National Library of Energy BETA

Sample records for agency doc number

  1. Property:NEPA LeadAgencyDocNumber | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    LeadAgencyDocNumber Jump to: navigation, search Property Name NEPA LeadAgencyDocNumber Property Type String This is a property of type String. Pages using the property "NEPA...

  2. Property:NEPA FundingAgencyDocNumber | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    + DOEEA-1676 + N NV-020-03-26 + DE-PS07-02ID14264 + O One Nevada + NA + S Sigurd Red Butte No2 + NA + Retrieved from "http:en.openei.orgwindex.php?titleProperty:NEPAF...

  3. Associate Research Physicist (Post Doc, Experimental Research...

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Post Doc, Experimental Research, NSTX-U, Radio Frequency Waves) Department: Research Staff: RM1 Requisition Number: 1500421 The Princeton Plasma Physics Laboratory (PPPL) seeks to...

  4. raising_investment_funds_for_clean_energy_programs.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc Microsoft ...

  5. howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc (117.5 KB) More Documents & Publications How to Design and Market Energy Efficiency Programs to Specific Neighborhoods Using Social Media to Engage the Community in Energy Efficiency

  6. highperformanceleasingstrategiesforstateandlocalgovernments.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc highperformanceleasingstrategiesforstateandlocalgovernments.doc (93 KB) More Documents & Publications High Performance Leasing Strategies for State and Local Governments Leveraging Portfolio Manager for Disclosure and Green Leasing Practices

  7. Doc...~En.

    Office of Legacy Management (LM)

    ' : ,:#;: .' :.' . ,.:: :,; ..,' ... ..,,..,.... - .~~._ I&i3:scD .::-:, TO-340 .":: ..' . - ' - -. ' . .." ,.. .;.. Very traly yours;, -' .~X :, Doc...~En. ' Br.:Re&ng ';;a' : _, Div. Reading File ., ,, .~, ,.~-

  8. exploringpowerpurchaseagreementsthebasicspart1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc exploringpowerpurchaseagreementsthebasicspart1.doc (112.5 KB) More Documents & Publications Exploring Power Purchase Agreements - The Basics Part 1

  9. finance_programs.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    financeprograms.doc financeprograms.doc financeprograms.doc Microsoft Office document icon financeprograms.doc More Documents & Publications Tools for Designing & Implementing ...

  10. Key Agency Targets Summary _FY 2012_.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    all projects in the capital work plan; and 3) At least 80% of Capital Allocation Board (CAB) approved "major capital investment" projectprogram elements of cost, schedule, and...

  11. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    Agency Notification Agreements This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page E-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008

  12. Weatherization Beyond the Numbers: Case Studies of Fifteen High-performing Weatherization Agencies - Conducted May 2011 through July 2012

    SciTech Connect (OSTI)

    Tonn, Bruce Edward; Rose, Erin M.; Hawkins, Beth A.


    The report presents fifteen individual case studies of high-performing and unique local weatherization agencies. This research was one component of the retrospective evaluation of the U.S. Department of Energy s Weatherization Assistance Program. The agencies were chosen to represent a range of contexts and approaches to weatherization. For example, the set of agencies includes a mix of urban and rural agencies, those that mainly use in-house crews to weatherize homes versus those that use contractor crews, and a mix of locations, from very cold climates to moderate to hot humid and dry climates. The case studies were mainly based on site visits to the agencies that encompassed interviews with program directors, weatherization crews, and recipients of weatherization. This information was supplemented by secondary materials. The cases document the diversity of contexts and challenges faced by the agencies and how they operate on a day-by-day basis. The cases also high common themes found throughout the agencies, such as their focus on mission and respect for their clients.

  13. Doc.~:Ru.

    Office of Legacy Management (LM)

    .' , .' c,j .c; Distriblition:~ ;. <; ~..,:L.D.i&%.ay,FiN-OR00 Doc.~:Ru. ,.,. 75. ' Br..Reading 'ire' ,lliv. Read&q File ,: '. ~ ,, .-' . ...: - SURNAME..

  14. partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc partneringwithutilitiespart2advancedtopicsforlocalgovernments.doc (129.5 KB) More Documents & Publications Partnering With Utilities to Offer Energy Efficiency Programs Webinar Transcript Partnering with Utilities Part 2 - Advanced Topics for Local Governments in Creating

  15. webinar_innovation_financing.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    financing.doc webinarinnovationfinancing.doc webinarinnovationfinancing.doc Microsoft Office document icon webinarinnovationfinancing.doc More Documents & Publications ...

  16. webinar_innovation_planning_zoning.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    planningzoning.doc webinarinnovationplanningzoning.doc webinarinnovationplanningzoning.doc Microsoft Office document icon webinarinnovationplanningzoning.doc More ...

  17. webinar_innovation_organizing_strategizing.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    organizingstrategizing.doc webinarinnovationorganizingstrategizing.doc webinarinnovationorganizingstrategizing.doc Microsoft Office document icon webinarinnovationorganizi...

  18. webinar_innovation_net_metering_interconnection.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    netmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc Microsoft Office document icon ...

  19. fed_finance_facilities_ee_upgrades_deployment.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc Microsoft Office document icon ...

  20. Microsoft Word - FAL2003-03R.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    3-03R.doc Microsoft Word - FAL2003-03R.doc Microsoft Word - FAL2003-03R.doc (198.25 KB) More Documents & Publications WPN 06-8: Dun and Bradstreet Universal Numbering System (DUNS) and Central Contractor Registration (CCR) and Grants.Gov Reminder Microsoft Word - FAL2003-03Rattach.doc WPN 03-7: Grants.Gov: Dun and Bradstreet Universal Numbering System (Duns) and Central Contractor Registration (CCR)

  1. shprkEA.doc

    Office of Legacy Management (LM)

    ... Name Agency or Company Madeline Roanhorse Ray Russell Harlen Charlie Navajo UMTRA Program ... Quality, 13(1):146-150. International Atomic Energy Agency (IAEA), 1994. Handbook of ...

  2. Microsoft Word - 2007 NESHAP Final with Signature page.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    2005 FOIA ANNUAL REPORT.doc Microsoft Word - 2005 FOIA ANNUAL REPORT.doc report2005.pdf Microsoft Word - 2005 FOIA ANNUAL REPORT.doc (45.24 KB) More Documents & Publications U.S. Department of Energy 2008 Annual FOIA Report Office of Information Resources (MA-90) ANNUAL FOIA REPORT FOR 2009

    trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation, or favoring by the U.S. Government or any agency thereof. Available for sale to the

  3. Advanced Research Projects Agency - Energy Program Specific Recovery...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Advanced Research Projects Agency - Energy Program Specific Recovery Plan PDF icon Microsoft Word - 44F1801D.doc More Documents & Publications Microsoft Word - PSRP Updates ...

  4. Environmental Records.doc

    Office of Environmental Management (EM)

    Protection Agency EPCRA Emergency Planning and Community Right-To-Know Act of ... of management services organizations dedicated to solving waste cleanup problems. ...

  5. Microsoft Word - S0244800.doc

    Office of Legacy Management (LM)

    ... ground water from the interceptor drains and extraction wells is solar evaporation. ... Annual Performance Report, Shiprock, New Mexico U.S. Department of Energy Doc. No. ...

  6. Microsoft Word - 08071744_DocProd.doc

    Office of Legacy Management (LM)

    ... Location Specific Information: Ticket Number Location Sample Date Description GIS 005 40-SC 812008 Cat. I GIS 006 5-SC 8122008 Cat. I GIS 007 51-SC 8132008 Cat. II; ...

  7. Microsoft Word - ContractManagementPlanningDRIVERS.doc | Department... (indexed) [DOE]

    ContractManagementPlanningDRIVERS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS.doc Microsoft Word - ARRAMOModelMod.doc...

  8. energydisclosureandleasingstandardsbestpractices.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    energydisclosureandleasingstandardsbestpractices.doc energydisclosureandleasingstandardsbestpractices.doc energydisclosureandleasingstandardsbestpractices.doc (100.5 KB) More Documents & Publications Leveraging Portfolio Manager for Disclosure and Green Leasing Practices Communicating Success, Measuring Improvements, Sharing Results Communicating Success, Measuring Improvements, Sharing Results

  9. TentativeAgreement.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Iani, Region 10 Administrator U.S. Environmental Protection Agency CC: R. Jim, YN P. Sobotta, NPT K. Niles, Oregon Energy W. J. Taylor, ORP R. Gay, CTUIR J. H. Swailes, ORP L....

  10. Category:NEPA Doc | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    NEPA Doc Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Category: NEPA Documents Collections Add.png Add a new NEPA Document Collection Pages in category "NEPA Doc"...

  11. spurring_local_economic_development_clean_energy_programs.doc... (indexed) [DOE]

    spurringlocaleconomicdevelopmentcleanenergyprograms.doc spurringlocaleconomicdevelopmentcleanenergyprograms.doc More Documents & Publications Spurring Local Economic...

  12. webinar_innovation_permitting_inspections.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications webinarinnovationfinancing.doc raisinginvestmentfundsforcleanenergyprograms.doc Communicating Success, Measuring Improvements, Sharing Results

  13. Microsoft Word - AL2002-03.doc | Department of Energy

    Office of Environmental Management (EM)

    2-03.doc Microsoft Word - AL2002-03.doc PDF icon Microsoft Word - AL2002-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - FAL2004-01.doc...

  14. Microsoft Word - FAL2004-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - FAL2004-01.doc PDF icon Microsoft Word - FAL2004-01.doc More Documents & Publications Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-02.doc...

  15. Microsoft Word - AL2006-08.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    8.doc Microsoft Word - AL2006-08.doc PDF icon Microsoft Word - AL2006-08.doc More Documents & Publications AL2007-05.doc&0; Microsoft Word - AL2005-14.doc Microsoft Word - ...

  16. Microsoft Word - AL2005-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5-03.doc Microsoft Word - AL2005-03.doc PDF icon Microsoft Word - AL2005-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - AL2006-08.doc ...

  17. Microsoft Word - 98-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    8-11.doc Microsoft Word - 98-11.doc PDF icon Microsoft Word - 98-11.doc More Documents & Publications Microsoft Word - AL2006-08.doc Microsoft Word - AL2005-01.doc Microsoft Word -...

  18. SPDWRAP#1.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Please notify Aon Hewitt's Your Benefit Resources (YBR) in Appendix G to update your personal information, such as your home address and home telephone number. 2. Eligibility...

  19. HABAdv#1671.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    6 Subject: U Plant Closure Plan Adopted: September 10, 2004 Page 1 September 10, 2004 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Linda Hoffman, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Ron Kreizeneeck, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Subject: U Plant Closure Plan Dear Mssrs. Klein, Kreizeneeck, and Ms.

  20. Habadv-119.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    9 Subject: B Reactor Engineering Evaluation and Cost Analysis Adopted: June 8, 2001 Page 1 June 8, 2001 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Chuck Findley, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Re: B Reactor Engineering Evaluation and Cost Analysis Dear

  1. N0057000.doc

    Office of Legacy Management (LM)

    000 GJO- 2002-380- TAC GJO-PIN 13.5.1-1 Pinellas Environmental Restoration Project Northeast Site Non-Aqueous Phase Liquids Interim Measures Progress Report July through September 2002 October 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-02GJ79491 Task Order Number ST03-107 Document Number N0057000 Contents DOE/Grand Junction Office Northeast Site NAPL Interim Measures Progress Report October 2002 Page

  2. 2B-01.doc

    Energy Savers

    ... performed under DOE contract number DE-AC01-02GJ79491 by the S.M. Stoller Corporation for the U.S. Department of Energy, Office of Legacy Man- agement, Grand Junction, Colorado. ...

  3. Report2003.doc (indexed) [DOE]

    III. Definitions of Terms and Acronyms Used in the Report. ... current fiscal year 1013 (Enter this number also in Line ... (some records involved search adequacy) 5: Remand: 9 7 ...

  4. LibraDLFinal.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    To reserve a Libra session, go to, click on "Microscope Scheduling", use proposal number and password to log in.You may only sign up for 1 Core sessions and 1 Flex ...

  5. FIBDLFinal.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    To reserve a FIB session, go to, click on "Microscope Scheduling", use proposal number and password to log in.You may only sign up for 2 Core sessions and 2 Flex ...

  6. 3010DLFinal.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    go to, click on "Microscope Scheduling", use proposal number and password to log in. You may only sign up for 2 Core sessions and 1 Flex session at a time. ...

  7. TecnaiDLFinal.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    To reserve a Tecnai session, go to, click on "Microscope Scheduling", use proposal number and password to log in. You may only sign up for 1 Core session and 1 ...

  8. Microsoft Word - CMPTemplate031307.doc | Department of Energy

    Office of Environmental Management (EM)

    CMPTemplate031307.doc Microsoft Word - CMPTemplate031307.doc PDF icon Microsoft Word - CMPTemplate031307.doc More Documents & Publications Chapter 42 - Contract Administration...

  9. Microsoft Word - ACQUISITION LETTER.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ACQUISITION LETTER.doc Microsoft Word - ACQUISITION LETTER.doc PDF icon Microsoft Word - ACQUISITION LETTER.doc More Documents & Publications ACQUISITION LETTER DEAR Part 933 OPAM ...

  10. Microsoft Word - SpecialTermsandConditions0506.doc | Department...

    Energy Savers

    Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc More Documents &...

  11. Microsoft Word - FY2005finaliparhandbook.doc | Department of...

    Energy Savers

    Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc More Documents & Publications...

  12. Microsoft Word - ARRAAttachment2.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAAttachment2.doc Microsoft Word - ARRAAttachment2.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment3.rtf Microsoft Word -...

  13. Microsoft Word - ARRAMOModelMod.doc | Department of Energy

    Energy Savers

    ARRAMOModelMod.doc Microsoft Word - ARRAMOModelMod.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS...

  14. Microsoft Word - ARRAModelWAS.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ARRAModelWAS.doc Microsoft Word - ARRAModelWAS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAMOModelMod...

  15. Microsoft Word - August06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    August06.doc Microsoft Word - August06.doc PDF icon Microsoft Word - August06.doc More Documents & Publications Microsoft Word - April

  16. Microsoft Word - FY10PropertyBSCContractor.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor.doc PDF icon Microsoft Word - FY10PropertyBSCContractor.doc More Documents & Publications Microsoft Word - ...

  17. Microsoft Word - GJPPGPracticesDraft.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    GJPPGPracticesDraft.doc Microsoft Word - GJPPGPracticesDraft.doc PDF icon Microsoft Word - GJPPGPracticesDraft.doc More Documents & Publications 1 DOE Purchase Card Policy Natural ...

  18. Microsoft Word - Cross Reference Matrix Introduction.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Cross Reference Matrix Introduction.doc Microsoft Word - Cross Reference Matrix Introduction.doc PDF icon Microsoft Word - Cross Reference Matrix Introduction.doc More Documents & ...

  19. Microsoft Word - April06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    April06.doc Microsoft Word - April06.doc PDF icon Microsoft Word - April06.doc More Documents & Publications Secretary Directs FPO to Prepare Strategic Plan Microsoft Word - August

  20. Engaging Financial Institution Partners Transcript.doc | Department...

    Office of Environmental Management (EM)

    Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Microsoft ...

  1. AL2007-03.doc (indexed) [DOE]

    from GAO and Inspector General (IG) reports of other federal agencies. Introduction The IA relationship involves two Federal agencies that enter into a relationship for the...

  2. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page I-3 U n c o n t r o l l e d c o p y Long-Term Surveillance and Maintenance ...

  3. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Doc. No. S06401 June 2010 Page B-2 U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. ...

  4. Ammendment 2.doc | Department of Energy (indexed) [DOE]

    Ammendment 2.doc More Documents & Publications Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&0; RFQ DE-RQ01-04ME90001.doc&0; Attachment 3-Past Performance...

  5. Microsoft Word - 1938.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    personal information is revealed in a LANS record: Education, salary, medical history, employment history, social security number, date and place of birth, or mother's maiden name. Form 1938 (3/14) Page 1 of 3 Form 1938 Universal Beneficiary Designation/Change Form Instructions: The information on this form will replace any prior beneficiary designation. You may name anyone or any entity as your beneficiary and you may change your beneficiary at any time by completing a new Universal Beneficiary

  6. Oct08.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    8 ANL/EVS/NL-08-10 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: Editor: Donna J. Holdridge Contributor: John Schatz Website: ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Leadership Noble County Members Tour SGP Site Members of the non-profit organization Leadership Noble County

  7. Dec08.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    8 ANL/EVS/NL-08-12 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. AMF2 Team Surveys Storm Peak Area The U.S. Department of Energy recently announced the initial deployment of the second ARM Mobile

  8. Jan09.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    9 ANL/EVS/NL-09-01 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Routine AVP Clouds with Low Optical Water Depths (CLOWD) Optical Radiative Observations (RACORO) Field Campaign Scheduled at SGP

  9. June08.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    8 ANL/EVS/NL-08-06 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: Editor: Donna J. Holdridge Contributor: Lynne Roeder Website: ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. Interagency Effort Will Measure Carbon Dioxide Profiles Beginning in June, the ARM Climate Research Facility (ACRF) is supporting an

  10. Sep08.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    8 ANL/EVS/NL-08-09 Technical Contact: Brad W. Orr Phone: 630-252-8665 Email: Editor: Donna J. Holdridge Website: ACRF Southern Great Plains Newsletter is published by Argonne National Laboratory, managed by UChicago Argonne, LLC, for the U.S. Department of Energy under contract number DE-AC02-06CH11357. 3D Water Vapor Field Campaign Concludes Researchers from the Colorado State University recently concluded a week-long field experiment at the SGP (August

  11. Index2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Index2.doc Index2.doc Index2.doc (11.46 KB) More Documents & Publications Sylvania Corporation, Hicksville, NY and Bayside, NY - Addendum to July 8, 2004 O:\HOMEPAGE\FOIA\report99.PDF&#0; U.S. Department of Energy 2004 Annual Report

  12. SubcontractingGuidelines.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; (245.71 KB) More Documents & Publications Guidance of the Department of Energy Subcontracting Program Acquisition Guide Chapter 19 Update Chapter 19 - Small Business Programs

  13. Microsoft Word - AL2005-16.doc | Department of Energy

    Office of Environmental Management (EM)

    6.doc Microsoft Word - AL2005-16.doc PDF icon Microsoft Word - AL2005-16.doc More Documents & Publications Microsoft Word - AL2005-10.doc Audit Report: IG-0860 Microsoft Word -...

  14. Microsoft Word - AL2005-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5-02.doc Microsoft Word - AL2005-02.doc PDF icon Microsoft Word - AL2005-02.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc...

  15. Microsoft Word - AL2005-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - AL2005-11.doc PDF icon Microsoft Word - AL2005-11.doc More Documents & Publications Audit Report: OAS-L-13-08 Microsoft Word - AL2005-12.doc CHAPTER 7...

  16. Microsoft Word - AL2006-02.doc | Department of Energy

    Energy Savers

    2.doc Microsoft Word - AL2006-02.doc PDF icon Microsoft Word - AL2006-02.doc More Documents & Publications Microsoft Word - AL2006-03.doc Archived Financial Assistance Letters...

  17. Microsoft Word - AL2006-03.doc | Department of Energy

    Energy Savers

    3.doc Microsoft Word - AL2006-03.doc PDF icon Microsoft Word - AL2006-03.doc More Documents & Publications Microsoft Word - AL2006-02.doc Archived Financial Assistance Letters...

  18. Microsoft Word - al2005-04.doc | Department of Energy

    Energy Savers

    al2005-04.doc Microsoft Word - al2005-04.doc PDF icon Microsoft Word - al2005-04.doc More Documents & Publications AL2005-04ClassDeviation.pdf Microsoft Word - Matrixpart2.doc...

  19. Microsoft Word - AL2005-14.doc | Department of Energy

    Office of Environmental Management (EM)

    4.doc Microsoft Word - AL2005-14.doc PDF icon Microsoft Word - AL2005-14.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc...

  20. Microsoft Word - AL2005-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    7.doc Microsoft Word - AL2005-07.doc PDF icon Microsoft Word - AL2005-07.doc More Documents & Publications Microsoft Word - AL2006-07.doc OPAM Policy Acquisition Guides Initial ...

  1. Microsoft Word - AL2005-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - AL2005-01.doc PDF icon Microsoft Word - AL2005-01.doc More Documents & Publications Microsoft Word - AL2006-08.doc Acquisition Letter Archive listing ...

  2. Microsoft Word - AL2006-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1.doc Microsoft Word - AL2006-01.doc PDF icon Microsoft Word - AL2006-01.doc More Documents & Publications Microsoft Word - al2005-06.doc Chapter 19 - Small Business Programs OPAM...

  3. Microsoft Word - Flash2007-43.doc | Department of Energy

    Office of Environmental Management (EM)

    43.doc Microsoft Word - Flash2007-43.doc Microsoft Word - Flash2007-43.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash...

  4. al99-06attachment.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    attachment.doc&0; al99-06attachment.doc&0; PDF icon al99-06attachment.doc&0; More Documents & Publications Microsoft Word - AL2000-05Attachment.doc Microsoft Word - NSRC...

  5. Microsoft Word - FWP- Fact Sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FWP- Fact Sheet.doc Microsoft Word - FWP- Fact Sheet.doc PDF icon Microsoft Word - FWP- Fact Sheet.doc More Documents & Publications Microsoft Word - FOA cover sheet.doc Microsoft ...

  6. Microsoft Word - AL2005-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2005-10.doc Microsoft Word - AL2005-10.doc Microsoft Word - AL2005-10.doc (133.11 KB) More Documents & Publications Microsoft Word - AL2005-16.doc Audit Report: IG-0860 Microsoft ...

  7. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    SAR.doc Microsoft Word - PeerReviewSAR.doc Microsoft Word - PeerReviewSAR.doc (13.47 KB) More Documents & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross ...

  8. Microsoft Word - al2007-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    al2007-11.doc Microsoft Word - al2007-11.doc PDF icon Microsoft Word - al2007-11.doc More Documents & Publications Acquisition Letter: AL2005-08 Microsoft Word - al2004-03.doc OPAM...

  9. Flash2007-33DomesticDeliveryParticipatingAgencies.doc

    Energy Savers

    Securities and Exchange Commission 900,500.00 13 Department of TransportationFederal Motor Carrier Safety Administration 252,027.08 14 Pension Benefit Guaranty Corporation ...

  10. Microsoft Word - FOIA NOT AGENCY RECORD RESPONSE.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    April 11, 2013 CERTIFIED MAIL Mr. Ryan Henry Law Offices of Ryan Henry, P.L.L.C. 1380 Pantheon Way, Suite 215 San Antonio, Texas 78232 Dear Mr. Henry: FREEDOM OF INFORMATION ACT REQUEST (FOI 2013-00782) This letter is in response to your electronic Freedom of Information Act (FOIA) request that you sent to the Department of Energy (DOE), Richland Operations Office (RL) requesting documents relating to the jobs performed by Dritherm International, Inc., from January 1, 1995, to present, including

  11. Microsoft Word - Matrixpart1.doc | Department of Energy (indexed) [DOE]

    Matrixpart1.doc More Documents & Publications Part 1, Clauses Prescribed in FAR Part 52 Microsoft Word - Matrixpart2.doc...

  12. csep_transcript_aspen.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications highperformanceleasingstrategiesforstateandlocalgovernments.doc Using Social Media to Engage the Community in Energy Efficiency Projects.doc ...

  13. csep_transcript_minneapolis.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications newguideforcommunityenergystrategicplanning.doc cseptranscriptaspen.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, ...

  14. csep_transcript_arlington.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Office document icon cseptranscriptarlington.doc More Documents & Publications Tools for Designing & Implementing Better Finance Programs financeprograms.doc financeprograms

  15. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    F Radiological Survey Procedures U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page F-3 F.1 Radiological Survey Procedures This section describes the actions and method used by the Monticello Legacy Management (LM) Representative when conducting radiological surveys for the purpose of identifying radiologically contaminated material and determining the Radium-226

  16. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    G Uranium Scanning Procedure U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page G-3 Uranium Scanning Procedure for Property MP-00211 1. Select a Ludlum Model 12 ratemeter with a 44-9 pancake Geiger-Mueller beta-gamma detector or equivalent instrument capable of meeting detection limit criteria. 2. Check that the ratemeter and the detector have calibration

  17. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Appendix H Procedures for the Transportation of Radioactive Materials U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page H-3 H1.0 Purpose The purpose of this procedure is to ensure that radioactive material is transported (1) using best management practices, (2) in compliance with U.S. Department of Transportation (DOT) requirements, and (3) with minimal risk to

  18. Microsoft Word - BEPA.doc

    National Nuclear Security Administration (NNSA)

    ... or other agreement pursuant to U.S. Fish and Wildlife Service Office of Law ... into cooperative agreements with State fish and wildlife agencies or other appropriate ...

  19. Microsoft Word - Chapter 11.doc

    National Nuclear Security Administration (NNSA)

    ... Continued Operation of the Department of EnergyNational Nuclear Security Administration ... Protection Agency), 2010c, The Green Book Nonattainment Areas for Criteria ...

  20. Microsoft Word - S05575_AP.doc

    Office of Legacy Management (LM)

    ... Department of Energy Annual Performance Report, Shiprock, New Mexico December 2009 Doc. ... groundwater from the interceptor drains and extraction wells is solar evaporation. ...

  1. Microsoft Word - Appendix-B.doc

    Office of Legacy Management (LM)

    1 Site Environmental Report May 2012 Doc. No. S08629 Page B-i Contents Abbreviations ................................................................................................................................. iii Measurement Abbreviations .......................................................................................................... iii References

  2. PIC DOC 01/08/11 ? SOS

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    PIC DOC 010811 - SOS Content Outline 1) Usable Quotes We shouldn't equate public involvement with meetings. Maynard Plahuta Meetings, of many kinds, are probably the most...

  3. Microsoft Word - S05527_VMR 2009.DOC

    Office of Legacy Management (LM)

    ... Wells - Golf Course and Residential, Near the Gunnison Site U.S. Department of Energy 2009 Verification Monitoring Report-Gunnison, Colorado, Processing Site August 2009 Doc. ...

  4. Microsoft Word - S06692_VMR.doc

    Office of Legacy Management (LM)

    ... DOE Monitoring Wells - Golf Course and Residential, Near the Gunnison Site ... Monitoring Report-Gunnison, Colorado, Processing Site U.S. Department of Energy Doc. No. ...

  5. Microsoft Word - S05914_MR.doc

    Office of Legacy Management (LM)

    ... Energy 2009 Groundwater Monitoring Report Project Shoal Area, CAU 447 March 2010 Doc. No. ... The contaminant boundary (Figure 2) is a probabilistic forecast of the maximum extent over ...

  6. Microsoft Word - S07050_WM.doc

    Office of Legacy Management (LM)

    ... NI), Setaria viridis (green foxtail, UPL), Xanthium strumarium (cocklebur, FAC) Naturita-Monitoring Report for Wetland Area U.S. Department of Energy Doc. No. S07050 September ...

  7. Microsoft Word - AL2000-05.doc | Department of Energy

    Energy Savers

    .doc Microsoft Word - AL2000-05.doc PDF icon Microsoft Word - AL2000-05.doc More Documents & Publications al99-06.doc&0; Microsoft Word - AL2000-05Attachment.doc AL2004-01r2.pdf...

  8. transcript_pv_mapper.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    transcript_pv_mapper.doc transcript_pv_mapper.doc transcript_pv_mapper.doc transcript_pv_mapper.doc (74.5 KB) More Documents & Publications PVMapper: A Tool for Energy Siting transcript_jedi_model.doc 2009 National Electric Transmission Congestion Study - San Francisco Workshop

  9. Microsoft Word - AL2007-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    7-01.doc Microsoft Word - AL2007-01.doc Microsoft Word - AL2007-01.doc (151.65 KB) More Documents & Publications Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc Microsoft Word - Corp Impl Microsoft Word - AL2006-11

  10. Microsoft Word - FAL2004-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    4-03.doc Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-03.doc (538.96 KB) More Documents & Publications Microsoft Word - FAL2004-01.doc Financial Assistance Letter No. FAL 2006-04 Microsoft Word - FAL2006-04.doc

  11. Microsoft Word - Appendix N_Historical.doc

    Office of Legacy Management (LM)

    N Example Historical Marker and Plaque U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page N-3 Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page N-4

  12. Microsoft Word - AL2000-01.doc | Department of Energy

    Office of Environmental Management (EM)

    AL2000-01.doc Microsoft Word - AL2000-01.doc PDF icon Microsoft Word - AL2000-01.doc More Documents & Publications ALFAL 99-01 Department of Energy No Microsoft Word -...

  13. Microsoft Word - AL2008-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2008-06.doc Microsoft Word - AL2008-06.doc PDF icon Microsoft Word - AL2008-06.doc More Documents & Publications Chapter 9 - Contracting Qualifications Microsoft Word - PART...

  14. Microsoft Word - 99-04.doc | Department of Energy (indexed) [DOE]

    Word - 99-04.doc More Documents & Publications Policy Flash 2014-18 Complex-Wide Strategic Sourcing Microsoft Word - AL2000-01.doc Microsoft Word - AL2005-11.doc...

  15. Microsoft Word - AL2006-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    0.doc Microsoft Word - AL2006-10.doc PDF icon AL2006-10 More Documents & Publications Microsoft Word - Matrixpart2.doc Microsoft Word - AcqGuide70pt52Matrixpart2Redo...

  16. Microsoft Word - AL2004-02.doc | Department of Energy (indexed) [DOE]

    Microsoft Word - AL2004-02.doc More Documents & Publications Microsoft Word - AL2005-02.doc Microsoft Word - al2005-04.doc Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all...

  17. Microsoft Word - al95-06.doc | Department of Energy

    Energy Savers

    5-06.doc Microsoft Word - al95-06.doc PDF icon Microsoft Word - al95-06.doc More Documents & Publications ppl970-1.pdf Audit Report: IG-0589 Inspection Report: INS-O-02-01...

  18. Microsoft Word - meritrev.doc | Department of Energy

    Energy Savers

    Microsoft Word - meritrev.doc Microsoft Word - meritrev.doc PDF icon Microsoft Word - meritrev.doc More Documents & Publications Policy Flash 2013-38 Revised Merit Review Guide For...

  19. Microsoft Word - al95-14.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    al95-14.doc Microsoft Word - al95-14.doc PDF icon Microsoft Word - al95-14.doc More Documents & Publications Cooperation with the New Independent States of the Former Soviet Union ...

  20. Microsoft Word - AL2006-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    7.doc Microsoft Word - AL2006-07.doc PDF icon Microsoft Word - AL2006-07.doc More Documents & Publications OPAM Policy Acquisition Guides Personal Property Management Certification ...

  1. Microsoft Word - FAC2005-27.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAC2005-27.doc Microsoft Word - FAC2005-27.doc PDF icon Microsoft Word - FAC2005-27.doc More Documents & Publications Policy Flash 2015-07 - FAC 2005-78 Policy Flash Search Listing ...

  2. Microsoft Word - al2005-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    - al2005-06.doc PDF icon Microsoft Word - al2005-06.doc More Documents & Publications Microsoft Word - AL2006-01.doc OPAM Policy Acquisition Guides Acquisition Letter: AL2005-08...

  3. Microsoft Word - al96-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    6-09.doc Microsoft Word - al96-09.doc PDF icon Microsoft Word - al96-09.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis Chapter...

  4. Microsoft Word - AL2005-08.doc | Department of Energy

    Office of Environmental Management (EM)

    8.doc Microsoft Word - AL2005-08.doc Microsoft Word - AL2005-08.doc More Documents & Publications OPAM Policy Acquisition Guides Attachment FY2011-28 OPAM Microsoft Word -...

  5. Microsoft Word - FAC2005-19.doc | Department of Energy

    Office of Environmental Management (EM)

    FAC2005-19.doc Microsoft Word - FAC2005-19.doc Microsoft Word - FAC2005-19.doc More Documents & Publications Acquisitlon Letter No. AL 2008-06 AL2008-06.pdf fac2001-27.pdf...

  6. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word -...

  7. Microsoft Word - FORM46002.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    2.doc Microsoft Word - FORM46002.doc Microsoft Word - FORM46002.doc More Documents & Publications DOE F 4600.2 ATTACHMENT FLASH 2011-46(6) Attachment FY2011-63 OPAM...

  8. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc More Documents & Publications Microsoft Word - AL 2010-07 Acquistion Letters Remaining...

  9. Operating Guidelines Appendix C D.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Operating Guidelines Appendix C D.DOC&0; Operating Guidelines Appendix C D.DOC&0; PDF icon Operating Guidelines Appendix C D.DOC&0; More Documents & Publications Operating ...

  10. Microsoft Word - FAL2006-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAL2006-03.doc Microsoft Word - FAL2006-03.doc PDF icon Microsoft Word - FAL2006-03.doc More Documents & Publications Financial Assistance Letter No. FAL 2006-03 Microsoft Word - ...

  11. Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc |...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Speech 082508 FINAL.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc More Documents & Publications Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc ...

  12. Microsoft Word - 2005 FOIA ANNUAL REPORT.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    2005 FOIA ANNUAL REPORT.doc Microsoft Word - 2005 FOIA ANNUAL REPORT.doc report2005.pdf PDF icon Microsoft Word - 2005 FOIA ANNUAL REPORT.doc More Documents & Publications U.S. ...

  13. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2008-05.doc Microsoft Word - AL2008-05.doc PDF icon Microsoft Word - AL2008-05.doc More Documents & Publications Acquisition Letters Remaining In Effect Acquisition Letters ...

  14. Microsoft Word - Matrixpart2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Matrixpart2.doc Microsoft Word - Matrixpart2.doc PDF icon Microsoft Word - Matrixpart2.doc More Documents & Publications AcqGuide70.52Matrixpart2Redo-OPAM Microsoft Word - ...

  15. Microsoft Word - al2004-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    al2004-03.doc Microsoft Word - al2004-03.doc PDF icon Microsoft Word - al2004-03.doc More Documents & Publications Acquisition Letter: AL2005-08 OPAM Policy Acquisition Guides ...

  16. Microsoft Word - FY09PropertyBSCContractor.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FY09PropertyBSCContractor.doc Microsoft Word - FY09PropertyBSCContractor.doc PDF icon Microsoft Word - FY09PropertyBSCContractor.doc More Documents & Publications FY09 Property ...

  17. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAL2004-05.doc Microsoft Word - FAL2004-05.doc PDF icon Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word - Section ...

  18. Microsoft Word - Brochure_Senior Officials.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    BrochureSenior Officials.doc Microsoft Word - BrochureSenior Officials.doc Microsoft Word - BrochureSenior Officials.doc (29.28 KB) More Documents & Publications Preservation of ...

  19. Microsoft Word - CSATCourseCatalog_02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    CSATCourseCatalog02.doc Microsoft Word - CSATCourseCatalog02.doc classroom-1008856960720.jpg Microsoft Word - CSATCourseCatalog02.doc (554.38 KB) More Documents & Publications ...

  20. Microsoft Word - May2009.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    May2009.doc Microsoft Word - May2009.doc Microsoft Word - May2009.doc (6.77 MB) More Documents & Publications Special Resource StudyEnvironmental Assessment for Manhattan Project ...

  1. Property:NEPA TieredDoc | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    TieredDoc Jump to: navigation, search Property Name NEPA TieredDoc Property Type Page This is a property of type Page. Pages using the property "NEPA TieredDoc" Showing 25 pages...

  2. Microsoft Word - ARRAAttachment12v1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment12v1.doc More Documents & Publications Microsoft Word - DRAFT CRB Interview Guidance.doc Microsoft Word - ARRAGuideAttachment10v1

  3. Microsoft Word - AL2006-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2006-11.doc Microsoft Word - AL2006-11.doc PDF icon Microsoft Word - AL2006-11.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis...

  4. Microsoft Word - figure_03.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    Oil and Gas Reserves"; PointLogic Energy; Ventyx; and the Bureau of Safety and Environmental Enforcement, and predecessor agencies. IN OH TN WV VA KY MD PA NY VT NH MA CT ME RI ...

  5. Microsoft Word - references.doc

    Office of Legacy Management (LM)

    ... D.C., June 29. U.S. Environmental Protection Agency (EPA), 1995, "Compilation of Air Pollution Emission Factors," Volume 1, "Stationary Point and Area Sources," AP 42, 5th ...

  6. Operating Guidelines Appendix A B.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Operating Guidelines Appendix A B.DOC&#0; Operating Guidelines Appendix A B.DOC&#0; Operating Guidelines Appendix A B.DOC&#0; (73.17 KB) More Documents & Publications Operating Guidelines Appendix C D.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; DOE HR Guidebook 12_15_05.DOC&#0;

  7. Microsoft Word - CERFDOE Final Report - 071204.doc | Department...

    Office of Environmental Management (EM)

    Microsoft Word - CERFDOE Final Report - 071204.doc (394.42 KB) More Documents & Publications Integrated Project Team RM DOE EIR FM.doc Independent Oversight Activity Report, ...

  8. Microsoft Word - ADR-Provisions-FederalAcquisitionReg.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications ADR Provisions in Federal Acquisition Regulation (FAR) Microsoft Word - ACQUISITION LETTER.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc...

  9. Microsoft Word - AL2005-12.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon Microsoft Word - AL2005-12.doc More Documents & Publications Microsoft Word - AL2005-11.doc OPAM Policy Acquisition Guides Chapter 31 - Contract Cost Principles...

  10. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Energy Savers

    & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross Reference Matrix Introduction.doc Assessment of the Effects of Climate Change on Federal Hydropower...

  11. Design Potential of Metal Foil Substrates for Optimized DOC Performanc...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Design Potential of Metal Foil Substrates for Optimized DOC Performance Design Potential of Metal Foil Substrates for Optimized DOC Performance Poster presentation at the 2007 ...

  12. DOE EIR FM.doc | Department of Energy

    Office of Environmental Management (EM)

    EIR FM.doc PDF icon DOE EIR FM.doc More Documents & Publications Contractor Statement of Work (SOW) Template (for EIR) External Independent Review (EIR) Standard Operating...

  13. Microsoft Word - EODchecklist1.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    New Employee Orientation FORMS CHECKLIST EOD Date: Employee Name: Organization: HR Specialist: Phone Number: Admin Contact: Phone Number: New Employee Orientation Forms to be ...

  14. AcqGuide9pt3.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    taken by one agency are recognized and effective for all Executive Branch agencies. ... While in many agencies, the debarment and suspension function resides within the Office of ...

  15. Microsoft Word - S05949_IR.doc

    Office of Legacy Management (LM)

    ... erosion. 2.1.4 Pond 4 Pond 4 is a lined solar evaporation pond that collects water ... store U.S. Department of Energy 2009 Annual Inspection-Monticello, Utah December 2009 Doc. ...

  16. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    and Recovery Act Cleanups This page intentionally left blank U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. ...

  17. Form:NEPA Doc | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    NEPA Doc Jump to: navigation, search Input the name of a NEPA Document below. If the document already exists, you will be able to edit its information. AddEdit a NEPA Document...

  18. Microsoft Word - Appendix A_Background.doc

    Office of Legacy Management (LM)

    ... and Maintenance (LTSM) Program records at the DOE Grand ... Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. ... (DOE 2003c). The two communities closest to the Chemical ...

  19. Microsoft Word - Appendix A.doc

    Office of Legacy Management (LM)

    ... and Maintenance (LTSM) Program records at the DOE Grand ... Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. ... (DOE 2003c). The two communities closest to the Chemical ...

  20. Edwin Parks (Doc) | Department of Energy

    Office of Environmental Management (EM)

    Doc Parks has over 27 years of active-duty military service with the U.S. Air Force (USAF), serving a broad range of command and staff positions in nuclear operations policy, ...

  1. Utah Municipal Power Agency | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Municipal Power Agency Place: Utah Phone Number: (801) 798-7489 Website: Facebook: https:www.facebook.compagesUtah-Municipal-Power-Agency152219714819535 Outage...

  2. RetTrendReport1205.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    RetTrendReport1205.doc&#0; RetTrendReport1205.doc&#0; RetTrendReport1205.doc&#0; (2.58 MB) More Documents & Publications Pension Plans for Contractor Workers April 1-10 comments.doc&#0; POLICY GUIDANCE MEMORANDUM #39 Phased Retirement

  3. AcqGuide70pt5.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AcqGuide70pt5.doc&#0; AcqGuide70pt5.doc&#0; AcqGuide70pt5.doc&#0; (16.21 KB) More Documents & Publications Chapter 70.3102-05-6: Contractor Compensation - Variable Pay Policy Flash 2016-34 AcqGuide41pt1.doc&#0;

  4. Microsoft Word - Chapter 05 a.doc | Department of Energy

    Office of Environmental Management (EM)

    Microsoft Word - Chapter 05 a.doc Microsoft Word - Chapter 05 a.doc Microsoft Word - Chapter 05 a.doc (7.05 MB) More Documents & Publications Microsoft Word - Chapter 01.doc EIS-0426: Record of Decision EIS-0426: Final Environmental Impact Statement

  5. Microsoft Word - Chapter 01.doc | Department of Energy

    Office of Environmental Management (EM)

    Microsoft Word - Chapter 01.doc Microsoft Word - Chapter 01.doc Microsoft Word - Chapter 01.doc (10.76 MB) More Documents & Publications Microsoft Word - Chapter 05 a.doc EIS-0426: Record of Decision EIS-0426: Final Environmental Impact Statement

  6. DOC-DOE Joint China Mission Statement | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Joint China Mission Statement DOC-DOE Joint China Mission Statement DOC-DOE Joint China Mission Statement DOC-DOE Joint China Mission Statement (109.75 KB) More Documents & Publications DOC-DOE China Mission Announcement Press Release FACT SHEET: U.S.-China Clean Energy Cooperation Announcements US-China Clean Energy Cooperation

  7. expanding_chp_in_your_state.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc (130 KB) More Documents & Publications Combined Heat and Power: Expanding CHP in Your State Sustainable Energy Resources for Consumers (SERC) - Solar Hot Water Sustainable Energy Resources for Consumers (SERC) - Geothermal/Ground-Source Heat Pumps

  8. Microsoft Word - DOETTQuestions.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    DOETTQuestions.doc Microsoft Word - DOETTQuestions.doc Microsoft Word - DOETTQuestions.doc (48.9 KB) More Documents & Publications Microsoft Word - 73FR72036_UC signed 1&#0; Microsoft Word - SRNL Fed Register Response.doc Subcontractor Rights Under CRADAs and WFO Agreements

  9. Microsoft Word - FAL2006-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAL2006-04.doc Microsoft Word - FAL2006-04.doc Microsoft Word - FAL2006-04.doc (74.69 KB) More Documents & Publications Financial Assistance Letter No. FAL 2006-04 Microsoft Word - AL2006-03.doc Microsoft Word - FAL2004-01

  10. Microsoft Word - Federal Register Response _Jan09_.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Federal Register Response _Jan09_.doc Microsoft Word - Federal Register Response _Jan09_.doc Microsoft Word - Federal Register Response _Jan09_.doc (13.88 KB) More Documents & Publications Microsoft Word - Document2 Microsoft Word - Intellectual Property Provisions _NRD-1003_.doc Microsoft Word - ARRAAttachment12v1

  11. Microsoft Word - Final Sample Participant Profile November 2008.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Final Sample Participant Profile November 2008.doc Microsoft Word - Final Sample Participant Profile November 2008.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - DRAFT CRB Interview Guidance

  12. Microsoft Word - PART 970.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PART 970.doc Microsoft Word - PART 970.doc Microsoft Word - PART 970.doc (1.03 MB) More Documents & Publications Searchable Electronic Department of Energy Acquisition Regulation Microsoft Word - Matrixpart2.doc AcqGuide70.52Matrixpart2Redo-OPAM

  13. Microsoft Word - master.doc

    Gasoline and Diesel Fuel Update

    9 (Released January 8, 1999) Energy Information Administration DOE/EIA-0202(99/1Q) Distribution Category UC-950 Short-Term Energy Outlook January 1999 Energy Information Administration Office of Energy Markets and End Use U.S. Department of Energy Washington, DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the U.S. Department of Energy. The information contained herein should be attributed to the Energy

  14. Microsoft Word - FAL2003-03Rattach.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Agency Name(s). Required {Select all that apply} * U.S. Department of Energy {Enter DOE Office, Division, etc.} * National Nuclear Security Administration {Enter NNSA Office, Division, etc.} * If appropriate, list other agencies: {Enter name of other agency. Can have more than one} Funding Opportunity Title. Required {Enter title of the funding opportunity announcement} Announcement Type. Required {Select one} * Initial Announcement * Modification Funding Opportunity Number. Required Complete in

  15. Microsoft Word - meritrev.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ... Preference: In merit reviewer selection, there should be no preference based on race, ethnic identity, gender, religion, region, age, or institutional affiliation. 3 Number of ...

  16. AL2007-05.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL 2007-05 Acquisition Regulation Date 03292007 ACQUISITION LETTER This Acquisition ... LETTERS REMAINING IN EFFECT NUMBER DATE SUBJECT 93-4 040793 Displaced Workers ...

  17. Microsoft Word - U0186500.doc

    Office of Legacy Management (LM)

    New Mexico, UMTRA Site September 2003 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number ...

  18. Microsoft Word - Highlights.doc

    Gasoline and Diesel Fuel Update

    ... Source: National Oceanic and Atmospheric Administration, ... or commercial-sector generators to third parties, ... number in this table is net of re-injection and water cut. ...

  19. Microsoft Word - lesht.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Relative Humidity Climatology at the ARM NSA, SGP, and TWP Climate Research Facility ... ACRF Site Start Date End Date Number of Soundings NSA 04282002 11302003 402 SGP 0501...

  20. Microsoft Word - IG-0648.doc

    Energy Savers

    ... Further, although the Department's Environment, Safety and Health personnel investigate ... to either OSHA logs or CAIRS. Safety Statistics For a number of years, the Department ...

  1. Microsoft Word - TP22135.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Sandia National Laboratories will not be liable for any loss ... Although ferrite is typically not observed in bar stock, ... of deuterium in a number of austenitic stainless ...

  2. Microsoft Word - S0171500.doc

    Office of Legacy Management (LM)

    DOE-LM/GJ850-2005 ESL-RPT-2005-03 Alternatives for Mending a Permeable Reactive Barrier at a Former Uranium Milling Site: Monticello, Utah April 2005 Prepared for U. S. Environmental Protection Agency Region 8, Denver, Colorado Under Interagency Agreement DW89953767018 By U. S. Department of Energy Grand Junction, Colorado Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado

  3. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    K MMTS and MVP Site Inspection Checklists U n c o n t r o l l e d c o p y MMTS Annual Inspection Checklist U n c o n t r o l l e d c o p y MMTS Annual Inspection Checklist Page 1 of 38 I. MMTS Site Information Site name: Monticello Mill Tailings (USDOE) Site; Operable Units I, II, and III Date of inspection: Site Location: Monticello, Utah: EPA Region 8 EPA ID: UT 3890090035 Lead Agency: U.S. Department of Energy Office of Legacy Management (DOE-LM) PCOR Date: September 2004 Operational and

  4. Habadv#165 RCBRA.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    5 Subject: River Corridor Baseline Risk Assessment (RCBRA) Adopted: September 10, 2004 Page 1 September 10, 2004 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Ron Kreizeneeck, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Linda Hoffman, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Subject: Risk Assessment Work Plan for the 100 Area

  5. Microsoft Word - figure_03.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    0 U.S. Energy Information Administration | Natural Gas Annual Figure 3. Marketed production of natural gas in the United States and the Gulf of Mexico, 2014 (million cubic feet) None 1-15,000 15,001-100,000 100,001-200,000 200,001-500,000 500,001 and over Sources: Energy Information Administration (EIA), Form EIA-895, "Annual Quantity and Value of Natural Gas Report"; Form EIA-914, "Monthly Natural Gas Production Report"; state agencies; Form EIA-23, "Annual Survey of

  6. State Energy Program - Program Year 2014 - Formula Award - Administrative and Legal Requirement Doc (indexed) [DOE]

    Weatherization and Intergovernmental Programs Office (WIPO) STATE: Mult PROJECT TITLE : State Energy Program - Program Year 2014 - Formula Award - Administrative and Legal Requirement Doc (ALRD) Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number SEP-ALRD-2014 GFO-SEP-ALRD-2014 Based on my review of the information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 451.1A), I have made the following

  7. Microsoft Word - N0049800.doc

    Office of Legacy Management (LM)

    49800 GJO-2002-306-TAR MAC-PIN 14.5.2 Pinellas Environmental Restoration Project at the Young-Rainey STAR Center Building 100 Area Plume Control Technology Selection Report February 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-96GJ87335 Task Order Number MAC02-10 This page intentionally left blank Document Number N0049800 Contents DOE/Grand Junction Office Building 100 Area Plume Control Technology

  8. Microsoft Word - M084.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  9. LATEST_m_93.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    3 AM Change Number M-93-01-02 Federal Facility Agreement and Consent Order Change Control Form Do not use blue ink. Type or print using black ink. Date 123101 Originator Phone H....

  10. CM300DLFinal.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    To reserve a CM300 session, go to, click on "Microscope Scheduling", use proposal number and password to log in. You may only sign up for 2 sessions per month, ...

  11. Microsoft Word - U0195900.doc

    Office of Legacy Management (LM)

    GJO-2004-589-TAC ESL-RPT-2004-02 ESL-RPT-2004-02 U0195900 Office of Legacy Management ... Number U0195900 Contents DOEOffice of Legacy Management Diffusion Multilayer Sampling ...

  12. Microsoft Word - U0127400.doc

    Office of Legacy Management (LM)

    12-TAR MAC-GWMON 1.8 Chemistry of Phase I Phytoremediation Soils: Work Plan for the Monument Valley, Arizona, UMTRA Project Site September 2001 This page intentionally left blank UMTRA Ground Water Project Chemistry of Phase I Phytoremediation Soils: Work Plan for the Monument Valley, Arizona, UMTRA Project Site September 2001 Prepared for U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Project Number UGW-511-0015-37-000 Document Number U0127400 Work Performed Under DOE

  13. AcqGuide42pt3.doc | Department of Energy

    Office of Environmental Management (EM)

    1pt1.doc&#0; AcqGuide41pt1.doc&#0; AcqGuide41pt1.doc&#0; (13.23 KB) More Documents & Publications Chapter 41 - Acquisition of Utility Services Policy Flash 2016-31 Chapter 41: Utilities

    2pt3.doc&#0; AcqGuide42pt3.doc&#0; AcqGuide42pt3.doc&#0; (56.38 KB) More Documents & Publications Chapter 42 - Contract Administration Acquisition Guide Chapter 42.1202 - Novation Agreements Chapter 9.2: Performance Guarantees

  14. Microsoft Word - Clay Memo PMC Coburn Obama 11_9_06.doc | Department...

    Office of Environmental Management (EM)

    Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc More Documents & Publications...

  15. Microsoft Word - DP_cover_and_front matter_FINAL1.DOC | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FINAL1.DOC Microsoft Word - DPcoverandfront matterFINAL1.DOC PDF icon Microsoft Word - DPcoverandfront matterFINAL1.DOC More Documents & Publications Microsoft Word - ...

  16. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc PDF icon Microsoft Word - TSLCC 200750508 rev 1.doc More Documents & Publications FY 2007 Total System ...

  17. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of...

    Office of Environmental Management (EM)

    TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc More Documents & Publications FY 2007 Total System Life...

  18. Microsoft Word - APPENDIX E flysheet.doc

    National Nuclear Security Administration (NNSA)

    ... and potential impacts of these activities were assessed using standard methods endorsed by the U.S. Environmental Protection Agency (EPA) and local air pollution control agencies. ...

  19. Microsoft Word - table_21.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    9 Table 21. Number of natural gas commercial consumers by type of service and state, 2013-2014 R Revised data. Note: Totals may not equal sum of components due to independent rounding. Source: Energy Information Administration (EIA), Form EIA-176, "Annual Report of Natural and Supplemental Gas Supply and Disposition." Please see the cautionary note regarding the number of residential and commercial customers located on the second page of Appendix A of this report. Alabama 67,006 130

  20. Microsoft Word - n0021500.doc

    Office of Legacy Management (LM)

    PIN 16.2 Environmental Restoration Program Wastewater Neutralization Area/Building 200 Area Corrective Measures Implementation Plan Addendum January 2000 Environmental Restoration Program Wastewater Neutralization Area/Building 200 Area Corrective Measures Implementation Plan Addendum January 2000 Prepared for U.S. Department of Energy Albuquerque Operations Office Grand Junction Office Prepared by MACTEC Environmental Restoration Services, LLC Grand Junction, Colorado Project Number

  1. AcqGuide39pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon AcqGuide39pt1.doc&0; More Documents & Publications Chapter 39 - Acquisition of Information Technology AcqGuide38pt1.doc&0; Microsoft Word - AcqGuide16pt1...

  2. AcqGuide70pt31.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon AcqGuide70pt31.doc&0; More Documents & Publications Microsoft Word - AcqGuide70pt31A.doc Policy Flash 2014-26 Acquisition Guide Chapter 70.31A - Costs...

  3. AcqGuide47pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AcqGuide47pt1.doc&0; PDF icon AcqGuide47pt1.doc&0; More Documents & Publications Chapter 47 - Transportation TEC Working Group Topic Groups Manual Review Key Documents ...

  4. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    22.62 KB) More Documents & Publications Microsoft Word - FOA cover sheet.doc Recovery Act, Office of the Biomass Program,Funding Opportunity Announcements Special Notice Microsoft Word - FOA cover sheet.doc

  5. Microsoft Word - e0399102.doc

    Office of Legacy Management (LM)

    UNCONTROLLED IF PRINTED E0399101 GJO-2003-493-TAC MNT 015.20 REV. 06 Copy No. ______ Draft-Final Monticello Site Management Plan October 2003 UNCONTROLLED IF PRINTED Prepared by U.S. Department of Energy Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-02GJ79491 UNCONTROLLED IF PRINTED Contents October 2003 Site Management Plan Page iii Contents Acronyms and Abbreviations

  6. Microsoft Word - U01866.doc

    Office of Legacy Management (LM)

    186600 GJO-2003-489-TAC GJO-GWDUR 2.0 UMTRA Ground Water Project Verification Monitoring Report for the Durango, Colorado, UMTRA Project Site September 2003 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract No. DE-AC13-02GJ79491 Document Number U0186600 Contents DOE/Grand Junction Office Verification Monitoring Report-Durango, Colorado September 2003 Page iii Contents 1.0

  7. Microsoft Word - August06.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    August 2006 Office of History and Heritage Resources Volume 2, Number 2 In This Issue * B-Reactor Study for Deputy Secretary * Museum and Visitor Center Conference * National Park Service Manhattan Project Resource Study * DOE Headquarters Museum/Visitor Center * Want to Receive Partners in Preservation? * 2007 DOE Cultural Resources Forum: Hanford, Washington * 2006 DOE Cultural Resources Forum: Oak Ridge, Tennessee * K-25 Racetrack? * FPO Funds Field Office Preservation * Pantex Donates Cold

  8. csep_transcript_transportation.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    More Documents & Publications cseptranscriptminneapolis.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, 2011 (Text Version) Transcript: Biomass ...

  9. comm_pace_updates_field_resources_prog_design_implementation.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy comm_pace_updates_field_resources_prog_design_implementation.doc comm_pace_updates_field_resources_prog_design_implementation.doc comm_pace_updates_field_resources_prog_design_implementation.doc comm_pace_updates_field_resources_prog_design_implementation.doc (126.5 KB) More Documents & Publications Commercial PACE: Updates from the Field & New Resources for Design and Implementation Combined Heat and Power: Expanding CHP in Your State expanding_chp_in_your_state

  10. 20130226_sunshot_transcript_lbnl.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc (73.5 KB) More Documents & Publications Why Are Resiential PV Prices in Germany So Much Lower Than in the United States? text_alternative_stat_webinar_2012_7_25.docx An Analysis of Residential PV System Price Differences between the United States and Germany

  11. DOCS System Configuration Management Plan | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    DOCS System Configuration Management Plan DOCS System Configuration Management Plan The DOCS Systems Configuration Management Plan (SCMP), from an actual DOE systems engineering project, can be used as a template to facilitate the creation of the CMP for your particular project. DOCS System Configuration Management Plan (654.98 KB) More Documents & Publications OPC Security Whitepaper #3Hardening Guidelines for OPC Hosts NMMSS Software Quality Assurance Plan ABB SCADA/EMS System INEEL

  12. chap4_3.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    CALORIMETRY V.E. Viola and R. Bougault In any attempt to describe a system in terms of thermodynamic variables, a knowledge of heat content is fundamental. For hot nuclei, this energetic factor is usually expressed in terms of excitation energy per nucleon, E*/A. Because nuclei are finite systems, size is important. Thus, it is necessary to determine both the heat content E* and the number of nucleons A that characterize the disintegrating ensemble. In this chapter we examine the methods by

  13. word2pdf43408.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    YOUR BENEFIT PLAN LOS ALAMOS NATIONAL SECURITY, LLC Retiree Voluntary Accidental Death and Dismemberment Plan (ADD) Questions about Your Coverage In the event You have questions regarding any aspect of Your coverage, You should contact Your Employee Benefits Manager or You may write to us at: The Hartford Group Benefits Division, Customer Service P.O. Box 2999 Hartford, CT 06104-2999 Or call Us at: 1-800-523-2233 When calling, please give Us the following information: 1) the policy number; and

  14. CompleteProject List.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    CompleteProject List.doc&#0; CompleteProject List.doc&#0; CompleteProject List.doc&#0; (9.47 KB) More Documents & Publications Tribal Energy Program February 2012 Award Project Descriptions CX-008525: Categorical Exclusion Determination 2010 Program Review Meeting

  15. AcqGuide41pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1pt1.doc&#0; AcqGuide41pt1.doc&#0; AcqGuide41pt1.doc&#0; (13.23 KB) More Documents & Publications Chapter 41 - Acquisition of Utility Services Policy Flash 2016-31 Chapter 41: Utilities

  16. AcqGuide9pt2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AcqGuide9pt2.doc&#0; AcqGuide9pt2.doc&#0; AcqGuide9pt2.doc&#0; (16.88 KB) More Documents & Publications Chapter 9.2: Performance Guarantees Policy Flash 2016-32 Chapter 9 - Contracting Qualifications

  17. Microsoft Word - AL2003-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    3-04.doc Microsoft Word - AL2003-04.doc Microsoft Word - AL2003-04.doc (254.1 KB) More Documents & Publications AL2004-01r2.pdf City of Tulare Renewable Biogas Fuel Cell Project

  18. Microsoft Word - LibraryofPriorRulemakings.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    LibraryofPriorRulemakings.doc Microsoft Word - LibraryofPriorRulemakings.doc Microsoft Word - LibraryofPriorRulemakings.doc (28.89 KB) More Documents & Publications Solar Background Document 1 Natural Gas Imports and Exports First Quarter Report 2014 Natural Gas Imports and Exports Second Quarter Report 2014

  19. Microsoft Word - Political Activity and the Federal Employee.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Political Activity and the Federal Employee.doc Microsoft Word - Political Activity and the Federal Employee.doc Microsoft Word - Political Activity and the Federal Employee.doc (165.92 KB) More Documents & Publications Political Activity at DOE Facilities by DOE Contractors Audit Report: IG-0473 PROCESSING INVITATIONS FOR A PRESIDENTIAL APPOINTEE

  20. Microsoft Word - competitionincontractingguidev2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc (215.28 KB) More Documents & Publications AcqGuide 5.2-OPAM Acquisition Guide, Chapter 6.1, Competition Requirements Microsoft Word - AG Chapter 6 1 Nov 2010

  1. Microsoft Word - fal2004-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    fal2004-04.doc Microsoft Word - fal2004-04.doc Microsoft Word - fal2004-04.doc (132.28 KB) More Documents & Publications U.S. Department of Energy - Guide to Financial Assistance - Audit Requirements for For-Profit Organizations Financial Assistance Guide (2013) Revised Guide for Financial Assistance

  2. AcqGuide3pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    pt1.doc&0; AcqGuide3pt1.doc&0; PDF icon AcqGuide3pt1.doc&0; More Documents & Publications POLICY FLASH 2016-04 Procurement Integrity PI Brief 6 15 07 final2&0;

  3. Microsoft Word - FY08AnnualReport.doc | Department of Energy

    Office of Environmental Management (EM)

    FY08AnnualReport.doc Microsoft Word - FY08AnnualReport.doc PDF icon Microsoft Word - FY08AnnualReport.doc More Documents & Publications Microsoft Word - FY09AnnualReportv1.doc...

  4. Microsoft Word - AL2005-05Revised.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AL2005-05Revised.doc Microsoft Word - AL2005-05Revised.doc PDF icon Microsoft Word - AL2005-05Revised.doc More Documents & Publications AL2007-03.doc&0; 2011-31 Attachment...

  5. Microsoft Word - ALonEO13423Last.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ALonEO13423Last.doc Microsoft Word - ALonEO13423Last.doc PDF icon Microsoft Word - ALonEO13423Last.doc More Documents & Publications Microsoft Word - AL2008-05.doc Tri-Party ...

  6. Microsoft Word - ITSI award doc 06-D0008 conformed to P00001...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ITSI award doc 06-D0008 conformed to P00001.doc Microsoft Word - ITSI award doc 06-D0008 conformed to P00001.doc More Documents & Publications Policy Flash 2015-02 Acquisition ...

  7. Microsoft Word - Flash2008-09Attachment.doc | Department of Energy (indexed) [DOE]

    9Attachment.doc More Documents & Publications Flash2007-02Attachment.doc&0; Microsoft Word - AL2000-05Attachment.doc Flash2007-03Attachment.doc&0;...

  8. Microsoft Word - Policy Flash 2008-04.doc | Department of Energy

    Office of Environmental Management (EM)

    4.doc Microsoft Word - Policy Flash 2008-04.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  9. Microsoft Word - Policy Flash 2008-06.doc | Department of Energy

    Office of Environmental Management (EM)

    6.doc Microsoft Word - Policy Flash 2008-06.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  10. Microsoft Word - AL2000-05Attachment.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Attachment.doc Microsoft Word - AL2000-05Attachment.doc PDF icon Microsoft Word - AL2000-05Attachment.doc More Documents & Publications al99-06attachment.doc&0; EXHIBIT A: CRADA,...

  11. Microsoft Word - DRAFT CRB Interview Guidance.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    DRAFT CRB Interview Guidance.doc Microsoft Word - DRAFT CRB Interview Guidance.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc Microsoft Word - Document2

  12. Microsoft Word - Policy Flash 2008-07.doc | Department of Energy

    Office of Environmental Management (EM)

    07.doc Microsoft Word - Policy Flash 2008-07.doc More Documents & Publications Microsoft Word - Policy Flash 2008-10...

  13. Microsoft Word - Policy Flash 2008-10.doc | Department of Energy

    Office of Environmental Management (EM)

    10.doc Microsoft Word - Policy Flash 2008-10.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07...

  14. Microsoft Word - table_20.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    8 Table 20. Number of natural gas residential consumers by type of service and state, 2013-2014 Alabama 765,957 0 765,957 769,418 0 769,418 Alaska 124,411 0 124,411 126,416 0 126,416 Arizona 1,171,997 6 1,172,003 1,186,788 6 1,186,794 Arkansas R 549,764 0 R 549,764 549,034 0 549,034 California 10,471,814 283,094 10,754,908 10,372,973 408,747 10,781,720 Colorado 1,672,307 5 1,672,312 1,690,576 5 1,690,581 Connecticut 512,110 1,382 513,492 521,460 1,198 522,658 Delaware 155,627 0 155,627 158,502 0

  15. Microsoft Word - table_22.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    0 Table 22. Number of natural gas industrial consumers by type of service and state, 2013-2014 Alabama 2,876 267 3,143 2,973 271 3,244 Alaska 2 1 3 1 0 1 Arizona 257 126 383 256 130 386 Arkansas 513 507 1,020 531 478 1,009 California 32,662 5,334 37,996 32,266 5,282 37,548 Colorado 946 6,347 7,293 986 6,837 7,823 Connecticut 3,360 1,094 4,454 3,340 877 4,217 Delaware 28 110 138 28 113 141 Florida 166 362 528 165 355 520 Georgia 984 1,258 2,242 887 1,594 2,481 Hawaii 22 0 22 23 0 23 Idaho 109 R

  16. Microsoft Word - table_05.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    3 Table 5. Number of producing gas wells by state and the Gulf of Mexico, December 31, 2010-2014 Alabama 7,026 7,063 6,327 R 6,165 6,118 Alaska 269 277 185 R 159 170 Arizona 5 5 5 5 5 Arkansas 7,397 8,388 8,538 R 9,843 10,150 California 1,580 1,308 1,423 R 1,335 1,118 Colorado 28,813 30,101 32,000 R 32,468 38,346 Gulf of Mexico 1,852 1,559 1,474 R 1,146 1,400 Illinois 50 40 40 R 34 36 Indiana 620 914 819 R 921 895 Kansas 22,145 25,758 24,697 R 23,792 24,354 Kentucky 17,670 14,632 17,936 R 19,494

  17. Microsoft Word - S03736_ FMP010609.doc

    Office of Legacy Management (LM)

    Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 LMS/CNT/S03736 This page intentionally left blank LMS/CNT/S03736 Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 This page intentionally left blank U.S. Department of Energy Fluid Management Plan For CAU 443: CNTA, Subsurface, Nevada January 2009 Doc. No. S0373600 Page i Contents Acronyms and Abbreviations

  18. Microsoft Word - S04019_GSB.doc

    Office of Legacy Management (LM)

    Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 LMS/GSB/S04019 This page intentionally left blank LMS/GSB/S04019 Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 This page intentionally left blank U.S. Department of Energy Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009, Rev. 3 Doc. No. S04019 Page i Contents Abbreviations

  19. Microsoft Word - S06178_MP.doc

    Office of Legacy Management (LM)

    Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited LMS/RUL/S06178 This page intentionally left blank LMS/RUL/S06178 Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited This page intentionally left blank U.S. Department of Energy Rulison Monitoring Plan July 2010 Doc. No. S06178 Page i Contents 1.0

  20. Microsoft Word - S06596_GW.doc

    Office of Legacy Management (LM)

    Annual Groundwater Report May 2009 through April 2010 September 2010 LMS/MNT/S06596 This page intentionally left blank LMS/MNT/S06596 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report May 2009 through April 2010 September 2010 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report May 2009-April 2010 September 2010 Doc. No. S06596 Page i Contents

  1. Microsoft Word - S05428_VMR.doc

    Office of Legacy Management (LM)

    Slick Rock, Colorado, Processing Sites 2008 and 2009 Update July 2010 LMS/SRE-SRW/S05428 This page intentionally left blank LMS/SRE-SRW/S05428 Verification Monitoring Report for the Slick Rock, Colorado, Processing Sites 2008 and 2009 Update July 2010 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report-Slick Rock, Colorado, 2008 and 2009 Update July 2010 Doc. No. S05428 Page i Contents

  2. AcqGuide42pt1.doc

    Energy Savers

    1.1 (March 2004) 1 Acquisition Regulations System [Reference: FAR 1; DEAR 901; DOE O 541.1] Overview This section discusses the Civilian Agency Acquisition Council, agency acquisition regulations, deviations from the FAR and DEAR, ratification of unauthorized commitments, and Contracting Officers and their representatives. The Civilian Agency Acquisition Council The DOE representative to the Civilian Agency Acquisition Council is a staff member of the Office of Procurement and Assistance Policy,

  3. [Agency Name]

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    3, 2012 1. Introduction The Department of Energy sees the implementation of the Plain Writing Act as an important initiative that helps the Department share relevant information in a way that is clear, concise, and informative. The areas referenced in this report are only a few of the successes we have encountered as we continue to implement the Act. 1. Departmental Plain Writing Officials 2. Ingrid Kolb, Director of the Office of Management, Senior Agency Official Responsible for Plain Writing

  4. [Agency Name]

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Plain Writing Compliance Report | page 1 I. SENIOR AGENCY OFFICIAL FOR PLAIN WRITING Senior Official for Plain Writing: Ingrid Kolb Director, Office of Management Plain Writing Implementation Contact: Michael Coogan Office of the Executive Secretariat II. TO DATE, DEPARTMENT OF ENERGY (DOE) COMMUNICATIONS RELEASED IN PLAIN LANGUAGE * DOE website overhaul includes a focus on Plain Writing, geared toward the public and DOE employees. * DOE Powerpedia Page (DOE's internal Wikipedia site) shares

  5. Microsoft Word - 6-19-06 TEC NOTES.doc

    Office of Environmental Management (EM)

    48D7DF19-707E-28B27A.doc Microsoft Word - 48D7DF19-707E-28B27A.doc Microsoft Word - 48D7DF19-707E-28B27A.doc (126.75 KB) More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - GSP_Charter.doc Department of Energy

    564M_Biomass_Project Descriptions FINAL 120409 Microsoft Word - 564M_Biomass_Project Descriptions FINAL 120409 Microsoft Word - 564M_Biomass_Project Descriptions FINAL 120409 (100.66

  6. Texas Municipal Power Agency | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Texas Municipal Power Agency Jump to: navigation, search Name: Texas Municipal Power Agency Place: Texas Sector: Wind energy Phone Number: (936) 873-1100 Website:

  7. Placer County Water Agency | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Placer County Water Agency Jump to: navigation, search Name: Placer County Water Agency Place: California Phone Number: (530) 823-4850 Website: Twitter: @PlacerWater...

  8. Microsoft Word - S03273_Rev1.doc

    Office of Legacy Management (LM)

    Surface, Hot Creek Valley, Nevada, for Calendar Year 2007 September 2008 Rev. 1 DOE-LM/1558-2007 This page intentionally left blank DOE-LM/1558-2008 Post-Closure Inspection and Monitoring Report for Corrective Action Unit 417: Central Nevada Test Area Surface, Hot Creek Valley, Nevada for Calendar Year 2007 September 2008 Rev. 1 This page intentionally left blank U.S. Department of Energy CY 2007 Post-Closure Inspection & Monitoring Report for CAU 417 September 2008, Rev. 1 Doc. No. S0327300

  9. Microsoft Word - S05069_ROD.doc

    Office of Legacy Management (LM)

    Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 LMS/LEH/S05069 This page intentionally left blank LMS/LEH/S05069 Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 This page intentionally left blank U.S. Department of Energy ROD for DOE Areas for LEHR September 2009 Doc. No. S05069, Rev. 0 Page i Contents Acronyms and Abbreviations

  10. Microsoft Word - U0194500July2005.doc

    Office of Legacy Management (LM)

    4500 GJO-2004-579-TAC Office of Legacy Management Refinement of Conceptual Model and Recommendations for Improving Remediation Efficiency at the Shiprock, New Mexico, Site July 2005 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Conceptual Model Refinement and Efficiency Recommendations July 2005 Doc. No.

  11. Microsoft Word - Report Cover.doc

    Office of Environmental Management (EM)

    on Smart Grid RFI RedSeal Systems, Inc. 1 October 29, 2010 Office of Electricity Delivery and Energy Reliability US Department of Energy Room 8H033 1000 Independence Avenue, SW Washington, DC 20585 Re: Comments on "Smart Grid RFI: Addressing Policy and Logistical Challenges" 75 FR 57006 [FR Doc. 2010-23251] From: Steve Dauber Vice-President, Marketing RedSeal Systems 2121 South El Camino Real, Suite 300 San Mateo, CA 94403 Ph: 650-645-6209 RedSeal

  12. Microsoft Word - Renew the Parks.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    cost of PV systems was the biggest concern. To overcome this barrier, the National Park Service will have to form partnerships with other agencies and groups. Potential...

  13. Microsoft Word - Transportation pdf.doc

    National Nuclear Security Administration (NNSA)

    ... These regulations interpret the terms of NEPA and define the ... the less extensive the search for alternatives an agency ... 1995), where the user can enter the pertinent accident ...

  14. M-90-03-02.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    of Hanford Federal Facility Agreement and Consent Order (HFFACO) requirements M-90-10 and M-90- 11 to accelerate joint agency decisions and schedule establishment...

  15. Microsoft Word - Grant Rating Sheet.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    No Proposed project supports agency education objectives-increasing understanding, awareness and appreciation of the Columbia River system and its many uses? Does it enhance the...

  16. AcqGuide38pt1.doc (indexed) [DOE]

    the competitive nature of the purchase. Must agencies conduct Procurement Planning and Market Research before using an FSS contract? Not necessarily. As a general rule, obtaining...

  17. Central Minnesota Municipal Power Agency | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Power Agency Place: Minnesota Phone Number: 507-526-2193 Website: Facebook: https:www.facebook.compagesCentral-Minnesota-Municipal-Power-Agency-CMMPA...

  18. Municipal Energy Agency of MS | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Name: Municipal Energy Agency of MS Place: Mississippi Phone Number: (601) 362-2252 Facebook: https:www.facebook.compagesMunicipal-Energy-Agency-of-Mississippi Outage...

  19. pocforms06a0399.doc | Department of Energy (indexed) [DOE]

    More Documents & Publications fleetappforms04f1298.doc&0; OPC Security Whitepaper 3Hardening Guidelines for OPC Hosts Critical Decision 2 (CD-2) Approval Template...

  20. transcript_jedi_model.doc | Department of Energy (indexed) [DOE]

    document icon transcriptjedimodel.doc More Documents & Publications TAP Webcast Transcript July-29, 2009 Scenario Jedi Tools for Designing & Implementing Better Finance Programs

  1. Microsoft Word - al2006-12.doc | Department of Energy (indexed) [DOE]

    Microsoft Word - al2006-12.doc More Documents & Publications Acquisition Letter No. AL 2008-02 Department of Energy Special Report: DOEIG-0934...

  2. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    A NRC Concurrence with Completion of Remedial Action This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page A-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No.

  3. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    Real Estate Documentation This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page B-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page B-6

  4. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    09 Doc. No. S05767 Page A-1 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page A-2 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page A-3 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page A-4 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009

  5. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    Response to Comments This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page G-1 Well Completion Report for CAU 443 CNTA U.S. Department of Energy Doc. No. S05827 December 2009 Page G-2 U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page G-3 Well Completion Report for CAU 443 CNTA U.S. Department of Energy Doc. No. S05827 December 2009 Page G-4

  6. Enter the Post-Doc: The Untapped Sourcing Pipeline

    SciTech Connect (OSTI)

    Boscow, Ryan B.


    This article addresses the potential formulation and utilization of an industry-based Post-Doc program in order to create workforce candidate pipelines with targeted universities.

  7. Effectiveness of a Diesel Oxidation Catalyst (DOC) to control...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion Effectiveness of a ...

  8. Microsoft Word - 8E2A4440.doc (indexed) [DOE]

    48D7DF19-707E-28B27A.doc (126.75 KB) More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - GSP_Charter.doc

    Grant Amount Non-Fed Amount Project Location (City) Project Location (State) Description 1) Pilot and Demonstration Scale FOA - Pilot Scale Algenol Biofuels Inc. $25,000,000 $33,915,478 Freeport TX This project will make ethanol directly from carbon dioxide and seawater using algae. The

  9. Microsoft Word - AL2006-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon Microsoft Word - AL2006-09.doc More Documents & Publications Microsoft PowerPoint - Executive Order13423rbl Sample Contract Language for Construction Using ...

  10. Microsoft Word - S05837_FFA 4th qtr 09.doc

    Office of Legacy Management (LM)

    ... - - - -- - -- -- ,Additional Quarterly Sun*cillancc RcquircHcnts Note: All ... Sites FFA Quarterly Report: July 1-September 30, 2009 U.S. Department of Energy Doc. No. ...

  11. Microsoft Word - DOE_Staffing_Study_Cover.doc | Department of...

    Office of Environmental Management (EM)

    Word - DOEStaffingStudyCover.doc More Documents & Publications 2010 DOE Strategic Sustainability Performance Plan - Report to the White House Council on Environmental...

  12. Microsoft Word - FFATA Memo 30 March 2007.doc | Department of... (indexed) [DOE]

    FFATA Memo 30 March 2007.doc More Documents & Publications Policy Flash 2014-35 Rescission of American Recovery and Reinvestment Act Reporting Requirements. Flash2008-44attachment....

  13. Microsoft Word - S04268_Mar07 thru Mar08.doc

    Office of Legacy Management (LM)

    ... molybdenum, nitrate, selenium, sulfate, and uranium (DOE 1999). Restoration standards (see Table 1) for these Tuba City Annual Performance Evaluation U.S. Department of Energy Doc. ...

  14. Doc Cambell's Post Greenhouse Low Temperature Geothermal Facility...

    Open Energy Information (Open El) [EERE & EIA]

    Low Temperature Geothermal Facility Facility Doc Cambell's Post Sector Geothermal energy Type Greenhouse Location Las Cruces, New Mexico Coordinates 32.3123157,...

  15. Microsoft Word - AcqGuide71pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    1pt1.doc Microsoft Word - AcqGuide71pt1.doc PDF icon Microsoft Word - AcqGuide71pt1.doc More Documents & Publications Chapter 71 - Review and Approval of Contract and Financial ...

  16. Microsoft Word - AcqGuide7pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    pt1.doc Microsoft Word - AcqGuide7pt1.doc ACQUISITION PLANNING PDF icon Microsoft Word - AcqGuide7pt1.doc More Documents & Publications ACQUISITION PLANNING Policy Flash 2015-13 ...

  17. Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc | Department...

    Energy Savers

    ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc More Documents & Publications Microsoft Word -...

  18. Microsoft Word - Flash2009dashxxFAC34.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc More Documents & Publications Federal Acquisition Regulation; Federal...

  19. Microsoft Word - Flash2008-08attachmentFAC22.doc | Department...

    Energy Savers

    Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc More Documents & Publications Policy Flash 2013-75...

  20. Microsoft Word - Flash2007-61FACAttachment.doc | Department of...

    Energy Savers

    Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc More Documents & Publications Microsoft Word -...

  1. Microsoft Word - PolicyFlash2007-10Attch2.doc | Department of...

    Energy Savers

    PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc More Documents & Publications Policy Flash 2013-37 Federal...

  2. Microsoft Word - Policy Flash 2008-02.doc | Department of Energy

    Energy Savers

    Microsoft Word - Policy Flash 2008-02.doc Microsoft Word - Policy Flash 2008-02.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  3. Microsoft Word - Policy Flash 2008-03.doc | Department of Energy

    Energy Savers

    Microsoft Word - Policy Flash 2008-03.doc Microsoft Word - Policy Flash 2008-03.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  4. Microsoft Word - NationalPolicyAssurances5-06.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    NationalPolicyAssurances5-06.doc Microsoft Word - NationalPolicyAssurances5-06.doc PDF icon Microsoft Word - NationalPolicyAssurances5-06.doc More Documents & Publications ...

  5. Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc |...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Press Release RECOMP 2-8-08 REV FINAL.doc Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc PDF icon Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc More ...

  6. Microsoft Word - FY10PropertyBSCFed.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PropertyBSCFed.doc Microsoft Word - FY10PropertyBSCFed.doc PDF icon Microsoft Word - FY10PropertyBSCFed.doc More Documents & Publications Microsoft Word - FY09PropertyBSCContractor...

  7. Microsoft Word - DP_cover_and_front matter_R1_Draft_3.DOC | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    R1Draft3.DOC Microsoft Word - DPcoverandfront matterR1Draft3.DOC PDF icon Microsoft Word - DPcoverandfront matterR1Draft3.DOC More Documents & Publications Microsoft ...

  8. Microsoft Word - ARRAGuideAttachment10v1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ARRAGuideAttachment10v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - DRAFT CRB Interview Guidance

  9. Microsoft Word - HABAdv#230_LTS.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    on record destruction and develop a plan to preserve historical records. The Board looks forward to continuing to work with the Tri-Party agencies to assist with the determination...

  10. Microsoft Word - HABAdv#219 ERDF.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Program Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd, Suite 115 (B1-46) Richland,...

  11. Flash2007-02Attachment.doc (indexed) [DOE]

    April 11, 2005 and April 17, 2006, requiring agencies to publish on the Government-wide point of entry (GPE) or e-Buy the documentation required by the FAR to support the use of...

  12. Microsoft Word - FAC2005-27.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    the Act contain the definitions of minority institution and Hispanic-serving institution. ... and comply with 8.405 and 16.505 in a report to the agency senior procurement ...

  13. Microsoft Word - ayers_jk.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Overview of National Aeronautics and Space Agency Langley Atmospheric Radiation Measurement Project Cloud Products and Validation J.K. Ayers, R. Palikonda, M. Khaiyer, D.R. Doelling, D.A. Spangenberg, M.L. Nordeen, D.N. Phan, and H. Yi Analytical Services and Materials, Inc. Hampton, Virginia P. Minnis and L. Nguyen National Aeronautics and Space Agency Langley Research Center Climate Science Branch Hampton, Virginia Q.Z. Trepte Science Applications International Corporation Hampton, Virginia

  14. Microsoft Word - PV Report v20.doc

    Gasoline and Diesel Fuel Update

    2 APPENDIX A FINAL EIA - Technology Forecast Updates - Residential and Commercial Building Technologies - Reference Case Presented to: U.S. Energy Information Administration Prepared by Navigant Consulting, Inc. 1200 19 St. NW, Suite 700 Washington, D.C. 20036 With SAIC 8301 Greensboro Drive McLean, VA 22102 March 2014 Final DISCLAIMER This presentation was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government, nor any agency

  15. DOE HR Guidebook 12_15_05.DOC | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    HR Guidebook 12_15_05.DOC&#0; DOE HR Guidebook 12_15_05.DOC&#0; DOE HR Guidebook 12_15_05.DOC&#0; (8.6 MB) More Documents & Publications Operating Guidelines Appendix A B.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; Operating Guidelines Appendix C D.DOC&#0;

  16. Project Summary-TES-SNL.doc. (Conference) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Project Summary-TES-SNL.doc. Citation Details In-Document Search Title: Project Summary-TES-SNL.doc. Abstract not provided. Authors: Siegel, Nathan Phillip Publication Date: ...

  17. Microsoft Word - US_Japan_REE_agenda_ver7.doc | Department of...

    Office of Environmental Management (EM)

    Microsoft Word - USJapanREEagendaver7.doc Microsoft Word - USJapanREEagendaver7.doc U.S. - Japan Roundtable on Rare Earth Elements Research PDF icon Microsoft Word -...

  18. Microsoft Word - FY11 DNWD Budget CJ_Draft_20100124.doc

    Energy Savers

    PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor.doc (59.07 KB) More Documents & Publications Microsoft Word - FY09PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCFed

    PropertyBSCFed.doc Microsoft Word - FY10PropertyBSCFed.doc Microsoft Word - FY10PropertyBSCFed.doc (59.02 KB) More Documents & Publications Microsoft Word - FY09PropertyBSCContractor.doc Microsoft Word - FY10PropertyBSCContractor


  19. Microsoft Word - RAP_Central_Plateau_Milestones_Draft_Advice.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TPA Proposed Changes to Hanford Central Plateau Cleanup Work and Schedule Authors: Cimon, Niles, Catrell, Bouchey, Garnant, Vanni, Mattson, Engstrom, Serres, Leckband Originating Committee: River and Plateau Version #1 :Color: __pink__yellow__green__salmon__purple_X_blue Background (paragraphs numbered to aid review) 1. The Hanford Advisory Board (Board) provides the Tri-Party Agreement (TPA) agencies with policy advice that reflects the Board's core values related to Hanford cleanup. These

  20. Microsoft Word - Appendix M_ContingencyTrees.doc

    Office of Legacy Management (LM)

    M Groundwater Operable Unit Contingency Trees U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page M-3 Figure M-1. Validation and Statistical Evaluation Scheme Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page M-4 Figure M-2. Decision Tree for Objective 1 Data U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page M-5 Figure M-3. Decision Tree for Objective 2 Data Weldon

  1. Microsoft Word - Annual Report 2006_Final.doc (indexed) [DOE]

    AcqGuide37pt1 binney Nov 2010 (201 KB) More Documents & Publications Chapter 37 - Service Contracting AcqGuide37pt1.doc&#0; Special Review: OAS-M-15-05

    AcqGuide70pt31A.doc (30.08 KB) More Documents & Publications AcqGuide70pt31.doc&#0; Acquisition Guide Chapter 70.31A - Costs Associated with Whistleblower Actions Acquisition Letter No. AL-2016-06

    0, Small Business Programs - An Overview Guiding Principles It is the policy of the Department of Energy to provide maximum

  2. Microsoft Word - frm-1901rev1.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Form FRM-1901 ASBESTIFORM SHIPMENT NOTIFICATION Fax to (702) 295-1153 02/14/08 Rev. 01 Page 1 of 1 The generator signed below shall submit this notification to NNSA/NSO at least seven days in advance of arrival of shipment of Asbestiform low-level waste to the Area 5 Radioactive Waste Management Site (RWMS). Generator: Generator Address: Generator Telephone Number: Fax Number: Transporter Name: Transporter Address: Transporter Telephone Number: Fax Number: Waste Stream Identification Number:

  3. Microsoft Word - S05993_CY2009 Annual Rpt.doc

    Office of Legacy Management (LM)

    ... of Site Surveillance and Maintenance Activities-CY 2009 U.S. Department of Energy Doc. No. ... Purpose Approval Date Status as of December 31, 2009 Phase II and III Upgrades to Solar ...

  4. Microsoft Word - ex1b-ITER-mar07.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    B - Patent Rights - Acquisition by the Government - ITER UT-B Contracts Div March 2007 Page 1 of 6 ex1b-ITER-mar07.doc Exhibit 1B ITER Ref: DEAR 952.227-13 PATENT RIGHTS - ...

  5. Microsoft Word - AL2005-13.doc | Department of Energy (indexed) [DOE]

    Microsoft Word - AL2005-13.doc More Documents & Publications PBA2007 Presentation-short-6-19-07DOE&0; Accident Investigation of the February 7, 2013, Scissor Lift Accident in the...

  6. Microsoft Word - S08266_App_A-3.doc

    Office of Legacy Management (LM)

    Score 0 Fernald Preserve, Ohio, Wetland Mitigation Monitoring Report U.S. Department of Energy Doc. No. S08266 Appendix A-3, 2011 Amphibian Index of Biotic Integrity Data...

  7. Microsoft Word - Appendix B_RiskAssessmenr.doc

    Office of Legacy Management (LM)

    ... U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page ... if ingested at frequencies and amounts similar to those of residential use (DOE 1997). ...

  8. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    NRC Technical Evaluation Report on Revised LTSP This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. ...

  9. Microsoft Word - N01058_LTSM Plan.doc

    Office of Legacy Management (LM)

    ... for the Pinellas Site U.S. Department of Energy Doc. No. ... replaced by an aboveground system that currently is in use (DOE 1997b). The Old Drum Storage Site is located at the ...

  10. Microsoft Word - VI_12_Degrees Awarded 2015.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    nuclear systems A. Bonasera Post Doc. at INFN - Laboratori Nazionali del Sud, Catania, Italy STUDENTS WHO RECEIVED GRADUATE DEGREES FROM NON-THESIS April 1, 2014 - March 31, 2015 ...

  11. Microsoft Word - Appendix D_LegalDescription.doc

    Office of Legacy Management (LM)

    for the Chemical Plant Area Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page D-4 Legal Description for the Chemical Plant Area All that ...

  12. Microsoft Word - Appendix G_DistributionList.doc

    Office of Legacy Management (LM)

    ... Jefferson City, MO 65102-0180 Ms. Cynthia Green, Realty Specialist Missouri Department of ... Jefferson City, MO 65102 Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. ...

  13. Microsoft Word - S04801_Avian2008 _2_ revised.doc

    Office of Legacy Management (LM)

    ... Swallows were observed throughout the spring and summer. Violet-green, Barn, and Cliff ... Avian Wetland Surveys at Monticello Mill Tailing Site, 2008 U.S. Department of Energy Doc. ...

  14. Petascale Post-Doc Project a Supercomputing Success Story

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Petascale Post-Doc Project a Supercomputing Success Story Petascale Post-Doc Project a Supercomputing Success Story ARRA-funded program takes petascale computing researchers to the next level March 24, 2014 Contact: Kathy Kincade, +1 510 495 2124, petascalepostdocs.jpg From left: Jihan Kim, Filipe Maia, Alice Koniges, Robert Preissl, Brian Austin, Wangyi (Bobby) Liu , Kirsten Fagnan and Praveen Narayanan. The first post-doctoral research project centered at the Department of

  15. FAQs Docs for the Buy American Provision | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    FAQs Docs for the Buy American Provision FAQs Docs for the Buy American Provision These documents answer the most frequently asked questions about the Buy American Provision. International Trade Agreements and the Recovery Act Buy American Provisions: Frequently Asked Questions (57.16 KB) Computer Hardware and Software: Frequently Asked Questions (50.6 KB) More Documents & Publications Questions and Answers for the Smart Grid Investment Grant Program: Buy American Buy American Guidance

  16. Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc [DOE]

    Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

  17. Microsoft Word - AcqGuide70pt31A.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    AcqGuide70pt31A.doc Microsoft Word - AcqGuide70pt31A.doc PDF icon Microsoft Word - AcqGuide70pt31A.doc More Documents & Publications AcqGuide70pt31.doc&0; Policy Flash 2014-26...

  18. DOC-DOE China Mission Announcement Press Release | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    China Mission Announcement Press Release DOC-DOE China Mission Announcement Press Release DOC-DOE China Mission Announcement Press Release DOC-DOE China Mission Announcement Press Release (34.5 KB) More Documents & Publications DOC-DOE Joint China Mission Statement China 2015 Business Development Mission Marketing Flyer DOE-LPO_Email-Update_001_Through_11

  19. Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

    Office of Energy Efficiency and Renewable Energy (EERE)

    Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

  20. Microsoft Word - GC Mediation Evaluation _2-06-09_.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy GC Mediation Evaluation _2-06-09_.doc Microsoft Word - GC Mediation Evaluation _2-06-09_.doc Microsoft Word - GC Mediation Evaluation _2-06-09_.doc (29.87 KB) More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc HQ Mediation Program Brochure Microsoft Word - DRAFT CRB Interview Guidance

  1. Microsoft Word - National Science Bowl Fact Sheet.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy National Science Bowl Fact Sheet.doc Microsoft Word - National Science Bowl Fact Sheet.doc Microsoft Word - National Science Bowl Fact Sheet.doc (244.47 KB) More Documents & Publications Microsoft Word - National Science Bowl Fact Sheet.doc Idaho Operations AMWTP Fact Sheet Heating Ventilation and Air Conditioning Efficiency

  2. Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy PPL 970-Materials and Inventory 5-9-05.doc Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc (22.24 KB) More Documents & Publications Microsoft Word - al95-06.doc DOE-HDBK-1139-2006 ppl970-3.pdf

  3. Microsoft Word - AAFS_Proposal_VB.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    PROPOSAL FACT SHEET PAC cycle: (Do not complete) Date: Assigned Experiment Number Title: Experiment Spokesperson and Alternate: Telephone and...

  4. Microsoft Word - FAL2004-02.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Subject: Implementation of Fiscal Year (FY) 2004 Legislative Provisions What is the Purpose of this Financial Assistance Letter (FAL)? This FAL provides Contracting Officers and grants personnel guidance for the implementation of certain provisions contained in the Energy and Water Development Appropriations Act, 2004 (Energy & Water Act), Pub. L. 108-137, enacted December 1, 2003 and the Department of Interior and Related Agencies Appropriations Act, 2004 (Interior Act), Pub. L. 108-108,

  5. Microsoft Word - 03NESHAP-FINAL.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Standards Hazardous Air Pollutants DOE/NV/11718--929 June 2004 Calendar Year 2003 Prepared by: Bechtel Nevada Post Office Box 98521 Las Vegas, NV 89193-8521 for DISCLAIMER Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation, or favoring by the U.S. Government or any agency thereof or its contractors or subcontractors. This report has been reproduced

  6. Microsoft Word - 2007_Final.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    402 ECOLOGICAL MONITORING AND COMPLIANCE PROGRAM 2007 REPORT March 2008 Prepared by National Security Technologies, LLC Ecological Services P.O. Box 98521 Las Vegas, NV 89193-8521 DISCLAIMER Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation, or favoring by the United States Government or any agency thereof or its contractors or subcontractors.

  7. Microsoft Word - Full Thesis.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Fuel Competition in Power Generation and Elasticities of Substitution June 2012 Independent Statistics & Analysis U.S. Department of Energy Washington, DC 20585 U.S. Energy Information Administration | Fuel Competition in Power Generation and Elasticities of Substitution i This report was prepared by the U.S. Energy Information Administration (EIA), the statistical and analytical agency within the U.S. Department of Energy. By law, EIA's data, analyses, and forecasts are

  8. Microsoft Word - CQA2004_20060727.doc

    Gasoline and Diesel Fuel Update

    4) Distribution Category UC-950 Cost and Quality of Fuels for Electric Plants 2003 and 2004 June 30, 2006 (Updated August 2, 2006) Energy Information Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. Department of Energy Washington DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the Department of Energy. The information contained herein should not be construed as advocating or reflecting

  9. Microsoft Word - CQA2005W.doc

    Gasoline and Diesel Fuel Update

    5) Distribution Category UC-950 Cost and Quality of Fuels for Electric Plants 2004 and 2005 December 2006 Energy Information Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. Department of Energy Washington DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the Department of Energy. The information contained herein should not be construed as advocating or reflecting any policy position of

  10. Microsoft Word - CQA2006W.doc

    Gasoline and Diesel Fuel Update

    6) Distribution Category UC-950 Cost and Quality of Fuels for Electric Plants 2005 and 2006 October 2007 Energy Information Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. Department of Energy Washington DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the Department of Energy. The information contained herein should not be construed as advocating or reflecting any policy position of the

  11. Microsoft Word - CQA2008_FINAL.doc

    Gasoline and Diesel Fuel Update

    8) Distribution Category UC-950 Cost and Quality of Fuels for Electric Plants 2007 and 2008 January 2010 U.S. Energy Information Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. Department of Energy Washington DC 20585 This report was prepared by the U.S. Energy Information Administration (EIA), the statistical and analytical agency within the U.S. Department of Energy. By law, EIA's data, analyses, and forecasts are independent of approval by any other officer or

  12. Request Number:

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    3023307 Name: Madeleine Brown Organization: nJa Address: --- -------- -------- -- Country: Phone Number: United States Fax Number: n/a E-mail: --- -------- --------_._------ --- Reasonably Describe Records Description: Please send me a copy of the emails and records relating to the decision to allow the underage son of Bill Gates to tour Hanford in June 2010. Please also send the emails and records that justify the Department of Energy to prevent other minors from visiting B Reactor. Optional

  13. Request Number:

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    1074438 Name: Gayle Cooper Organization: nla Address: _ Country: United States Phone Number: Fax Number: nla E-mail: . ~===--------- Reasonably Describe Records Description: Information pertaining to the Department of Energy's cost estimate for reinstating pension benefit service years to the Enterprise Company (ENCO) employees who are active plan participants in the Hanford Site Pension Plan. This cost estimate was an outcome of the DOE's Worker Town Hall Meetings held on September 17-18, 2009.

  14. Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy NationalPolicyAssurancesAwardTermsFinal81804.doc Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc (31.13 KB) More Documents & Publications Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc National Policy Assurances to be Incorporated as Award Terms Microsoft Word - NationalPolicyAssurances5-06.doc

  15. Using Other Agencies' Contracts [DOE]

    The Department of Energy's (DOE) use of other agencies contracts has increased in recent years. Other agency contracts include Economy Act interagency agreements, Franchise Fund Organizations,...

  16. Microsoft Word - AL2006-08.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    (071206) NUMBER DATE SUBJECT 2002-06 081402 Domestic and Foreign Procurement Preference Rules 2002-08 120202 Project Labor Agreements 2005-04 110204 Class Deviation to ...

  17. Microsoft Word - Appendix G.doc

    Office of Legacy Management (LM)

    ... to batch release (unless an emergency release is warranted). ... As a practical matter, the planning and design work will ... conditions would present a number of logistical problems. ...

  18. Microsoft Word - fellows_nomination_reworked.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    for each individual nomination Candidate Last Name: First Name: Middle Initial: Z Number: Organization: Phone: Mail Stop: Email Address: Nominator Last Name: First Name:...

  19. Microsoft Word - Highlights Bullets.doc

    Gasoline and Diesel Fuel Update

    ... or commercial-sector generators to third parties, ... National Oceanic and Atmospheric Administration; Federal ... number in this table is net of re-injection and water cut. ...

  20. Microsoft Word - U0192600_January 2004.doc

    Office of Legacy Management (LM)

    Number U0192600 Contents DOEOffice of Legacy Management Tuba City Semi-Annual ... Performance Evaluation DOEOffice of Legacy Management Page iv January 2004 Figure 11a. ...

  1. Microsoft Word - 20050821_Appendix_A.doc

    U.S. Energy Information Administration (EIA) (indexed site)

    0. U.S. Number of Vehicles, Vehicle-Kilometers, Motor Fuel Consumption and Expenditures, 2001 ENERGY INFORMATION ADMINISTRATION HOUSEHOLD VEHICLES ENERGY USE: LATEST A N D TRENDS...

  2. Microsoft Word - pfam5000_revised.doc

    Office of Scientific and Technical Information (OSTI)

    ... The mean subfamily size is 8, and the largest subfamily, from the Pfam family HVCcapsid (hepatitis C virus capsid protein), contains 1236 sequences. 15 Figure 7: Number of ...

  3. Microsoft Word -

    Office of Legacy Management (LM)

    PROCEEDINGS, TOUGH Symposium 2006 Lawrence Berkeley National Laboratory, Berkeley, California, May 15-17, 2006 - 1 - TRITIUM TRANSPORT THROUGH A LOW-PERMEABILITY NATURAL GAS RESERVOIR Clay A. Cooper 1 , Ming Ye 2 , and Jenny Chapman 2 Desert Research Institute 1 2215 Raggio Pkwy Reno, Nevada, 89512, USA E-mail: 2 755 E. Flamingo Road Las Vegas, NV 89119, USA ABSTRACT The U.S. Department of Energy and its predecessor agencies conducted a program in the 1960s and 1970s to evaluate

  4. Microsoft Word - HABAdv#237EECA.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    7 Subject: EE/CA for 105-KE Reactor Decommissioning Adopted: Nov. 5, 2010 Page 1 November 5, 2010 Dave Brockman, Manager U.S. Department of Energy, Office of River Protection P.O. Box 450 (H6-60) Richland, WA 99352 Matt McCormick, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd,, Suite 115 Richland WA 99352 Jane Hedges, Program Manager Washington State Department

  5. Microsoft Word - NEPA18_Final.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    6415 Rev. 18 Hanford Site National Environmental Policy Act (NEPA) Characterization J. P. Duncan, Editor K. W. Burk M. A. Chamness R. A. Fowler B. G. Fritz P. L. Hendrickson E. P. Kennedy G. V. Last T. M. Poston M. R. Sackschewsky M. J. Scott S. F. Snyder M. D. Sweeney P. D. Thorne September 2007 Prepared for the U.S. Department of Energy under Contract DE-AC05-76RL01830 DISCLAIMER This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the

  6. Microsoft Word - 2012O-01.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    1 Subject: PW 1,3,6 and CW-5 February 10, 2012 Page 1 February 10, 2012 Matt McCormick, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dennis Faulk, Manager U.S. Environmental Protection Agency, Region 10 309 Bradley Blvd,, Suite 115 Richland WA 99352 Jane Hedges, Program Manager Washington State Department of Ecology 3100 Port of Benton Blvd. Richland, WA 99354 Re: PW 1,3,6 and CW-5 Record of Decision Dear Messrs. McCormick, Faulk and Ms. Hedges,

  7. Microsoft Word - DOE_EA-1454.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    54 Rev. 0 Environmental Assessment Reactivation and Use of Three Former Borrow Sites in the 100-F, 100-H, and 100-N Areas U.S. Department of Energy Richland Operations Office Richland, Washington 99352 March 2003 DOE/EA-1454 Rev. 0 EA for Reactivation and Use of Three Former Borrow Sites in the 100-F, 100-H, and 100-N Areas March 2003 i TABLE OF CONTENTS 1.0 PURPOSE AND NEED FOR AGENCY ACTION ................................................... 1-1 2.0 BACKGROUND

  8. (Document Number)

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    A TA-53 TOUR FORM/RADIOLOGICAL LOG (Send completed form to MS H831) _____________ _____________________________ _________________________________ Tour Date Purpose of Tour or Tour Title Start Time and Approximate Duration ___________________________ ______________ _______________________ _________________ Tour Point of Contact/Requestor Z# (if applicable) Organization/Phone Number Signature Locations Visited: (Check all that apply, and list any others not shown. Prior approval must be obtained

  9. Associate Research Physicist (Post-doc) - NSTX-U | Princeton Plasma Physics

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Lab (Post-doc) - NSTX-U Department: Experimental Supervisor(s): Dr. Luis F. Delgado-Aparicio Staff: RM 1 Requisition Number: 1600451 The Princeton University Plasma Physics Laboratory (PPPL) seeks to fill a post-doctoral research physicist position at the National Spherical Torus Experiment Upgrade (NSTX-U) in Princeton, NJ. For tokamaks and future facilities to operate safely in a high-pressure long-pulse discharge, it is imperative to address key issues associated with impurity sources,

  10. Microsoft Word - 090713HanfordARRAupdate.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Backgrounder Contacts: July 13, 2009 Geoff Tyree, DOE (509) 376-4171, Cameron Hardy, DOE (509) 376-5365, Update on Hiring and Recovery Act Funding at the Hanford Site, Richland Operations Office Projects Total Number of Jobs Saved/Created The total number of jobs saved to date with Recovery Act funding for DOE Richland Operations Office projects is approximately 300. The total number of jobs created to date is approximately 900. New Hires in June

  11. Microsoft Word - M088.SF30.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  12. Microsoft Word - M093.SF30.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  13. Microsoft Word - SF30 A062.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  14. Microsoft Word - M117 Melter.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  15. Microsoft Word - SF30 A056.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  16. Microsoft Word - SF30 A064.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  17. Microsoft Word - SF30 A061.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  18. Microsoft Word - M092.SF30.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  19. Microsoft Word - SF30 A070.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  20. Microsoft Word - SF30 A072.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  1. Microsoft Word - M128 Word _2_.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  2. Microsoft Word - SF30 A060.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  3. Microsoft Word - M068 SF 30.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  4. Microsoft Word - M071 SF 30.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  5. Microsoft Word - M069 SF 30.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  6. Microsoft Word - SF30 A058.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  7. Microsoft Word - SF30 A059.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  8. Microsoft Word - SF30 A074.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  9. Microsoft Word - M090.SF30.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  10. Microsoft Word - M091.SF30.DOC

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of Offers is extended, is not...

  11. Microsoft Word - M066 SF 30.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    TO AMENDMENTS OF SOLICITATIONS The above numbered solicitation is amended as set forth in Item 14. The hour and date specified for receipt of offers is extended, is not...

  12. Microsoft Word - ISDAC_orientation_pkt.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    If you have any questions please feel free to contact Debbie at 509.392.1854. Contents Cell Phone Numbers Fairbanks * Campaign Info Site Locations in Fairbanks Badging and Access ...

  13. Microsoft Word - M073 SF 30.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    history and information, etc.), which can be used to distinguish or trace an individual's identity, (e.g. name, social security numbers, date and place of birth, mother's maiden...

  14. Microsoft Word - Attachment A3.doc

    Office of Environmental Management (EM)

    A3 DRAWING NUMBER 51-W-214-W UNDERGROUND FACILITIES TYPICAL DISPOSAL PANEL Waste Isolation ... A3 Page A3-1 of 1 Drawing 51-W-214-W Underground Facilities Typical Disposal Panel 1

  15. M_16_01_05.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    0, 2402,11:26 AM Change Number M-16-01-05 Federal Facility Agreement and Consent Order Change Control Form Do not use blue ink. Type or print using black ink. Date 12312001...

  16. M_016_01_06.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    5 AM Change Number M-016-01-06 Federal Facility Agreement and Consent Order Change Control Form Do not use blue ink. Type or print using black ink. Date 123101 Originator Phone...

  17. CM200DL-Final.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    To reserve a CM200 session, go to, click on "Microscope Scheduling", use proposal number and password to log in. You may only sign up for one Core session at a ...

  18. Microsoft Word - knuteson-ro.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    ... The number of AERI observations used in the monthly statistics is shown in Figure 4 as a ... The opposite is true for the monthly statistics of the 10 m observed brightness ...

  19. Microsoft Word - IG-0744 Cover.doc

    Office of Environmental Management (EM)

    I I D D E E N N T T I I F F Y Y A A N N D D P P R R O O T T E E C C T T Y Y O O U U R R V V I I T T A A L L R R E E C C O O R R D D S S July 2010 Records Management Division Office of IT Planning, Architecture, and E-Government Office of the Chief Information Officer 2 INTRODUCTION Each Federal agency is responsible for establishing a Vital Records Program for the identification and protection of those records needed for continuity of operations before, during, and after emergencies; and those

  20. Microsoft Word - 02 Tilghman.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    APPROPRIATION FY 2015 FY 2015 FY 2016 FY 2017 Enacted Current Enacted Request 1 $ % Department of Energy Budget by Appropriation Energy and Water Development, and Related Agencies Energy Programs Energy Efficiency and Renewable Energy 1,914,195 1,840,847 2,069,194 2,898,400 +829,206 +40.1% Electricity Delivery and Energy Reliability 146,975 143,901 206,000 262,300 +56,300 +27.3% Nuclear Energy 833,379 821,883 986,161 993,896 +7,735 +0.8% Office of Technology Transitions 0 0 0 8,400 +8,400 N/A

  1. First NESAP Post-doc Takes on BoxLib

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    First NESAP Post-doc Takes on BoxLib First NESAP Post-doc Takes on BoxLib Brian Friesen to Work with Ann Almgren's Group in CCSE June 22, 2015 brianfriesenphoto Brian Friesen, PhD The first of eight post-doctoral researchers participating in the NERSC Exascale Science Applications Program (NESAP) is now working full time at NERSC. Brian Friesen, a graduate student in computational astrophysics at the University of Oklahoma, joined the NESAP team May 18. He's been assigned to Ann Almgren's group

  2. Microsoft Word - AL-PO-0001-0007.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Authorized List Doc. ID: OP-AL-0001-007.doc Off-Hours Shift Operator Date: 2001/11/20 This policy is effective 11/20/2001 and denotes those individuals who have been authorized for Off-Hours Shift Operation. 1. Alderman, Steven 2. Aigeldinger, Georg 3. Baethke, Niko 4. Bauer, Benjamin 5. Brendebach, Boris 6. Day, Lorraine 7. Desta, Yohannes 8. Doomes, Edward 9. Dust, Reinhard 10. Farquar, George 11. Fluegge, Michael 12. Goettert, Jost 13. Koch, Kevin 14. Kong, Jong Ren 15. Lian, Kun 16. Ling,

  3. Microsoft Word - 1751a.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    This form shall be protected as LANS Employment Sensitive and/or LANS Employment Sensitive/PII when one or a combination of the following personal information is revealed in a LANS record: Education, salary, medical history, employment history, social security number, date and place of birth, or mother's maiden name. Form 1751a Revision Date: 1/14 Page 1 of 2 Section I: Employee Information Employee Name Z Number Date of Qualifying Event Mailing Address (New Hires or Change of Address Only)

  4. Microsoft Word - Append E waterlevels.doc

    Office of Legacy Management (LM)

    Groundwater Level Data Since 2000 This page intentionally left blank Groundwater Levels a ______________________________________________________________________________________________________ a Numbers in parentheses indicate elevation of bottom of well for dry measurements. ______________________________________________________________________________________________________ Well Id Collect Depth to Water Well Id Collect Depth to Water Date Water Elevation Date Water Elevation

  5. Microsoft Word - ex15-ITER-sept10.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    5 - Rights in Data-Special Works - ITER UT-B Contracts Div Sept 2010 Page 1 of 1 ex15-ITER-sept10.doc Exhibit 15-ITER Ref: FAR 52.227-17 RIGHTS IN DATA SPECIAL WORKS ITER ...

  6. Microsoft Word - FY07AnnualReport.doc | Department of Energy (indexed) [DOE]

    FY07AnnualReport.doc More Documents & Publications Microsoft Word - FY08AnnualReport.doc Audit Report: IG-0857 Attachment 5 Volume II Pricing Matrix.xls...

  7. Microsoft Word - 0-PEP-6-14-07.doc | Department of Energy

    Energy Savers

    Word - 0-PEP-6-14-07.doc Microsoft Word - 0-PEP-6-14-07.doc PSF.pdf More Documents & Publications Sample Project Execution Plan Project Execution Plan Review Module (RM) Microsoft...

  8. Microsoft Word - g413.3-10Final5-6-08.doc | Department of Energy

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    g413.3-10Final5-6-08.doc Microsoft Word - g413.3-10Final5-6-08.doc DOEEVMSGoldCardSep2011.pdf More Documents & Publications EVMS and Project Analysis Standard Operating...

  9. V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerabilit...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability June 25, 2013 - 12:41am Addthis PROBLEM: ...

  10. RFQ DE-RQ01-04ME90001.doc | Department of Energy

    Energy Savers

    DE-RQ01-04ME90001.doc&0; More Documents & Publications Ammendment 2.doc Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&0; Operating Guidelines Appendix A B...

  11. Ex Parte Memo - 09 02 Mtg-09.09.10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Parte Memo - 09 02 Mtg-09.09.10.doc Ex Parte Memo - 09 02 Mtg-09.09.10.doc Summary of ex parte meeting on energy efficiency standards PDF icon Ex Parte Memo - 09 02 ...

  12. Application to Export Electric Energy OE Doc No. EA-339-A Shell...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Doc No. EA-339-A Shell Energy North America (US), L.P. Application to Export Electric Energy OE Doc No. EA-339-A Shell Energy North America (US), L.P. Application from Shell Energy ...

  13. Microsoft Word - Actinin_Safinya.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    3 Structure of Actin Cross-linked with α-Actinin: A Network of Bundles Olivier Pelletier, Elena Pokidysheva, Linda S. Hirst, Nate Bouxsein, Youli Li and Cyrus R. Safinya Materials and Physics Departments, Biomolecular Science & Engineering Program, Materials Research Laboratory, University of California, Santa Barbara, California 93106 With the emerging proteomics era, the biosciences community is now challenged to elucidate the structures and functions of a large number of interacting

  14. Microsoft Word - CSC Scorecard.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Fee Determination Posting Requirements Office of Environmental Management Attachment 2 Award Fee Determination Scorecard Contractor: Computer Sciences Corporation (CSC) Contract: Occupational Health Services Contract Number: DE-AC06-04RL14383 Award Period: 10/01/2011 to 09/30/2012 Basis of Evaluation: Performance and Evaluation Plan (PEMP) for Period FY 2012 Award Fee Available: $916,130.00 Award Fee Earned: $824,517.00 (90%) Award Fee Area Adjectival Ratings: Performance Incentive Allocated

  15. Microsoft Word - FIA-12-0061.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    John P. Newton ) ) Filing Date: October 9, 2012 ) Case No.: FIA-12-0061 ) ) Issued: October 31, 2012 _______________ Decision and Order _______________ On October 9, 2012, John P. Newton ("Appellant") filed an Appeal from determinations issued to him on September 6, 2012, and September 12, 2012, by the Office of Information Resources (OIR) of the Department of Energy (DOE) (FOIA Request Numbers HQ-2012-01768-F & HQ-2012-01835-F). In those determinations, OIR responded to two

  16. Microsoft Word - UPDATE 4 - Unit 4.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    4 to: A Dispersion Modeling Analysis of Downwash from Mirant's Potomac River Power Plant Modeling Unit 4 Emissions at Maximum and Minimum Loads ENSR Corporation December 23, 2005 Document Number 10350-002-410 (Update 4) December, 2005 1-1 1.0 INTRODUCTION This report describes dispersion modeling performed for Unit 4 at Mirant's Potomac River Generating Station. The modeling was performed according to the Protocol approved by the Virginia Department of Environmental Quality. The purpose of the

  17. Federal Agency NEPA Procedures [DOE]

    Each Federal agency is required to develop NEPA procedures that supplement the CEQ Regulations. Developed in consultation with CEQ, Federal agency NEPA procedures must meet the standards in the CEQ...

  18. Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy National Policy AssurancesAwardTermsREVJuly2005.doc Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc (31.87 KB) More Documents & Publications Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc National Policy Assurances to be Incorporated as Award Terms Microsoft Word - NationalPolicyAssurances5-06

  19. Microsoft Word - Corp Impl | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Corp Impl Microsoft Word - Corp Impl Microsoft Word - Corp Impl (422.79 KB) More Documents & Publications ESTABLISHMENT OF MANAGEMENT DECISIONS ON OFFICE OF INSPECTOR GENERAL REPORTS, DOE O 221.3 Microsoft Word - AL2007-01.doc DOE Systems Engineering Methodology (SEM): Stage Exit V

  20. DOE/Grand Junction Office Bluewater LTSP July 1997 Doc. No. S00012AA...

    Office of Legacy Management (LM)

    DOEGrand Junction Office Bluewater LTSP July 1997 Doc. No. S00012AA, Page iii Contents Page 1.0 Introduction ......

  1. advanced_biofuels_pathways_webinar_alt_text.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    advanced_biofuels_pathways_webinar_alt_text.doc advanced_biofuels_pathways_webinar_alt_text.doc advanced_biofuels_pathways_webinar_alt_text.doc advanced_biofuels_pathways_webinar_alt_text.doc (113 KB) More Documents & Publications Sustainability for the Global Biofuels Industry: Minimizing Risks and Maximizing Opportunities Webinar Transcript "The Promise and Challenge of Algae as Renewable Sources of Biofuels" 9-8-2010 - Transcript NABC Webinar

  2. Effectiveness of a Diesel Oxidation Catalyst (DOC) to control CO and hydrocarbon emissions from Reactivity Controlled Compression Ignition (RCCI) combustion [DOE]

    Performance of two commercially available DOCs with different precious metal loadings and Pt:Pd ratios were compared to model DOC containing Pt only

  3. NDRPProtocolTechBasisCompiled020705.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Basis Document for the Neutron Dose Reconstruction Project NEUTRON DOSE RECONSTRUCTION PROTOCOL Roger B. Falk, Joe M. Aldrich, Jerry Follmer, Nancy M. Daugherty, and Dr. Duane E. Hilmas Oak Ridge Institute of Science and Education and Dr. Phillip L. Chapman Department of Statistics, Colorado State University February 7, 2005 ORISE 05-0199 This document was produced under contract number DE-AC05-00OR22750 between the U.S. Department of Energy and Oak Ridge Associated Universities The authors of

  4. Microsoft Word - FAL2004-01.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Financial Assistance Letters (FALs) that remain in effect are identified below. All other previously issued FALs have been superseded by a formal rulemaking, incorporated into other guidance, and/or canceled. *************** Financial Assistance Letters Remaining in Effect Number Date Subject 96-01 03/08/96 Implementation Guidance on Sections 3001 and 3002 of EPAct 96-02 08/01/96 Implementation Guidance on Section 2306 of EPAct 97-05 12/18/97 Merit Review/Lobbying 2001-02 07/30/01 Preservation

  5. AcqGuide70pt5.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Acquisition Guide Chapter 70.3102-05-6 July 2016 Contractor Compensation - Variable Pay [Reference: FAR 31.205-6, DEAR 970.3102 -05-6, DOE Order 350.1] 1.0 Summary of Latest Changes This update: (1) changes the chapter number from 70.5 to 70.3102-05-6 to reflect the applicable FAR part, and (2) includes administrative changes. 2.0 Discussion This chapter supplements other more primary acquisition regulations and policies contained in the references above and should be considered in the context

  6. Microsoft Word - Q0032900-Aug-2004.doc

    Office of Legacy Management (LM)

    Q0032900 DOE-LM/GJ684-2004 Monticello Mill Tailings Site Operable Unit III Post-Record of Decision Monitoring Plan Draft Final August 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado Document Number Q0032900 Contents U.S. Department of Energy MMTS OU III Post-ROD Monitoring Plan August 2004 Draft Final Page iii Contents Page

  7. Microsoft Word - S06010_Ltr.doc

    Office of Legacy Management (LM)

    6010 Task Order LM00-502 Control Number 10-0184 January 21, 2010 U.S. Department of Energy Office of Legacy Management ATTN: Jack Craig Site Manager 3600 Collins Ferry Road Morgantown, WV 26505 SUBJECT: Rulison Long-Term Hydrologic Monitoring Program Sampling and Analysis Results for 2009 Dear Mr. Craig: The U.S. Department of Energy (DOE) Office of Legacy Management conducted annual sampling at the Rulison, Colorado, Site for the Long-Term Hydrologic Monitoring Program (LTHMP) on May 11 and 12,

  8. Microsoft Word - U0199700_August 2004.doc

    Office of Legacy Management (LM)

    9700 DOE-EM/GJ708-2004 Tuba City, Arizona, Land Management Project Site Semi-Annual Performance Evaluation September 2003 through February 2004 August 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy, Grand Junction, Colorado This page intentionally left blank Document Number U0199700 Contents U.S. Department of Energy Tuba City Semi-Annual Performance Evaluation August 2004 Page iii Contents 1.0 Introduction

  9. Microsoft Word - RNA_folding_Herschlag.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    March 2003 Exploring the Folding Landscape of a Structured RNA by SAXS Rick Russell, Ian S. Millett, Sebastian Doniach and Daniel Herschlag Stanford University One goal of genome projects is to systematically identify genes (1,2). The best current knowledge indicates that humans carry approximately 35000 genes. This number is an estimate that varies from expert to expert and range up to 100,000 (3-5). To anyone who has taken an elementary biology class, this ambiguity must seem strange. How hard

  10. Microsoft Word - Hurricane Analysis v11.doc

    Gasoline and Diesel Fuel Update

    The Impact of Tropical Cyclones on Gulf of Mexico Crude Oil and Natural Gas Production Table of Contents 1. Summary 2. Tropical Cyclones in the Gulf of Mexico 3. Tropical Cyclone Impacts on Gulf of Mexico Oil and Natural Gas Production and Refinery Operations 4. Forecasting Shut-In Production A. Model 1: Using the NOAA Forecast of the Atlantic ACE Index to Estimate Shut- In Production B. Model 2: Using the NOAA Forecast of the Number of Atlantic Tropical Cyclones to Estimate Shut-In Production

  11. Microsoft Word - ATVMLP template.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Advanced Technology Vehicles Manufacturing Loan Program 1 CORRECTION TO ATVMLP INTERIM FINAL RULE: The ATVM Loan Program would like to make note of the following error in the Interim Final Rule published in the Federal Register (Vol. 73, No. 219) on November 12, 2008: - On page 66728 Cargo Van fuel economy figures are incorrectly identified as: - 24.2 miles per gallon (mpg) for 2005 fuel economy average - 30.2 mpg for 2005 mpg x 125%. - The correct numbers are: - 19.9 mpg for 2005 fuel economy

  12. Microsoft Word - UPDATE 2 - Unit 1.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    2 to: A Dispersion Modeling Analysis of Downwash from Mirant's Potomac River Power Plant Modeling Unit 1 Emissions at Maximum and Minimum Loads ENSR Corporation December 20, 2005 Document Number 10350-002-410 (Update 2) December, 2005 1-1 1.0 INTRODUCTION This report describes AERMOD modeling results performed for Unit 1 at Mirant's Potomac River Generating Station. The purpose of these runs was to demonstrate that operation of Unit 1 for 24 hours a day at loads from 35 MW to 88 MW with the use

  13. Microsoft Word - Fact Sheet Environment 100808 FINAL.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Environment 100808 FINAL.doc Microsoft Word - Fact Sheet Environment 100808 FINAL.doc Microsoft Word - Fact Sheet Environment 100808 FINAL.doc (56.51 KB) More Documents & Publications Major Communications Report May 5, 2009 Major Communications Report April 30, 2009 Major Communications Report April 28, 2009

  14. Microsoft Word - va_Final3a_06-04-032.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    vaFinal3a06-04-032.doc Microsoft Word - vaFinal3a06-04-032.doc PDF icon Microsoft Word - vaFinal3a06-04-032.doc More Documents & Publications DOE F 473.2 Headquarters ...

  15. Microsoft Word - Bill's version 5-20-05.doc | Department of Energy

    Office of Environmental Management (EM)

    Bill's version 5-20-05.doc Microsoft Word - Bill's version 5-20-05.doc Microsoft Word - Bill's version 5-20-05.doc (717.91 KB) More Documents & Publications Audit Report: IG-0690 Audit Report: OAS-M-06-04 Audit Report: OAI-M-16-15

  16. Fact Sheet -- Climate VISION 02-12-031.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Fact Sheet -- Climate VISION 02-12-031.doc&#0; Fact Sheet -- Climate VISION 02-12-031.doc&#0; Fact Sheet -- Climate VISION 02-12-031.doc&#0; (28.89 KB) More Documents & Publications Meeting President Bush's Climate Change Challenge to Business and Industry Climate Vision Progress Report 2007 Climate VISION Progress Report 2007

  17. Microsoft Word - PressRelease_Siting_2-8-06_Final.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PressReleaseSiting2-8-06Final.doc Microsoft Word - PressReleaseSiting2-8-06Final.doc PDF icon Microsoft Word - PressReleaseSiting2-8-06Final.doc More Documents & ...

  18. Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    DOE E-Government Act Report 11.16.06 Final.doc Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc ...

  19. AcqGuide35pt1rev2.doc | Department of Energy

    Energy Savers

    AcqGuide35pt1rev2.doc&0; AcqGuide35pt1rev2.doc&0; AcqGuide35pt1rev2.doc&0; More Documents & Publications Attachment FY2011-58 OPAM Chapter 35 - Research and Development...

  20. Microsoft Word - ADR Revised Policy82508Reformatted.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy ADR Revised Policy82508Reformatted.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc (52.42 KB) More Documents & Publications ADR Policy Federal Register Document 2009 ECR FINAL REPORT 2010

  1. Microsoft Word - CHAP02ESH _REVISED1_3.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    CHAP02ESH _REVISED1_3.doc Microsoft Word - CHAP02ESH _REVISED1_3.doc Microsoft Word - CHAP02ESH _REVISED1_3.doc (183.77 KB) More Documents & Publications Regulatory Aspects of ISM COMMENTS&#0; A:\CHAP05PERFASSM(REVISED).PDF&#0;

  2. Notices Marine Corps Base Camp Smith HI Landholding Agency: Navy

    Energy Savers

    Register Vol. 81, No. 156 Friday, August 12, 2016 Notices Marine Corps Base Camp Smith HI Landholding Agency: Navy Property Number: 77201630011 Status: Excess Comments: ...

  3. Designation of Non-Federal Agencies as Cooperating Agencies ...

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    that are relevant in determining appropriate cooperating agencies, and encourages agencies to document their expectations, roles, and responsibilities (including funding). ...

  4. Microsoft Word - HABAdv #231_TPA_Change_Package.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    budget. The Tri-Party agencies should maintain a clear commitment to these milestones to signal potential opportunities to the private sector. * The Tri-Party agencies should not...

  5. Microsoft Word - NMMSS News DEC 23 08 Update.doc

    National Nuclear Security Administration (NNSA)

    IS SPONSORED BY DOE AND NRC NMMSS news PUBLISHED PERIODICALLY BY & FOR NMMSS USERS December 23, 2008 SPECIAL EDITION NUREG/BR-0007, Rev.6 Published The NRC wishes to inform industry that it has published its update of NUREG/BR-0007. This NUREG was updated to reflect changes to NMMSS reports that become effective January 1, 2009. Link to the updated NUREG:

  6. Microsoft Word - Appendix E_InstiControls.doc

    Office of Legacy Management (LM)

    Institutional Control Documentation U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page E-iii Appendix E Institutional Control Documentation Notation on Ownership Record for Notification to Potential Owners of Contaminated Groundwater and Applied Restrictions Chemical Plant Site and Quarry Areas (Recorded Book 3754, Pages 419-424, St. Charles County, Missouri)................................E-1 Real Estate License, Groundwater Wells and Sampling on

  7. Microsoft Word - NO1113_Dewatering report.doc

    Office of Legacy Management (LM)

    Hydrologic Assessment of Dewatering for Installation of the Belcher Road Water Transmission Line This page intentionally left blank U.S. Department of Energy Dewatering Evaluation Report for Road Const. & Water Line Replacement June 2008 Doc. No. N0111300 Page C-3 The rate of pumping resulting from aquifer dewatering for installation of the planned water transmission line beneath Belcher Road is expected be larger than any of the discharge rates associated with drainage infrastructure

  8. Microsoft Word - S04877_AnnInspRpt2008.doc

    Office of Legacy Management (LM)

    Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2008 LMS/MNT/S04877 This page intentionally left blank LMS/MNT/S04877 2008 Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2008 This page intentionally left blank U.S. Department of Energy 2008 Annual Inspection-Monticello, Utah December 2008 Doc. No. S487700 Page i Contents Executive

  9. Microsoft Word - S04929_GW_Mon_NDEP_Final.doc

    Office of Legacy Management (LM)

    Groundwater Monitoring Report Central Nevada Test Area, Corrective Action Unit 443 March 2009 Rev. 1 LMS/CNT/S04929 This page intentionally left blank LMS/CNT/S04929 2008 Groundwater Monitoring Report Central Nevada Test Area, Corrective Action Unit 443 March 2009 Rev. 1 This page intentionally left blank U.S. Department of Energy 2008 Groundwater Monitoring Report-CNTA, CAU 443 March 2009 Doc. No. S04929 Rev. 1 Page i Contents 1.0

  10. Microsoft Word - S04932 History final.doc

    Office of Legacy Management (LM)

    FUSRAP History of the Chupadera Mesa, NM, Site December 2008 Doc. No. S0493200 (FUSRAP NM.04-5) Page 1 of 9 FUSRAP History of the Chupadera Mesa, NM, Site The following historical summary is provided to document the inclusion of the Chupadera Mesa, NM, Site into the Formerly Utilized Sites Remedial Action Program (FUSRAP). Although no remedial action was required, the site met eligibility criterion and was included under FUSRAP, under which the final radiological surveys were performed.

  11. Microsoft Word - S05378_2009 GW Rpt.doc

    Office of Legacy Management (LM)

    08 through April 2009 October 2009 LMS/MNT/S05378 This page intentionally left blank LMS/MNT/S05378 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report May 2008 through April 2009 October 2009 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report May 2008-April 2009 October 2009 Doc. No. S05378 Page i Contents

  12. Microsoft Word - S05551_1stqtr report.doc

    Office of Legacy Management (LM)

    09 July 2009 LMS/RFS/S05551 This page intentionally left blank LMS/RFS/S05551 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2009 July 2009 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2009 July 2009 Doc. No. S05551 Page i Contents

  13. Microsoft Word - S06528_1st qtr 2010.doc

    Office of Legacy Management (LM)

    10 July 2010 LMS/RFS/S06528 This page intentionally left blank LMS/RFS/S06528 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2010 July 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2010 July 2010 Doc. No. S06528 Page i Contents

  14. Microsoft Word - S07079_jul_sep_10.doc

    Office of Legacy Management (LM)

    July 1-September 30, 2010 October 2010 Doc. No. S07079 Page 1 Monticello, Utah, National Priorities List (NPL) Sites Federal Facilities Agreement (FFA) Quarterly Report: July 1-September 30, 2010 This report summarizes project status and activities implemented July through September 2010, and provides a schedule of near-term activities for the Monticello Mill Tailings Site (MMTS) and the Monticello Vicinity Properties (MVP) Site. This report also includes disposal cell and Pond 4 leachate

  15. Microsoft Word - S08999_Apr11-Mar12.doc

    Office of Legacy Management (LM)

    1 Through March 2012 Tuba City, Arizona, Disposal Site July 2012 LMS/TUB/S08999 This page intentionally left blank LMS/TUB/S08999 Annual Groundwater Report April 2011 Through March 2012 Tuba City, Arizona, Disposal Site July 2012 This page intentionally left blank U.S. Department of Energy Tuba City Annual Groundwater Report-April 2011 through March 2012 July 2012 Doc. No. S08999 Page i Contents Abbreviations

  16. Microsoft Word - AppendixH_CommentResponse.doc

    Office of Legacy Management (LM)

    NFSS Vicinity Property Report October 2010 Doc. No. S06246 Page H-1 Responsiveness Summary The U.S. Department of Energy (DOE) released the Formerly Utilized Sites Remedial Action Program Niagara Falls Storage Site Vicinity Properties, New York: Review of Radiological Conditions at Six Vicinity Properties and Two Drainage Ditches on April 23, 2010, for public comment. Report availability was announced through a message to stakeholders sent on behalf of DOE by USACE. The announcement provided a

  17. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    2009 Revegetation Success Monitoring This page intentionally left blank 2009 Revegetation Success Monitoring Central Nevada Test Area Corrective Action Unit 417 UC-1 Central Mud Pit This page intentionally left blank U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc No. S05767 Page C-i Contents 1.0 Introduction and Purpose ..................................................................................................C-1 2.0 Monitoring

  18. Microsoft Word - S05775_2009 VMR.doc

    Office of Legacy Management (LM)

    Report for the Old and New Rifle, Colorado, Processing Sites September 2009 LMS/RFO/RFN/S05775 This page intentionally left blank LMS/RFO/RFN/S05775 2009 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2009 This page intentionally left blank U.S. Department of Energy 2009 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2009 Doc. No. S05775 Page i Contents

  19. Microsoft Word - S07012_RFL_2010_VMR_LEC.doc

    Office of Legacy Management (LM)

    Old and New Rifle, Colorado, Processing Sites September 2010 LMS/RFO/RFN/S07012 This page intentionally left blank LMS/RFO/RFN/S07012 2010 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2010 This page intentionally left blank U.S. Department of Energy 2010 Verification Monitoring Report for the Old and New Rifle, Colorado, Processing Sites September 2010 Doc. No. S07012 Page i Contents

  20. Microsoft Word - S07033_2nd qtr 2010.doc

    Office of Legacy Management (LM)

    Second Quarter Calendar Year 2010 October 2010 LMS/RFS/S07033 This page intentionally left blank LMS/RFS/S07033 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities Second Quarter Calendar Year 2010 October 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-2nd Quarter CY 2010 October 2010 Doc. No. S07033 Page i Contents

  1. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    MV-4 Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page B-1 Table B-1. MV-4 Chronology Date Time Depth (ft bgs) Activity 04/16/09 through 04/22/09 NA NA Mobilization to CNTA and rig-up to drill 04/22/09 15:45 0 Rig inspection and drill pad walk through inspection, continue with preparations for drilling. 04/22/09 21:50 0 Begin drilling 31-inch diameter conductor casing borehole 04/23/09 10:10 100 Advanced

  2. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    MV-5 Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page C-1 Table C-1. MV-5 Chronology Date Time Depth (ft bgs) Activity 05/09/09 through 05/10/09 NA NA Move rig and equipment from MV-4 pad to MV-5 pad and prepare to drill MV-5. 05/10/09 12:10 0 Rig inspection and drill pad walk through inspection, continue with preparations for drilling. 05/10/09 14:00 0 Begin drilling 31-inch diameter conductor casing

  3. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    UC-1-P-1SRC Data This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page D-1 Table D-1. UC-1-P-1SRC Chronology Date Time Depth (ft bgs) Activity 05/23/09 13:30 - 18:30 NA Position workover rig over the hole and pulled out about 50 ft of 4.5-in. casing. A steel die fell into hole and indications were that casing had separated during initial pulling. 05/24/09 06:00 - 09:00 NA Workover rig moves off the hole after

  4. Microsoft Word - ex15-ITER-sept10.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    5 - Rights in Data-Special Works - ITER UT-B Contracts Div Sept 2010 Page 1 of 1 ex15-ITER-sept10.doc Exhibit 15-ITER Ref: FAR 52.227-17 RIGHTS IN DATA í SPECIAL WORKS í ITER (Sept 2010) (a) Definitions. (1) "Data", as used in this clause, means recorded information, regardless of form or the media on which it may be recorded. The term includes technical data and computer software. The term does not include information incidental to contract administration, such as financial,

  5. Microsoft Word - ex1b-ITER-mar07.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    B - Patent Rights - Acquisition by the Government - ITER UT-B Contracts Div March 2007 Page 1 of 6 ex1b-ITER-mar07.doc Exhibit 1B ITER Ref: DEAR 952.227-13 PATENT RIGHTS - ACQUISITION BY THE GOVERNMENT - ITER (Mar 2007) (a) Definitions. (1) "Invention", as used in this clause, means any invention or discovery which is or may be patentable or otherwise protectable under title 35 of the United States Code or any novel variety of plant that is or may be protectable under the Plant Variety

  6. Microsoft Word - ex9-ITER-june11.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    - Technical Data - ITER UT-B Contracts Div June 2011 Page 1 of 5 ex9-ITER-june11.doc Exhibit 9 ITER Ref: DEAR 927.409; FAR 52.227-14, 52.227-14 Alt.V, 52.227-16 TECHNICAL DATA - ITER (June 2011) 1. RIGHTS IN DATA - GENERAL (a) Definitions. (1) "Computer data bases," as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include computer software. (2) "Computer

  7. Microsoft Word - ex9ed-ITER-june11.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    ED - Technical Data - ITER UT-B Contracts Div June 2011 Page 1 of 5 ex9ed-ITER-june11.doc Exhibit 9ED ITER Ref: DEAR 927.409; FAR 52.227-14, 52.227-14 Alt. IV, 52.227-14 Alt. V, 52.227-16 TECHNICAL DATA - ITER (June 2011) 1. RIGHTS IN DATA-GENERAL (a) Definitions. (1) "Computer data bases," as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include computer

  8. Microsoft Word - ex9rdf-ITER-sept09.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    RDF - Technical Data - ITER UT-B Contracts Div Sept 2009 Page 1 of 5 ex9rdf-ITER-sept09.doc Exhibit 9RDF-ITER Ref: DEAR 970.5227-1 TECHNICAL DATA - ITER (Sept 2009) 1. Rights in Data-Facilities. (a) Definitions. (1) "Computer Data Bases", as used in this clause, means a collection of data in a form capable of, and for the purpose of, being stored in, processed, and operated on by a computer. The term does not include Computer Software. (2) "Computer Software", as used in this

  9. Microsoft Word - FINAL_Recommendation_2008-03.doc

    Office of Environmental Management (EM)

    Regarding the EPA Stormwater Discharge Permit Background The U.S. Environmental Protection Agency (EPA) regulates Stormwater discharge at Los Alamos National Laboratory (LANL). ...

  10. Microsoft Word - Rhode Island EA - FINAL EA.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    ... The pipeline would be insulated to provide freeze ... The six major greenhouse gases are carbon dioxide, methane, ... Agency floodplain maps, the proposed project ...

  11. Microsoft Word - No Fear Stats FY02.doc

    Office of Environmental Management (EM)

    ... Pending Written Notification 3 Investigation 61 Hearings 115 Final Agency Action 15 Appeal with EEOC Office of Federal Operations NA XI. Complaint Investigations: 29 CFR ...

  12. Microsoft Word - No Fear Stats FY04.doc

    Office of Environmental Management (EM)

    ... Pending Written Notification 8 Investigation 34 Hearings 45 Final Agency Action 10 Appeal with EEOC Office of Federal Operations 28 XI. Complaint Investigations: 29 CFR ...

  13. Microsoft Word - No Fear Stats FY06.doc

    Office of Environmental Management (EM)

    ... Pending Written Notification 1 Investigation 61 Hearings 31 Final Agency Action 14 Appeal with EEOC Office of Federal Operations 24 XI. Complaint Investigations: 29 CFR ...

  14. Microsoft Word - No Fear Stats FY03.doc

    Office of Environmental Management (EM)

    ... Pending Written Notification 12 Investigation 52 Hearings 69 Final Agency Action 15 Appeal with EEOC Office of Federal Operations NA XI. Complaint Investigations: 29 CFR ...

  15. Microsoft Word - Canceled -7 Section C April 16 2010.doc

    Office of Environmental Management (EM)

    ... Law Enforcement Agency LMG Light Machine Gun LRI Live Round Inhibitor LRMB Live Round ... Incident Response Plan SMG Submachine Gun SNM Special Nuclear Material SO Office of ...

  16. Microsoft Word - HABAdv #234_FY2012_Budget_Requests.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Protection Agency, Region 10 309 Bradley Blvd., Suite 115 Richland, WA 99352 Jane Hedges, Program Manager Washington State Department of Ecology 3100 Port of Benton...

  17. Microsoft Word - HABAdv#227_ModelingvsCharacterization.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Protection Agency, Region 10 309 Bradley Blvd., Suite 115 Richland, WA 99352 Jane Hedges, Program Manager Washington State Department of Ecology 3100 Port of Benton...

  18. Microsoft Word - HABAdv #232_ARRA_Funding.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Protection Agency, Region 10 309 Bradley Blvd., Suite 115 Richland, WA 99352 Jane Hedges, Program Manager Washington State Department of Ecology 3100 Port of Benton...

  19. Microsoft Word - HABChairSelectionProcess_2006.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    ChairVice-chairs Selection Process Nominations 1) Board members, alternates and Tri-Party agencies provide nominations for HAB chair (from September to October 15, 2006). a....

  20. Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Energy Citrix_2FA_Authentication_12_3_2009.doc Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc Microsoft Word - Citrix_2FA_Authentication_12_3_2009.doc (453.3 KB) More Documents & Publications Citrix_2FA_Authentication_09.09 Using Two-Factor RSA Token with WebVPN User guide for remote access to VDI and Workplace using RSA token

  1. Microsoft Word - GNEP Website Glossary 2006-02-03_no_links.doc | Department

    Office of Environmental Management (EM)

    of Energy GNEP Website Glossary 2006-02-03_no_links.doc Microsoft Word - GNEP Website Glossary 2006-02-03_no_links.doc Microsoft Word - GNEP Website Glossary 2006-02-03_no_links.doc (29.63 KB) More Documents & Publications GNEP Glossary Generation-IV Roadmap Report of the Fuel Cycle Crosscut Group DOE-HDBK-1113-2008

  2. Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_.doc (160.81 KB) More Documents & Publications Notice of Proposed Rulemaking (August 6, 2009) Notice of Proposed Rulemaking (May 16, 2007) Final Rule (December 4, 2009)

  3. Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy NSRC precompetitive User Agreement amended 1-18-07.doc Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc (69.15 KB) More Documents & Publications EXHIBIT A: CRADA, WFO, PUA and NPUA Comparison Table, with suggested changes Class_Waiver_NPUA-2.pdf ClassWaiver-PUA.pdf

  4. Agency-Wide Screening [DOE]

    Federal agencies face energy-related requirements on new construction projects and major renovations. These Federal requirements range from reductions in fossil-fuel use to specifying the use of...

  5. State Agency Loan Program [DOE]

    Just over half of all SALP loans are directed to Energy Performance Contracts (EPCs) that the Maryland Department of General Services coordinates with the State’s agencies. These EPCs are typical...

  6. The EURATOM Supply Agency

    SciTech Connect (OSTI)

    Lightner, J.


    With the coming liberalization of trade and industry within the European Community (EC) and a more centrally-coordinated EC external trade policy, it is timely to ask if in the 1990s there will be any significant changes in the commercial relations between the EC and non-EC companies trading in nuclear fuel. The key vehicle for implementing any change of policy would probably be the European Atomic Energy Community (EURATOM) Supply Agency in Brussels, which is charged under the EURATOM Treaty with overseeing the equitable supply of nuclear fuel to and among EC companies. The EURATOM Supply Agency (the Agency) is a signatory to almost all EC-company contracts for transactions that occur on the territory of the Community, which includes Belgium, Denmark, France, the Federal Republic of Germany (FRG), Great Britain, Greece, Ireland, Italy, Luxembourg, the Netherlands, Portugal, and Spain. During the 1980s, the Supply Agency has rarely tried to influence the commercial decisions of EC member companies. The nuclear fuel industry has largely perceived the Agency as an administrative office that registers contracts and maintains relations with some outside governments, particularly Australia, Canada, and the USA. However, in 1988 the Agency began to have a more direct commercial impact when it reviewed the practice-previously conducted routinely by the EURATOM Safeguards Directorate in Luxembourg at the request of EC-member companies-of swapping safeguards obligations on equivalent quantities of uranium at different locations (flag swapping). The Agency`s actions inhibiting flag swaps, as well as a related de facto policy restricting material swaps of Southern African uranium, caused it to be viewed as obstructive by some EC companies. During 1989 the discussion about flag swaps and swaps involving South African and Namibian uranium has subsided, and a far-reaching discussion has arisen about EC trade policy in general.

  7. Broad Agency Announcements

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Broad Agency Announcements Broad Agency Announcements World-class experts and capabilities countering all aspects of explosive threats, and aiming predominantly at enhanced detection capabilities. LACED can respond to BAAs, so long as the BAA solicitations satisfies FOA criteria noted in "When LACED can Participate" under the FOAs section. When a BAA is relevant to LACED's unique capabilities and its Department of Energy mission, LACED in general may respond to the BAA on its own.

  8. NDIA_PMSC_SurveillanceGuide_Oct2004.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    PDF icon NDIAPMSCSurveillanceGuideOct2004.doc More Documents & Publications EVMS Surveillance Standard Operating Procedure (ESSOP) NDIAPMSCEVMSIntentGuideNov2006.pdf ...

  9. Microsoft Word - S02459_2006Annual GW Rpt.doc

    Office of Legacy Management (LM)

    Site Operable Unit III Annual Ground Water Report October 2005 through April 2006 ... Site OU III Annual Ground Water Report October 2005-April 2006 September 2006 Doc. ...

  10. Microsoft Word - S05212_2008 Post-Closure InspRpt.doc

    Office of Legacy Management (LM)

    ... and maintenance program * Communicate with ... Salmon-Calendar Year 2008 U.S. Department of Energy Doc. No. ... businesses from nearby communities. * Continue the ...

  11. OSTIblog Articles in the Adopt-A-Doc Topic | OSTI, US Dept of...

    Office of Scientific and Technical Information (OSTI)

    STIP is a robust and effective collaboration across the DOE... Related Topics: .EDUconnections, Adopt-A-Doc, DOE Green Energy, DOE STI, journal literature, National Library of ...

  12. Microsoft Word - S04916_2008 Macroinvert Biomonitoring Rpt.doc

    Office of Legacy Management (LM)

    ... retention pond are cliff swallows, violet-green swallows, song sparrows, and black phoebes. 2008 Macroinvertebrate Sampling-Monticello, Utah U.S. Department of Energy Doc. No. ...

  13. NVN-088208 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    6 months earlier; BLM NOI was just a formality Relevant Numbers Lead Agency Doc Number Serial Number NVN-088208 Lease Numbers NVN-074249 NVN-074250 NVN-074253 NVN-074254 Tiered Doc...

  14. NVN-091276 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20121025 Relevant Numbers Lead Agency Doc Number Serial Number NVN-091276 Lease Numbers NVN-083928 NVN-085708 Tiered Doc DOI-NV-W010-2012-0061...

  15. FEMP Best Practices and Lessons Learned for Federal Agency ESPC Projects: Preliminary Assessment

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    5. PRELIMINARY ASSESSMENT (PA) 5.1 To get a useful PA from the ESCO, the agency should provide the ESCO with all relevant current information about the facilities, including energy consumption and previous audits. 5.2 The PA should be only as long as necessary to convey the viability of a project. An example/template of a PA can be found at: . 5.3 Set deadlines for PA submission and for agency completion of PA review and response to the

  16. Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    Department of Energy Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc meeting on Energy Efficiency and Sustainable Design of Federal Buildings Microsoft Word - Agenda for 9-2-10 DOE Mtg re EE of Fed Bldgs.doc (99.54 KB) More Documents & Publications Ex Parte Memo - 09 02 Mtg-09.09.10.doc Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc

  17. NVN-086287 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20081203 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086287 Lease Numbers NVN-074855 Proposed Action Installation and sampling...

  18. NVN-087930 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Decision Document Date 20090916 Relevant Numbers Lead Agency Doc Number NVN-087930 Serial Number NVN-087930 Lease Numbers NVN-018423 NVN-076291 NVN-083928 NVN-085708 NVN-085709...

  19. NVN-087809 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Decision Document Date 20090612 Relevant Numbers Lead Agency Doc Number NV-087809 Serial Number NV-087809 Lease Numbers NVN-085710 NVN-085711 Proposed Action A Gravity...

  20. NVN-086761 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20090224 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086761 Lease Numbers NVN-079305 NVN-079306 NVN-079307 Proposed Action...

  1. NVN-086286 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    NOI, POO Decision Document Date 20081201 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086286 Lease Numbers NVN-085722 NVN-085723 NVN-085724 Proposed Action The...

  2. NVN-087791 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20090721 Relevant Numbers Lead Agency Doc Number Serial Number NVN-087791 Lease Numbers NVN-074854 NVN-076298 NVN-076299 NVN-076300 NVN-076301...

  3. NVN-086285 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20081201 Relevant Numbers Lead Agency Doc Number Serial Number NVN-086285 Lease Numbers NVN-083928 NVN-085708 NVN-085709 Proposed Action The...

  4. NVN-088259 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20100317 Relevant Numbers Lead Agency Doc Number Serial Number NVN-088259 Lease Numbers NVN-074308 NVN-074309 Proposed Action Closely spaced...

  5. NVN-087812 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20090721 Relevant Numbers Lead Agency Doc Number Serial Number NVN-087812 Lease Numbers NVN-074854 NVN-076298 NVN-076299 NVN-076300 NVN-076301...

  6. NVN-89274 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-89274 Lease Numbers NVN-085716 NVN-086893 NVN-088920 Proposed Action...

  7. NVN-087811 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20090721 Relevant Numbers Lead Agency Doc Number Serial Number NVN-087811 Lease Numbers NVN-074854 NVN-076298 NVN-076299 NVN-076300 NVN-076301...

  8. NVN-89534 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Date 20110302 Application Document Type NOI Relevant Numbers Lead Agency Doc Number Serial Number NVN-089534 Lease Numbers NVN-083928 NVN-077668 Proposed Action Two thermal...

  9. NVN-89292 | Open Energy Information

    Open Energy Information (Open El) [EERE & EIA]

    Type NOI Decision Document Date 20101202 Relevant Numbers Lead Agency Doc Number Serial Number NVN-089292 Lease Numbers NVN-088435 NVN-088436 NVN-088437 Proposed Action...

  10. DOE/ID-Number

    Office of Scientific and Technical Information (OSTI)

    Microfluidic Sampling System for High Temperature Electrochemical MC&A September 26, 2013 II DISCLAIMER This information was prepared as an account of work sponsored by an agency...


    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    41 Federal Register / Vol. 80, No. 243 / Friday, December 18, 2015 / Notices ENVIRONMENTAL PROTECTION AGENCY [ER-FRL-9024-5] Environmental Impact Statements; Notice of Availability Responsible Agency: Office of Federal Activities, General Information (202) 564-7146 or Weekly receipt of Environmental Impact Statements Filed 12/07/2015 Through 12/11/2015 Pursuant to 40 CFR 1506.9. Notice Section 309(a) of the Clean Air Act requires that EPA make public its comments on

  12. Designation of Non-Federal Agencies as Cooperating Agencies [DOE]

    This Council on Environmental Quality Memorandum (CEQ) urges agencies to more actively solicit the participation of state, tribal and local governments as cooperating agencies in implementing the environmental impact statement process. The Memorandum refers agencies to existing CEQ guidance on the types of actions and expertise that are relevant in determining appropriate cooperating agencies, and encourages agencies to document their expectations, roles, and responsibilities (including funding).

  13. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page B-1 Table 1. UC-1 Monument Elevations and Subsidence Elevation at Top of Monument a,b Subsidence (m) Date SM-1 N 6,430,874.2869 E 539,588.2339 SM-2 N 6,430,863.3239 E 539,644.8195 SM-3 N 6,430,855.2553 E 539,684.3327 SM-4 N 6,430,849.7763 E 539,715.7991 SM-5 N 6,430,852.0243 E 539,585.4651 SM-6 N 6,430,841.7590 E 539,641.4674 SM-7 N 6,430,834.5289 E 539,680.5243 SM-8 N

  14. Microsoft Word - settlement closeout press release _2_ _2_.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    fuel to dry storage, and emptying and closing 11 of 15 underground high- level waste storage tanks. The agency met its commitment providing 30 million to the state over a...

  15. Microsoft Word - CFAC 7-Year PSA.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    be deemed unreasonable for BPA to require credit security from an assignee with a Moody's credit rating below "A", or the equivalent if rated by another credit rating agency. No...

  16. Microsoft Word - Power Sales Agreement ALCOA - 081909 pm.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    be deemed unreasonable for BPA to require credit security from an assignee with a Moody's credit rating below "A", or the equivalent if rated by another credit rating agency. No...

  17. Microsoft Word - HABAdv#225_CommunityRelationsplan.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    communication technologies as they come into use by the general public. The Board looks forward to continuing to work with the Tri-Party Agencies on the draft Community Relations...

  18. Microsoft Word - HABAdv#220 FY2010 Budget.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    Protection Agency, Region 10 309 Bradley Blvd., Suite 115 (B1-46) Richland, WA 99352 Jane Hedges, Program Manager Washington State Department of Ecology 3100 Port of Benton...

  19. Microsoft Word - FIA-13-0047 & 0048.doc

    Office of Energy Efficiency and Renewable Energy (EERE) (indexed site)

    ... to use and dispose of the record as it sees fit; (3) The extent to which agency ... Accordingly, DOE cannot use and dispose of the record as it sees fit and the videotape has ...

  20. Microsoft Word - AMI White paper final 013108 _2_.doc

    U.S. Department of Energy (DOE) all webpages (Extended Search)

    NETL Modern Grid Strategy Powering our 21st-Century Economy ADVANCED METERING INFRASTRUCTURE Conducted by the National Energy Technology Laboratory for the U.S. Department of Energy Office of Electricity Delivery and Energy Reliability February 2008 Office of Electricity Delivery and Energy Reliability V1.0 DISCLAIMER This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government nor any agency thereof, nor any of