2015 Alabama 2,973 271 3,244 3,031 269 3,300 Alaska 1 0 1 4 0 4 Arizona 256 130 386 253 147 400 Arkansas 531 478 1,009 538 485 1,023 California 32,266 5,282 37,548 31,771 5,083 36,854 Colorado 986 6,837 7,823 1,018 7,080 8,098 Connecticut 3,340 877 4,217 3,335 610 3,945 Delaware 28 113 141 29 115 144 Florida 165 355 520 152 327 479 Georgia 887 1,594 2,481 951 1,597 2,548 Hawaii 23 0 23 25 0 25 Idaho 115 74

  12. Microsoft Word - table_05.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    3 Table 5. Number of wells producing natural gas by state and the Gulf of Mexico, 2011-2015 Alabama 346 R 6,243 367 R 6,203 402 R 6,174 436 R 6,117 414 6,044 Alaska 2,040 R 274 1,981 R 281 2,006 R 300 2,042 R 338 2,096 329 Arizona 1 5 1 R 4 1 R 3 0 R 6 1 6 Arkansas 165 R 8,428 174 R 9,012 218 R 9,324 233 R 9,778 240 9,965 California 25,958 R 4,240 26,061 R 4,356 26,542 R 4,183 26,835 R 4,211 27,075 4,209 Colorado 5,963 R 43,792 6,456 R 46,141 6,799 R 46,883 7,771 R 46,876 7,733 46,322 Florida 30

  13. Microsoft Word - S03736_ FMP010609.doc

    Office of Legacy Management (LM)

    Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 LMS/CNT/S03736 This page intentionally left blank LMS/CNT/S03736 Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 This page intentionally left blank U.S. Department of Energy Fluid Management Plan For CAU 443: CNTA, Subsurface, Nevada January 2009 Doc. No. S0373600 Page i Contents Acronyms and Abbreviations

  14. Microsoft Word - S04019_GSB.doc

    Office of Legacy Management (LM)

    Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 LMS/GSB/S04019 This page intentionally left blank LMS/GSB/S04019 Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 This page intentionally left blank U.S. Department of Energy Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009, Rev. 3 Doc. No. S04019 Page i Contents Abbreviations

  15. Microsoft Word - S05094_VMR.doc

    Office of Legacy Management (LM)

    08 May 2009 LMS/RVT/S05094 This page intentionally left blank LMS/RVT/S05094 Verification Monitoring Report for the Riverton, Wyoming, Processing Site Update for 2008 May 2009 This page intentionally left blank U.S. Department of Energy Riverton, Wyoming, Verification Monitoring Report May 2009 Doc. No. S05094 Page i Contents 1.0 Introduction ........................................................................................................................1-1 2.0 Site Conditions

  16. Microsoft Word - S05575_AP.doc

    Office of Legacy Management (LM)

    8 through March 2009 for the Shiprock, New Mexico, Site December 2009 LMS/SHP/S05575 This page intentionally left blank LMS/SHP/S05575 Annual Performance Report April 2008 through March 2009 for the Shiprock, New Mexico, Site December 2009 This page intentionally left blank U.S. Department of Energy Annual Performance Report, Shiprock, New Mexico December 2009 Doc. No. S05575 Page i Contents

  17. Microsoft Word - S05949_IR.doc

    Office of Legacy Management (LM)

    Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2009 LMS/MNT/S05949 This page intentionally left blank LMS/MNT/S05949 2009 Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2009 This page intentionally left blank U.S. Department of Energy 2009 Annual Inspection-Monticello, Utah December 2009 Doc. No. S05949 Page i Contents Executive

  18. Microsoft Word - S06093_VMR.doc

    Office of Legacy Management (LM)

    09 April 2010 LMS/RVT/S06093 This page intentionally left blank LMS/RVT/S06093 Verification Monitoring Report for the Riverton, Wyoming, Processing Site Update for 2009 April 2010 This page intentionally left blank U.S. Department of Energy Riverton, Wyoming, Verification Monitoring Report April 2010 Doc. No. S06093 Page i Contents 1.0 Introduction ........................................................................................................................1-1 2.0 Site Conditions

  19. Microsoft Word - S06178_MP.doc

    Office of Legacy Management (LM)

    Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited LMS/RUL/S06178 This page intentionally left blank LMS/RUL/S06178 Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited This page intentionally left blank U.S. Department of Energy Rulison Monitoring Plan July 2010 Doc. No. S06178 Page i Contents 1.0

  20. Microsoft Word - S06182_GCAP.doc

    Office of Legacy Management (LM)

    Groundwater Compliance Action Plan for the Lakeview, Oregon, Processing Site June 2010 LMS/LKP/S06182 This page intentionally left blank LMS/LKP/S06182 Groundwater Compliance Action Plan for the Lakeview, Oregon, Processing Site June 2010 This page intentionally left blank U.S. Department of Energy Groundwater Compliance Action Plan for the Lakeview, Oregon, Processing Site June 2010 Doc. No.S06182 Page i Contents

  1. Microsoft Word - S06596_GW.doc

    Office of Legacy Management (LM)

    Annual Groundwater Report May 2009 through April 2010 September 2010 LMS/MNT/S06596 This page intentionally left blank LMS/MNT/S06596 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report May 2009 through April 2010 September 2010 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report May 2009-April 2010 September 2010 Doc. No. S06596 Page i Contents

  2. [Agency Name]

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    2 1. Introduction The Department of Energy sees the implementation of the Plain Writing Act as an important initiative that helps the Department share relevant information in a way that is clear, concise, and informative. The areas referenced in this report are only a few of the successes we have encountered as we continue to implement the Act. 1. Departmental Plain Writing Officials 2. Ingrid Kolb, Director of the Office of Management, Senior Agency Official Responsible for Plain Writing 3.

  3. Placer County Water Agency | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Placer County Water Agency Jump to: navigation, search Name: Placer County Water Agency Place: California Phone Number: (530) 823-4850 Website: www.pcwa.net Twitter: @PlacerWater...

  4. Texas Municipal Power Agency | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Texas Municipal Power Agency Jump to: navigation, search Name: Texas Municipal Power Agency Place: Texas Sector: Wind energy Phone Number: (936) 873-1100 Website: www.texasmpa.org...

  5. Central Minnesota Municipal Power Agency | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Power Agency Place: Minnesota Phone Number: 507-526-2193 Website: www.cmmpa.org Facebook: https:www.facebook.compagesCentral-Minnesota-Municipal-Power-Agency-CMMPA...

  6. Municipal Energy Agency of MS | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Name: Municipal Energy Agency of MS Place: Mississippi Phone Number: (601) 362-2252 Facebook: https:www.facebook.compagesMunicipal-Energy-Agency-of-Mississippi Outage...

  7. Microsoft Word - 0918rir.doc

    Office of Legacy Management (LM)

    DOE AREAS REMEDIAL INVESTIGATION REPORT for the LABORATORY FOR ENERGY-RELATED HEALTH RESEARCH UNIVERSITY OF CALIFORNIA, DAVIS Prepared for: United States Department of Energy National Nuclear Security Administration Service Center 1301 Clay Street Oakland, California 94612-5208 Prepared by: Weiss Associates 5801 Christie Avenue, Suite 600 Emeryville, California 94608-1827 September 18, 2003 Rev. 0 DOE Oakland Operations Contract DE-AC03-96SF20686 J:\DOE\4007\110\RI_PLAN\0918_REV0\0918RIR.DOC

  8. Microsoft Word - S0131700_NOV04.doc

    Office of Legacy Management (LM)

    S0131700 DOE-LM/GJ757-2004 Office of Legacy Management Monument Valley Ground Water Remediation: Pilot Study Work Plan November 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy, Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Monument Valley GW Remediation Pilot Study Work Plan November 2004 Doc. No. S0131700 Page 3 Signature Page Authors: J. Waugh, S.

  9. Microsoft Word - S03273_Rev1.doc

    Office of Legacy Management (LM)

    Surface, Hot Creek Valley, Nevada, for Calendar Year 2007 September 2008 Rev. 1 DOE-LM/1558-2007 This page intentionally left blank DOE-LM/1558-2008 Post-Closure Inspection and Monitoring Report for Corrective Action Unit 417: Central Nevada Test Area Surface, Hot Creek Valley, Nevada for Calendar Year 2007 September 2008 Rev. 1 This page intentionally left blank U.S. Department of Energy CY 2007 Post-Closure Inspection & Monitoring Report for CAU 417 September 2008, Rev. 1 Doc. No. S0327300

  10. Microsoft Word - S05069_ROD.doc

    Office of Legacy Management (LM)

    Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 LMS/LEH/S05069 This page intentionally left blank LMS/LEH/S05069 Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 This page intentionally left blank U.S. Department of Energy ROD for DOE Areas for LEHR September 2009 Doc. No. S05069, Rev. 0 Page i Contents Acronyms and Abbreviations

  11. Microsoft Word - U0194500July2005.doc

    Office of Legacy Management (LM)

    4500 GJO-2004-579-TAC Office of Legacy Management Refinement of Conceptual Model and Recommendations for Improving Remediation Efficiency at the Shiprock, New Mexico, Site July 2005 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Conceptual Model Refinement and Efficiency Recommendations July 2005 Doc. No.

  12. Microsoft Word - S06654_ESL.doc

    Office of Environmental Management (EM)

    on Smart Grid RFI RedSeal Systems, Inc. 1 October 29, 2010 Office of Electricity Delivery and Energy Reliability US Department of Energy Room 8H033 1000 Independence Avenue, SW Washington, DC 20585 Re: Comments on "Smart Grid RFI: Addressing Policy and Logistical Challenges" 75 FR 57006 [FR Doc. 2010-23251] From: Steve Dauber Vice-President, Marketing RedSeal Systems 2121 South El Camino Real, Suite 300 San Mateo, CA 94403 Ph: 650-645-6209 sdauber@redseal.net www.redseal.net RedSeal

  13. interiorlightingefficiencyformunicipalities.doc | Department of Energy

    Energy Savers

    Proposed Energy Transport Corridors

    doe.gov/media/Myths_and_Facts.pdf http://www.doe.gov/media/Myths_and_Facts.pdf http://www.doe.gov/media/Myths_and_Facts.pdf (143.91 KB) More Documents & Publications Biofuels & Greenhouse Gas Emissions: Myths versus Facts Microsoft Word - 47C468D4-69BA-281F40.doc Biofuels & Greenhouse Gas Emissions: Myths versus Facts

    of Energy

    energy.gov/media/F...Biofuels_Lower_Gas_Prices.pdf

  14. Microsoft Word - Transportation pdf.doc

    National Nuclear Security Administration (NNSA)

    ... These regulations interpret the terms of NEPA and define the ... the less extensive the search for alternatives an agency ... 1995), where the user can enter the pertinent accident ...

  15. M-90-03-02.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    of Hanford Federal Facility Agreement and Consent Order (HFFACO) requirements M-90-10 and M-90- 11 to accelerate joint agency decisions and schedule establishment...

  16. Microsoft Word - Renew the Parks.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    cost of PV systems was the biggest concern. To overcome this barrier, the National Park Service will have to form partnerships with other agencies and groups. Potential...

  17. Microsoft Word - Grant Rating Sheet.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    No Proposed project supports agency education objectives-increasing understanding, awareness and appreciation of the Columbia River system and its many uses? Does it enhance the...

  18. AcqGuide38pt1.doc

    Energy.gov (indexed) [DOE]

    the competitive nature of the purchase. Must agencies conduct Procurement Planning and Market Research before using an FSS contract? Not necessarily. As a general rule, obtaining...

  19. Microsoft Word - 8E2A4440.doc

    Energy.gov (indexed) [DOE]

    48D7DF19-707E-28B27A.doc (126.75 KB) More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - GSP_Charter.doc Department of Energy

    564M_Biomass_Project Descriptions FINAL 120409 (100.66 KB) More Documents & Publications 564M_Biomass_Projects.pdf Microsoft Word - 338M_Geothermal_Project_Descriptions ARRA Projects Chart

    NATIONAL PARKS COMMITTEE ON ENERGY AND NATURAL RESOURCES U.S. SENATE

  20. transcript_jedi_model.doc | Department of Energy

    Energy.gov (indexed) [DOE]

    document icon transcriptjedimodel.doc More Documents & Publications TAP Webcast Transcript July-29, 2009 Scenario Jedi Tools for Designing & Implementing Better Finance Programs

  1. pocforms06a0399.doc | Department of Energy

    Energy.gov (indexed) [DOE]

    More Documents & Publications fleetappforms04f1298.doc&0; OPC Security Whitepaper 3Hardening Guidelines for OPC Hosts Critical Decision 2 (CD-2) Approval Template...

  2. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    A NRC Concurrence with Completion of Remedial Action This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page A-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No.

  3. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    B Real Estate Documentation This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page B-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page

  4. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    NRC Technical Evaluation Report on Revised LTSP This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page D-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page D-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page D-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No.

  5. Enter the Post-Doc: The Untapped Sourcing Pipeline

    SciTech Connect (OSTI)

    Boscow, Ryan B.

    2011-07-30

    This article addresses the potential formulation and utilization of an industry-based Post-Doc program in order to create workforce candidate pipelines with targeted universities.

  6. Effectiveness of a Diesel Oxidation Catalyst (DOC) to control...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion Effectiveness of a ...

  7. Microsoft Word - AL2006-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon Microsoft Word - AL2006-09.doc More Documents & Publications Microsoft PowerPoint - Executive Order13423rbl Sample Contract Language for Construction Using ...

  8. Microsoft Word - FFATA Memo 30 March 2007.doc | Department of...

    Energy.gov (indexed) [DOE]

    FFATA Memo 30 March 2007.doc More Documents & Publications Policy Flash 2014-35 Rescission of American Recovery and Reinvestment Act Reporting Requirements. Flash2008-44attachment....

  9. Doc Cambell's Post Greenhouse Low Temperature Geothermal Facility...

    Open Energy Information (Open El) [EERE & EIA]

    Low Temperature Geothermal Facility Facility Doc Cambell's Post Sector Geothermal energy Type Greenhouse Location Las Cruces, New Mexico Coordinates 32.3123157,...

  10. Microsoft Word - al2006-12.doc | Department of Energy

    Energy.gov (indexed) [DOE]

    Microsoft Word - al2006-12.doc More Documents & Publications Acquisition Letter No. AL 2008-02 Department of Energy Special Report: DOEIG-0934...

  11. Microsoft Word - DOE_Staffing_Study_Cover.doc | Department of...

    Office of Environmental Management (EM)

    Word - DOEStaffingStudyCover.doc More Documents & Publications 2010 DOE Strategic Sustainability Performance Plan - Report to the White House Council on Environmental...

  12. Microsoft Word - AcqGuide71pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1pt1.doc Microsoft Word - AcqGuide71pt1.doc PDF icon Microsoft Word - AcqGuide71pt1.doc More Documents & Publications Chapter 71 - Review and Approval of Contract and Financial ...

  13. Microsoft Word - AcqGuide7pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    pt1.doc Microsoft Word - AcqGuide7pt1.doc ACQUISITION PLANNING PDF icon Microsoft Word - AcqGuide7pt1.doc More Documents & Publications ACQUISITION PLANNING Policy Flash 2015-13 ...

  14. Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc | Department...

    Energy Savers

    ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc More Documents & Publications Microsoft Word -...

  15. Microsoft Word - Flash2009dashxxFAC34.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc More Documents & Publications Federal Acquisition Regulation; Federal...

  16. Microsoft Word - Flash2008-08attachmentFAC22.doc | Department...

    Energy Savers

    Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc More Documents & Publications Policy Flash 2013-75...

  17. Microsoft Word - Flash2007-61FACAttachment.doc | Department of...

    Energy Savers

    Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc More Documents & Publications Microsoft Word -...

  18. Microsoft Word - PolicyFlash2007-10Attch2.doc | Department of...

    Energy Savers

    PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc More Documents & Publications Policy Flash 2013-37 Federal...

  19. Microsoft Word - Policy Flash 2008-02.doc | Department of Energy

    Energy Savers

    Microsoft Word - Policy Flash 2008-02.doc Microsoft Word - Policy Flash 2008-02.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  20. Microsoft Word - Policy Flash 2008-03.doc | Department of Energy

    Energy Savers

    Microsoft Word - Policy Flash 2008-03.doc Microsoft Word - Policy Flash 2008-03.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  1. Microsoft Word - ARRAGuideAttachment10v1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ARRAGuideAttachment10v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - DRAFT CRB Interview Guidance

  2. Microsoft Word - NationalPolicyAssurances5-06.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    NationalPolicyAssurances5-06.doc Microsoft Word - NationalPolicyAssurances5-06.doc PDF icon Microsoft Word - NationalPolicyAssurances5-06.doc More Documents & Publications ...

  3. Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc |...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Press Release RECOMP 2-8-08 REV FINAL.doc Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc PDF icon Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc More ...

  4. Microsoft Word - FY10PropertyBSCFed.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PropertyBSCFed.doc Microsoft Word - FY10PropertyBSCFed.doc PDF icon Microsoft Word - FY10PropertyBSCFed.doc More Documents & Publications Microsoft Word - FY09PropertyBSCContractor...

  5. Microsoft Word - DP_cover_and_front matter_R1_Draft_3.DOC | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    R1Draft3.DOC Microsoft Word - DPcoverandfront matterR1Draft3.DOC PDF icon Microsoft Word - DPcoverandfront matterR1Draft3.DOC More Documents & Publications Microsoft ...

  6. Flash2007-02Attachment.doc

    Energy.gov (indexed) [DOE]

    April 11, 2005 and April 17, 2006, requiring agencies to publish on the Government-wide point of entry (GPE) or e-Buy the documentation required by the FAR to support the use of...

  7. Microsoft Word - FAC2005-27.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    the Act contain the definitions of minority institution and Hispanic-serving institution. ... and comply with 8.405 and 16.505 in a report to the agency senior procurement ...

  8. Microsoft Word - TR01-18.doc

    Office of Legacy Management (LM)

    10 Annual Inspection Report for the Weldon Spring, Missouri, Site January 2011 LMS/WEL/S07299 ENERGY Legacy Management U.S. DEPARTMENT OF This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government nor any agency thereof, nor any of their employees, makes any warranty, express or implied, or assumes any legal liability or responsibility for the accuracy, completeness, or usefulness of any information, apparatus,

  9. Microsoft Word - ayers_jk.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Overview of National Aeronautics and Space Agency Langley Atmospheric Radiation Measurement Project Cloud Products and Validation J.K. Ayers, R. Palikonda, M. Khaiyer, D.R. Doelling, D.A. Spangenberg, M.L. Nordeen, D.N. Phan, and H. Yi Analytical Services and Materials, Inc. Hampton, Virginia P. Minnis and L. Nguyen National Aeronautics and Space Agency Langley Research Center Climate Science Branch Hampton, Virginia Q.Z. Trepte Science Applications International Corporation Hampton, Virginia

  10. Project Summary-TES-SNL.doc. (Conference) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Project Summary-TES-SNL.doc. Citation Details In-Document Search Title: Project Summary-TES-SNL.doc. Abstract not provided. Authors: Siegel, Nathan Phillip Publication Date: ...

  11. Microsoft Word - US_Japan_REE_agenda_ver7.doc | Department of...

    Office of Environmental Management (EM)

    Microsoft Word - USJapanREEagendaver7.doc Microsoft Word - USJapanREEagendaver7.doc U.S. - Japan Roundtable on Rare Earth Elements Research PDF icon Microsoft Word -...

  12. DOE HR Guidebook 12_15_05.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications Operating Guidelines Appendix A B.DOC&0; 2 Jun 03 Roles and Responsibilities CSO Highlighted.doc&0; Operating Guidelines Appendix C...

  13. Microsoft Word - 2007 waste return memoGS.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    2005 FOIA ANNUAL REPORT.doc Microsoft Word - 2005 FOIA ANNUAL REPORT.doc report2005.pdf Microsoft Word - 2005 FOIA ANNUAL REPORT.doc (45.24 KB) More Documents & Publications U.S. Department of Energy 2008 Annual FOIA Report Office of Information Resources (MA-90) ANNUAL FOIA REPORT FOR 2009

    14, 2008 Generators: In the last year there have been several changes in how we handle waste verification failures. A recent memorandum (Policy on compliance of Radioactive Waste Acceptance

  14. Microsoft Word - S08266_App_A-3.doc

    Office of Legacy Management (LM)

    Score 0 Fernald Preserve, Ohio, Wetland Mitigation Monitoring Report U.S. Department of Energy Doc. No. S08266 Appendix A-3, 2011 Amphibian Index of Biotic Integrity Data...

  15. Microsoft Word - VI_12_Degrees Awarded 2015.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    nuclear systems A. Bonasera Post Doc. at INFN - Laboratori Nazionali del Sud, Catania, Italy STUDENTS WHO RECEIVED GRADUATE DEGREES FROM NON-THESIS April 1, 2014 - March 31, 2015 ...

  16. Microsoft Word - Appendix M_ContingencyTrees.doc

    Office of Legacy Management (LM)

    M Groundwater Operable Unit Contingency Trees U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page M-3 Figure M-1. Validation and Statistical...

  17. Microsoft Word - S05993_CY2009 Annual Rpt.doc

    Office of Legacy Management (LM)

    ... Property Utilization and Disposal SEP Solar Evaporation Pond Rocky Flats Annual Report of Site Surveillance and Maintenance Activities-CY 2009 U.S. Department of Energy Doc. No. ...

  18. Microsoft Word - S05993_CY2009 Annual Rpt.doc

    Office of Legacy Management (LM)

    ... of Site Surveillance and Maintenance Activities-CY 2009 U.S. Department of Energy Doc. No. ... Purpose Approval Date Status as of December 31, 2009 Phase II and III Upgrades to Solar ...

  19. Microsoft Word - AL2005-13.doc | Department of Energy

    Energy.gov (indexed) [DOE]

    Microsoft Word - AL2005-13.doc More Documents & Publications PBA2007 Presentation-short-6-19-07DOE&0; Accident Investigation of the February 7, 2013, Scissor Lift Accident in the...

  20. Microsoft Word - AppendixH_CommentResponse.doc

    Office of Legacy Management (LM)

    S06246 Page H-1 Responsiveness Summary The U.S. Department of Energy (DOE) released the ... NFSS Vicinity Property Report U.S. Department of Energy Doc. No. S06246 October 2010 Page ...

  1. Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

    Energy.gov [DOE]

    Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

  2. Microsoft Word - GC Mediation Evaluation _2-06-09_.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy GC Mediation Evaluation _2-06-09_.doc Microsoft Word - GC Mediation Evaluation _2-06-09_.doc Microsoft Word - GC Mediation Evaluation _2-06-09_.doc (29.87 KB) More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc HQ Mediation Program Brochure Microsoft Word - DRAFT CRB Interview Guidance

  3. Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

    Office of Energy Efficiency and Renewable Energy (EERE)

    Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

  4. Microsoft Word - FAL2003-03R.doc | Department of Energy

    Office of Environmental Management (EM)

    3-03R.doc Microsoft Word - FAL2003-03R.doc PDF icon Microsoft Word - FAL2003-03R.doc More Documents & Publications Microsoft Word - FAL2003-03Rattach.doc FAL2003-03Attachment.pdf...

  5. Microsoft Word - National Science Bowl Fact Sheet.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy National Science Bowl Fact Sheet.doc Microsoft Word - National Science Bowl Fact Sheet.doc Microsoft Word - National Science Bowl Fact Sheet.doc (244.47 KB) More Documents & Publications Microsoft Word - National Science Bowl Fact Sheet.doc Idaho Operations AMWTP Fact Sheet Heating Ventilation and Air Conditioning Efficiency

  6. Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy PPL 970-Materials and Inventory 5-9-05.doc Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc (22.24 KB) More Documents & Publications Microsoft Word - al95-06.doc DOE-HDBK-1139-2006 ppl970-3.pdf

  7. DOC-DOE China Mission Announcement Press Release | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    China Mission Announcement Press Release DOC-DOE China Mission Announcement Press Release DOC-DOE China Mission Announcement Press Release DOC-DOE China Mission Announcement Press Release (34.5 KB) More Documents & Publications DOC-DOE Joint China Mission Statement China 2015 Business Development Mission Marketing Flyer DOE-LPO_Email-Update_001_Through_11

  8. Petascale Post-Doc Project a Supercomputing Success Story

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Petascale Post-Doc Project a Supercomputing Success Story Petascale Post-Doc Project a Supercomputing Success Story ARRA-funded program takes petascale computing researchers to the next level March 24, 2014 Contact: Kathy Kincade, +1 510 495 2124, kkincade@lbl.gov petascalepostdocs.jpg From left: Jihan Kim, Filipe Maia, Alice Koniges, Robert Preissl, Brian Austin, Wangyi (Bobby) Liu , Kirsten Fagnan and Praveen Narayanan. The first post-doctoral research project centered at the Department of

  9. Request Number:

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    1074438 Name: Gayle Cooper Organization: nla Address: _ Country: United States Phone Number: Fax Number: nla E-mail: . ~===--------- Reasonably Describe Records Description: Information pertaining to the Department of Energy's cost estimate for reinstating pension benefit service years to the Enterprise Company (ENCO) employees who are active plan participants in the Hanford Site Pension Plan. This cost estimate was an outcome of the DOE's Worker Town Hall Meetings held on September 17-18, 2009.

  10. NDRPProtocolTechBasisCompiled020705.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    ... A very small number of values that were zero were reset to 1. A very small number of reads associated with initials DU1, DU2, DU3, and NMD were removed; these initials had too few ...

  11. Using Other Agencies' Contracts

    Energy.gov [DOE]

    The Department of Energy's (DOE) use of other agencies contracts has increased in recent years. Other agency contracts include Economy Act interagency agreements, Franchise Fund Organizations,...

  12. Microsoft Word - AAFS_Proposal_VB.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    PROPOSAL FACT SHEET PAC cycle: (Do not complete) Date: Assigned Experiment Number Title: Experiment Spokesperson and Alternate: Telephone and...

  13. TWP93.0100104 DOC#: TWP-DOC-1.4 SCIENCE AND SITING STRATEGY FOR THE

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TWP93.0100104 DOC#: TWP-DOC-1.4 SCIENCE AND SITING STRATEGY FOR THE TROPICAL WESTERN PACIFIC ARM CART LOCALE Thomas P. Ackerman The Pennsylvania State University Bill Clements Fairley Barnes Los Alamos National Laboratory David S. Renné National Renewable Energy laboratory Science and Siting Strategy for the Tropical Western Pacific ARM CART Locale Ackennan, T., B. Clements, F. Barnes, and D. Renne DISCLAIMER This is a working document of the Tropical Western Pacific Program of the United

  14. Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy NationalPolicyAssurancesAwardTermsFinal81804.doc Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc (31.13 KB) More Documents & Publications Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc National Policy Assurances to be Incorporated as Award Terms Microsoft Word - NationalPolicyAssurances5-06.doc

  15. Microsoft Word - FAL2004-02.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Subject: Implementation of Fiscal Year (FY) 2004 Legislative Provisions What is the Purpose of this Financial Assistance Letter (FAL)? This FAL provides Contracting Officers and grants personnel guidance for the implementation of certain provisions contained in the Energy and Water Development Appropriations Act, 2004 (Energy & Water Act), Pub. L. 108-137, enacted December 1, 2003 and the Department of Interior and Related Agencies Appropriations Act, 2004 (Interior Act), Pub. L. 108-108,

  16. Microsoft Word - NEPA Fact Sheet 082814.doc

    National Nuclear Security Administration (NNSA)

    National Environmental Policy Act The National Environmental Policy Act (NEPA) of 1969 was enacted by Congress to ensure that federal agencies consider the potential environmental impacts of their proposed actions and alternatives before deciding on a course of action. NEPA requires the preparation of an environmental impact statement (EIS) for major federal actions that may significantly affect the quality of the environment. Under NEPA, the term "environment" encompasses both the

  17. Microsoft Word - Full Thesis.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Fuel Competition in Power Generation and Elasticities of Substitution June 2012 Independent Statistics & Analysis www.eia.gov U.S. Department of Energy Washington, DC 20585 U.S. Energy Information Administration | Fuel Competition in Power Generation and Elasticities of Substitution i This report was prepared by the U.S. Energy Information Administration (EIA), the statistical and analytical agency within the U.S. Department of Energy. By law, EIA's data, analyses, and forecasts are

  18. Microsoft Word - Norwich Final EA.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    36 FINAL ENVIRONMENTAL ASSESSMENT FOR THE NORWICH COGENERATION INITIATIVE, NORWICH, CONNECTICUT U.S. Department of Energy National Energy Technology Laboratory Morgantown, West Virginia March 2011 DOE/EA-1836 FINAL ENVIRONMENTAL ASSESSMENT FOR THE NORWICH COGENERATION INITIATIVE, NORWICH, CONNECTICUT U.S. Department of Energy National Energy Technology Laboratory Morgantown, West Virginia March 2011 DOE/EA-1836 iii March 2011 COVER SHEET Responsible Agency: U.S. Department of Energy (DOE or the

  19. Microsoft Word - CQA2004_20060727.doc

    Gasoline and Diesel Fuel Update

    4) Distribution Category UC-950 Cost and Quality of Fuels for Electric Plants 2003 and 2004 June 30, 2006 (Updated August 2, 2006) Energy Information Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. Department of Energy Washington DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the Department of Energy. The information contained herein should not be construed as advocating or reflecting

  20. Microsoft Word - CQA2005W.doc

    Gasoline and Diesel Fuel Update

    5) Distribution Category UC-950 Cost and Quality of Fuels for Electric Plants 2004 and 2005 December 2006 Energy Information Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. Department of Energy Washington DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the Department of Energy. The information contained herein should not be construed as advocating or reflecting any policy position of

  1. Microsoft Word - CQA2006W.doc

    Gasoline and Diesel Fuel Update

    6) Distribution Category UC-950 Cost and Quality of Fuels for Electric Plants 2005 and 2006 October 2007 Energy Information Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. Department of Energy Washington DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the Department of Energy. The information contained herein should not be construed as advocating or reflecting any policy position of the

  2. Microsoft Word - CQA2008_FINAL.doc

    Gasoline and Diesel Fuel Update

    8) Distribution Category UC-950 Cost and Quality of Fuels for Electric Plants 2007 and 2008 January 2010 U.S. Energy Information Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. Department of Energy Washington DC 20585 This report was prepared by the U.S. Energy Information Administration (EIA), the statistical and analytical agency within the U.S. Department of Energy. By law, EIA's data, analyses, and forecasts are independent of approval by any other officer or

  3. Agency Improvement Plan For Fiscal Year 2006 and Fiscal Year 2007 |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Agency Improvement Plan For Fiscal Year 2006 and Fiscal Year 2007 Agency Improvement Plan For Fiscal Year 2006 and Fiscal Year 2007 Department of Energy Report and Agency Improvement Plan,For Fiscal Year 2006 and Fiscal Year 2007 Agency Improvement Plan For Fiscal Year 2006 and Fiscal Year 2007 (163.45 KB) More Documents & Publications Office of Information Resources (MA-90) Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc FY 2008 E-Government Act

  4. (Document Number)

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    A TA-53 TOUR FORM/RADIOLOGICAL LOG (Send completed form to MS H831) _____________ _____________________________ _________________________________ Tour Date Purpose of Tour or Tour Title Start Time and Approximate Duration ___________________________ ______________ _______________________ _________________ Tour Point of Contact/Requestor Z# (if applicable) Organization/Phone Number Signature Locations Visited: (Check all that apply, and list any others not shown. Prior approval must be obtained

  5. Microsoft Word - NONPHMC_CoC.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    CERTIFICATE OF CONFORMANCE Container Identification Number:_________________________________________________ Section 1. Vent The vent that has been installed on this waste container and the waste packaging meet the requirements of HNF-EP-0063, Section 2.11.4. The vent is an approved vent listed in Appendix H of HNF-EP-0063 or has been approved for use. ~ N/A - Vent Not Required Per HNF-EP-0063 ~ Yes - Vent Model Number: Vent Serial Number: Section 2. Certification Signature of this Certificate

  6. Microsoft Word - AL2006-08.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    (071206) NUMBER DATE SUBJECT 2002-06 081402 Domestic and Foreign Procurement Preference Rules 2002-08 120202 Project Labor Agreements 2005-04 110204 Class Deviation to ...

  7. Microsoft Word - 20050821_Appendix_A.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    0. U.S. Number of Vehicles, Vehicle-Kilometers, Motor Fuel Consumption and Expenditures, 2001 ENERGY INFORMATION ADMINISTRATION HOUSEHOLD VEHICLES ENERGY USE: LATEST A N D TRENDS...

  8. Microsoft Word - NEPA18_Final.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    ... PUREX Plutonium-uranium extraction RCRA Resource ... drift in great numbers in water, especially at or near the ... Plant community. A habitat description based on the dominant ...

  9. Microsoft Word - fellows_nomination_reworked.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    for each individual nomination Candidate Last Name: First Name: Middle Initial: Z Number: Organization: Phone: Mail Stop: Email Address: Nominator Last Name: First Name:...

  10. Microsoft Word - U0192600_January 2004.doc

    Office of Legacy Management (LM)

    Number U0192600 Contents DOEOffice of Legacy Management Tuba City Semi-Annual ... Performance Evaluation DOEOffice of Legacy Management Page iv January 2004 Figure 11a. ...

  11. Microsoft Word - pfam5000_revised.doc

    Office of Scientific and Technical Information (OSTI)

    ... The mean subfamily size is 8, and the largest subfamily, from the Pfam family HVCcapsid (hepatitis C virus capsid protein), contains 1236 sequences. 15 Figure 7: Number of ...

  12. Microsoft Word - Cooper_Tritium.final.doc

    Office of Legacy Management (LM)

    PROCEEDINGS, TOUGH Symposium 2006 Lawrence Berkeley National Laboratory, Berkeley, California, May 15-17, 2006 - 1 - TRITIUM TRANSPORT THROUGH A LOW-PERMEABILITY NATURAL GAS RESERVOIR Clay A. Cooper 1 , Ming Ye 2 , and Jenny Chapman 2 Desert Research Institute 1 2215 Raggio Pkwy Reno, Nevada, 89512, USA E-mail: clay@dri.edu 2 755 E. Flamingo Road Las Vegas, NV 89119, USA ABSTRACT The U.S. Department of Energy and its predecessor agencies conducted a program in the 1960s and 1970s to evaluate

  13. Microsoft Word - 2012O-01.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    1 Subject: PW 1,3,6 and CW-5 February 10, 2012 Page 1 February 10, 2012 Matt McCormick, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd,, Suite 115 Richland WA 99352 Jane Hedges, Program Manager Washington State Department of Ecology 3100 Port of Benton Blvd. Richland, WA 99354 Re: PW 1,3,6 and CW-5 Record of Decision Dear Messrs. McCormick, Faulk and Ms. Hedges,

  14. Microsoft Word - DOE_EA-1454.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    54 Rev. 0 Environmental Assessment Reactivation and Use of Three Former Borrow Sites in the 100-F, 100-H, and 100-N Areas U.S. Department of Energy Richland Operations Office Richland, Washington 99352 March 2003 DOE/EA-1454 Rev. 0 EA for Reactivation and Use of Three Former Borrow Sites in the 100-F, 100-H, and 100-N Areas March 2003 i TABLE OF CONTENTS 1.0 PURPOSE AND NEED FOR AGENCY ACTION ................................................... 1-1 2.0 BACKGROUND

  15. Microsoft Word - HAB adv #147.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    7 Subject: Hanford Budget Process Adopted: April 4, 2003 Page 1 April 4, 2003 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Roy Schepens, Manager U. S Department of Energy, Office of River Protection P.O. Box 450 Richland, WA 99352 John Iani, Regional Administrator U. S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington State Department of Ecology P.O. Box 47600

  16. Microsoft Word - HAB adv #148.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    8 Subject: Hanford Solid Waste EIS Adopted: June 6, 2003 Page 1 June 6, 2003 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Tom Fitzsimmons, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 John Iani, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Re: Revised Draft Hanford Solid Waste Environmental Impact Statement Dear Mssrs. Klein,

  17. Microsoft Word - HABAdv#219 ERDF.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    19 Subject: ERDF Expansion - Record of Decision Amendment Adopted: June 5, 2009 Page 1 June 5, 2009 Dave Brockman, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Program Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd, Suite 115 (B1-46) Richland, WA 99352 Re: Environmental Restoration Disposal Facility (ERDF) Expansion - Record of Decision (ROD) Dear Messrs. Brockman and Faulk, Background ERDF plays a key role

  18. Microsoft Word - HABAdv#237EECA.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    7 Subject: EE/CA for 105-KE Reactor Decommissioning Adopted: Nov. 5, 2010 Page 1 November 5, 2010 Dave Brockman, Manager U.S. Department of Energy, Office of River Protection P.O. Box 450 (H6-60) Richland, WA 99352 Matt McCormick, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd,, Suite 115 Richland WA 99352 Jane Hedges, Program Manager Washington State Department

  19. Microsoft Word - HABAdv#251PIP.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    1 Subject: Hanford Public Involvement Plan Adopted: November 4, 2011 Page 1 November 4, 2011 Scott Samuelson, Manager U.S. Department of Energy, Office of River Protection P.O. Box 450 (H6-60) Richland, WA 99352 Matt McCormick, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd,, Suite 115 Richland WA 99352 Jane Hedges, Program Manager Washington State Department of

  20. Microsoft Word - HABAdv#252LSSC.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    2 Subject: Hanford's 2011 Lifecycle Scope, Schedule, and Cost Report Adopted: November 4, 2011 Page 1 November 4, 2011 Scott Samuelson, Manager U.S. Department of Energy, Office of River Protection P.O. Box 450 (H6-60) Richland, WA 99352 Matt McCormick, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd,, Suite 115 Richland WA 99352 Jane Hedges, Program Manager

  1. Microsoft Word - NEPA18_Final.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    6415 Rev. 18 Hanford Site National Environmental Policy Act (NEPA) Characterization J. P. Duncan, Editor K. W. Burk M. A. Chamness R. A. Fowler B. G. Fritz P. L. Hendrickson E. P. Kennedy G. V. Last T. M. Poston M. R. Sackschewsky M. J. Scott S. F. Snyder M. D. Sweeney P. D. Thorne September 2007 Prepared for the U.S. Department of Energy under Contract DE-AC05-76RL01830 DISCLAIMER This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the

  2. Associate Research Physicist (Post-doc) - NSTX-U | Princeton Plasma Physics

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Lab (Post-doc) - NSTX-U Department: Experimental Supervisor(s): Dr. Luis F. Delgado-Aparicio Staff: RM 1 Requisition Number: 1600451 The Princeton University Plasma Physics Laboratory (PPPL) seeks to fill a post-doctoral research physicist position at the National Spherical Torus Experiment Upgrade (NSTX-U) in Princeton, NJ. For tokamaks and future facilities to operate safely in a high-pressure long-pulse discharge, it is imperative to address key issues associated with impurity sources,

  3. Microsoft Word - 090713HanfordARRAupdate.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Backgrounder Contacts: July 13, 2009 Geoff Tyree, DOE (509) 376-4171, Geoff_Tyree@rl.gov Cameron Hardy, DOE (509) 376-5365, Cameron_M_Hardy@rl.gov Update on Hiring and Recovery Act Funding at the Hanford Site, Richland Operations Office Projects Total Number of Jobs Saved/Created The total number of jobs saved to date with Recovery Act funding for DOE Richland Operations Office projects is approximately 300. The total number of jobs created to date is approximately 900. New Hires in June

  4. Microsoft Word - S04040_tracer.doc

    Office of Legacy Management (LM)

    ... It is likely that the combination of fast-flowing water and accumulation of oxidized iron ... number of tests, the results of the three reactors may not be statistically different. ...

  5. M_16_01_05.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    0, 2402,11:26 AM Change Number M-16-01-05 Federal Facility Agreement and Consent Order Change Control Form Do not use blue ink. Type or print using black ink. Date 12312001...

  6. M_016_01_06.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    5 AM Change Number M-016-01-06 Federal Facility Agreement and Consent Order Change Control Form Do not use blue ink. Type or print using black ink. Date 123101 Originator Phone...

  7. Microsoft Word - Attachment A3.doc

    Office of Environmental Management (EM)

    A3 DRAWING NUMBER 51-W-214-W UNDERGROUND FACILITIES TYPICAL DISPOSAL PANEL Waste Isolation ... A3 Page A3-1 of 1 Drawing 51-W-214-W Underground Facilities Typical Disposal Panel 1

  8. Microsoft Word - SF30_M010.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    ... IDOE 0 5660.18 Management of Nuclear Materials Table J .2.9 DOE-RLIORP Implementing Documents Document NumberTil ASME NQA-1 -2004 Quality Assurance Requirements for Nuclear ...

  9. Microsoft Word - Q0032900-Aug-2004.doc

    Office of Legacy Management (LM)

    DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado Document Number Q0032900 Contents U.S. Department of Energy MMTS OU III ...

  10. Microsoft Word - knuteson-ro.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    ... The number of AERI observations used in the monthly statistics is shown in Figure 4 as a ... The opposite is true for the monthly statistics of the 10 m observed brightness ...

  11. Microsoft Word - 02 Tilghman.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    APPROPRIATION FY 2015 FY 2015 FY 2016 FY 2017 Enacted Current Enacted Request 1 $ % Department of Energy Budget by Appropriation Energy and Water Development, and Related Agencies Energy Programs Energy Efficiency and Renewable Energy 1,914,195 1,840,847 2,069,194 2,898,400 +829,206 +40.1% Electricity Delivery and Energy Reliability 146,975 143,901 206,000 262,300 +56,300 +27.3% Nuclear Energy 833,379 821,883 986,161 993,896 +7,735 +0.8% Office of Technology Transitions 0 0 0 8,400 +8,400 N/A

  12. First NESAP Post-doc Takes on BoxLib

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    First NESAP Post-doc Takes on BoxLib First NESAP Post-doc Takes on BoxLib Brian Friesen to Work with Ann Almgren's Group in CCSE June 22, 2015 brianfriesenphoto Brian Friesen, PhD The first of eight post-doctoral researchers participating in the NERSC Exascale Science Applications Program (NESAP) is now working full time at NERSC. Brian Friesen, a graduate student in computational astrophysics at the University of Oklahoma, joined the NESAP team May 18. He's been assigned to Ann Almgren's group

  13. Microsoft Word - AL-PO-0001-0007.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Authorized List Doc. ID: OP-AL-0001-007.doc Off-Hours Shift Operator Date: 2001/11/20 This policy is effective 11/20/2001 and denotes those individuals who have been authorized for Off-Hours Shift Operation. 1. Alderman, Steven 2. Aigeldinger, Georg 3. Baethke, Niko 4. Bauer, Benjamin 5. Brendebach, Boris 6. Day, Lorraine 7. Desta, Yohannes 8. Doomes, Edward 9. Dust, Reinhard 10. Farquar, George 11. Fluegge, Michael 12. Goettert, Jost 13. Koch, Kevin 14. Kong, Jong Ren 15. Lian, Kun 16. Ling,

  14. Microsoft Word - 1751a.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    This form shall be protected as LANS Employment Sensitive and/or LANS Employment Sensitive/PII when one or a combination of the following personal information is revealed in a LANS record: Education, salary, medical history, employment history, social security number, date and place of birth, or mother's maiden name. Form 1751a Revision Date: 1/14 Page 1 of 2 Section I: Employee Information Employee Name Z Number Date of Qualifying Event Mailing Address (New Hires or Change of Address Only)

  15. Microsoft Word - CBFO Manager Transition.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    8 Tremont St., Suite 530 | Boston, MA 02108 | www.catf.us | 617.624.0234 COMMENTS OF THE CLEAN AIR TASK FORCE ON THE DRAFT REPORT OF THE SEAB TASK FORCE ON THE FUTURE OF NUCLEAR POWER September 20, 2016 The draft report correctly identifies a number of the key obstacles and challenges to expansion of nuclear energy, and we agree with a number of its recommendations, especially in the area of expanding NRC capability to license non light water reactors. CATF also applauds the report's recognition

  16. Federal Agency NEPA Procedures

    Energy.gov [DOE]

    Each Federal agency is required to develop NEPA procedures that supplement the CEQ Regulations. Developed in consultation with CEQ, Federal agency NEPA procedures must meet the standards in the CEQ...

  17. Microsoft Word - FY07AnnualReport.doc | Department of Energy

    Energy.gov (indexed) [DOE]

    FY07AnnualReport.doc More Documents & Publications Microsoft Word - FY08AnnualReport.doc Audit Report: IG-0857 Attachment 5 Volume II Pricing Matrix.xls...

  18. Microsoft Word - 0-PEP-6-14-07.doc | Department of Energy

    Energy Savers

    Word - 0-PEP-6-14-07.doc Microsoft Word - 0-PEP-6-14-07.doc PSF.pdf More Documents & Publications Sample Project Execution Plan Project Execution Plan Review Module (RM) Microsoft...

  19. Microsoft Word - g413.3-10Final5-6-08.doc | Department of Energy

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    g413.3-10Final5-6-08.doc Microsoft Word - g413.3-10Final5-6-08.doc DOEEVMSGoldCardSep2011.pdf More Documents & Publications EVMS and Project Analysis Standard Operating...

  20. V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerabilit...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability June 25, 2013 - 12:41am Addthis PROBLEM: ...

  1. RFQ DE-RQ01-04ME90001.doc | Department of Energy

    Energy Savers

    DE-RQ01-04ME90001.doc&0; More Documents & Publications Ammendment 2.doc Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&0; Operating Guidelines Appendix A B...

  2. Ex Parte Memo - 09 02 Mtg-09.09.10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Parte Memo - 09 02 Mtg-09.09.10.doc Ex Parte Memo - 09 02 Mtg-09.09.10.doc Summary of ex parte meeting on energy efficiency standards PDF icon Ex Parte Memo - 09 02 ...

  3. Application to Export Electric Energy OE Doc No. EA-339-A Shell...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Doc No. EA-339-A Shell Energy North America (US), L.P. Application to Export Electric Energy OE Doc No. EA-339-A Shell Energy North America (US), L.P. Application from Shell Energy ...

  4. Microsoft Word - VI_12_Degrees Awarded 2015.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    4 - March 31, 2015 Name Year Thesis Title Advisor Present Position Hua Zheng 2014 Density and temperature in quantum nuclear systems A. Bonasera Post Doc. at INFN - Laboratori Nazionali del Sud, Catania, Italy STUDENTS WHO RECEIVED GRADUATE DEGREES FROM NON-THESIS April 1, 2014 - March 31, 2015 Name Year Advisor Present Position Issac Sarver 2014 R. Rapp

  5. Microsoft Word - ex15-ITER-sept10.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    5 - Rights in Data-Special Works - ITER UT-B Contracts Div Sept 2010 Page 1 of 1 ex15-ITER-sept10.doc Exhibit 15-ITER Ref: FAR 52.227-17 RIGHTS IN DATA SPECIAL WORKS ITER ...

  6. Microsoft Word - Corp Impl 10-05-06.final.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Corp Impl 10-05-06.final.doc Microsoft Word - Corp Impl 10-05-06.final.doc Microsoft Word - Corp Impl 10-05-06.final.doc (422.79 KB) More Documents & Publications ESTABLISHMENT OF MANAGEMENT DECISIONS ON OFFICE OF INSPECTOR GENERAL REPORTS, DOE O 221.3 Microsoft Word - AL2007-01.doc DOE Systems Engineering Methodology (SEM): Stage Exit V

  7. Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy National Policy AssurancesAwardTermsREVJuly2005.doc Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc (31.87 KB) More Documents & Publications Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc National Policy Assurances to be Incorporated as Award Terms Microsoft Word - NationalPolicyAssurances5-06

  8. Microsoft Word - AcqGuide70pt31A.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AcqGuide70pt31A.doc Microsoft Word - AcqGuide70pt31A.doc Microsoft Word - AcqGuide70pt31A.doc (30.08 KB) More Documents & Publications AcqGuide70pt31.doc&#0; Acquisition Guide Chapter 70.31A - Costs Associated with Whistleblower Actions Acquisition Letter No. AL-2016-06

  9. DOE/Grand Junction Office Bluewater LTSP July 1997 Doc. No. S00012AA...

    Office of Legacy Management (LM)

    DOEGrand Junction Office Bluewater LTSP July 1997 Doc. No. S00012AA, Page iii Contents Page 1.0 Introduction ......

  10. Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion

    Energy.gov [DOE]

    Performance of two commercially available DOCs with different precious metal loadings and Pt:Pd ratios were compared to model DOC containing Pt only

  11. Microsoft Word - Q00336-Sept- 2004.doc

    Office of Legacy Management (LM)

    652 U.S. Department of Energy Remedial Action Report for the Interim Remedial Action Record of Decision Operable Unit III, Surface Water and Ground Water Monticello Mill Tailings (USDOE) Site, Monticello, Utah EPA CERCLIS Identification Number UT 3890090035 September 2004 Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy

  12. Microsoft Word - FIA-12-0061.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    John P. Newton ) ) Filing Date: October 9, 2012 ) Case No.: FIA-12-0061 ) ) Issued: October 31, 2012 _______________ Decision and Order _______________ On October 9, 2012, John P. Newton ("Appellant") filed an Appeal from determinations issued to him on September 6, 2012, and September 12, 2012, by the Office of Information Resources (OIR) of the Department of Energy (DOE) (FOIA Request Numbers HQ-2012-01768-F & HQ-2012-01835-F). In those determinations, OIR responded to two

  13. Microsoft Word - FIA-12-0063.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    the Native Hawaiian Legal ) Corporation. ) ) Filing Date: October 12, 2012 ) Case No.: FIA-12-0063 ) ) Issued: October 31, 2012 _______________ Decision and Order _______________ On October 12, 2012, the Native Hawaiian Legal Corporation ("Appellant") filed an Appeal from a determination issued to it on September 11, 2012, by the Golden Field Office (GFO) of the United States Department of Energy (DOE) (FOIA Request Number GO-12-296). In its determination, the GFO responded to the

  14. Microsoft Word - UPDATE 4 - Unit 4.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    4 to: A Dispersion Modeling Analysis of Downwash from Mirant's Potomac River Power Plant Modeling Unit 4 Emissions at Maximum and Minimum Loads ENSR Corporation December 23, 2005 Document Number 10350-002-410 (Update 4) December, 2005 1-1 1.0 INTRODUCTION This report describes dispersion modeling performed for Unit 4 at Mirant's Potomac River Generating Station. The modeling was performed according to the Protocol approved by the Virginia Department of Environmental Quality. The purpose of the

  15. Microsoft Word - Actinin_Safinya.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    3 Structure of Actin Cross-linked with α-Actinin: A Network of Bundles Olivier Pelletier, Elena Pokidysheva, Linda S. Hirst, Nate Bouxsein, Youli Li and Cyrus R. Safinya Materials and Physics Departments, Biomolecular Science & Engineering Program, Materials Research Laboratory, University of California, Santa Barbara, California 93106 With the emerging proteomics era, the biosciences community is now challenged to elucidate the structures and functions of a large number of interacting

  16. Microsoft Word - CSC Scorecard.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Energy Fee Determination Posting Requirements Office of Environmental Management Attachment 2 Award Fee Determination Scorecard Contractor: Computer Sciences Corporation (CSC) Contract: Occupational Health Services Contract Number: DE-AC06-04RL14383 Award Period: 10/01/2011 to 09/30/2012 Basis of Evaluation: Performance and Evaluation Plan (PEMP) for Period FY 2012 Award Fee Available: $916,130.00 Award Fee Earned: $824,517.00 (90%) Award Fee Area Adjectival Ratings: Performance Incentive

  17. Microsoft Word - ISDAC_orientation_pkt.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    ORIENTATION PACKAGE ISDAC Field Campaign March 29 - May 2 Fairbanks, Alaska 1 Welcome to Alaska! This information package is to help you become familiar with the area and answer some questions you might have as you arrive. If you have any questions please feel free to contact Debbie at 509.392.1854. Contents Cell Phone Numbers Fairbanks * Campaign Info Site Locations in Fairbanks Badging and Access Mission Schedule Safety Network and Communications Office Equipment * Local Information * Map Cell

  18. Microsoft Word - NERSC_Results.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Reliability Results of NERSC Systems Akbar Mokhtarani, William Kramer, Jason Hick NERSC - LBNL Abstract In order to address the needs of future scientific applications for storing and accessing large amounts of data in an efficient way, one needs to understand the limitations of current technologies and how they may cause system instability or unavailability. A number of factors can impact system availability ranging from facility-wide power outage to a single point of failure such as network

  19. Microsoft Word - Fact Sheet Environment 100808 FINAL.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Environment 100808 FINAL.doc Microsoft Word - Fact Sheet Environment 100808 FINAL.doc Microsoft Word - Fact Sheet Environment 100808 FINAL.doc (56.51 KB) More Documents & Publications Major Communications Report May 5, 2009 Major Communications Report April 30, 2009 Major Communications Report April 28, 2009

  20. Microsoft Word - va_Final3a_06-04-032.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    vaFinal3a06-04-032.doc Microsoft Word - vaFinal3a06-04-032.doc PDF icon Microsoft Word - vaFinal3a06-04-032.doc More Documents & Publications DOE F 473.2 Headquarters ...

  1. Microsoft Word - ADR Revised Policy82508Reformatted.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy ADR Revised Policy82508Reformatted.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc (52.42 KB) More Documents & Publications ADR Policy Federal Register Document 2009 ECR FINAL REPORT 2010

  2. Microsoft Word - CHAP02ESH _REVISED1_3.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    CHAP02ESH _REVISED1_3.doc Microsoft Word - CHAP02ESH _REVISED1_3.doc Microsoft Word - CHAP02ESH _REVISED1_3.doc (183.77 KB) More Documents & Publications Regulatory Aspects of ISM COMMENTS&#0; A:\CHAP05PERFASSM(REVISED).PDF&#0;

  3. AcqGuide35pt1rev2.doc | Department of Energy

    Energy Savers

    AcqGuide35pt1rev2.doc&0; AcqGuide35pt1rev2.doc&0; AcqGuide35pt1rev2.doc&0; More Documents & Publications Attachment FY2011-58 OPAM Chapter 35 - Research and Development...

  4. Microsoft Word - Bill's version 5-20-05.doc | Department of Energy

    Energy Savers

    Bill's version 5-20-05.doc Microsoft Word - Bill's version 5-20-05.doc Microsoft Word - Bill's version 5-20-05.doc (717.91 KB) More Documents & Publications Audit Report: IG-0690 Audit Report: OAS-M-06-04 Audit Report: OAI-M-16-15

  5. NDIA_PMSC_SurveillanceGuide_Oct2004.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    NDIA_PMSC_SurveillanceGuide_Oct2004.doc NDIA_PMSC_SurveillanceGuide_Oct2004.doc NDIA_PMSC_SurveillanceGuide_Oct2004.doc (117.26 KB) More Documents & Publications EVMS Surveillance Standard Operating Procedure (ESSOP) NDIA_PMSC_EVMS_IntentGuide_Nov_2006.pdf Recommendations to Improve EVM and Project Management Integration in the DOE

  6. Microsoft Word - PressRelease_Siting_2-8-06_Final.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PressReleaseSiting2-8-06Final.doc Microsoft Word - PressReleaseSiting2-8-06Final.doc PDF icon Microsoft Word - PressReleaseSiting2-8-06Final.doc More Documents & ...

  7. Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    DOE E-Government Act Report 11.16.06 Final.doc Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc ...

  8. Microsoft Word - FAL2004-01.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Financial Assistance Letters (FALs) that remain in effect are identified below. All other previously issued FALs have been superseded by a formal rulemaking, incorporated into other guidance, and/or canceled. *************** Financial Assistance Letters Remaining in Effect Number Date Subject 96-01 03/08/96 Implementation Guidance on Sections 3001 and 3002 of EPAct 96-02 08/01/96 Implementation Guidance on Section 2306 of EPAct 97-05 12/18/97 Merit Review/Lobbying 2001-02 07/30/01 Preservation

  9. Microsoft Word - S06010_Ltr.doc

    Office of Legacy Management (LM)

    6010 Task Order LM00-502 Control Number 10-0184 January 21, 2010 U.S. Department of Energy Office of Legacy Management ATTN: Jack Craig Site Manager 3600 Collins Ferry Road Morgantown, WV 26505 SUBJECT: Rulison Long-Term Hydrologic Monitoring Program Sampling and Analysis Results for 2009 Dear Mr. Craig: The U.S. Department of Energy (DOE) Office of Legacy Management conducted annual sampling at the Rulison, Colorado, Site for the Long-Term Hydrologic Monitoring Program (LTHMP) on May 11 and 12,

  10. Microsoft Word - U0199700_August 2004.doc

    Office of Legacy Management (LM)

    9700 DOE-EM/GJ708-2004 Tuba City, Arizona, Land Management Project Site Semi-Annual Performance Evaluation September 2003 through February 2004 August 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy, Grand Junction, Colorado This page intentionally left blank Document Number U0199700 Contents U.S. Department of Energy Tuba City Semi-Annual Performance Evaluation August 2004 Page iii Contents 1.0 Introduction

  11. Microsoft Word - u01493_July2002.doc

    Office of Legacy Management (LM)

    97-TAR MAC-GWSHP1.9 Final Ground Water Compliance Action Plan for Remediation at the Shiprock, New Mexico, UMTRA Site July 2002 U0149300 GJO-2001-297-TAR GWSHP1.9 Final Ground Water Compliance Action Plan for Remediation at the Shiprock, New Mexico, UMTRA Site July 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed under DOE Contract No. DE-AC13-96GJ87335 This page intentionally left blank Document Number U0149300 Contents DOE/Grand Junction

  12. AcqGuide70pt5.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Acquisition Guide Chapter 70.3102-05-6 July 2016 Contractor Compensation - Variable Pay [Reference: FAR 31.205-6, DEAR 970.3102 -05-6, DOE Order 350.1] 1.0 Summary of Latest Changes This update: (1) changes the chapter number from 70.5 to 70.3102-05-6 to reflect the applicable FAR part, and (2) includes administrative changes. 2.0 Discussion This chapter supplements other more primary acquisition regulations and policies contained in the references above and should be considered in the context

  13. Microsoft Word - UPDATE 2 - Unit 1.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    2 to: A Dispersion Modeling Analysis of Downwash from Mirant's Potomac River Power Plant Modeling Unit 1 Emissions at Maximum and Minimum Loads ENSR Corporation December 20, 2005 Document Number 10350-002-410 (Update 2) December, 2005 1-1 1.0 INTRODUCTION This report describes AERMOD modeling results performed for Unit 1 at Mirant's Potomac River Generating Station. The purpose of these runs was to demonstrate that operation of Unit 1 for 24 hours a day at loads from 35 MW to 88 MW with the use

  14. Microsoft Word - IAEA moment paper-1.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    The Impact of Tropical Cyclones on Gulf of Mexico Crude Oil and Natural Gas Production Table of Contents 1. Summary 2. Tropical Cyclones in the Gulf of Mexico 3. Tropical Cyclone Impacts on Gulf of Mexico Oil and Natural Gas Production and Refinery Operations 4. Forecasting Shut-In Production A. Model 1: Using the NOAA Forecast of the Atlantic ACE Index to Estimate Shut- In Production B. Model 2: Using the NOAA Forecast of the Number of Atlantic Tropical Cyclones to Estimate Shut-In Production

  15. Microsoft Word - PHMC_CoC.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    CERTIFICATE OF CONFORMANCE (CHPRC) Container Identification Number:_________________________________________________ Section 1. Vent The vent has been installed on this waste container and the waste packaging meets the requirements of HNF-EP-0063, Section 2.11.4. The vent is an approved vent listed in Appendix H of HNF-EP-0063 or has been approved for use. The vent on this container has been procured as a safety significant item. ~ N/A - Vent Not Required Per HNF-EP-0063 ~ N/A - Vent Procured

  16. Microsoft Word - RNA_folding_Herschlag.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    March 2003 Exploring the Folding Landscape of a Structured RNA by SAXS Rick Russell, Ian S. Millett, Sebastian Doniach and Daniel Herschlag Stanford University One goal of genome projects is to systematically identify genes (1,2). The best current knowledge indicates that humans carry approximately 35000 genes. This number is an estimate that varies from expert to expert and range up to 100,000 (3-5). To anyone who has taken an elementary biology class, this ambiguity must seem strange. How hard

  17. CM200DL-Final.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Core Status: new users must complete 2 trouble free training sessions and pass the drivers test to work independently during Core sessions. Flex Status: core users must complete 5 trouble free sessions to work during Flex sessions. To reserve a CM200 session, go to www/ncem.lbl.gov, click on "Microscope Scheduling", use proposal number and password to log in. You may only sign up for one Core session at a time. To cancel a session, email your request to the technical staff in charge

  18. Designation of Non-Federal Agencies as Cooperating Agencies ...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    that are relevant in determining appropriate cooperating agencies, and encourages agencies to document their expectations, roles, and responsibilities (including funding). ...

  19. Notices ENVIRONMENTAL PROTECTION AGENCY

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    076 Federal Register / Vol. 77, No. 250 / Monday, December 31, 2012 / Notices ENVIRONMENTAL PROTECTION AGENCY [ER-FRL-9006-8] Notice of Intent: Designation of an Expanded Ocean Dredged Material Disposal Site (ODMDS) off Charleston, South Carolina AGENCY: U.S. Environmental Protection Agency (EPA) Region 4. ACTION: Notice of Intent to prepare an Environmental Assessment (EA) for the designation of an expanded ODMDS off Charleston, South Carolina. Purpose: EPA has the authority to designate ODMDSs

  20. International Energy Agency (IEA)

    Energy.gov [DOE]

    The International Energy Agency is an international energy forum comprised of 29 industrialized countries under the Organization for Economic Development and Cooperation (OECD).

  1. Microsoft Word - NMMSS News DEC 23 08 Update.doc

    National Nuclear Security Administration (NNSA)

    IS SPONSORED BY DOE AND NRC NMMSS news PUBLISHED PERIODICALLY BY & FOR NMMSS USERS December 23, 2008 SPECIAL EDITION NUREG/BR-0007, Rev.6 Published The NRC wishes to inform industry that it has published its update of NUREG/BR-0007. This NUREG was updated to reflect changes to NMMSS reports that become effective January 1, 2009. Link to the updated NUREG: http://www.nrc.gov/reading-rm/doc-collections/nuregs/brochures/br0007/r6/index.html

  2. Microsoft Word - NO1113_Dewatering report.doc

    Office of Legacy Management (LM)

    C Hydrologic Assessment of Dewatering for Installation of the Belcher Road Water Transmission Line This page intentionally left blank U.S. Department of Energy Dewatering Evaluation Report for Road Const. & Water Line Replacement June 2008 Doc. No. N0111300 Page C-3 The rate of pumping resulting from aquifer dewatering for installation of the planned water transmission line beneath Belcher Road is expected be larger than any of the discharge rates associated with drainage infrastructure

  3. Microsoft Word - S04801_Avian2008 _2_ revised.doc

    Office of Legacy Management (LM)

    Final Report Avian Wetland Surveys at Monticello Mill Tailings Site, 2008 November 2008 LMS/MNT/S04801 This page intentionally left blank LMS/MNT/S04801 Final Report Avian Wetland Surveys at Monticello Mill Tailing Site, 2008 November 2008 This page intentionally left blank U.S. Department of Energy Avian Wetland Surveys at Monticello Mill Tailing Site, 2008 November 2008 Doc. No. S0480100 Page i Contents 1.0 Summary

  4. Microsoft Word - S04816_InvestigationPlan.doc

    Office of Legacy Management (LM)

    New Brunswick, New Jersey, Site Investigation Plan to Identify Potential Radiological Contamination in a Sanitary Sewer December 2008 LMS/NBL/S04816 This page intentionally left blank New Brunswick, New Jersey, Site Investigation Plan to Identify Potential Radiological Contamination in a Sanitary Sewer December 2008 This page intentionally left blank U.S. Department of Energy Investigation Plan to Identify Contamination in a Sanitary Sewer December 2008 Doc. No. S0481600 Page i Contents 1.0

  5. Microsoft Word - S04877_AnnInspRpt2008.doc

    Office of Legacy Management (LM)

    Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2008 LMS/MNT/S04877 This page intentionally left blank LMS/MNT/S04877 2008 Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2008 This page intentionally left blank U.S. Department of Energy 2008 Annual Inspection-Monticello, Utah December 2008 Doc. No. S487700 Page i Contents Executive

  6. Microsoft Word - S04929_GW_Mon_NDEP_Final.doc

    Office of Legacy Management (LM)

    8 Groundwater Monitoring Report Central Nevada Test Area, Corrective Action Unit 443 March 2009 Rev. 1 LMS/CNT/S04929 This page intentionally left blank LMS/CNT/S04929 2008 Groundwater Monitoring Report Central Nevada Test Area, Corrective Action Unit 443 March 2009 Rev. 1 This page intentionally left blank U.S. Department of Energy 2008 Groundwater Monitoring Report-CNTA, CAU 443 March 2009 Doc. No. S04929 Rev. 1 Page i Contents 1.0

  7. Microsoft Word - S04932 History final.doc

    Office of Legacy Management (LM)

    FUSRAP History of the Chupadera Mesa, NM, Site December 2008 Doc. No. S0493200 (FUSRAP NM.04-5) Page 1 of 9 FUSRAP History of the Chupadera Mesa, NM, Site The following historical summary is provided to document the inclusion of the Chupadera Mesa, NM, Site into the Formerly Utilized Sites Remedial Action Program (FUSRAP). Although no remedial action was required, the site met eligibility criterion and was included under FUSRAP, under which the final radiological surveys were performed.

  8. Microsoft Word - S05072_WaterQualityComplStrategy.doc

    Office of Legacy Management (LM)

    Water Quality Compliance Strategy December 2009 LMS/MNT/S05072 This page intentionally left blank LMS/MNT/S05072 Monticello Mill Tailings Site Operable Unit III Water Quality Compliance Strategy December 2009 This page intentionally left blank U.S. Department of Energy MMTS Water Quality Compliance Strategy December 2009 Doc. No. S05072 Page i Contents 1.0 Introduction......................................................................................................................... 1 1.1

  9. Microsoft Word - S05378_2009 GW Rpt.doc

    Office of Legacy Management (LM)

    08 through April 2009 October 2009 LMS/MNT/S05378 This page intentionally left blank LMS/MNT/S05378 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report May 2008 through April 2009 October 2009 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report May 2008-April 2009 October 2009 Doc. No. S05378 Page i Contents

  10. Microsoft Word - S05551_1stqtr report.doc

    Office of Legacy Management (LM)

    09 July 2009 LMS/RFS/S05551 This page intentionally left blank LMS/RFS/S05551 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2009 July 2009 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2009 July 2009 Doc. No. S05551 Page i Contents

  11. Microsoft Word - S05837_FFA 4th qtr 09.doc

    Office of Legacy Management (LM)

    July 1-September 30, 2009 October 2009 Doc. No. S05837 Page 1 Monticello National Priorities List Sites Federal Facilities Agreement (FFA) Quarterly Report: July 1-September 30, 2009 This report summarizes project status and activities implemented July through September 2009, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) sites. This report also includes disposal cell and Pond 4 leachate collection data,

  12. Microsoft Word - S06397_Apr09 thru Mar10.doc

    Office of Legacy Management (LM)

    Groundwater Report April 2009 through March 2010 Tuba City, Arizona, Disposal Site July 2010 LMS/TUB/S06397 This page intentionally left blank LMS/TUB/S06397 Annual Groundwater Report April 2009 through March 2010 Tuba City, Arizona, Disposal Site July 2010 This page intentionally left blank U.S. Department of Energy Tuba City Annual Groundwater Report-April 2009 through March 2010 July 2010 Doc. No. S06397 Page i Contents 1.0 Introduction

  13. Microsoft Word - S06430_JanMar.doc

    Office of Legacy Management (LM)

    31, 2010 April 2010 Doc. No. S06430 Page 1 Monticello, Utah, National Priorities List Sites Federal Facilities Agreement (FFA) Quarterly Report: January 1-March 31, 2010 This report summarizes project status and activities implemented January through March 2010, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) Site. This report also includes disposal cell and Pond 4 leachate collection data, quarterly site

  14. Microsoft Word - S06528_1st qtr 2010.doc

    Office of Legacy Management (LM)

    10 July 2010 LMS/RFS/S06528 This page intentionally left blank LMS/RFS/S06528 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2010 July 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2010 July 2010 Doc. No. S06528 Page i Contents

  15. Microsoft Word - S06584StSoil.doc

    Office of Legacy Management (LM)

    Radiological Assessment of Stained Soils at the Monument Valley Processing Site June 2010 LMS/MON/S06584 This page intentionally left blank LMS/MON/S06584 Radiological Assessment of Stained Soils at the Monument Valley Processing Site June 2010 This page intentionally left blank U.S. Department of Energy Radiological Assessment of Stained Soils at the Monument Valley Processing Site June 2010 Doc. No. S06584 Page i Contents

  16. Microsoft Word - S06770_AprJune.doc

    Office of Legacy Management (LM)

    April 1-June 30, 2010 July 2010 Doc. No. S06770 Page 1 Monticello, Utah, National Priorities List Sites Federal Facilities Agreement (FFA) Quarterly Report: April 1-June 30, 2010 This report summarizes project status and activities implemented April through June 2010, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) Site. This report also includes disposal cell and Pond 4 leachate collection data, quarterly

  17. Microsoft Word - S07079_jul_sep_10.doc

    Office of Legacy Management (LM)

    July 1-September 30, 2010 October 2010 Doc. No. S07079 Page 1 Monticello, Utah, National Priorities List (NPL) Sites Federal Facilities Agreement (FFA) Quarterly Report: July 1-September 30, 2010 This report summarizes project status and activities implemented July through September 2010, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) Site. This report also includes disposal cell and Pond 4 leachate

  18. Microsoft Word - S08999_Apr11-Mar12.doc

    Office of Legacy Management (LM)

    1 Through March 2012 Tuba City, Arizona, Disposal Site July 2012 LMS/TUB/S08999 This page intentionally left blank LMS/TUB/S08999 Annual Groundwater Report April 2011 Through March 2012 Tuba City, Arizona, Disposal Site July 2012 This page intentionally left blank U.S. Department of Energy Tuba City Annual Groundwater Report-April 2011 through March 2012 July 2012 Doc. No. S08999 Page i Contents Abbreviations

  19. Federal Register Volume 75 Number 240; Wednesday, December 15, 2010

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    9:10 Dec 14, 2010 Jkt 223001 PO 00000 Frm 00029 Fmt 4703 Sfmt 4703 E:\FR\FM\15DEN1.SGM 15DEN1 hsrobinson on DSK69SOYB1PROD with NOTICES Federal Register / Vol. 75, No. 240 / Wednesday, December 15, 2010 / Notices 78231 Relay Service (FIRS) at 1-800-877- 8339. [FR Doc. 2010-31503 Filed 12-14-10; 8:45 am] BILLING CODE 4000-01-P DEPARTMENT OF ENERGY Office of Energy Efficiency and Renewable Energy Management of Energy and Water Efficiency in Federal Buildings: Availability of Guidance AGENCY:

  20. Agency-Wide Screening

    Energy.gov [DOE]

    Federal agencies face energy-related requirements on new construction projects and major renovations. These Federal requirements range from reductions in fossil-fuel use to specifying the use of...

  1. State Agency Loan Program

    Energy.gov [DOE]

    Just over half of all SALP loans are directed to Energy Performance Contracts (EPCs) that the Maryland Department of General Services coordinates with the State’s agencies. These EPCs are typical...

  2. Broad Agency Announcements

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Broad Agency Announcements Broad Agency Announcements World-class experts and capabilities countering all aspects of explosive threats, and aiming predominantly at enhanced detection capabilities. LACED can respond to BAAs, so long as the BAA solicitations satisfies FOA criteria noted in "When LACED can Participate" under the FOAs section. When a BAA is relevant to LACED's unique capabilities and its Department of Energy mission, LACED in general may respond to the BAA on its own.

  3. The EURATOM Supply Agency

    SciTech Connect (OSTI)

    Lightner, J.

    1989-11-01

    With the coming liberalization of trade and industry within the European Community (EC) and a more centrally-coordinated EC external trade policy, it is timely to ask if in the 1990s there will be any significant changes in the commercial relations between the EC and non-EC companies trading in nuclear fuel. The key vehicle for implementing any change of policy would probably be the European Atomic Energy Community (EURATOM) Supply Agency in Brussels, which is charged under the EURATOM Treaty with overseeing the equitable supply of nuclear fuel to and among EC companies. The EURATOM Supply Agency (the Agency) is a signatory to almost all EC-company contracts for transactions that occur on the territory of the Community, which includes Belgium, Denmark, France, the Federal Republic of Germany (FRG), Great Britain, Greece, Ireland, Italy, Luxembourg, the Netherlands, Portugal, and Spain. During the 1980s, the Supply Agency has rarely tried to influence the commercial decisions of EC member companies. The nuclear fuel industry has largely perceived the Agency as an administrative office that registers contracts and maintains relations with some outside governments, particularly Australia, Canada, and the USA. However, in 1988 the Agency began to have a more direct commercial impact when it reviewed the practice-previously conducted routinely by the EURATOM Safeguards Directorate in Luxembourg at the request of EC-member companies-of swapping safeguards obligations on equivalent quantities of uranium at different locations (flag swapping). The Agency`s actions inhibiting flag swaps, as well as a related de facto policy restricting material swaps of Southern African uranium, caused it to be viewed as obstructive by some EC companies. During 1989 the discussion about flag swaps and swaps involving South African and Namibian uranium has subsided, and a far-reaching discussion has arisen about EC trade policy in general.

  4. Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Citrix_2FA_Authentication_12_3_2009.doc Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc (453.3 KB) More Documents & Publications Citrix_2FA_Authentication_09.09 Using Two-Factor RSA Token with WebVPN User guide for remote access to VDI and Workplace using RSA token

  5. Microsoft Word - GNEP Website Glossary 2006-02-03_no_links.doc | Department

    Office of Environmental Management (EM)

    of Energy GNEP Website Glossary 2006-02-03_no_links.doc Microsoft Word - GNEP Website Glossary 2006-02-03_no_links.doc Microsoft Word - GNEP Website Glossary 2006-02-03_no_links.doc (29.63 KB) More Documents & Publications GNEP Glossary Generation-IV Roadmap Report of the Fuel Cycle Crosscut Group DOE-HDBK-1113-2008

  6. Microsoft Word - o435.1Chg1Recertification.doc

    Office of Environmental Management (EM)

    competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc (215.28 KB) More Documents & Publications AcqGuide 5.2-OPAM Acquisition Guide, Chapter 6.1, Competition Requirements Microsoft Word - AG Chapter 6 1 Nov 2010

    CITSS Configurable Item List COTS Software CITSS Configurable Items Page 1 January 1998 CI # CITSS Function Vendor/Version Install Date Location Description/Notes SW-001 Data Base Server

  7. Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc (160.81 KB) More Documents & Publications Notice of Proposed Rulemaking (August 6, 2009) Notice of Proposed Rulemaking (May 16, 2007) Final Rule (December 4, 2009)

  8. Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy NSRC precompetitive User Agreement amended 1-18-07.doc Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc (69.15 KB) More Documents & Publications EXHIBIT A: CRADA, WFO, PUA and NPUA Comparison Table, with suggested changes Class_Waiver_NPUA-2.pdf ClassWaiver-PUA.pdf

  9. Microsoft Word - NO1113_Dewatering report.doc

    Office of Legacy Management (LM)

    Description of Groundwater Modeling This page intentionally left blank U.S. Department of Energy Dewatering Evaluation Report for Road Const. & Water Line Replacement June 2008 Doc. No. N0111300 Page A-3 A1.0 Modeling Codes Groundwater flow in the Building 100 area is simulated with the finite-difference code MODFLOW, as developed by the U.S. Geological Survey (McDonald and Harbaugh 1988, Harbaugh and McDonald 1996). The particle tracking module MODPATH (Pollock 1989) is employed to

  10. Microsoft Word - S01187_RVT LTMP.doc

    Office of Legacy Management (LM)

    Management Plan for the Riverton, Wyoming, Processing Site September 2009 LMS/RVT/S001187-0.0 Formerly DOE-LM/1430-2007 This page intentionally left blank LMS/RVT/S01187-0.0 Formerly DOE-LM/1430-2007 Long-Term Management Plan for the Riverton, Wyoming, Processing Site September 2009 This page intentionally left blank U.S. Department of Energy Long-Term Management Plan for the Riverton, Wyoming, Processing Site September 2009 Doc. No. S01187-0.0 Page i Contents

  11. Microsoft Word - S0162200_VariationHydraulicConductivity-PRB.doc

    Office of Legacy Management (LM)

    DOE-LM/GJ803-2005 ESL-RPT-2005-01 Variation in Hydraulic Conductivity Over Time at the Monticello Permeable Reactive Barrier February 2005 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado U.S. Department of Energy Variation in Hydraulic Conductivity Over Time at the Monticello Permeable Reactive Barrier February 2005 Doc. No. S0162200 Page v Contents Executive

  12. Microsoft Word - ex15-ITER-sept10.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    5 - Rights in Data-Special Works - ITER UT-B Contracts Div Sept 2010 Page 1 of 1 ex15-ITER-sept10.doc Exhibit 15-ITER Ref: FAR 52.227-17 RIGHTS IN DATA í SPECIAL WORKS í ITER (Sept 2010) (a) Definitions. (1) "Data", as used in this clause, means recorded information, regardless of form or the media on which it may be recorded. The term includes technical data and computer software. The term does not include information incidental to contract administration, such as financial,

  13. Microsoft Word - ex1b-ITER-mar07.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    B - Patent Rights - Acquisition by the Government - ITER UT-B Contracts Div March 2007 Page 1 of 6 ex1b-ITER-mar07.doc Exhibit 1B ITER Ref: DEAR 952.227-13 PATENT RIGHTS - ACQUISITION BY THE GOVERNMENT - ITER (Mar 2007) (a) Definitions. (1) "Invention", as used in this clause, means any invention or discovery which is or may be patentable or otherwise protectable under title 35 of the United States Code or any novel variety of plant that is or may be protectable under the Plant Variety

  14. Microsoft Word - ex9-ITER-june11.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    - Technical Data - ITER UT-B Contracts Div June 2011 Page 1 of 5 ex9-ITER-june11.doc Exhibit 9 ITER Ref: DEAR 927.409; FAR 52.227-14, 52.227-14 Alt.V, 52.227-16 TECHNICAL DATA - ITER (June 2011) 1. RIGHTS IN DATA - GENERAL (a) Definitions. (1) "Computer data bases," as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include computer software. (2) "Computer

  15. Microsoft Word - ex9ed-ITER-june11.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    ED - Technical Data - ITER UT-B Contracts Div June 2011 Page 1 of 5 ex9ed-ITER-june11.doc Exhibit 9ED ITER Ref: DEAR 927.409; FAR 52.227-14, 52.227-14 Alt. IV, 52.227-14 Alt. V, 52.227-16 TECHNICAL DATA - ITER (June 2011) 1. RIGHTS IN DATA-GENERAL (a) Definitions. (1) "Computer data bases," as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include computer

  16. Microsoft Word - ex9rdf-ITER-sept09.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    RDF - Technical Data - ITER UT-B Contracts Div Sept 2009 Page 1 of 5 ex9rdf-ITER-sept09.doc Exhibit 9RDF-ITER Ref: DEAR 970.5227-1 TECHNICAL DATA - ITER (Sept 2009) 1. Rights in Data-Facilities. (a) Definitions. (1) "Computer Data Bases", as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include Computer Software. (2) "Computer Software", as used in this

  17. Microsoft Word - No Fear Stats FY02.doc

    Office of Environmental Management (EM)

    ... Pending Written Notification 3 Investigation 61 Hearings 115 Final Agency Action 15 Appeal with EEOC Office of Federal Operations NA XI. Complaint Investigations: 29 CFR ...

  18. Microsoft Word - No Fear Stats FY04.doc

    Office of Environmental Management (EM)

    ... Pending Written Notification 8 Investigation 34 Hearings 45 Final Agency Action 10 Appeal with EEOC Office of Federal Operations 28 XI. Complaint Investigations: 29 CFR ...

  19. Microsoft Word - No Fear Stats FY06.doc

    Office of Environmental Management (EM)

    ... Pending Written Notification 1 Investigation 61 Hearings 31 Final Agency Action 14 Appeal with EEOC Office of Federal Operations 24 XI. Complaint Investigations: 29 CFR ...

  20. Microsoft Word - No Fear Stats FY03.doc

    Office of Environmental Management (EM)

    ... Pending Written Notification 12 Investigation 52 Hearings 69 Final Agency Action 15 Appeal with EEOC Office of Federal Operations NA XI. Complaint Investigations: 29 CFR ...

  1. Microsoft Word - Canceled -7 Section C April 16 2010.doc

    Office of Environmental Management (EM)

    ... Law Enforcement Agency LMG Light Machine Gun LRI Live Round Inhibitor LRMB Live Round ... Incident Response Plan SMG Submachine Gun SNM Special Nuclear Material SO Office of ...

  2. Microsoft Word - 25 May Vienna GTR Fact Sheet_FINAL 1 .doc |...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1 .doc More Documents & Publications Global Threat Reduction Initiative U.S. Global Threat Reduction InitiativeU.S.-Origin Nuclear Fuel Removals Global Threat Reduction Initiative...

  3. OSTIblog Articles in the Adopt-A-Doc Topic | OSTI, US Dept of...

    Office of Scientific and Technical Information (OSTI)

    STIP is a robust and effective collaboration across the DOE... Related Topics: .EDUconnections, Adopt-A-Doc, DOE Green Energy, DOE STI, journal literature, National Library of ...

  4. NVN-088208 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    6 months earlier; BLM NOI was just a formality Relevant Numbers Lead Agency Doc Number Serial Number NVN-088208 Lease Numbers NVN-074249 NVN-074250 NVN-074253 NVN-074254 Tiered Doc...

  5. NVN-091276 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20121025 Relevant Numbers Lead Agency Doc Number Serial Number NVN-091276 Lease Numbers NVN-083928 NVN-085708 Tiered Doc DOI-NV-W010-2012-0061...

  6. FEMP Best Practices and Lessons Learned for Federal Agency ESPC Projects: Preliminary Assessment

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5. PRELIMINARY ASSESSMENT (PA) 5.1 To get a useful PA from the ESCO, the agency should provide the ESCO with all relevant current information about the facilities, including energy consumption and previous audits. 5.2 The PA should be only as long as necessary to convey the viability of a project. An example/template of a PA can be found at: http://www1.eere.energy.gov/femp/docs/10_patemplate.docx . 5.3 Set deadlines for PA submission and for agency completion of PA review and response to the

  7. NVN-086287 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20081203 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086287 Lease Numbers NVN-074855 Proposed Action Installation and sampling...

  8. NVN-087930 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Decision Document Date 20090916 Relevant Numbers Lead Agency Doc Number NVN-087930 Serial Number NVN-087930 Lease Numbers NVN-018423 NVN-076291 NVN-083928 NVN-085708 NVN-085709...

  9. NVN-087809 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Decision Document Date 20090612 Relevant Numbers Lead Agency Doc Number NV-087809 Serial Number NV-087809 Lease Numbers NVN-085710 NVN-085711 Proposed Action A Gravity...

  10. NVN-086761 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20090224 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086761 Lease Numbers NVN-079305 NVN-079306 NVN-079307 Proposed Action...

  11. NVN-086286 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    NOI, POO Decision Document Date 20081201 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086286 Lease Numbers NVN-085722 NVN-085723 NVN-085724 Proposed Action The...

  12. NVN-087791 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20090721 Relevant Numbers Lead Agency Doc Number Serial Number NVN-087791 Lease Numbers NVN-074854 NVN-076298 NVN-076299 NVN-076300 NVN-076301...

  13. NVN-086285 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20081201 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086285 Lease Numbers NVN-083928 NVN-085708 NVN-085709 Proposed Action The...

  14. NVN-088259 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20100317 Relevant Numbers Lead Agency Doc Number Serial Number NVN-088259 Lease Numbers NVN-074308 NVN-074309 Proposed Action Closely spaced...

  15. NVN-087812 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20090721 Relevant Numbers Lead Agency Doc Number Serial Number NVN-087812 Lease Numbers NVN-074854 NVN-076298 NVN-076299 NVN-076300 NVN-076301...

  16. NVN-89274 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89274 Lease Numbers NVN-085716 NVN-086893 NVN-088920 Proposed Action...

  17. NVN-087811 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20090721 Relevant Numbers Lead Agency Doc Number Serial Number NVN-087811 Lease Numbers NVN-074854 NVN-076298 NVN-076299 NVN-076300 NVN-076301...

  18. NVN-89534 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Date 20110302 Application Document Type NOI Relevant Numbers Lead Agency Doc Number Serial Number NVN-089534 Lease Numbers NVN-083928 NVN-077668 Proposed Action Two thermal...

  19. NVN-89292 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-089292 Lease Numbers NVN-088435 NVN-088436 NVN-088437 Proposed Action...

  20. DOE/ID-Number

    Office of Scientific and Technical Information (OSTI)

    Microfluidic Sampling System for High Temperature Electrochemical MC&A September 26, 2013 II DISCLAIMER This information was prepared as an account of work sponsored by an agency...

  1. Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc meeting on Energy Efficiency and Sustainable Design of Federal Buildings Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc (99.54 KB) More Documents & Publications Ex Parte Memo - 09 02 Mtg-09.09.10.doc Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc

  2. Designation of Non-Federal Agencies as Cooperating Agencies

    Energy.gov [DOE]

    This Council on Environmental Quality Memorandum (CEQ) urges agencies to more actively solicit the participation of state, tribal and local governments as cooperating agencies in implementing the environmental impact statement process. The Memorandum refers agencies to existing CEQ guidance on the types of actions and expertise that are relevant in determining appropriate cooperating agencies, and encourages agencies to document their expectations, roles, and responsibilities (including funding).

  3. Relative importance of multiple factors on terrestrial loading of DOC to Arctic river networks

    SciTech Connect (OSTI)

    Kicklighter, David W.; Hayes, Daniel J; Mcclelland, James W; Peterson, Bruce; Mcguire, David; Melillo, Jerry

    2014-01-01

    Terrestrial carbon dynamics influence the contribution of dissolved organic carbon (DOC) to river networks in addition to controlling carbon fluxes between the land surface and the atmosphere. In this study, we use a biogeochemical process model to simulate the lateral transfer of DOC from land to the Arctic Ocean via riverine transport. We estimate that the pan-arctic watershed has contributed, on average, 32 Tg C/yr of DOC to the Arctic Ocean over the 20th century with most coming from the extensive area of boreal deciduous needle-leaved forests and forested wetlands in Eurasian watersheds. We also estimate that the rate of terrestrial DOC loading has been increasing by 0.037 Tg C/yr2 over the 20th century primarily as a result of increases in air temperatures and precipitation. These increases have been partially compensated by decreases in terrestrial DOC loading caused by wildfires. Other environmental factors (CO2 fertilization, ozone pollution, atmospheric nitrogen deposition, timber harvest, agriculture) are estimated to have relatively small effects on terrestrial DOC loading to arctic rivers. The effects of the various environmental factors on terrestrial carbon dynamics have both compensated and enhanced concurrent effects on hydrology to influence terrestrial DOC loading. Future increases in riverine DOC concentrations and export may occur from warming-induced increases in terrestrial DOC production associated with enhanced microbial metabolism and the exposure of additional organic matter from permafrost degradation along with decreases in water yield associated with warming-induced increases in evapotranspiration. Improvements in simulating terrestrial DOC loading to pan-arctic rivers in the future will require better information on the spatial distribution of precipitation and its temporal trends, carbon dynamics of larch-dominated ecosystems in eastern Siberia, and the role of industrial organic effluents on carbon budgets of rivers in western

  4. AcqGuideChapter39pt2.doc

    Energy Savers

    FAR 7.103 Agency-head responsibilities. FAR 10.001 Policy. FAR 11.002 Policy. FAR 39.000 Scope of part. FAR 39.2 Electronic and Information Technology. FAR 39.201 Scope of subpart. ...

  5. Microsoft Word - CFAC 7-Year PSA.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    be deemed unreasonable for BPA to require credit security from an assignee with a Moody's credit rating below "A", or the equivalent if rated by another credit rating agency. No...

  6. Microsoft Word - Power Sales Agreement ALCOA - 081909 pm.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    be deemed unreasonable for BPA to require credit security from an assignee with a Moody's credit rating below "A", or the equivalent if rated by another credit rating agency. No...

  7. Microsoft Word - settlement closeout press release _2_ _2_.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    fuel to dry storage, and emptying and closing 11 of 15 underground high- level waste storage tanks. The agency met its commitment providing 30 million to the state over a...

  8. Microsoft Word - FIA-13-0047 & 0048.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ... to use and dispose of the record as it sees fit; (3) The extent to which agency ... Accordingly, DOE cannot use and dispose of the record as it sees fit and the videotape has ...

  9. Microsoft Word - AMI White paper final 013108 _2_.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    NETL Modern Grid Strategy Powering our 21st-Century Economy ADVANCED METERING INFRASTRUCTURE Conducted by the National Energy Technology Laboratory for the U.S. Department of Energy Office of Electricity Delivery and Energy Reliability February 2008 Office of Electricity Delivery and Energy Reliability V1.0 DISCLAIMER This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government nor any agency thereof, nor any of

  10. Microsoft Word - HAB - AdviceDevelopmentTechniques-draft-3.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Final Draft Advice Development and Issue Manager Roles and Responsibilities This process is provided as general guidelines for Issue Managers to consider during the Hanford Advisory Board (HAB) Issue and Advice development process. Identification of Potential Issue * The issue is either identified by a Tri-Party Agreement Agency (Agency) as needing HAB input, or identified by a HAB member and brought to the attention of the appropriate HAB Committee. * Additional information may be required from

  11. Microsoft Word - 48D7DF19-707E-28B27A.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    48D7DF19-707E-28B27A.doc Microsoft Word - 48D7DF19-707E-28B27A.doc PDF icon Microsoft Word - 48D7DF19-707E-28B27A.doc More Documents & Publications Microsoft Word - ...

  12. Microsoft Word - 46ED31B8-1E53-08CF52.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    46ED31B8-1E53-08CF52.doc Microsoft Word - 46ED31B8-1E53-08CF52.doc PDF icon Microsoft Word - 46ED31B8-1E53-08CF52.doc More Documents & Publications Microsoft Word - ...

  13. International Energy Agency

    Energy.gov [DOE]

    DOE's market transformation efforts have reached to European and other countries who are part of the international distributed and decentralized energy community. Through its partnership with DOE, the combined heat and power (CHP) program of the International Energy Agency (IEA) conducts research and analysis of CHP markets and deployment efforts around the world and has used lessons learned from U.S. research, development, and deployment efforts to recommend market transformation activities and policies that will lead to new CHP installations worldwide.

  14. NVN-091277 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Relevant Numbers Lead Agency Doc Number Serial Number NVN-091277 Proposed Action Conduct water sampling, archaeological surveys, and shallow temperature surveys. Data Completion...

  15. NVN-91276 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Mineral Manager none provided Selected Dates Relevant Numbers Lead Agency Doc Number Serial Number NVN-091276 Data Completion Notes No documents from which to populate page. 9...

  16. NVN-89276 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89276 Proposed Action Geochemical survey Documents Serial Register Page:...

  17. NVN-89275 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89275 Proposed Action Geophysical surveys. Documents Serial Register Page:...

  18. NVN-89278 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89278 Proposed Action Geophysical survey. Documents Serial Register Page:...

  19. Microsoft Word - Turbine Manufactures MOU FINAL_5-31-08_.doc | Department

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    of Energy Turbine Manufactures MOU FINAL_5-31-08_.doc Microsoft Word - Turbine Manufactures MOU FINAL_5-31-08_.doc Microsoft Word - Turbine Manufactures MOU FINAL_5-31-08_.doc (65.18 KB) More Documents & Publications Memorandum of Understanding between the U.S. Wind Turbine Manufacturers and the U.S. Department of Energy on Developing a Shared Strategy to Achieve 20% Wind Energy in 2030 Linkages from DOE's Wind Energy Program to Commercial Renewable Power Generation DOE Wind Energy

  20. Find "Hot Docs" at the Geothermal Technologies Legacy Collection | OSTI, US

    Office of Scientific and Technical Information (OSTI)

    Dept of Energy Office of Scientific and Technical Information "Hot Docs" at the Geothermal Technologies Legacy Collection Back to the OSTI News Listing for 2008 The Legacy Collection Now you can get "Hot Docs" from the Geothermal Technologies Legacy Collection. These are documents that have been searched for and downloaded more than any other documents in the collection during the previous month and each preceding month. "Hot Docs" are highlighted for

  1. V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy 5: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability June 25, 2013 - 12:41am Addthis PROBLEM: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability PLATFORM: Apache OpenOffice SDK 3.x ABSTRACT: Apache has acknowledged a vulnerability in Apache OpenOffice SDK REFERENCE LINKS: Apache OpenOffice Secunia Advisory SA53963 Secunia Advisory SA53846 CVE-2013-1571 IMPACT ASSESSMENT:

  2. Microsoft Word - Final_APPROVED_Recommendation2009-01.doc

    Office of Environmental Management (EM)

    DR. ARUN MAJUMDAR DIRECTOR ADVANCED RESEARCH PROJECTS AGENCY-ENERGY U.S. DEPARTMENT OF ENERGY BEFORE THE SUBCOMMITTEE ON INVESTIGATIONS AND OVERSIGHT COMMITTEE ON SCIENCE, SPACE, AND TECHNOLOGY U.S. HOUSE OF REPRESENTATIVES JANUARY 24, 2012 Mr. Chairman, Ranking Member Tonko, and the esteemed Members of this Subcommittee, I want to thank you for inviting me to testify on behalf of the Advanced Research Projects Agency-Energy (ARPA-E) about our recent R&D activities, a recent report by the

  3. Microsoft Word - ARP-III press release Final _2_.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    CH2M-WG Idaho, LLC. News Release For Immediate Release Date: June 23, 2008 Media Contact: Erik Simpson, 208-360-0426 Agencies propose to commence exhumation in third buried waste retrieval area The U.S. Department of Energy (DOE), the U.S. Environmental Protection Agency and the State of Idaho are proposing to expand the removal of buried waste to a third retrieval area at the Idaho National Laboratory Site's Radioactive Waste Management Complex (RWMC). There are currently two adjacent

  4. Notices Marine Corps Base Camp Smith HI Landholding Agency: Navy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    503 Federal Register / Vol. 81, No. 156 / Friday, August 12, 2016 / Notices Marine Corps Base Camp Smith HI Landholding Agency: Navy Property Number: 77201630011 Status: Excess Comments: Public access denied and no alternative method to gain access without compromising national security. Reasons: Secured Area Iowa L80004, RTHBUN-29396 Shower Building in South Fork area Rathbun Project; 13736 Shrike Pl. Mystic IA 52574 Landholding Agency: COE Property Number: 31201630003 Status: Excess Comments:

  5. Number | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Property:NumOfPlants Property:NumProdWells Property:NumRepWells Property:Number of Color Cameras Property:Number of Devices Deployed Property:Number of Plants included in...

  6. Microsoft Word - FINAL_PIC_Apr2007_summary.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    4, 2007 FINAL MEETING SUMMARY HANFORD ADVISORY BOARD PUBLIC INVOLVEMENT AND COMMUNICATION COMMITTEE MEETING April 4, 2007 Clackamas, OR Topics in this Meeting Summary Welcome and Introductions ................................................................................................ 1 Tri-Party Agency Quarterly Update - Look Ahead, Look Back ........................................ 1 Budget Meetings

  7. Microsoft Word - FINAL_PIC_Jan2007_summary.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    January 31, 2007 FINAL MEETING SUMMARY HANFORD ADVISORY BOARD PUBLIC INVOLVEMENT AND COMMUNICATION COMMITTEE MEETING January 31, 2007 Richland, WA Topics in this Meeting Summary Welcome and Introductions............................................................................................................. 1 Tri-Party Agency Quarterly Update - Look Ahead, Look Back..................................................... 1 Budget

  8. Microsoft Word - FINAL_PIC_Sept2007_summary.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    September 5, 2007 FINAL MEETING SUMMARY HANFORD ADVISORY BOARD PUBLIC INVOLVEMENT COMMITTEE MEETING September 5, 2007 Seattle, WA Topics in this Meeting Summary Welcome and Introductions ................................................................................................ 1 Tri-Party Agency Update - Look Ahead, Look Back ........................................................ 1 Debrief of Regional Budget Meetings

  9. Application to Export Electric Energy OE Doc No. EA-339-A Shell...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    78, No. 45 - March 7, 2013 Application to Export Electric Energy OE Doc No. EA-339-A Shell Energy North America (US), L.P.: Federal Register Notice, Volume 78, No. 45 - March 7,...

  10. Microsoft Word - FEMP-State MOU pdf version.doc | Department...

    Energy.gov (indexed) [DOE]

    FEMP-State MOU pdf version.doc (15.06 KB) More Documents & Publications FEMP Peer Review 2001 FEMP Customer Survey Report (Appendices) Federal Utility Partnership Working Group ...

  11. Fact Sheet -- Climate VISION 02-12-031.doc | Department of Energy

    Energy Savers

    Fact Sheet -- Climate VISION 02-12-031.doc&0; (28.89 KB) More Documents & Publications Meeting President Bush's Climate Change Challenge to Business and Industry Climate Vision ...

  12. Microsoft Word - S05516_AttachD1_OrigLndfl_MM_Plan.doc

    Office of Legacy Management (LM)

    ... Energy Doc. No. S05516-1.0 September 2009 Page 3-8 3.4 Soil Cover The cover system at the OLF is designed to meet the minimum soil erosion requirements from both water and wind ...

  13. DOE/ID-Number

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Dry Storage Cask Inventory Assessment Prepared for U.S. Department of Energy Nuclear Fuels Storage and Transportation Planning Project Robert H. Jones Jr. (SRNL) August 31, 2015 FCRD-NFST-2014-000602, Revision 1 SRNL-TR-2014-00193 DISCLAIMER This information was prepared as an account of work sponsored by an agency of the U.S. Government. Neither the U.S. Government nor any agency thereof, nor any of their employees, makes any warranty, expressed or implied, or assumes any legal liability or

  14. EIS-0530: DOC Notice of Availability of a Draft Environmental Impact

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Statement | Department of Energy DOC Notice of Availability of a Draft Environmental Impact Statement EIS-0530: DOC Notice of Availability of a Draft Environmental Impact Statement Nationwide Public Safety Broadband Network Programmatic Environmental Impact Statement for the Southern United States The Department of Commerce announces the availability of the Nationwide Public Safety Broadband Network Draft Programmatic Environmental Impact Statement for the Southern United States. For more

  15. An Energy.gov Mini-Doc: 2016 Collegiate Wind Competition | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy An Energy.gov Mini-Doc: 2016 Collegiate Wind Competition An Energy.gov Mini-Doc: 2016 Collegiate Wind Competition Addthis In this short documentary, we follow three student teams who participated in the 2016 U.S. Department of Energy Collegiate Wind Competition in New Orleans. The competition provides undergraduate students real-world skills they need to enter tomorrow's clean energy workforce. The challenge is to: develop and deliver a business plan, establish a deployment strategy,

  16. NSR Key Number Retrieval

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    NSR Key Number Retrieval Pease enter key in the box Submit

  17. International Energy Agency

    SciTech Connect (OSTI)

    Claudy, D.E.

    1982-01-01

    The International Energy Agency (IEA) responded to the 1973-1974 oil embargo with an emergency allocation program outlined in the Agreement on an International Energy Program (IEP), viewed by the US as an executive agreement and by most participants as a treaty. The IEA's four standing groups on Relations with Producer and other Consumer Countries, on Long-Term Cooperation, on the Oil Market, and on Emergency Questions are organized to accommodate co041869flicting interests through voting rights and to allow constructive interaction among intergovernmental bodies. A description of the allocation system and industry's role in emergencies is followed by a summary of US legal requirements relating to these activities. Four appendices reproduce the IEP Agreement and diagram the IEA organizational structure, the IEA emergency allocation system, and the Emergency Management Organization. (DCK)

  18. International energy agency

    SciTech Connect (OSTI)

    Not Available

    1988-01-01

    The International Energy Agency's emergency oil sharing system is designed to enable member nations to share oil supplied during an oil supply disruption equal to or exceeding 7 percent or more of members' oil supplies. However, participation could have anticompetitive consequences and under U.S. antitrust laws could result in suits against U.S. companies. To ensure participation of major U.S. oil companies, legislation provides a statutory defense against any civil or criminal suit brought under federal or state antitrust laws for some actions. This report describes efforts to expand the antitrust and breach of contract defenses for oil company supply transactions during an oil emergency and to resolve the problem of foreign blockage of information critical to U.S. antitrust review of oil transactions involving foreign affiliates of U.S. companies.

  19. International Energy Agency

    SciTech Connect (OSTI)

    Not Available

    1988-03-01

    The International Energy Agency's emergency oil sharing system is designed to enable member nations to share oil supplies during an oil supply disruption equal to or exceeding 7 percent or more of members' oil supplies. However, participation could have anticompetitive consequences and under U.S. antitrust laws could result in suits against U.S. companies. To ensure participation of major U.S. oil companies, legislation provides a statutory defense against any civil or criminal suit brought under federal or state antitrust laws for some actions. This report describes efforts to expand the antitrust and breach of contract defenses for oil company supply transactions during an oil emergency and to resolve the problem of foreign blockage of information critical to U.S. antitrust review of oil transactions involving foreign affilitates of U.S. companies.

  20. California Environmental Protection Agency | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Agency Jump to: navigation, search Logo: California Environmental Protection Agency Name: California Environmental Protection Agency Address: 1001 I Street, PO Box 2815 Place:...

  1. London Climate Change Agency | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Climate Change Agency Jump to: navigation, search Name: London Climate Change Agency Place: London, Greater London, United Kingdom Zip: SE1 8AA Product: Agency responsible for...

  2. Assam Energy Development Agency | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Energy Development Agency Jump to: navigation, search Name: Assam Energy Development Agency Place: Guwahati, Assam, India Zip: 781005 Sector: Renewable Energy Product: Nodal agency...

  3. Goa Energy Development Agency | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Goa Energy Development Agency Jump to: navigation, search Name: Goa Energy Development Agency Place: Bardez, Goa, India Zip: 403511 Sector: Renewable Energy Product: Nodal agency...

  4. Federal Agency NEPA Procedures | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Federal Agency NEPA Procedures Federal Agency NEPA Procedures Each Federal agency is required to develop NEPA procedures that supplement the CEQ Regulations. Developed in...

  5. Microsoft Word - Deposition Request Form Rev10-12.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Deposition Request Form rev10/12-sm Personal Contact Information Date: ____/____/______ Name:_________________________________ Phone #__________________ E-Mail_____________________________ Project Reference Number: _________________________ Dept _________________ Professor _____________________________ Professor Email ________________________________ Substrate Description ( substrate provided by user) Total Number of Substrates: ________ Deposition Specifications Film

  6. Microsoft Word - Contract Administration Long Testimony _FINAL_.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Statement of Gregory H. Friedman Inspector General Department of Energy Before the Subcommittee on Government Management, Organization and Procurement of the Committee on Oversight and Government Reform U.S. House of Representatives FOR RELEASE ON DELIVERY 2:00 PM July 18, 2007 1 Mr. Chairman and members of the Subcommittee, I am pleased to be here today at your request to testify on issues pertaining to contract management at the Department of Energy. More than any other civilian agency in the

  7. Tentative Agreement as it went to public comment.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Tentative Agreement on Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Negotiations on the Overall Strategy and Approach for Hanford Groundwater Protection, Monitoring and Remediation (Tri-Party Agreement Milestone Series M-024) The U.S. Department of Energy, Richland Operations Office (RL), the State of Washington, Department of Ecology, and the U.S. Environmental Protection Agency (EPA), hereinafter referred to as the parties, have concluded negotiations on an

  8. Microsoft Word - FINAL_Recommendation_2008-01.doc

    Office of Environmental Management (EM)

    i Foreword Environmental justice is the fair treatment and meaningful involvement of all people regardless of race, color, national origin, or income with respect to the development, implementation, and enforcement of environmental laws, regulations, and policies. On February 11, 1994, President Clinton issued Executive Order 12898, Federal Actions to Address Environmental Justice in Minority Populations and Low-Income Populations tasked each federal agency to make achieving EJ part of its

  9. Microsoft Word - FINAL_Recommendation_2008-03.doc

    Office of Environmental Management (EM)

    3 Approved July 30, 2008 1 NORTHERN NEW MEXICO CITIZENS' ADVISORY BOARD (NNMCAB) Recommendation to the Department of Energy Environmental Monitoring, Remediation and Surveillance Committee No. 2008-03 Recommendation for Actions Regarding the EPA Stormwater Discharge Permit Background The U.S. Environmental Protection Agency (EPA) regulates Stormwater discharge at Los Alamos National Laboratory (LANL). A new draft Permit covering the next five years has been issued by the EPA. National Pollution

  10. Microsoft Word - Brochure_Senior Officials.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Preservation of Department of Energy Federal Records __________________________________________ A Reminder for Senior Officials Office of IT Planning, Architecture and E-Government March 2009 Office of the Chief Information Officer 2 Purpose & Scope The Federal Records Act requires the Department of Energy (DOE) to preserve records that reflect the agency functions, policies, decisions, procedures, and operations, as well as documents and datasets that serve as evidence of the

  11. Microsoft Word - National Report 05-02-03.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    May 2003 United States of America National Report Joint Convention on the Safety of Spent Fuel Management and on the Safety of Radioactive Waste Management United States Department of Energy In Cooperation with the United States Nuclear Regulatory Commission United States Environmental Protection Agency United States Department of State -ii- ABSTRACT AND ACKNOWLEDGEMENT The United States of America ratified the "Joint Convention on the Safety of Spent Fuel Management and on the Safety of

  12. Microsoft Word - Second National Report -- Final Rev 30.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    , Rev. 1 October 2005 United States of America Second National Report for the Joint Convention on the Safety of Spent Fuel Management and on the Safety of Radioactive Waste Management United States Department of Energy In Cooperation with the United States Nuclear Regulatory Commission United States Environmental Protection Agency United States Department of State U.S. Second National Report-Joint Convention on the Safety of Spent Fuel Management and on the Safety of Radioactive Waste Management

  13. Microsoft Word - 20111012_RAP Dec_Mtg_Topics.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    October12, 2011 1/2 Potential December RAP Committee Meeting Agenda Topics Topic/Purpose (incl. any framing questions) 2012 Priority? Issue Managers (* denotes lead) Agency Lead (s) Time Allocation 618-10&11 * Characterization (bottles) * Etc. TBD TBD TBD 60 min (30 min) 100 - K * What RAP will do based on review of Proposed Plan * River Corridor decisions - schedule * In situ technology development - status * Discuss potential concerns (advice points?) TBD TBD TBD 120 min Site-wide Permit *

  14. Microsoft Word - CARES 2010.Science Plan.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    7 CARES: Carbonaceous Aerosol and Radiative Effects Study Science Plan May 2010 RA Zaveri Principal Investigator WJ Shaw DJ Cziczo DISCLAIMER This report was prepared as an account of work sponsored by the U.S. Government. Neither the United States nor any agency thereof, nor any of their employees, makes any warranty, express or implied, or assumes any legal liability or responsibility for the accuracy, completeness, or usefulness of any information, apparatus, product, or process disclosed, or

  15. Microsoft Word - FOI 2013-00962.Partial.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    21, 2013 CERTIFIED MAIL Mr. Tom Carpenter Hanford Challenge 219 1 st Avenue South Suite 310 Seattle, Washington 98104 Dear Mr. Carpenter: FREEDOM OF INFORMATION ACT REQUEST (FOI 2013-00962) This letter is in response to your Freedom of Information Act (FOIA) request that you sent to this office requesting agency records relating to or generated in connection with classifying Hanford tank waste as transuranic, or TRU, waste that could be sent to the Waste Isolation Pilot Plant (WIPP) in New

  16. Microsoft Word - Final EA for HARC Battleground.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    9 FINAL ENVIRONMENTAL ASSESSMENT BATTLEGROUND ENERGY RECOVERY PROJECT HARRIS COUNTY, TEXAS U.S. DEPARTMENT OF ENERGY National Energy Technology Laboratory OCTOBER 2011 THIS PAGE INTENTIONALLY LEFT BLANK COVER SHEET Responsible Agency: U.S. Department of Energy Title: Final Environmental Assessment for the Battleground Energy Recovery Project (DOE/EA-1769) Location: Deer Park, Harris County, Texas Contact: William J. Gwilliam, Document Manager National Energy Technology Laboratory U.S. Department

  17. Microsoft Word - HAB Adv #145 Groundwater.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    5 Subject: Groundwater Strategy and Groundwater Protection Adopted: April 4, 2003 Page 1 Apr. 4, 2003 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Roy Schepens, Manager U. S Department of Energy, Office of River Protection P.O. Box 450 Richland, WA 99352 John Iani, Regional Administrator U. S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington State Department of

  18. Microsoft Word - HABChairSelectionProcess_2006.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Chair/Vice-chair/s Selection Process Nominations 1) Board members, alternates and Tri-Party agencies provide nominations for HAB chair (from September to October 15, 2006). a. Nominations may include current HAB members or alternates, or others not currently involved with HAB activities (referred to as "non-HAB candidates"). b. Nominations must be accompanied by a written statement of willingness to serve. c. Candidates should be made aware of the considerable amount of time required

  19. Microsoft Word - NEPA Big Sky Final EA .doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    886 FINAL ENVIRONMENTAL ASSESSMENT For The Big Sky Regional Carbon Sequestration Partnership - Phase III: Kevin Dome Carbon Storage Project U.S. DEPARTMENT OF ENERGY NATIONAL ENERGY TECHNOLOGY LABORATORY April 2013 U.S. Department of Energy Kevin Dome Carbon Storage Project National Energy Technology Laboratory Final Environmental Assessment i April 2013 COVER SHEET Responsible Agency: The U.S. Department of Energy (DOE) Title: Environmental Assessment for the Big Sky Regional Carbon

  20. Microsoft Word - CQA2007W_FINAL.doc

    Gasoline and Diesel Fuel Update

    7) Distribution Category UC-950 Cost and Quality of Fuels for Electric Plants 2006 and 2007 December 2008 Energy Information Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. Department of Energy Washington DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the Department of Energy. The information contained herein should not be construed as advocating or reflecting any policy position of