Powered by Deep Web Technologies
Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

Sun-Sentinel South Florida consumer costs rising faster than  

E-Print Network [OSTI]

Sun-Sentinel South Florida consumer costs rising faster than the national average May 18, 2011|By Donna Gehrke-White, Sun Sentinel We are not imagining it: The cost of living has jumped in South Florida

Belogay, Eugene A.

2

A technical look at the WTI incinerator  

SciTech Connect (OSTI)

EPA has granted Waste Technologies Industries (WTI) temporary authorization to burn hazardous waste in its new incinerator in East Liverpool, Ohio. The approval is based on preliminary data showing that the incinerator was able to meet EPA`s emission standards for dioxins and furans in tests run this summer. WTI is allowed to continue burning waste pending final evaluation of its March 1993 performance tests. The action marks yet another hurdle cleared by WTI in its 11-year effort to construct and operate a commercial hazardous waste incinerator. The facility`s long-standing predicament as a target for environmental and public interest groups has made it the subject of numerous lawsuits and many legal reviews. In this article, however, we focus on the technical aspects of the system. The WTI incinerator is described in {open_quotes}Performance Testing of a Rotary Kiln Incinerator,{close_quotes} a paper by Alfred Sigg of Von Roll, Incorporated (Norcross, Georgia). The paper was presented at the 1993 Incineration Conference, which was held in Knoxville, Tennessee on May 3-7, 1993. 1 fig., 2 tabs.

NONE

1993-11-01T23:59:59.000Z

3

Picosecond laser ablation of nano-sized WTi thin film  

Science Journals Connector (OSTI)

Interaction of an Nd:YAG laser, operating at 532 nm wavelength and pulse duration of 40 ps, with tungsten-titanium (WTi) thin film (thickness, 190 nm)...2...were found to be sufficient for modification of the WTi

S. Petrovi?; B. Gakovi?; D. Peruško; T. Desai; D. Batani; M. ?ekada…

2009-08-01T23:59:59.000Z

4

WTI Crude Oil Price: Base Case and 95% Confidence Interval  

Gasoline and Diesel Fuel Update (EIA)

9 9 Notes: Spot WTI prices broke $35 and even $36 per barrel in November as anticipated boosts to world supply from OPEC and other sources did not show up in actual stocks data. The recent decline in prices seems to be more the result of an unraveling of speculative pressures than a change in underlying fundamentals. Prices had been running higher than supply/demand fundamentals would have indicated throughout the fall months as a result of rising Mideast tensions, concern over the adequacy of distillate supplies, and expectations of Iraqi supply interruptions. But Mideast tensions seemed to ease in December and the market appeared to perceive a quick return of Iraqi crude oil supplies at full capacity. Pledges by Saudi Arabia/OPEC to offset a longer term Iraqi

5

WTI Crude Oil Price: Base Case and 95% Confidence Interval  

Gasoline and Diesel Fuel Update (EIA)

6 6 Notes: Spot WTI crude oil prices broke $35 and even $36 per barrel in November as anticipated boosts to world supply from OPEC and other sources did not show up in actual stocks data. The recent decline in prices seems to be more the result of an unraveling of speculative pressures than a change in underlying fundamentals. Prices had been running higher than supply/demand fundamentals would have indicated throughout the fall months as a result of rising Mideast tensions, concern over the adequacy of distillate supplies, and expectations of Iraqi supply interruptions. But Mideast tensions seemed to ease in December and the market appeared to perceive a quick return of Iraqi crude oil supplies at full capacity. Pledges by Saudi Arabia/OPEC to offset a longer term Iraqi

6

Thermal diffusion in Au?WTi?Pd metallization on silicon  

Science Journals Connector (OSTI)

This paper presents the results of investigation of thermal diffusion in Au?Wti?Pd metallization on (111) n-Si. Thin films were deposited by dc sputtering to the thickness of 50 (Pd), 100–200 (WTi) and 70–200 nm (Au). After deposition the samples were subjected to thermal treatments vacuum 1 × 10?5 mbar, at temperatures up to 600°C. Characterization included RBS, AES, XRD and SEM structural analysis and sheet resistivity measurements. During annealing up to 450°C diffusion occurs only at the Pd?Si interface, at 500°C other components interdiffuse at isolated areas of the samples and at 600°C there is total interdiffusion on components. Thermal degradation oftthe \\{WTi\\} diffusion barrier is enhanced by the growth of Pd2Si phase, during which silicon is released from the substrate and mechanical stress is introduced. Better diffusion barrier properties were obtained when \\{WTi\\} films were deposited in nitrogen or oxygen atmosphere.

M Milosavljevi?; N Bibi?; M Stojanovi?; J Turkovi?; I.H Wilson

1990-01-01T23:59:59.000Z

7

Speculative trading and oil price dynamic: A study of the WTI market  

Science Journals Connector (OSTI)

The aim of this paper is to study the oil price dynamic in West Texas Intermediate (WTI) market in the US. By using statistical and econometric tools, we first attempt to identify the long term relationship between WTI spot prices and the prices of futures contracts on the New York Mercantile Exchange (NYMEX). Subsequently we model the short term dynamic between these two prices and this analysis points up several breaks. On this basis, a short term Markov Switching Vectorial Error Correction model (MS-VECM) with two distinct states (standard state and crisis state) has been estimated. Finally we introduce the volumes of transactions observed on the NYMEX for the WTI contracts and we estimate the influence of the non-commercial players. We conclude that the hypothesis of an influence of non-commercial players on the probability for being in the crisis state cannot be rejected. In addition, we show that the rise in liquidity of the first financial contracts, as measured by the volume of open interest, is a key element to understand the dynamics in market prices.

Emmanuel Hache; Frédéric Lantz

2013-01-01T23:59:59.000Z

8

Revealing asymmetries in the loss function of WTI oil futures market  

Science Journals Connector (OSTI)

This paper examines behavioural aspects of the West Texas Intermediate (WTI) oil 1-month futures from 1995 to ... regarding preferences. Even without observing fundamentals of WTI oil futures we can assess whethe...

E. C. Mamatzakis

2014-09-01T23:59:59.000Z

9

Structure–Diffusion Relationship of Magnetron-Sputtered WTi Barriers Used in Indium Interconnections  

Science Journals Connector (OSTI)

Tungsten-titanium (WTi) thin films are known as potential adhesion ... and diffusion barriers. The barrier efficiency of WTi thin films against indium (In) diffusion...in situ...annealing. Specific multilayered s...

A. Le Priol; E. Le Bourhis; P.-O. Renault; P. Muller…

2014-03-01T23:59:59.000Z

10

Economically rational expectations theory: evidence from the WTI oil price survey data  

E-Print Network [OSTI]

Economically rational expectations theory: evidence from the WTI oil price survey data Georges PRAT are not conclusive regarding this hypothesis. Moosa and Al- Loughani (1994) find that futures prices on the WTI of whether or not expectations are rational unsolved. Using private WTI oil price expectations revealed

Paris-Sud XI, Université de

11

WTI Crude Oil Price: Base Case and 95% Confidence Interval  

Gasoline and Diesel Fuel Update (EIA)

7 7 Notes: Spot WTI prices broke $35 and even $36 per barrel in November as anticipated boosts to world supply from OPEC and other sources failed to find much realization in actual stocks data. The idea that stocks are still languishing at below-normal levels is particularly persuasive when one views current levels (for key consuming regions) relative to "normal" values which account for the long-term trend in OECD stocks. We believe that monthly average WTI prices will stay around $30 per barrel for the first part of 2001. This is a noticeable upward shift in our projected average prices from even a month ago. The shift reflects greater emphasis on the lack of stock builds and less emphasis on the assumption that supply from OPEC and non-OPEC suppliers may be exceeding demand by 1-2

12

Comparison of \\{WTi\\} and WTi(N) as diffusion barriers for Al and Cu metallization on Si with respect to thermal stability and diffusion behavior of Ti  

Science Journals Connector (OSTI)

Abstract The thermal stability of \\{WTi\\} and WTi(N) as diffusion barriers for Al and Cu metallization on Si (1 0 0) was investigated by time of flight secondary ion mass spectrometry (ToF-SIMS) depth profiling, X-ray diffraction (XRD), electron microscopy (SEM and TEM) and X-ray photoelectron spectroscopy (XPS). For both, Al and Cu, Ti diffusion out of \\{WTi\\} into the metal was proved to occur at elevated temperatures (400 °C for Al and 600 °C for Cu) which further results in barrier film failure. Nitrogen incorporation into \\{WTi\\} leads to an elimination of the Ti diffusion and consequently to a better thermal stability of the barrier film. It is shown that besides crystal structure, Ti diffusion into the metallization is an essential factor of the barrier failure mechanism. The failure temperature for Al is lower than for Cu.

M. Fugger; M. Plappert; C. Schäffer; O. Humbel; H. Hutter; H. Danninger; M. Nowottnick

2014-01-01T23:59:59.000Z

13

Evaluation of the composition and morphology of a WTi/Si system processed by a picosecond laser  

Science Journals Connector (OSTI)

In this work we studied the influence of laser radiation on the composition, structure and morphology of WTi thin films deposited on n-type (100...2...were found to be sufficient for modification of the WTi/silic...

Suzana Petrovi?; D. Peruško; I. Radovi?-Bogdanovi?…

2012-06-01T23:59:59.000Z

14

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incineration facility (East Liverpool, Ohio). Volume 2. Introduction  

SciTech Connect (OSTI)

Contents: Overview; Facility Background; Risk Assessment History at WTI; Peer Review Comments and Key Assumptions; and References.

NONE

1997-05-01T23:59:59.000Z

15

Real-time curvature and optical spectroscopy monitoring of magnetron-sputtered \\{WTi\\} alloy thin films  

Science Journals Connector (OSTI)

Abstract \\{WTi\\} thin films are known as potential adhesion promoters and diffusion barriers. \\{WTi\\} thin films were deposited by magnetron sputtering from an alloyed target (W:Ti ~ 70:30 at.%). Real-time surface differential reflectance (SDR) spectroscopy and wafer-curvature measurements were performed during deposition to study the growth and the film continuity threshold. SDR measurements during \\{WTi\\} deposition allow the determination of the change in reflectivity of p-polarized light (at Si substrate Brewster's angle) between \\{WTi\\} film and Si substrate in order to monitor layer growth. The comparison between experimental and simulated \\{WTi\\} SDR signals assuming a homogeneous and continuous layer growth shows that film continuity is ensured beyond a thickness of 4.5 ± 0.2 nm. Real-time wafer-curvature measurements allow the determination of the intrinsic stress development in the film. Two regimes are noticed during the growth up to the development of a compressive steady state stress. The early stages of growth are rather complicated and divided into sub-regimes with similar boundaries revealed by both in situ techniques. Deposition of an interfacial continuous layer different from \\{WTi\\} bulk is suggested by both in situ techniques below a thickness of 4.5 nm.

A. Le Priol; L. Simonot; G. Abadias; P. Guérin; P.-O. Renault; E. Le Bourhis

2013-01-01T23:59:59.000Z

16

Wear behaviour of tool steels with added (WTi)C particles  

Science Journals Connector (OSTI)

The volume fraction of hard second phase particles in tool steels is limited by the formation of large interconnected carbides on solidification that embrittle the alloy. In this work, a novel carbide master alloy, FeWTiC, which contains (WTi)C particles, was used to increase the volume fraction of carbide in an H21 hot work die steel (0.3%C, 9%W, 3%Cr). Additions of up to 5 vol.% (WTi)C were successfully made to the vacuum melted steel, producing a homogeneous distribution of (WTi)C throughout the microstructure. TEM and fracture testing confirmed that a good bond existed between the (WTi)C and martensitic matrix. Wear testing was undertaken using pure sliding against an M2 tool steel counterface, in a block on ring configuration, in the load range of 54–254 N and a sliding speed of 0.98 m/s. At 54 N, an increase in volume fraction of (WTi)C gave a reduction in wear coefficient, associated with predominantly oxidational wear, with associated ploughing of the tool steel surface by oxide particles. At higher loads the addition of (WTi)C did not result in reduced wear rates. In addition to oxidational wear, delamination occurred, frequently initiated at the matrix/M6C particle interface. Fracture of the (WTi)C became more common as the load increased. A 1% (WTi)C marginally reduced the depth of deformation compared to the H21, but further additions had little additional effect. Detailed TEM indicated the complex interaction between oxide formation and surface deformation of the tool steel. The relationship between wear mechanism and microstructure is discussed.

A.J. Leonard; W.M. Rainforth

2003-01-01T23:59:59.000Z

17

Development of WTI and turbidity estimation model using SMA — application to Kushiro Mire, eastern Hokkaido, Japan  

Science Journals Connector (OSTI)

A new water-turbidity index (WTI) based on multispectral images was developed and tested at Kushiro Mire, eastern Hokkaido, Japan. An algorithm for turbidity estimation was developed and applied to Landsat TM images to monitor the turbid water on the mire surface during the snow-melting season. We used spectral mixture analysis (SMA) to produce a turbidity estimation model. The SMA “unmixes” a mixed pixel determining the fractions due to each spectral end member. In this study, we used four end members (1, alder; 2, reed; 3, high-concentration turbid water (485 ppm); 4, low-concentration turbid water (10 ppm) measured in the test site. The WTI was determined by the following equation: WTI=amax/(amax+amin), where amax is abundance of high-concentration turbid water and amin is abundance of low-concentration turbid water. The end-member spectra of alder and reed were measured in the laboratory using specimens collected at the test site. The spectrum of turbid water was measured at the test sites. The relative abundance of each end member was estimated based on this spectral information using SMA. The same formula was applied to Landsat TM images. Then we applied the WTI equation to the end-member images to obtain a WTI map. In the mire wetland region, turbid water spreads under alder trees and reed grasses. To verify our turbidity estimation method based on WTI under these conditions, we constructed a small experimental wetland consisting of mixed stands of alder and reed. WTI was calculated from the mixed spectrum of this “artificial wetland” and the regression curve for the relation between WTI and the actual turbidity was determined (R2=.91). Finally, this regression equation was used to derive a turbidity map from the WTI image.

Satoshi Kameyama; Yoshiki Yamagata; Futoshi Nakamura; Masami Kaneko

2001-01-01T23:59:59.000Z

18

Composition and structure modification of a WTi/Si system by short laser pulses  

Science Journals Connector (OSTI)

Picosecond (40 ps) pulsed Nd:YAG laser irradiation of a WTi thin film on silicon with a wavelength...2...was performed in air. This led to significant changes of the chemical composition and morphology on the sur...

S. Petrovi?; B. Gakovi?; D. Peruško; B. Radak; T. Desai; J. Kova?…

2010-03-01T23:59:59.000Z

19

Exploring the WTI crude oil price bubble process using the Markov regime switching model  

Science Journals Connector (OSTI)

Abstract The sharp volatility of West Texas Intermediate (WTI) crude oil price in the past decade triggers us to investigate the price bubbles and their evolving process. Empirical results indicate that the fundamental price of WTI crude oil appears relatively more stable than that of the market-trading price, which verifies the existence of oil price bubbles during the sample period. Besides, by allowing the WTI crude oil price bubble process to switch between two states (regimes) according to a first-order Markov chain, we are able to statistically discriminate upheaval from stable states in the crude oil price bubble process; and in most of time, the stable state dominates the WTI crude oil price bubbles while the upheaval state usually proves short-lived and accompanies unexpected market events.

Yue-Jun Zhang; Jing Wang

2014-01-01T23:59:59.000Z

20

Chemical and structural modifications of laser treated WTi surfaces at different ambient conditions  

Science Journals Connector (OSTI)

In this work we have studied the influence of laser modification on the composition and structure of tungsten titanium (WTi) thin films, deposited on n...-type (100) silicon wafers. After deposition, the samples ...

S. Petrovi?; D. Peruško; D. Milovanovi?; Z. Siketi?; M. Jakši?…

2011-11-01T23:59:59.000Z

Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

Influence of target structure on film stress in WTi sputtering  

SciTech Connect (OSTI)

In this report, the effect of sputtering target microstructure on the deposited film stress was investigated. By controlling the metallurgical process, two types of W-10wt%Ti target constituents, namely single-phase and multiple-phase WTi, were prepared. The former one was composed of W-rich ({beta}Ti,W) phase only, the latter one was with W, W-rich ({beta}Ti,W) and Ti-rich ({beta}Ti,W) phases. The stress of the films deposited on 12.7 cm diameter silicon oxide wafers from the single-phase target tends to be more compressive than that from the multiple-phase target. By increasing wafer temperature, the compressive stress was linearly decreased. In addition, the level of film stress was also affected by the film thickness and other sputtering parameters. To understand the causes for the differences in film stress between the multiple-phase and single-phase derived films, an evaluation of the film structure using a field-emission scanning electron microscope (FE-SEM) and mechanical testing using a nano-indentation instrument were performed. Finer domains with denser laminar structure were observed on the films deposited from the single-phase target. However, no significant difference in mechanical properties was found between these two from the nano-indentation measurements. It is envisioned that the more uniform solid solution between the W and Ti in the films obtained by sputtering the single-phase targets generates a higher compressive stress when deposited on the silicon oxide wafers resulting in a higher compressive stress.

Lo, C.F.; Wang, H.; Gilman, P. [Materials Research Corp., Orangeburg, NY (United States)

1998-12-31T23:59:59.000Z

22

Influence of a d.c. substrate bias on the resistivity, composition, crystallite size and microstrain of \\{WTi\\} and WTi-N films  

Science Journals Connector (OSTI)

The influence of a d.c. substrate bias on the properties of \\{WTi\\} and WTi-N films deposited by r.f. magnetron sputtering has been studied. The bias voltage was varied from 0 to ?200 V. The \\{WTi\\} films structure is b.c.c. W with the presence of the h.c.p. Ti phase at low bias (0 to ?50 V). For the WTi-N films, the structure is f.c.c. TiN at low bias and b.c.c. W + f.c.c. TiN at high bias (?100 V to ?200 V). Both films exhibit the columnar morphology. The titanium fraction in the films is lower than in the target and decreases when the bias increases owing to a titanium preferential resputtering caused by the ion bombardment of the substrate. The same behaviour is found for the film resistivity which diminishes when the bias is increased whereas the crystallite size increases. The microstrains have a more complex variation with the bias.

H. Ramarotafika; G. Lemperiere

1995-01-01T23:59:59.000Z

23

Microsoft PowerPoint - uncertainty_wti_2011_2012.ppt [Compatibility Mode]  

Gasoline and Diesel Fuel Update (EIA)

1 1 - December 2012 January 2011 December 2012 Historical WTI price and 95% NYMEX Confidence Interval, January 2011 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 1 2010 2010 2011 2011 2012 2012 2013 2013 Historical WTI price and 95% NYMEX Confidence Interval, February 2011 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 2 2010 2010 2011 2011 2012 2012 2013 2013 Historical WTI price and 95% NYMEX Confidence Interval, March 2011 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 3 2010 2010 2011 2011 2012 2012 2013 2013 Historical WTI price and 95% NYMEX Confidence Interval, April 2011 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 4 2010 2010 2011 2011 2012 2012 2013 2013 Historical WTI price and 95% NYMEX Confidence Interval, May 2011 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 5

24

Microsoft PowerPoint - uncertainty_wti_2009_2010.ppt [Compatibility Mode]  

Gasoline and Diesel Fuel Update (EIA)

09 09 - December 2010 January 2009 December 2010 Historical WTI price and 95% NYMEX Confidence Interval, January 2009 $180 $200 $120 $140 $160 $80 $100 $120 $20 $40 $60 $0 $20 Jan Jul Jan Jul Jan Jul Jan Jul 1 2008 2008 2009 2009 2010 2010 2011 2011 Historical WTI price and 95% NYMEX Confidence Interval, February 2009 $180 $200 $120 $140 $160 $80 $100 $120 $20 $40 $60 $0 $20 Jan Jul Jan Jul Jan Jul Jan Jul 2 2008 2008 2009 2009 2010 2010 2011 2011 Historical WTI price and 95% NYMEX Confidence Interval, March 2009 $180 $200 $120 $140 $160 $80 $100 $120 $20 $40 $60 $0 $20 Jan Jul Jan Jul Jan Jul Jan Jul 3 2008 2008 2009 2009 2010 2010 2011 2011 Historical WTI price and 95% NYMEX Confidence Interval, April 2009 $180 $200 $120 $140 $160 $80 $100 $120 $20 $40 $60 $0 $20 Jan Jul Jan Jul Jan Jul Jan Jul 4 2008 2008 2009 2009 2010 2010 2011 2011 Historical WTI price and 95% NYMEX

25

Microsoft PowerPoint - uncertainty_past_wti.ppt [Compatibility Mode]  

Gasoline and Diesel Fuel Update (EIA)

3 3 - January 2014 January 2013 January 2014 Historical WTI price and 95% NYMEX Confidence Interval, January 2013 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 1 2012 2012 2013 2013 2014 2014 2015 2015 Historical WTI price and 95% NYMEX Confidence Interval, February 2013 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 2 2012 2012 2013 2013 2014 2014 2015 2015 Historical WTI price and 95% NYMEX Confidence Interval, March 2013 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 3 2012 2012 2013 2013 2014 2014 2015 2015 Historical WTI price and 95% NYMEX Confidence Interval, April 2013 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 4 2012 2012 2013 2013 2014 2014 2015 2015 Historical WTI price and 95% NYMEX Confidence Interval, May 2013 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 5 2012

26

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incinerator facility (east Liverpool, Ohio)  

SciTech Connect (OSTI)

The report constitutes a comprehensive site-specific risk assessment for the WTI incineration facility located in East Liverpool, OH. Volume I is a description of the components and methodologies used in the risk assessment and provides a summary of the major results from the three components of the assessment.

NONE

1995-11-01T23:59:59.000Z

27

Effects of the pulse duration in laser modification of nano-sized WTi film on Si  

Science Journals Connector (OSTI)

A study of morphological and composition changes of the WTi/Si system induced by nanosecond and picosecond laser pulses is presented. A 190 nm thick WTi film was deposited on a silicon substrate of n-type (100). The pulsed laser systems used were: nanosecond TEA CO2 laser (emission, 10.6 µm; pulse FWHM; pulse duration 120 ns) and picosecond Nd:YAG laser (emission, 532 nm; pulse FWHM; pulse duration 40 ps). During experiments the used fluences (?) had similar values, ?1 = 20 J  cm ? 2 in case of the TEA CO2 laser and ?2 = 16 J cm ? 2 for the Nd:YAG laser. The laser-induced morphological and composition modifications showed a dependence on pulse duration. Generally, the following morphological changes were observed: (i) ablation/exfoliation of the WTi thin film, (ii) appearance of hydrodynamic features such as resolidified material, and (iii) formation of nano-sized grains and globules. Overall morphological modifications were more pronounced after the picosecond laser action. The surface composition analysis showed a quite different distribution of sample components depending on the pulse duration. Formation of the silicon dioxide (SiO2) was recorded only in the case of irradiation of the WTi/Si system by picosecond laser pulses.

Suzana Petrovi?; D Peruško; D Milovanovi?; J Kova?; M ?ekada; P Panjan; B Gakovi?; M Trtica

2010-01-01T23:59:59.000Z

28

Structure-stress-resistivity relationship in WTi alloy ultra-thin and thin films prepared by magnetron sputtering  

Science Journals Connector (OSTI)

WTi thin films were prepared from an alloyed target (W:Ti ? 70:30?at. %) by magnetron sputtering. Body-centered cubic W x T i 1 ? x solid solutions with a { 110 } fiber texture and columnar grains have been produced with 0.75 WTi thin films is about 60 ? 200 ? ? ? ? cm depending on the film thickness and microstructure (sputtering conditions). For both ultra-thin (9.5?nm) and thin (180?nm) films a stress transition from compressive to tensile is observed as the working pressure increases. The process-structure-property relations of the WTi ultra-thin and thin films are discussed in relation with the state of the art.

P.-O. Renault

2013-01-01T23:59:59.000Z

29

Modeling dynamic conditional correlations in WTI oil forward and futures returns  

Science Journals Connector (OSTI)

This paper estimates the dynamic conditional correlations in the daily returns on West Texas Intermediate (WTI) oil forward and futures prices from 3 January 1985 to 16 January 2004, using recently developed multivariate conditional volatility models. We find that the dynamic conditional correlations can vary dramatically, being negative in four of ten cases and being close to zero in another five cases. Only in the case of the dynamic volatilities of the three-month and six-month futures returns is the range of variation relatively narrow, namely (0.832, 0.996).

Alessandro Lanza; Matteo Manera; Michael McAleer

2006-01-01T23:59:59.000Z

30

Minimum variance hedging with bivariate regime-switching model for WTI crude oil  

Science Journals Connector (OSTI)

This paper proposes a four-regime bivariate Markov regime-switching model to estimate the daily time-varying minimum variance hedge ratios for West Texas Intermediate (WTI) crude oil, and evaluates its in- and out-of-sample hedging performances with two-regime model, CC-GARCH, TVC-GARCH, and OLS models. Empirical results reveal that the four-regime Markov switching model outperforms the other models for both in- and out-of-sample hedging performance. Based on Hansen’s SPA test (2005), the four-regime model significantly outperforms the other models for only in-sample hedging.

Jui-Cheng Hung; Yi-Hsien Wang; Matthew C. Chang; Kuang-Hsun Shih; Hsiu-Hsueh Kao

2011-01-01T23:59:59.000Z

31

Treatment of \\{WTi\\} Contacts on silicon with low energy argon ions  

Science Journals Connector (OSTI)

Thin layers of \\{WTi\\} were deposited by ion sputtering on p- and n-type Si(111) substrates. The initial target composition is 90: 10 W: Ti, the thicknesses of the layers were 200 and 350 nm, and the layers were grown at a rate of 10 nm min?1. After deposition, the contacts were bombarded by backsputtering with Ar+ ions at 3.5 keV. The as-deposited layers from a surface barrier on both substrates (0.62 V on n-Si and 0.66 V on p-Si). During ion bombardment, to doses from 0.5 × 1018 to 5 × 1018 ions cm?2, the barrier is reduced until the contacts become non-rectifying. The main effect during bombardment is sputtering and development of topography (scanning electron microscopy analysis), but there is also a shallow mixing at the interface (as shown by Rutherford backscattering and X-ray analyses). During annealing at 800 °C, pronounced metal-silicon interdiffusion is observed in bombarded specimens and not in unbombarded specimens. So-formed silicides renew the rectifying properties of \\{WTi\\} contacts, with an effective barrier height of 0.66–0.69 V on n-Si.

M. Milosavljevi?; N. Bibi?; I.H. Wilson; D. Peruško

1988-01-01T23:59:59.000Z

32

Report on the technical workshop on WTI incinerator risk issues. Held in Washington, DC on December 8-9, 1993  

SciTech Connect (OSTI)

The report includes information and materials from a peer review workshop organized by EPA's Risk Assessment Forum (RAF) for the Office of Solid Waste and Emergency Response and Region 5. The meeting was held in Washington, DC, at the Holiday Inn Capitol on December 8-9, 1993. The subject of the peer review was a draft project plan prepared by EPA Region 5 for assessing risk at an incinerator operated by Waste Technologies Industries (WTI) in East Liverpool, Ohio. The peer review panel was convened to evaluate the project plan as the scientific foundation for a risk assessment, which will be used in setting final permit conditions for the WTI facility.

Not Available

1993-12-01T23:59:59.000Z

33

WTI Crude Oil Prices Are Expected To Remain Relatively High Through At  

Gasoline and Diesel Fuel Update (EIA)

5 5 Notes: As we just saw, one of the primary factors impacting gasoline price is the crude oil price. This graph shows monthly average spot West Texas Intermediate crude oil prices. Spot WTI crude oil prices broke $36 per barrel in November briefly as anticipated boosts to world supply from OPEC and other sources did not show up in actual stocks data. Crude oil prices are expected to be about $30 per barrel for the rest of this year, but note the uncertainty bands on this projection. They give an indication of how difficult it is to know what these prices are going to do. Also, EIA does not forecast volatility. This relatively flat forecast could be correct on average, with wide swings around the base line. With the EIA forecast for crude prices staying high this year,

34

Can GARCH-class models capture long memory in WTI crude oil markets?  

Science Journals Connector (OSTI)

This paper investigates the issue whether GARCH-type models can well capture the long memory widely existed in the volatility of WTI crude oil returns. In this frame, we model the volatility of spot and futures returns employing several GARCH-class models. Then, using two non-parametric methods, detrended fluctuation analysis (DFA) and rescaled range analysis (R/S), we compare the long memory properties of conditional volatility series obtained from GARCH-class models to that of actual volatility series. Our results show that GARCH-class models can well capture the long memory properties for the time scale larger than a year. However, for the time scale smaller than a year, the GARCH-class models are misspecified.

Yudong Wang; Chongfeng Wu; Yu Wei

2011-01-01T23:59:59.000Z

35

Surface modification of a \\{WTi\\} thin film on Si substrate by nanosecond laser pulses  

Science Journals Connector (OSTI)

Interaction of a nanosecond transversely excited atmospheric (TEA) CO2 laser, operating at 10.6 ?m, with tungsten–titanium thin film (190 nm) deposited on silicon of n-type (1 0 0) orientation, was studied. Multi-pulse irradiation was performed in air atmosphere with laser energy densities in the range 24–49 J/cm2. The energy absorbed from the laser beam was mainly converted to thermal energy, which generated a series of effects. The following morphological changes were observed: (i) partial ablation/exfoliation of the \\{WTi\\} thin film, (ii) partial modification of the silicon substrate with formation of polygonal grains, (iii) appearance of hydrodynamic features including nano-globules. Torch-like plumes started appearing in front of the target after several laser pulses.

S. Petrovi?; B. Gakovi?; D. Peruško; M. Trtica; B. Radak; P. Panjan; Š. Miljani?

2008-01-01T23:59:59.000Z

36

Auto-correlated behavior of WTI crude oil volatilities: A multiscale perspective  

Science Journals Connector (OSTI)

In this paper, we investigate the long-range auto-correlated behavior of WTI crude oil volatility series employing multifractal detrended fluctuation analysis. Our findings show that the for small time scales, the auto-correlations of volatilities were multifractal while for large time scales, the auto-correlations were nearly monofractal. Based on multiscale analysis, we also investigate the dynamics of auto-correlations for different intervals of time scales and find that several shocks could make significant effects on the auto-correlated behaviors for small time scales. Analyzing the dynamics of multifractality degrees of auto-correlations for small time scales, we find that the stronger auto-correlations were always related to the lower degrees of multifractality. At last, we have discussions on the determination factors of price behavior, the predictive implications of scaling behavior in volatilities for oil markets and the reasons why long-range auto-correlations of volatility were always strong for both small time scales and large time scales. Our results are very important theoretically and practically.

Yudong Wang; Yu Wei; Chongfeng Wu

2010-01-01T23:59:59.000Z

37

WTI crude oil Futures in portfolio diversification: The time-to-maturity effect  

Science Journals Connector (OSTI)

The aim of the paper is to analyze the diversification effect brought by crude oil Futures contracts, the most liquid commodity Futures, into a portfolio of stocks. The studies that have documented the very low- and essentially negative-correlations between commodities and equities typically rely on normally distributed returns, which is not the case for crude oil Futures and stocks indexes. Moreover, the particular time-to-maturity chosen for the Future contract used as an investment vehicle is an important matter that needs to be addressed, in presence of forward curves switching between backwardation and contango shapes. Our goal in this paper is twofold: (a) we introduce copula functions to have a better representation of the dependence structure of oil Futures with equity indexes; (b) using this copula representation, we are able to analyze in a precise manner the “maturity effect” in the choice of crude oil Future contract with respect to its diversification benefits. Our finding is that, in the case of distant maturities Futures, e.g., 18 months, the negative correlation effect is more pronounced whether stock prices increase or decrease. This property has the merit to avoid the hurdles of a frequent roll over while being quite desirable in the current trendless equity markets. Empirical evidence is exhibited on a database comprising the NYMEX WTI crude oil Futures and S&P 500 index over a 15 year-time period.

Hélyette Geman; Cécile Kharoubi

2008-01-01T23:59:59.000Z

38

Testing the weak-form efficiency of the WTI crude oil futures market  

Science Journals Connector (OSTI)

Abstract The weak-form efficiency of energy futures markets has long been studied and empirical evidence suggests controversial conclusions. In this work, nonparametric methods are adopted to estimate the Hurst indexes of the WTI crude oil futures prices (1983–2012) and a strict statistical test in the spirit of bootstrapping is put forward to verify the weak-form market efficiency hypothesis. The results show that the crude oil futures market is efficient when the whole period is considered. When the whole series is divided into three sub-series separated by the outbreaks of the Gulf War and the Iraq War, it is found that the Gulf War reduced the efficiency of the market. If the sample is split into two sub-series based on the signing date of the North American Free Trade Agreement, the market is found to be inefficient in the sub-periods during which the Gulf War broke out. The same analysis on short-time series in moving windows shows that the market is inefficient only when some turbulent events occur, such as the oil price crash in 1985, the Gulf war, and the oil price crash in 2008.

Zhi-Qiang Jiang; Wen-Jie Xie; Wei-Xing Zhou

2014-01-01T23:59:59.000Z

39

Causality and volatility spillovers among petroleum prices of WTI, gasoline and heating oil in different locations  

Science Journals Connector (OSTI)

This paper examines the time series properties of daily spot and futures prices for three petroleum types traded at five commodity centers within and outside the United States. Examining five combinations of the spot and futures prices by petroleum type and trading center, the cointegration tests of each of these five groups suggest that spot and futures contracts offer little room for long-run commodity portfolio diversification. In the West Texas Intermediate (WTI) crude-oil group, the VEC model indicates that the New York Mercantile Exchange (NYMEX) 1-month futures price has the upper hand in terms of directional causality and volatility spillovers. In the NYMEX gasoline system, there are bi-directional causality relationships among all the gasoline spot and futures prices, but the spot price produces the greatest spillover. In the NYMEX heating oil system, information transmission and predictability among the spot, 1- and 3-month futures are found to be particularly strong and significant. In the international gasoline spot market, contrary to the world crude-oil market, there is no apparent world gasoline spot leader for the gasoline spot prices.

Shawkat Hammoudeh; Huimin Li; Bang Jeon

2003-01-01T23:59:59.000Z

40

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incinerator facility (east Liverpool, Ohio). Volume 3. Characterization of the nature and magnitude of emissions. Draft report  

SciTech Connect (OSTI)

This report constitutes a comprehensive site-specific risk assessment for the WTI incineration facility located in East Liverpool, OH. Volume III of the report describes the methods used to estimate both stack and fugitive emission rates from the facility.

NONE

1995-11-01T23:59:59.000Z

Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

Is WTI crude oil market becoming weakly efficient over time?: New evidence from multiscale analysis based on detrended fluctuation analysis  

Science Journals Connector (OSTI)

This paper extends the work in Tabak and Cajueiro [Are the crude oil markets becoming weakly efficient over time, Energy Economics 29 (2007) 28–36] and Alvarez-Ramirez et al. [Short-term predictability of crude oil markets: a detrended fluctuation analysis approach, Energy Economics 30 (2008) 2645–2656]. In this paper, we test for the efficiency of WTI crude oil market through observing the dynamic of local Hurst exponents employing the method of rolling window based on multiscale detrended fluctuation analysis. Empirical results show that short-term, medium-term and long-term behaviors were generally turning into efficient behavior over time. However, in this way, the results also show that the market did not evolve along stable conditions for long times. Multiscale analysis is also implemented based on multifractal detrended fluctuation analysis. We found that the small fluctuations of WTI crude oil market were persistent; however, the large fluctuations had high instability, both in the short- and long-terms. Our discussion is also extended by incorporating arguments from the crude oil market structure for explaining the different correlation dynamics.

Yudong Wang; Li Liu

2010-01-01T23:59:59.000Z

42

The Rising Sea  

E-Print Network [OSTI]

in the thick of a sea level rise. After reading the evidencepredictive figure for ocean level rise by the turn of thethat a 7-foot (2 m) sea level rise by the year 2100 should

Miller, Ryder W.

2011-01-01T23:59:59.000Z

43

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incinerator facility (east Liverpool, Ohio). Volume 1. Executive summary. Draft report  

SciTech Connect (OSTI)

This report constitutes a comprehensive site-specific risk assessment for the WTI incineration facility located in East Liverpool, OH. Volume I is a description of the components and methodologies used in the risk assessment and provides a summary of the major results from the three components of the assessment.

NONE

1995-11-01T23:59:59.000Z

44

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incinerator facility (east Liverpool, Ohio). Volume 4. Atmospheric dispersion and deposition modeling of emissions. Draft report  

SciTech Connect (OSTI)

The report constitutes a comprehensive site-specific risk assessment for the WTI incineration facility located in East Liverpool, OH. Volume IV describes the air dispersion model used to estimate air concentrations and particle deposition, as well as the results of the modeling exercise.

NONE

1995-11-01T23:59:59.000Z

45

Solar Smarter Faster | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Smarter Faster Smarter Faster Solar Smarter Faster Addthis Description As part of the SunShot Initiative, U.S. Department of Energy Secretary Steven Chu announced on April 15th the selection of up to $112.5 million over five years for funding to support the development of advanced solar photovoltaic (PV)-related manufacturing processes throughout the United States. The effort is led by Sematech, with a proven track record in breathing life back into the US semiconduster industry, and in partnership with CNSE, The College of Nanoscale Science and Engineering. Speakers Dan Armbrust, Pradeep Haldar, Dan Hallady, Alain Kaloyeros Duration 3:07 Credit Energy Department Video SAM ARMBRUST (President and CEO, Sematech): SunShot represents a very serious approach by the United States government, recognizing that we are

46

Report on the US EPA technical workshop on WTI incinerator risk assessment issues. Held in Washington, DC on January 11, 1996  

SciTech Connect (OSTI)

This report presents information and materials from a peer review workshop organized by EPA`s Risk Assessment Forum for Region 5 and the Office of Solid Waste and Emergency Response. The subject of the peer review was a draft document prepared by Region 5 assessing risk at an incinerator operated by Waste Technologies Industries (WTI) in East Liverpool, Ohio. This report summarizes the discussions that took place at the peer review workshop. The report opens with an overview of the workshop and a history of EPA`s WTI incinerator risk assessment activities (section 1), then presents the chairperson`s summary (section 2) and the five work group chairs` summaries (section 3). The body of the report ends with highlights of the peer reviewers` preliminary comments and of the comments offered by workshop observers (section 4).

NONE

1996-05-01T23:59:59.000Z

47

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incineration facility (East Liverpool, Ohio). Volume 6. Screening ecological risk assessment  

SciTech Connect (OSTI)

The Screening Ecological Risk Assessment (SERA) includes an evaluation of available biotic information from the site vicinity to provide a preliminary description of potential ecological receptors (e.g., rare, threatened and endangered species; migratory birds; and important game species), and important ecological habitats (e.g., wetland areas). A conceptual site model is developed that describe show stressors associated with the WTI facility might affect the ecological components in the surrounding environment through the development and evaluation of specific ecological endpoints. Finally, an estimate of the potential for current and/or future adverse impacts to the biotic component of the environment is provided, based on the integration of potential exposures of ecological receptors to WTI emissions and toxicological threshold values.

NONE

1997-05-01T23:59:59.000Z

48

The sun also rises.  

E-Print Network [OSTI]

??This is an adaptation of 'Fiesta: The Sun Also Rises'. The story is changed in form and function from a book into a screenplay. And… (more)

Erwin, Suzanne K.

2009-01-01T23:59:59.000Z

49

Faster Dissociation: Aryl Halide Radical Anions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Faster Dissociation: Measured Rates and Computed Effects on Barriers in Faster Dissociation: Measured Rates and Computed Effects on Barriers in Aryl Halide Radical Anions Norihiko Takeda, Pavel V. Poliakov, Andrew R. Cook, and John R. Miller J. Am. Chem. Soc. 126, 4301-4309 (2004). [Find paper at ACS Publications] Abstract: Carbon-halogen bond dissociation rates for a series of aryl halide radical anions (ArX-·: X = Cl, Br) in NMP were measured at room temperature by pulse radiolysis with 10-11 s time resolution. To obtain accurate dissociation rates, care was taken to measure and correct for competing decay channels. The observed rates correlated well with activation energies computed in the gas phase by density functional (DFT) calculations. The rates did not correlate well with electron affinities or dissociation energies obtained by the same computational methods, although such

50

Building Science Solutions Â… Faster and Better  

Broader source: Energy.gov (indexed) [DOE]

eere.energy.gov eere.energy.gov Webinar questions should be directed to: basc@pnnl.gov 2 | Building America eere.energy.gov Building Science Solutions - Faster and Better Sam Rashkin Michael Baechler Linda Connell Building America Solution Center October 11, 2012 3 | Building America eere.energy.gov Building America Solution Center Overview 4 | Building America eere.energy.gov World Class Research... ... at Your Finger Tips 5 | Building America eere.energy.gov Is: Easy Access to World-Class Research: * Guidance for Applying Targeted Energy Measures * Tool for Users to Prepare Customized Project Content * Source for Proven Performance * Link to Full References Is Not: * Design Tool for Customized Energy Packages What the DOE Building America Solution Center 'Is' & 'Is Not'

51

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incinerator facility (east Liverpool, Ohio). Volume 7. Accident analysis: Selection and assessment of potential release scenarios. Draft report  

SciTech Connect (OSTI)

This report constitutes a comprehensive site-specific risk assessment for the WTI incineration facility located in East Liverpool, OH. The Accident Analysis is an evaluation of the likelihood of occurrence and resulting consequences from several general classes of accidents that could potentially occur during operation of the facility. The Accident Analysis also evaluates the effectiveness of existing mitigation measures in reducing off-site impacts. Volume VII describes in detail the methods used to conduct the Accident Analysis and reports the results of evaluations of likelihood and consequence for the selected accident scenarios.

NONE

1995-11-01T23:59:59.000Z

52

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incinerator facility (east Liverpool, Ohio). Volume 6. Screening ecological risk assessment (SERA). Draft report  

SciTech Connect (OSTI)

This report constitutes a comprehensive site-specific risk assessment for the WTI incineration facility located in East Liverpool, OH. The Screening Ecological Risk Assessment (SERA) is an analysis of the potential significance of risks to ecological receptors (e.g., plants, fish, wildlife) from exposure to facility emissions. The SERA was performed using conservative assumptions and approaches to determine if a further, more refined analysis is warranted. Volume VI describes in detail the methods used in the SERA and reports the results of the SERA in terms of site-specific risks to ecological receptors.

NONE

1995-11-01T23:59:59.000Z

53

Characterization of Ti diffusion in PVD deposited WTi/AlCu metallization on monocrystalline Si by means of secondary ion mass spectroscopy  

Science Journals Connector (OSTI)

The diffusion behavior of Titanium in Al0.5Cu/W18Ti (at.%) metallization stacks on monocrystalline Silicon has been investigated. The metallization system was prepared by in situ sputtering deposition. It is demonstrated that \\{WTi\\} is not stable as a diffusion barrier between Al0.5Cu and Si in temperature ranges between 623 K and 673 K due to Ti depletion. The Ti diffusion in Al0.5Cu is characterized by diffusion profiles prepared by secondary ion mass spectroscopy after annealing. The activation energy derived from this data is 2.28 eV for Ti diffusion into Al0.5Cu. The causal chain of detecting this behavior is described application-oriented.

M. Plappert; O. Humbel; A. Koprowski; M. Nowottnick

2012-01-01T23:59:59.000Z

54

Ground potential rise monitor  

DOE Patents [OSTI]

A device and method for detecting ground potential rise (GPR) comprising positioning a first electrode and a second electrode at a distance from each other into the earth. The voltage of the first electrode and second electrode is attenuated by an attenuation factor creating an attenuated voltage. The true RMS voltage of the attenuated voltage is determined creating an attenuated true RMS voltage. The attenuated true RMS voltage is then multiplied by the attenuation factor creating a calculated true RMS voltage. If the calculated true RMS voltage is greater than a first predetermined voltage threshold, a first alarm is enabled at a local location. If user input is received at a remote location acknowledging the first alarm, a first alarm acknowledgment signal is transmitted. The first alarm acknowledgment signal is then received at which time the first alarm is disabled.

Allen, Zachery W. (Mandan, ND); Zevenbergen, Gary A. (Arvada, CO)

2012-04-03T23:59:59.000Z

55

EIND510 Usability Engineering C:\\NWARD Dell Laptop\\WTI_MSU\\Teaching\\EIND510 Usability Engineering\\EIND510\\EIND510 Fall 2011\\EIND510 syllabus Fall 2011.docx 1  

E-Print Network [OSTI]

of usability engineering across a range of product, service and system domains. #12;EIND510 ­ Usability usability analyses on products or services as part of a team-based usability engineering projectEIND510 ­ Usability Engineering C:\\NWARD Dell Laptop\\WTI_MSU\\Teaching\\EIND510 Usability Engineering

Dyer, Bill

56

Sea Level Rise Media Release  

E-Print Network [OSTI]

Sea Level Rise Media Release Coverage Report 07/06/2009 Melting Ice Could Lead to Massive Waves 06/11/2009 Rising sea levels could see U.S. Atlantic coast cities make hard choices; Where to let Baltimore Chronicle & Sentinel, The 06/08/2009 Rapid rise in sea levels on East Coast predicted Pittsburgh

Hu, Aixue

57

Faster-Than-Light Group Velocities and Causality Violation  

Science Journals Connector (OSTI)

...research-article Faster-Than-Light Group Velocities and Causality...group velocities in excess of the speed of light does not imply causality violation...phase velocity shall exceed the speed of light. Application of the theorem leads...

1970-01-01T23:59:59.000Z

58

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incinerator facility (east Liverpool, Ohio). Volume 5. Human health risk assessment (HHRA): Evaluation of potential risks from multipathway exposure to emissions. Draft report  

SciTech Connect (OSTI)

The Human Health Risk Assessment (HHRA) portion of the WTI Risk Assessment involves the integration of information about the facility with site-specific data for the surrounding region and population to characterize the potential human health risks due to emissions from the facility. The estimation of human health risks is comprised of the following general steps: (1) identification of substances of potential concern; (2) estimation of the nature and magnitude of chemical releases from the WTI facility; (3) prediction of the atmospheric transport of the emitted contaminants; (4) determination of the types of adverse effects associated with exposure to the substances of potential concern (referred to as hazard identification), and the relationship between the level of exposure and the severity of any health effect (referred to as dose-response assessment); (5) estimation of the magnitude of exposure (referred to as exposure assessment); and (6) characterization of the health risks associated with exposure (referred to as risk characterization).

NONE

1995-11-01T23:59:59.000Z

59

The effect of the financial sector on the evolution of oil prices: Analysis of the contribution of the futures market to the price discovery process in the WTI spot market  

Science Journals Connector (OSTI)

The aim of this article is to empirically measure the contribution of the futures market to the price discovery process in the spot market for benchmark crude oils, specifically that for West Texas Intermediate (WTI). For this purpose, we test the hypothesis that the recent evolution of the financial markets has affected the future oil market so as to increase its contribution to the price discovery process of the spot market. We modeled the relation between WTI spot and future prices as a cointegration relation. By using the Kalman filter technique, it was possible to obtain a time-varying measure of the contribution of future markets to the price discovery mechanism. The results show that in the case of WTI, the contribution of the futures market has been increasing, especially between 2003 and 2008 and then again after the start of 2009, evidencing the growing importance of factors particular to the financial markets in determining oil prices in recent years. During 2009, the spot prices adjusted to agents' future expectations rather than to the current supply and demand conditions.

Renan Silvério; Alexandre Szklo

2012-01-01T23:59:59.000Z

60

Faster plant growth in a safe, economical way  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Faster plant growth in a safe, economical way Faster plant growth in a safe, economical way Faster plant growth in a safe, economical way When applied to plants, Take-Off(tm) speeds crop emergence, increases growth rates and yields, improves stress tolerance and nutrient value, and reduces need for nitrogen fertilizers. April 3, 2012 Farmer in wheat field inspecting wheat Biagro Western offers Take-Off(tm), a metabolic plant stimulant that will allow farmers to increase crop carbon fixation and thereby increase nitrate uptake and nitrogen use efficiency. The new product speeds plants to maturity, allowing the plants to more efficiently assimilate nitrogen by coordinating the nitrogen uptake and photosynthesis processes. Field tests show that Take-Off(tm) reduced nitrogen inputs by 25 to 35 percent.

Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

Rising Cost of Generating Electricity  

Science Journals Connector (OSTI)

... METHODS are being discussed by electrical engineers to meet the rising costs of generating ... of generating electricity. Even before the War this was becoming a serious problem. In some cases it ...

1940-07-20T23:59:59.000Z

62

Redox evolution of a degassing magma rising to the surface Alain Burgisser and Bruno Scaillet  

E-Print Network [OSTI]

. The total weight fraction of each species (wTi) is the sum of its exsolved part (wgi) and its dissolved part: wTi = wgi + ai (imiP)bi where ai and bi are solubility constants experimentally determined (Table 1

Paris-Sud XI, Université de

63

Faster parameter estimation using risk-sensitive lters Sanjeewa Athuraliyay  

E-Print Network [OSTI]

Faster parameter estimation using risk-sensitive lters Sanjeewa Athuraliyay , Jason Fordz and John propose a risk-sensitive approach to parameter estimation for hidden Markov models HMMs. The parameter the improvement in estimation simu- lation studies are presented that compare parameter estimation based on risk-sensitive

Moore, John Barratt

64

Faster high-quality processor allocation Peter Walker 1  

E-Print Network [OSTI]

and mesh dimensions are powers of 2. Furthermore, these algorithms are much faster than MC1x1, which takes]. Reduced contention is not suffi- cient to compensate for this utilization drop [6]. Thus, research has focused on noncontiguous allocators (e.g. [7], [8], [1], Shell 2 X Shell 0 Shell 1 Fig. 1. MC1x1's shells

Bunde, David

65

Faster Fermions in the Tempered Hybrid Monte Carlo Algorithm  

E-Print Network [OSTI]

Tempering is used to change the quark mass while remaining in equilibrium between the trajectories of a standard hybrid Monte Carlo simulation of four flavours of staggered fermions. The algorithm is faster for small enough quark masses, and particularly so when more than one mass is required.

G. Boyd

1997-01-20T23:59:59.000Z

66

NREL: News Feature - Biomass Analysis Tool Is Faster, More Precise  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Biomass Analysis Tool Is Faster, More Precise Biomass Analysis Tool Is Faster, More Precise February 26, 2013 Photo of a left hand holding a rectangular tray that has 48 cups, each holding a small amount of a biomass sample. Below the tray is a slice of a poplar tree, about an inch thick and a foot in diameter. Enlarge image This tray of 80-milliliter samples was taken from a standard poplar tree, such as the one pictured here. It is ready to be loaded into NREL's molecular beam mass spectrometer for rapid analysis of the cell wall chemistry of each sample. Credit: Dennis Schroeder A screening tool from the U.S. Department of Energy's National Renewable Energy Laboratory (NREL) eases and greatly quickens one of the thorniest tasks in the biofuels industry: determining cell wall chemistry to find plants with ideal genes.

67

RAPIDD Gives ALS Users a Faster Path to Beam Time  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

RAPIDD Gives ALS Users a Faster RAPIDD Gives ALS Users a Faster Path to Beam Time RAPIDD Gives ALS Users a Faster Path to Beam Time Print Monday, 28 October 2013 08:31 ALS users are invited to check out our web pages detailing our new RAPIDD proposal process. This combined process for Rapid Access Proposals, Industry, and Director's Discretion beam time accommodates users who require limited but rapid access to the ALS. Proposals may be submitted at any time. RAPIDD complements the existing six-month General User Proposal process, which remains the access mechanism of choice for users who require significant beam time for an extended program of research, or for those wanting to perform complex experiments involving setup or reorganization of equipment at a beamline. The ALS structural biology community has been using RAPIDD for a year, with 160 proposals receiving beam time in that period. As of July 2013, RAPIDD access was extended to beamlines 7.3.3 (SAXS/WAXS), 8.3.2 (microtomography) and 11.3.1 (small molecule crystallography) and to users from industrial groups.

68

CHARACTERIZING UNCERTAIN SEA LEVEL RISE PROJECTIONS TO  

E-Print Network [OSTI]

CHARACTERIZING UNCERTAIN SEA LEVEL RISE PROJECTIONS TO SUPPORT INVESTMENT DECISIONS Many institutions worldwide are considering how to include expectations about future sea level rise sea level rise in its investment plans? Such extreme events--for instance, increased storm frequency

69

Probability of sea level rise  

SciTech Connect (OSTI)

The report develops probability-based projections that can be added to local tide-gage trends to estimate future sea level at particular locations. It uses the same models employed by previous assessments of sea level rise. The key coefficients in those models are based on subjective probability distributions supplied by a cross-section of climatologists, oceanographers, and glaciologists.

Titus, J.G.; Narayanan, V.K.

1995-10-01T23:59:59.000Z

70

Diesel prices continue to rise  

U.S. Energy Information Administration (EIA) Indexed Site

Diesel prices continue to rise The U.S. average retail price for on-highway diesel fuel rose to 4.16 a gallon on Monday. That's up 5.3 cents from a week ago, based on the weekly...

71

Faster than light motion does not imply time travel  

E-Print Network [OSTI]

Seeing the many examples in the literature of causality violations based on faster-than- light (FTL) signals one naturally thinks that FTL motion leads inevitably to the possibility of time travel. We show that this logical inference is invalid by demonstrating a model, based on (3+1)-dimensional Minkowski spacetime, in which FTL motion is permitted (in every direction without any limitation on speed) yet which does not admit time travel. Moreover, the Principle of Relativity is true in this model in the sense that all observers are equivalent. In short, FTL motion does not imply time travel after all.

H. Andréka; J. X. Madarász; I. Németi; M. Stannett; G. Székely

2014-07-09T23:59:59.000Z

72

Faster than light motion does not imply time travel  

E-Print Network [OSTI]

Seeing the many examples in the literature of causality violations based on faster-than- light (FTL) signals one naturally thinks that FTL motion leads inevitably to the possibility of time travel. We show that this logical inference is invalid by demonstrating a model, based on (3+1)-dimensional Minkowski spacetime, in which FTL motion is permitted (in every direction without any limitation on speed) yet which does not admit time travel. Moreover, the Principle of Relativity is true in this model in the sense that all observers are equivalent. In short, FTL motion does not imply time travel after all.

Andréka, H; Németi, I; Stannett, M; Székely, G

2014-01-01T23:59:59.000Z

73

Updating Maryland's Sea-level Rise  

E-Print Network [OSTI]

Updating Maryland's Sea-level Rise Projections Scientific and Technical Working Group Maryland Climate Change Commission June 26, 2013 #12;Sea-level Rise Expert Group Donald F. Boesch* , University-author of the National Assessment Scenarios report Author of paper(s) on recent sea-level rise ~ Author contributing

Ezer,Tal

74

Oak Ridge Finds Ways to Remove K-25 Faster, Cheaper | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Finds Ways to Remove K-25 Faster, Cheaper Finds Ways to Remove K-25 Faster, Cheaper Oak Ridge Finds Ways to Remove K-25 Faster, Cheaper February 1, 2012 - 12:00pm Addthis Oak Ridge Finds Ways to Remove K-25 Faster, Cheaper Oak Ridge Finds Ways to Remove K-25 Faster, Cheaper Oak Ridge Finds Ways to Remove K-25 Faster, Cheaper Oak Ridge Finds Ways to Remove K-25 Faster, Cheaper OAK RIDGE, Tenn. - K-25, once the world's largest building under one roof, reflects less of its former title every day. Due to the partnership between the U.S Department of Energy (DOE) Office of Environmental Management (EM) cleanup team and Oak Ridge's prime environmental management contractor, URS | CH2M Oak Ridge, LLC (UCOR), the 44-acre, multi-level uranium-enrichment superstructure is in the advanced stages of demolition.

75

Counting Rises, Levels and Drops in Compositions 1 Counting Rises, Levels and  

E-Print Network [OSTI]

Counting Rises, Levels and Drops in Compositions 1 Counting Rises, Levels and Drops in Compositions Mansour Department of Mathematics, Haifa University, Israel #12;Counting Rises, Levels and Drops;Counting Rises, Levels and Drops in Compositions 3 Definitions · A composition = 12 . . . m of n N

Heubach, Silvia

76

Empire Rising: International Law & (and) Imperial Japan  

E-Print Network [OSTI]

BEASLEY, THE RISE OF MODERN JAPAN: POLITICAL, Ec- ONOMIC,It was during this period that Japan experienced tremendousworld power. ALEXIS DUDDEN, JAPAN'S COLONIZATION OF KOREA:

Lee, David S.

2006-01-01T23:59:59.000Z

77

100 Gbps Test Link Sets Pace for Faster Trans-Atlantic Data Transfers  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

100 Gbps Test Link Sets Pace for Faster Trans-Atlantic Data Transfers News & Publications ESnet in the News ESnet News Media & Press Publications and Presentations Galleries ESnet...

78

Rising Oil Prices Hit Chemical Industry  

Science Journals Connector (OSTI)

Rising Oil Prices Hit Chemical Industry ... Rising petroleum prices have dogged chemical makers for more than a year, and in the third quarter, the situation has only gotten worse. ... Although chemical makers had factored high feedstock costs into their planning, the recent sudden spikes in oil costs may have caught the industry off guard. ...

ALEX TULLO

2000-09-18T23:59:59.000Z

79

Traveling Faster than the Speed of Light in Non-Commutative Geometry  

E-Print Network [OSTI]

We study various dynamical aspects of solitons in non-commutative gauge theories and find surprising results. Among them is the observation that the solitons can travel faster than the speed of light for arbitrarily long distances.

Akikazu Hashimoto; N. Itzhaki

2000-12-11T23:59:59.000Z

80

sea level rise | OpenEI Community  

Open Energy Info (EERE)

sea level rise sea level rise Home Graham7781's picture Submitted by Graham7781(1992) Super contributor 18 January, 2013 - 15:46 U.S. Global Change Research Program publishes "National Climate Assessment" report for United States climate change drought OpenEI sea level rise temperatures U.S. Global Climate Change program The U.S. Global Change Research Program, established under the Department of Commerce in 2010, and partnered with NOAA, released an extensive National Climate Assessment report, projecting future climate changes in the United States under different scenarios. The 1,200 page report highlights some rather grim findings about the future of climate change. Here are 5 of the more disconcerting graphics from the report: 1. U.S. Average Temperatures Syndicate content

Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

Toward faster and more accurate star sensors using recursive centroiding and star identification  

E-Print Network [OSTI]

TOWARD FASTER AND MORE ACCURATE STAR SENSORS USING RECURSIVE CENTROIDING AND STAR IDENTIFICATION A Dissertation by MALAK ANEES SAMAAN Submitted to the O?ce of Graduate Studies of Texas A&M University in partial fulfillment of the requirements... for the degree of DOCTOR OF PHILOSOPHY August 2003 Major Subject: Aerospace Engineering TOWARD FASTER AND MORE ACCURATE STAR SENSORS USING RECURSIVE CENTROIDING AND STAR IDENTIFICATION A Dissertation by MALAK ANEES SAMAAN Submitted to Texas A&M University...

Samaan, Malak Anees

2004-09-30T23:59:59.000Z

82

Photo of the Week: Faster than the Speed of Light | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Photo of the Week: Faster than the Speed of Light Photo of the Week: Faster than the Speed of Light Photo of the Week: Faster than the Speed of Light July 24, 2013 - 2:00pm Addthis If you've ever heard the thunderous sound of a sonic boom, you've experienced the shock waves in the air created by an object traveling faster than the speed of sound. But what happens when an object travels faster than the speed of light? At Jefferson Laboratory, construction is underway to upgrade the Continuous Electron Beam Accelerator Facility (CEBAF) and the CEABF Large Acceptance Spectrometer (CLAS12) at Hall B. During the experiments, the accelerator will shoot electrons at speeds faster than the speed at which light travels in the same medium, creating shock waves that emit a blue light, known as Cherenkov light -- this light is equivalent to the sonic boom. By recording data from Cherenkov light, scientists will be able to map a nucleon's three-dimensional spin.

83

Short rise time intense electron beam generator  

DOE Patents [OSTI]

A generator for producing an intense relativisitc electron beam having a subnanosecond current rise time includes a conventional generator of intense relativistic electrons feeding into a short electrically conductive drift tube including a cavity containing a working gas at a low enough pressure to prevent the input beam from significantly ionizing the working gas. Ionizing means such as a laser simultaneously ionize the entire volume of working gas in the cavity to generate an output beam having a rise time less than one nanosecond.

Olson, C.L.

1984-03-16T23:59:59.000Z

84

Past and future sea-level rise along the coast of North Carolina, United States  

E-Print Network [OSTI]

Focusing on factors that cause relative sea-level (RSL) rise to differ from the global mean, we evaluate RSL trajectories for North Carolina, United States, in the context of tide gauge and geological sea-level proxy records spanning the last $\\mathord{\\sim}$11,000 years. RSL rise was fastest ($\\mathord{\\sim}$7 mm/yr) during the early Holocene and decreased over time. During the Common Era before the 19th century, RSL rise ($\\mathord{\\sim}$0.7 to 1.1 mm/yr) was driven primarily by glacio-isostatic adjustment, dampened by tectonic uplift along the Cape Fear Arch. Ocean/atmosphere dynamics caused centennial variability of up to $\\mathord{\\sim}$0.6 mm/yr around the long-term rate. It is extremely likely (probability $P = 0.95$) that 20th century RSL rise at Sand Point, NC, (2.8 $\\pm$ 0.5 mm/yr) was faster than during any other century in $\\geq2,900$ years. Projections based on a fusion of process models, statistical models, expert elicitation and expert assessment indicate that RSL at Wilmington, NC, is very lik...

Kopp, Robert E; Kemp, Andrew C; Tebaldi, Claudia

2014-01-01T23:59:59.000Z

85

Paleomagnetism of Igenous Rocks from Shatsky Rise  

E-Print Network [OSTI]

1349 ..................................................... 94 2.6 Colatitude versus depth for Site U1350 ..................................................... 95 2.7 Colatitude arcs for Shatsky Rise sites compared to Pacific plate paleomagnetic... U1350 displayed directional changes consistent with significant paleosecular variation, but even this section does not completely average out secular variation, implying that the time span was <104-105 years. On the whole, the paleomagnetic data...

Pueringer, Margaret

2013-04-24T23:59:59.000Z

86

RISING ECONOMIC INSECURITY AMONG SENIOR SINGLE WOMEN  

E-Print Network [OSTI]

RISING ECONOMIC INSECURITY AMONG SENIOR SINGLE WOMEN Tatjana Meschede Martha Cronin Laura Sullivan paying bills, forgoing home maintenance or medical needs. New research shows that economic insecurity of the Great Recession had been felt--economic insecurity among this population subgroup increased by one

Snider, Barry B.

87

Bubble growth and rise in soft sediments  

Science Journals Connector (OSTI)

...predict rates of bubble rise as a result...model the unstable gas accumulations...measured the fracture strength, K 1c, of sediments...M., 2002, Gas production and...in artificial sludge deposits: Waste...containing large gas bubbles: Geotechnique...

88

The Rising Cost of Electricity Generation  

SciTech Connect (OSTI)

Through most of its history, the electric industry has experienced a stable or declining cost structure. Recently, the economic fundamentals have shifted and generating costs are now rising and driving up prices at a time when the industry faces new challenges to reduce CO{sub 2} emissions. New plant investment faces the most difficult economic environment in decades.

Tobey Winters

2008-06-15T23:59:59.000Z

89

Gas plants, new fields spark production rise  

SciTech Connect (OSTI)

Gas plant construction is welcomed by operators in the Williston Basin, North Dakota. Petroleum and gas production has increased. The Montana portion of the Williston Basin shows new discoveries. Some secondary recovery efforts are in operation. Industrial officials share the same enthusiasm and optimism for rising production as they do for exploration potential in the basin. 5 tables.

Lenzini, D.

1980-04-01T23:59:59.000Z

90

Genomics Rises To Drug Discovery Challenge  

Science Journals Connector (OSTI)

Genomics Rises To Drug Discovery Challenge ... Functional genomics and functional proteomics provide a set of powerful tools to help identify novel cellular targets ... With pharmaceutical companies and biotechnology firms always looking for ways to discover new medicines more quickly and more efficiently, they are increasingly turning to new genomics and proteomics technologies to speed things along. ...

STU BORMAN

1999-04-19T23:59:59.000Z

91

Rising Above the Water: New Orleans Implements Energy Efficiency...  

Energy Savers [EERE]

Rising Above the Water: New Orleans Implements Energy Efficiency and Sustainability Practices Following Hurricanes Katrina and Rita (Fact Sheet) Rising Above the Water: New Orleans...

92

Development of Sea Level Rise Scenarios for Climate Change Assessments...  

Open Energy Info (EERE)

Sea Level Rise Scenarios for Climate Change Assessments of the Mekong Delta, Vietnam Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Development of Sea Level Rise...

93

Naturally Occurring Mutations in the WTI Gene  

Science Journals Connector (OSTI)

Dominant oncogenes, like myc or ras, confer a gain of func-tion to transformed cells.1,2 Gain-of-function mutations result in abnormal, positive signals for cell proliferation. In general, however, genetic altera...

Max J. Coppes M.D.; Ph.D.…

1995-01-01T23:59:59.000Z

94

Faster Algorithms for Optimal Multiple Sequence Alignment Based on Pairwise Comparisons  

E-Print Network [OSTI]

Faster Algorithms for Optimal Multiple Sequence Alignment Based on Pairwise Comparisons Pankaj K algorithm more efficient, while still finding an optimal solution under these restrictions. Namely, in our) algorithms compute an optimal Multiple Sequence Alignment for a wide range of scoring functions. In 1970

Kolodny, Rachel

95

Jordan Thayer (UNH) Bounded Suboptimal Search 1 / 18 Finding Acceptable Solutions Faster  

E-Print Network [OSTI]

Jordan Thayer (UNH) Bounded Suboptimal Search ­ 1 / 18 Finding Acceptable Solutions Faster Using Inadmissible Information Jordan Thayer & Wheeler Ruml Supported by DARPA CSSG program (grant HR0011-09-1-0021) and NSF (grant IIS-0812141) #12;Bounded Suboptimal Heuristic Search Motivation EES Results Jordan Thayer

Ruml, Wheeler

96

Faster ECC over F2521-1 Robert Granger1 and Michael Scott2  

E-Print Network [OSTI]

Faster ECC over F2521-1 Robert Granger1 and Michael Scott2 1 Laboratory for Cryptologic Algorithms School of Computer and Communication Sciences ´Ecole Polytechnique F´ed´erale de Lausanne, CH-1015, Switzerland robbiegranger@gmail.com 2 Certivox Labs mike.scott@certivox.com Abstract. In this paper we present

97

CUSTOM DATA SUPPORT FOR THE FAST -PHYSICS SYSTEM TESTBED AND RESEARCH (FASTER) PROJECT  

E-Print Network [OSTI]

for the FASTER project. The effort will provide tailored datasets, statistics, best estimates and quality control Associates, LLC under Contract No. DE-AC02- 98CH10886 with the U.S. Department of Energy. The publisher-exclusive, paid-up, irrevocable, world-wide license to publish or reproduce the published form of this manuscript

98

Custom data support for the FAst -physics System Testbed and Research (FASTER) Project  

SciTech Connect (OSTI)

The multi-institution FAst -physics System Testbed and Research (FASTER) project, funded by the DOE Earth System Modeling program, aims to evaluate and improve the parameterizations of fast processes (those involving clouds, precipitation and aerosols) in global climate models, using a combination of numerical prediction models, single column models, cloud resolving models, large-eddy simulations, full global climate model output and ARM active and passive remote sensing and in-situ data. This poster presents the Custom Data Support effort for the FASTER project. The effort will provide tailored datasets, statistics, best estimates and quality control data, as needed and defined by FASTER participants, for use in evaluating and improving parameterizations of fast processes in GCMs. The data support will include custom gridding and averaging, for the model of interest, using high time resolution and pixel level data from continuous ARM observations and complementary datasets. In addition to the FASTER team, these datasets will be made available to the ARM Science Team. Initial efforts with respect to data product development, priorities, availability and distribution are summarized here with an emphasis on cloud, atmospheric state and aerosol properties as observed during the Spring 2000 Cloud IOP and the Spring 2003 Aerosol IOP at the ARM Southern Great Plains site.

Toto, T.; Jensen, M.; Vogelmann, A.; Wagener, R.; Liu, Y.; Lin, W.

2010-03-15T23:59:59.000Z

99

Microfluidics in structural biology: smaller, faster. . . better Carl Hansen and Stephen R Quake  

E-Print Network [OSTI]

Microfluidics in structural biology: smaller, faster. . . better Carl Hansen and Stephen R QuakeĂ? Microfluidic technologies promise unprecedented savings in cost and time through the integration of complex of this vision a reality, facilitating the first large-scale integration of microfluidic plumbing with biological

Hansen, Carl L.

100

Accelerated Corrective Consensus: Converge to the Exact Average at a Faster Rate  

E-Print Network [OSTI]

Accelerated Corrective Consensus: Converge to the Exact Average at a Faster Rate Yin Chen Roberto to reach convergence. Therefore, a great deal of effort has been devoted into accelerating consensus with improved accelerated consensus algorithms. Nevertheless, these techniques assume the communication graph

Amir, Yair

Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

Sleep with Guilt and Work Faster to Minimize Flow plus Energy  

E-Print Network [OSTI]

to reduce energy usage. Re- cently there is a lot of theory research on online job scheduling taking speedSleep with Guilt and Work Faster to Minimize Flow plus Energy Tak-Wah Lam1, , Lap-Kei Lee1 , Hing. {isaacto, pwong}@liverpool.ac.uk Abstract. In this paper we extend the study of flow-energy scheduling

Wong, Prudence W.H.

102

Faster Decomposition Under Increased Atmospheric CO2 Limits Soil Carbon Storage  

Science Journals Connector (OSTI)

...atmosphere is a major focus of Earth system models, because the C cycle is sensitive...cycle affect our climate. Earth system models project that rising atmospheric...through microbial decomposition. Earth system models typically treat decomposition...

Kees Jan van Groenigen; Xuan Qi; Craig W. Osenberg; Yiqi Luo; Bruce A. Hungate

2014-05-02T23:59:59.000Z

103

Utility rate change propagation is now much faster | OpenEI Community  

Open Energy Info (EERE)

rate change propagation is now much faster rate change propagation is now much faster Home > Groups > Utility Rate Rmckeel's picture Submitted by Rmckeel(297) Contributor 19 March, 2013 - 16:30 developer Semantic Mediawiki Utility Rates Good news, everyone! Changes to the utility rate template or fields cause small updates on all 29K+ utility rates on OpenEI, which takes time to process. Older versions of mediawiki and semantic mediawiki were not as efficient at handling these. Preliminary results after changing a field and tweaking job run speeds shows a ~60X improvement in speed. Changes to utility rates can now be propagated to the entire database in approximately 35 minutes - before it took more than one day. We are hopeful we will keep seeing various benefits from the upgrade process.

104

Estimating the Economic Cost of Sea-Level Rise  

E-Print Network [OSTI]

To improve the estimate of economic costs of future sea-level rise associated with global climate change,

Sugiyama, Masahiro.

105

FASTER: A new DOE effort to bridge ESM and ASR sciences  

SciTech Connect (OSTI)

In order to better use the long-term ARM measurements to evaluate parameterizations of fast processes used in global climate models --- mainly those related to clouds, precipitation and aerosols, the DOE Earth System Modeling (ESM) program funds a new multi-institution project led by the Brookhaven National Laboratory, FAst -physics System Testbed and Research (FASTER). This poster will present an overview of this new project and its scientific relationships to the ASR sciences and ARM measurements.

Liu, Y.

2010-03-15T23:59:59.000Z

106

The Emphasis on Ecological Design for High-rise Buildings  

E-Print Network [OSTI]

-rise buildings should be paid more attention because high-rise buildings consume a large amount of natural resources and energy. An ecological design method of high-rise buildings was introduced based on four points: adaptation of climate, ecological accounting...

Xu, F.; Zhang, G.; Xie, M.

2006-01-01T23:59:59.000Z

107

he Sun Rises From the Village (Gne Kyden  

E-Print Network [OSTI]

he Sun Rises From the Village (Güne Köyden Douyor) project, working this year in the village of Eymir in Yozgat's Sorgun district, has started off the semester with 70 volunteers. The Sun Rises From University's umbrella organization for student volunteer activity. The goal of The Sun Rises From the Village

GĂĽrel, Levent

108

ICE SHEET SOURCES OF SEA LEVEL RISE AND FRESHWATER DISCHARGE  

E-Print Network [OSTI]

ICE SHEET SOURCES OF SEA LEVEL RISE AND FRESHWATER DISCHARGE DURING THE LAST DEGLACIATION Anders E the sources of sea level rise and freshwater dis- charge to the global oceans associated with retreat of ice­10 m sea level rise at 19.0­19.5 ka, sourced largely from Northern Hemisphere ice sheet retreat

Carlson, Anders

109

Contemporary Sea Level Rise Anny Cazenave and William Llovel  

E-Print Network [OSTI]

Contemporary Sea Level Rise Anny Cazenave and William Llovel Laboratoire d'´etudes en g reserved 1941-1405/10/0115-0145$20.00 Key Words sea level rise, climate change, land ice melt, ocean we report on most recent results on contemporary sea level rise. We first present sea level

Siegel, David A.

110

CLIMATE CHANGE AND SEA LEVEL RISE SCENARIOS FOR CALIFORNIA  

E-Print Network [OSTI]

CLIMATE CHANGE AND SEA LEVEL RISE SCENARIOS FOR CALIFORNIA VULNERABILITY AND ADAPTATION This white paper provides an evaluation of physical elements of climate change and sea level rise, and a range of sea level rise along the California coast. Keywords: California climate change

111

Sea Level Rise Adaptation: From Climate Chaos to Climate Resilience  

E-Print Network [OSTI]

Sea Level Rise Adaptation: From Climate Chaos to Climate Resilience Human Dimensions and Ocean, 2013 #12;Main Discussion Points · How do we incorporate Sea-Level Rise into planning and regulatory actions? · What Does the new NRC Report on Sea- Level Rise mean to Decision-makers? · How does Sea-Level

Rohs, Remo

112

Sea-Level Rise OF THE EFFECTS OF  

E-Print Network [OSTI]

Climate Change AND Sea-Level Rise IN Florida AN Update OF THE EFFECTS OF Climate Change ON FLORIDA to them. Florida Oceans and Coastal Council. 2010. Climate Change and Sea-Level Rise in Florida: An Update, sea-level rise, with the expectation that updates for increasing greenhouse gases, air temperature

113

Virginia Wetlands Report Sea Level Rise & Other Coastal Hazards  

E-Print Network [OSTI]

Virginia Wetlands Report Sea Level Rise & Other Coastal Hazards: The Risks of Coastal Living See. Climate change is bringing increased temperatures, rising sea level, more frequent storms and increased in tide levels. From these records it is not only clear that water levels are rising, they appear

114

The Ohio State University South Campus High Rise  

E-Print Network [OSTI]

The Ohio State University South Campus High Rise Building & Utility Assessment Page 4.1 STRUCTURAL Campus High Rise Building & Utility Assessment Page 4.2 STRUCTURAL CONSTRAINTS The primary structural High Rise Building & Utility Assessment Page 4.3 CONNECTOR BUILDING The connector building discussed

115

Computational Fluid Dynamics of rising droplets  

SciTech Connect (OSTI)

The main goal of this study is to perform simulations of droplet dynamics using Truchas, a LANL-developed computational fluid dynamics (CFD) software, and compare them to a computational study of Hysing et al.[IJNMF, 2009, 60:1259]. Understanding droplet dynamics is of fundamental importance in liquid-liquid extraction, a process used in the nuclear fuel cycle to separate various components. Simulations of a single droplet rising by buoyancy are conducted in two-dimensions. Multiple parametric studies are carried out to ensure the problem set-up is optimized. An Interface Smoothing Length (ISL) study and mesh resolution study are performed to verify convergence of the calculations. ISL is a parameter for the interface curvature calculation. Further, wall effects are investigated and checked against existing correlations. The ISL study found that the optimal ISL value is 2.5{Delta}x, with {Delta}x being the mesh cell spacing. The mesh resolution study found that the optimal mesh resolution is d/h=40, for d=drop diameter and h={Delta}x. In order for wall effects on terminal velocity to be insignificant, a conservative wall width of 9d or a nonconservative wall width of 7d can be used. The percentage difference between Hysing et al.[IJNMF, 2009, 60:1259] and Truchas for the velocity profiles vary from 7.9% to 9.9%. The computed droplet velocity and interface profiles are found in agreement with the study. The CFD calculations are performed on multiple cores, using LANL's Institutional High Performance Computing.

Wagner, Matthew [Lake Superior State University; Francois, Marianne M. [Los Alamos National Laboratory

2012-09-05T23:59:59.000Z

116

Finite Theory of the Universe, Dark Matter Disproof and Faster-Than-Light Speed  

Science Journals Connector (OSTI)

The mathematical representation of General Relativity uses a four dimensional reference frame to position in time and space an object and tells us time is a linear variable that can have both a negative and positive value. In this paper a new mathematical model is being suggested which is based on the classical mechanics. The theory is objective and predicts low scale GPS gravitational time dilation, the perihelion precession disparity for all planets, the gravitational light bending, up to the rotation curve for all galaxies, the natural faster-than-light galactic expansion, even the constitution of a black hole and the center of the Universe.

Phil Bouchard

2012-01-01T23:59:59.000Z

117

Rising Above the Water: New Orleans Implements Energy Efficiency...  

Energy Savers [EERE]

Rising Above the Water: New Orleans Implements Energy Efficiency and Sustainability Practices Following Hurricanes Katrina and Rita On August 29, 2005, Hurricane Katrina, the...

118

Energy Management Strategies for Fast Battery Temperature Rise...  

Broader source: Energy.gov (indexed) [DOE]

Energy Management Strategies for Fast Battery Temperature Rise and Engine Efficiency Improvement at Very Cold Conditions Energy Management Strategies for Fast Battery Temperature...

119

Rising Electricity Costs: A Challenge For Consumers, Regulators, And Utilities  

Broader source: Energy.gov [DOE]

Presentation covers the rising electricity costs and is given at the Spring 2010 Federal Utility Partnership Working Group (FUPWG) meeting in Providence, Rhode Island.

120

The rise and fall of presidential power in Iran.  

E-Print Network [OSTI]

??This project explores the power dynamics within the Iranian political system, asking what accounts for the rise and fall of a president's power relative to… (more)

Jacobsen, Donavan.

2008-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

Bubble rise phenomena in various non-Newtonian fluids.  

E-Print Network [OSTI]

??"The bubble rise characteristic is very important for the design of heat and masss transfer operations in chemical, biochemical, environmental, and food processing industries. The… (more)

Hassan, N. M. S.

2011-01-01T23:59:59.000Z

122

Bigger brains cycle faster before neurogenesis begins: a comparison of brain development between chickens and bobwhite quail  

Science Journals Connector (OSTI)

...Research articles 1001 58 133 70 Bigger brains cycle faster before neurogenesis begins: a comparison of brain development between chickens and bobwhite...Irvine, CA 92697, USA The chicken brain is more than twice as big as the bobwhite...

2010-01-01T23:59:59.000Z

123

With faster processors and better numerical techniques, computational fluid dynamics (CFD) tools have revolutionized engineering design and optimization--  

E-Print Network [OSTI]

With faster processors and better numerical techniques, computational fluid dynamics (CFD) tools have revolutionized engineering design and optimization-- limiting expensive experimentation and Engineering Division (GED) at Southwest Research Institute® (SwRI®) has extensive experience and capabilities

Chapman, Clark R.

124

Sea-Level Rise, El Nińo, And The Future Of The California Coastline  

E-Print Network [OSTI]

City of Santa Barbara Sea-Level Rise Vulnerability Study.Projecting future sea level rise. California Climate Changeand responses to sea level rise. In Understanding Sea Level

Russell, Nicole Lian

2014-01-01T23:59:59.000Z

125

Argonne OutLoud: Rise of the Super Smart Supercomputer | Argonne National  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Rise of the Super Smart Supercomputer Rise of the Super Smart Supercomputer Rise of the Super Smart Supercomputer lecture 1 of 13 Rise of the Super Smart Supercomputer lecture Rise of the Super Smart Supercomputer lecture 1 of 13 Rise of the Super Smart Supercomputer lecture Rise of the Super Smart Supercomputer lecture 2 of 13 Rise of the Super Smart Supercomputer lecture Rise of the Super Smart Supercomputer lecture 3 of 13 Rise of the Super Smart Supercomputer lecture Rise of the Super Smart Supercomputer lecture 4 of 13 Rise of the Super Smart Supercomputer lecture Rise of the Super Smart Supercomputer lecture 5 of 13 Rise of the Super Smart Supercomputer lecture Rise of the Super Smart Supercomputer lecture 6 of 13 Rise of the Super Smart Supercomputer lecture Rise of the Super Smart Supercomputer lecture

126

Model flames in the Boussinesq limit: Rising Natalia Vladimirova  

E-Print Network [OSTI]

Model flames in the Boussinesq limit: Rising bubbles Natalia Vladimirova ASC/Flash Center the Boussinesq buoyancy approximation, we study a bubble of reaction products rising in the reactant fluid under with a specified speed. The flame speed, although known for laminar flame, is #12;Model flames in the Boussinesq

Vladimirova, Natalia

127

Young Scholars Rising 9th Graders Present Posters  

E-Print Network [OSTI]

Young Scholars Rising 9th Graders Present Posters On June 28, 2013, in the Ohio Union Cartoon Room, 78 rising 9th graders in the Young Scholars Program (YSP) exhibited their posters and projects from Austin, Director of YSP, said, "These YSP scholars really enjoy creating their poster presentations

Howat, Ian M.

128

Notch Sensitivity of Ceramic Composites with Rising Fracture Resistance  

E-Print Network [OSTI]

of common notched test configurations with the material's fracture resistance. Analogous treatments of notch sensitivity have been used previously for other materials that exhibit rising fracture resistance, includingNotch Sensitivity of Ceramic Composites with Rising Fracture Resistance Michael A. Mattoni

Zok, Frank

129

Heart-shaped bubbles rising in anisotropic liquids Chunfeng Zhou  

E-Print Network [OSTI]

Heart-shaped bubbles rising in anisotropic liquids Chunfeng Zhou Department of Chemical of an unusual inverted-heart shape for bubbles rising in an anisotropic micellar solution. We explain the bubble heart or a spade a . The upper sur- face has sloped shoulders that join in a point. The bottom

Feng, James J.

130

Rising Sea Levels Due to Global Warming Are Unstoppable  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Rising Sea Levels Rising Sea Levels Due to Global Warming Are Unstoppable Rising Sea Levels Due to Global Warming Are Unstoppable Mitigation can slow down but not prevent sea level rise for centuries to come August 5, 2013 Contact: Linda Vu, Lvu@lbl.gov, +1 510 495 2402 washington.jpg Because seawater absorbs heat more slowly than the atmosphere above it, our oceans won't feel the full impact of the greenhouse gases already in the air for hundreds of years. Warm water expands, raising sea levels. (Courtesy W. Washington) Select to enlarge. A reduction in greenhouse gas emissions could greatly lessen the impacts of climate change. However, the gases already added to the atmosphere ensure a certain amount of sea level rise to come, even if future emissions are reduced. A study by National Center for Atmospheric Research (NCAR)

131

City of Rising Sun, Indiana (Utility Company) | Open Energy Information  

Open Energy Info (EERE)

Rising Sun, Indiana (Utility Company) Rising Sun, Indiana (Utility Company) Jump to: navigation, search Name Rising Sun City of Place Indiana Utility Id 16068 Utility Location Yes Ownership M NERC Location RFC NERC RFC Yes Activity Distribution Yes References EIA Form EIA-861 Final Data File for 2010 - File1_a[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Utility Rate Schedules Grid-background.png Rate A- Residential Residential Rate B- General Power Commercial Average Rates Residential: $0.0792/kWh Commercial: $0.0888/kWh Industrial: $0.1490/kWh References ↑ "EIA Form EIA-861 Final Data File for 2010 - File1_a" Retrieved from "http://en.openei.org/w/index.php?title=City_of_Rising_Sun,_Indiana_(Utility_Company)&oldid=410165

132

Claritas Rise, Mars- Pre-Tharsis Magmatism? | Open Energy Information  

Open Energy Info (EERE)

Claritas Rise, Mars- Pre-Tharsis Magmatism? Claritas Rise, Mars- Pre-Tharsis Magmatism? Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Journal Article: Claritas Rise, Mars- Pre-Tharsis Magmatism? Details Activities (0) Areas (0) Regions (0) Abstract: Abstract Claritas rise is a prominent ancient (Noachian) center of tectonism identified through investigation of comprehensive paleotectonic information of the western hemisphere of Mars. This center is interpreted to be the result of magmatic-driven activity, including uplift and associated tectonism, as well as possible hydrothermal activity. Coupled with its ancient stratigraphy, high density of impact craters, and complex structure, a possible magnetic signature may indicate that it formed during an ancient period of Mars' evolution, such as when the dynamo

133

On the maximum pressure rise rate in boosted HCCI operation  

E-Print Network [OSTI]

This paper explores the combined effects of boosting, intake air temperature, trapped residual gas fraction, and dilution on the Maximum Pressure Rise Rate (MPRR) in a boosted single cylinder gasoline HCCI engine with ...

Wildman, Craig B.

134

Estimating the economic cost of sea-level rise  

E-Print Network [OSTI]

(cont.) In the case of a classical linear sea-level rise of one meter per century, the use of DIVA generally decreases the protection fraction of the coastline, and results in a smaller protection cost because of high ...

Sugiyama, Masahiro, Ph. D. Massachusetts Institute of Technology

2007-01-01T23:59:59.000Z

135

Rising Sea Levels Due to Global Warming Are Unstoppable  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Levels Due to Global Warming Are Unstoppable Mitigation can slow down but not prevent sea level rise for centuries to come August 5, 2013 Contact: Linda Vu, Lvu@lbl.gov, +1 510 495...

136

Fact #810: December 30, 2013 Leasing on the Rise  

Broader source: Energy.gov [DOE]

Leasing has been on the rise since 2009 and rose sharply from 2012 through the first half of 2013, with leases accounting for about 26% of all new light vehicle transactions. The pronounced dip in...

137

Adapting to Rising Sea Level: A Florida Perspective  

Science Journals Connector (OSTI)

Global climate change and concomitant rising sea level will have a profound impact on Florida’s coastal and marine systems. Sea?level rise will increase erosion of beaches cause saltwater intrusion into water supplies inundate coastal marshes and other important habitats and make coastal property more vulnerable to erosion and flooding. Yet most coastal areas are currently managed under the premise that sea?level rise is not significant and the shorelines are static or can be fixed in place by engineering structures. The new reality of sea?level rise and extreme weather due to climate change requires a new style of planning and management to protect resources and reduce risk to humans. Scientists must: (1) assess existing coastal vulnerability to address short term management issues and (2) model future landscape change and develop sustainable plans to address long term planning and management issues. Furthermore this information must be effectively transferred to planners managers and elected officials to ensure their decisions are based upon the best available information. While there is still some uncertainty regarding the details of rising sea level and climate change development decisions are being made today which commit public and private investment in real estate and associated infrastructure. With a design life of 30 yrs to 75 yrs or more many of these investments are on a collision course with rising sea level and the resulting impacts will be significant. In the near term the utilization of engineering structures may be required but these are not sustainable and must ultimately yield to “managed withdrawal” programs if higher sea?level elevations or rates of rise are forthcoming. As an initial step towards successful adaptation coastal management and planning documents (i.e. comprehensive plans) must be revised to include reference to climate change and rising sea?level.

Randall W. Parkinson

2009-01-01T23:59:59.000Z

138

Rising household diesel consumption in the United States: A cause for concern? Evidence on asymmetric pricing  

Science Journals Connector (OSTI)

Papers in the literature have thus far overlooked the projected increase in U.S. diesel car share when looking at asymmetries in petroleum pricing. This paper addresses this issue by comparing retail gasoline and diesel prices in order to see whether they rise faster than they fall given the price of their upstream input, crude oil. This phenomenon has been termed in the literature as “Rockets and Feathers.” We apply the threshold vector error correction model (TVECM) of Hansen and Seo (2002) which has not yet been applied in the literature. We account for the 2008 structural break to crude oil and petroleum prices by splitting the sample using evidence from the recent structural break unit root test of Kim and Perron (2009). Both markets seem to price symmetrically before the 2008 break, but we find evidence of asymmetric pricing after 2008 in diesel prices, and not in gasoline prices. Given that the diesel market is small relative to the gasoline market and therefore more open to price exploitation, the ongoing cost increases associated with the policy of switching to Ultra Low Sulphur diesel (ULSD) from 2006 to 2010 could be at the heart of this asymmetry. With this in mind, the U.S. Federal Trade Commission should monitor diesel prices as the market share grows, in order to ensure that consumers are not adversely affected.

Jack Fosten

2012-01-01T23:59:59.000Z

139

T-Mobile is making mobile surfing for your personal Internet favorites even easier, faster and convenient  

E-Print Network [OSTI]

T-Mobile is making mobile surfing for your personal Internet favorites even easier, faster on your mobile- phone display · Active widgets provide automatic notification of new information on personal Internet sites if required · Strategic partnership between T-Mobile and Opera for the creation

Deutschmann, Rainer

140

Memory flies sooner from flies that learn faster Daniel R. Papaj* and Emilie C. Snell-Rood  

E-Print Network [OSTI]

Memory flies sooner from flies that learn faster Daniel R. Papaj* and Emilie C. Snell melano- gaster have characterized a large number of genetic loci involved in learning and memory (2, 3 of a pattern of continuous ge- netic variation in learning and memory. In a recent issue of PNAS, work reported

Sokolowski, Marla

Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

Rising global temperatures accelerate drought-induced forest mortality  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Drought-induced forest mortality Drought-induced forest mortality Rising global temperatures accelerate drought-induced forest mortality Many southwestern forests in the United States will disappear or be heavily altered by 2050, according to a series of joint LANL-UNM studies. July 10, 2013 Piñon trees show increased susceptibility to drought when also subjected to rising temperatures. Piñon trees show increased susceptibility to drought when also subjected to rising temperatures. Contact Nancy Ambrosiano Communications Office (505) 667-0471 Email "Everybody knows trees die when there's a drought, if there's bark beetles or fire, yet nobody in the world can predict it with much accuracy." Research has dire global implications for forests LOS ALAMOS, N. M., July 10, 2013- Many southwestern forests in the United

142

Rising global temperatures accelerate drought-induced forest mortality  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Drought-induced forest mortality Drought-induced forest mortality Rising global temperatures accelerate drought-induced forest mortality Many southwestern forests in the United States will disappear or be heavily altered by 2050, according to a series of joint LANL-UNM studies. July 10, 2013 Piñon trees show increased susceptibility to drought when also subjected to rising temperatures. Piñon trees show increased susceptibility to drought when also subjected to rising temperatures. Contact Nancy Ambrosiano Communications Office (505) 667-0471 Email "Everybody knows trees die when there's a drought, if there's bark beetles or fire, yet nobody in the world can predict it with much accuracy." Research has dire global implications for forests LOS ALAMOS, N. M., July 10, 2013- Many southwestern forests in the United

143

Weatherization Projects on the Rise in Michigan County | Department of  

Broader source: Energy.gov (indexed) [DOE]

Weatherization Projects on the Rise in Michigan County Weatherization Projects on the Rise in Michigan County Weatherization Projects on the Rise in Michigan County August 12, 2010 - 5:03pm Addthis Kevin Craft Monroe County Opportunity Program (MCOP) has provided weatherization services to southeastern Michigan residents for over 20 years, and funds from the American Recovery and Reinvestment Act of 2009 recently allowed this private non-profit to hire more staff and increase the scope of its services. In April 2009, MCOP received $3 million in Recovery Act funds to spend over a three year period. "We initially used the money to hire three office staffers to process weatherization applications and a full-time inspector to conduct pre- and post-inspections on houses that are approved for weatherization," says

144

A Rising Star: Solid-State Lighting | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

A Rising Star: Solid-State Lighting A Rising Star: Solid-State Lighting A Rising Star: Solid-State Lighting June 16, 2009 - 5:00am Addthis John Lippert Just when consumers started getting familiar with the spiral ice-cream cone-shaped and prong-shaped compact fluorescents (CFLs), along comes LED lighting, a solid-state lighting (SSL) solution. Some experts are predicting that solid-state lighting is set to turn the current lighting industry on its head, and perhaps in the not-too-distant future make the century-old incandescent light bulb go the way of the dinosaur. Many consumers have been saving money and helping the environment for years by using LED lights during the holidays. These light strings use 75% less energy than conventional (i.e., incandescent) light strings. ENERGY STAR decorative light strings are independently tested to meet strict lifetime

145

A Rising Star: Solid-State Lighting | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

A Rising Star: Solid-State Lighting A Rising Star: Solid-State Lighting A Rising Star: Solid-State Lighting June 16, 2009 - 5:00am Addthis John Lippert Just when consumers started getting familiar with the spiral ice-cream cone-shaped and prong-shaped compact fluorescents (CFLs), along comes LED lighting, a solid-state lighting (SSL) solution. Some experts are predicting that solid-state lighting is set to turn the current lighting industry on its head, and perhaps in the not-too-distant future make the century-old incandescent light bulb go the way of the dinosaur. Many consumers have been saving money and helping the environment for years by using LED lights during the holidays. These light strings use 75% less energy than conventional (i.e., incandescent) light strings. ENERGY STAR decorative light strings are independently tested to meet strict lifetime

146

RADIOACTIVELY POWERED RISING LIGHT CURVES OF TYPE Ia SUPERNOVAE  

SciTech Connect (OSTI)

The rising luminosity of the recent, nearby supernova 2011fe shows a quadratic dependence with time during the first Almost-Equal-To 0.5-4 days. In addition, studies of the composite light curves formed from stacking together many Type Ia supernovae (SNe Ia) have found similar power-law indices for the rise, but may also show some dispersion that may indicate diversity. I explore what range of power-law rises are possible due to the presence of radioactive material near the surface of the exploding white dwarf (WD). I summarize what constraints such a model places on the structure of the progenitor and the distribution and velocity of ejecta. My main conclusion is that for the inferred explosion time for SN 2011fe, its rise requires an increasing mass fraction X {sub 56} Almost-Equal-To (4-6) Multiplication-Sign 10{sup -2} of {sup 56}Ni distributed between a depth of Almost-Equal-To 10{sup -2} and 0.3 M {sub Sun} below the WD's surface. Radioactive elements this shallow are not found in simulations of a single C/O detonation. Scenarios that may produce this material include helium-shell burning during a double-detonation ignition, a gravitationally confined detonation, and a subset of deflagration to detonation transition models. In general, the power-law rise can differ from quadratic depending on the details of the velocity, density, and radioactive deposition gradients in a given event. Therefore, comparisons of this work with observed bolometric rises of SNe Ia would place strong constraints on the properties of the shallow outer layers, providing important clues for identifying the elusive progenitors of SNe Ia.

Piro, Anthony L., E-mail: piro@caltech.edu [Theoretical Astrophysics, California Institute of Technology, 1200 East California Boulevard, M/C 350-17, Pasadena, CA 91125 (United States)

2012-11-10T23:59:59.000Z

147

Rise Time Measurement for Ultrafast X-Ray Pulses  

DOE Patents [OSTI]

A pump-probe scheme measures the rise time of ultrafast x-ray pulses. Conventional high speed x-ray diagnostics (x-ray streak cameras, PIN diodes, diamond PCD devices) do not provide sufficient time resolution to resolve rise times of x-ray pulses on the order of 50 fs or less as they are being produced by modern fast x-ray sources. Here, we are describing a pump-probe technique that can be employed to measure events where detector resolution is insufficient to resolve the event. The scheme utilizes a diamond plate as an x-ray transducer and a p-polarized probe beam.

Celliers, Peter M.; Weber, Franz A.; Moon, Stephen J.

2005-04-05T23:59:59.000Z

148

Subsidence, Sea Level Rise, and Seismicity in the Sacramento–San Joaquin Delta  

E-Print Network [OSTI]

butions to global sea level rise. Nature 428:406-409. Mount420. Reed DJ. 2002a. Sea-level rise and coastal marsh sus-MARCH 2005 Subsidence, Sea Level Rise, and Seismicity in the

Mount, Jeffrey; Twiss, Robert

2005-01-01T23:59:59.000Z

149

Assessment of Seawater Intrusion Potential From Sea-level Rise in Coastal Aquifers of California  

E-Print Network [OSTI]

2009). Impact of Sea-Level Rise on Sea Water Intrusion inC. (1997). Global Sea Level Rise: A Redetermination. Surveys2007). Effects of sea-level rise on groundwater flow in a

Loáiciga, Hugo A; Pingel, Thomas J; Garcia, Elizabeth S

2009-01-01T23:59:59.000Z

150

Potential Inundation Due to Rising Sea Levels in the San Francisco Bay Region  

E-Print Network [OSTI]

impact of accelerated sea level rise on San Francisco Bay.change scenarios and sea level rise estimates for thedistribution of sea level rise over the 1950–2000 period.

Knowles, Noah

2010-01-01T23:59:59.000Z

151

On the Rates of Sea Level Rise -- Clues From the Distant Past  

E-Print Network [OSTI]

vulnerable to sea level rise, with wetlands surrounded byA Just how much will sea level rise in the current century?on warming and tying sea level rise to such warming, gets

Berger, Wolfgang H

2009-01-01T23:59:59.000Z

152

"Half Seas Over": The Impact of Sea Level Rise on International Law and Policy  

E-Print Network [OSTI]

other ramifications of sea level rise. As the overview ofintro. 1960). SEA LEVEL RISE beneath the sea, immersedZONE ACTIVmES AND SEA LEVEL RISE I (Envi- ronment and Policy

Menefee, Samuel Pyeatt

1991-01-01T23:59:59.000Z

153

New Pilot Study on Sea Level Rise Offers Approach That Can Help...  

Broader source: Energy.gov (indexed) [DOE]

Pilot Study on Sea Level Rise Offers Approach That Can Help Communities Assess Possible Impact of Sea Level Rise on Energy Assets New Pilot Study on Sea Level Rise Offers Approach...

154

Acceleration of the contribution of the Greenland and Antarctic ice sheets to sea level rise  

E-Print Network [OSTI]

make a large sea?level rise contribu- tion, Geophys. Res.and Antarctic ice sheets to sea level rise E. Rignot, 1,2 I.ice sheets to sea level rise, Geophys. Res. Lett. , 38,

Rignot, E.; Velicogna, I.; van den Broeke, M. R; Monaghan, A.; Lenaerts, J. T. M

2011-01-01T23:59:59.000Z

155

The Rise of Egypt: New Beginnings or Same Old Story  

E-Print Network [OSTI]

The Rise of Egypt: New Beginnings or Same Old Story Monday March 28th - 2011 Course # 846A, Tuition dramatic than the change in government in Egypt. What does this mean for the workers of Egypt in this transition? Will the revolution in Egypt take the path of the failed revolutions in Iran or are we witnessing

Thompson, Michael

156

Analysis of Plume Rise Data from Five TVA Steam Plants  

Science Journals Connector (OSTI)

A large data set containing the measurements of the rise of plumes emitted by five TVA steam plants was examined. Particular attention was paid to the problem of the merging of the plumes emitted by adjacent stacks and to the role played by the ...

Domenico Anfossi

1985-11-01T23:59:59.000Z

157

Computational analysis of temperature rise phenomena in electric induction motors  

E-Print Network [OSTI]

Computational analysis of temperature rise phenomena in electric induction motors Ying Huai Institute, University of Southern Denmark, Grundvigs Alle 150, Sonderborg, DK-6400, Denmark c Danfoss Drives A/S, Denmark Received 12 October 2002; accepted 20 December 2002 Abstract In developing electric

Melnik, Roderick

158

SC-RISE LECTURE SERIES BRIGHT HORIZONS IN SOLAR ENERGY  

E-Print Network [OSTI]

are being developed including biomass, geothermal, hydropower, ocean thermal energy conversion, solar the role energy storage can play. Many complex environmental factors must also be fully addressed earlySC-RISE LECTURE SERIES BRIGHT HORIZONS IN SOLAR ENERGY Sustainable Energy Opportunities, Options

159

Manganese-oxidizing photosynthesis before the rise of cyanobacteria  

E-Print Network [OSTI]

Manganese-oxidizing photosynthesis before the rise of cyanobacteria Jena E. Johnsona,1 , Samuel M) The emergence of oxygen-producing (oxygenic) photosynthesis fundamentally transformed our planet; however biological innovation-- the evolution of oxygenic photosynthesis (3, 4). Several bio- chemical attributes

Fischer, Woodward

160

Why Do the Relativistic Masses and Momenta of Faster-than-Light Particles Decrease as their Speeds Increase?  

E-Print Network [OSTI]

It has recently been shown within a formal axiomatic framework using a definition of four-momentum based on the St\\"uckelberg-Feynman-Sudarshan-Recami "switching principle" that Einstein's relativistic dynamics is logically consistent with the existence of interacting faster-than-light inertial particles. Our results here show, using only basic natural assumptions on dynamics, that this definition is the only possible way to get a consistent theory of such particles moving within the geometry of Minkowskian spacetime. We present a strictly formal proof from a streamlined axiom system that given any slow or fast inertial particle, all inertial observers agree on the value of $\\mathsf{m}\\cdot \\sqrt{|1-v^2|}$, where $\\mathsf{m}$ is the particle's relativistic mass and $v$ its speed. This confirms formally the widely held belief that the relativistic mass and momentum of a positive-mass faster-than-light particle must decrease as its speed increases.

Judit X. Madarász; Mike Stannett; Gergely Székely

2013-09-15T23:59:59.000Z

Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

Leverage vs. Feedback: Which Effect Drives the Oil Market? Sofiane Aboura  

E-Print Network [OSTI]

on the WTI crude oil spot price. An increase in the volatility subsequent to an increase in the oil price (i- and fund-managers. Keywords: WTI, Crude Oil Price, Implied Volatility, Leverage Effect, Feedback Effect. JEL Codes: C4, G1, Q4. 1 Introduction The rise of the US benchmark oil West Texas Intermediate (WTI

Paris-Sud XI, Université de

162

SEA LEVEL RISE, COASTAL RISK, ADAPTATION OPTIONS TUESDAY, FEBRUARY 27, 2014  

E-Print Network [OSTI]

SEA LEVEL RISE, COASTAL RISK, ADAPTATION OPTIONS TUESDAY, FEBRUARY 27, 2014 For More Information@odu.edu "Sea Level Rise, Coastal Risk, and Adaptation Options" "Looking at what we know about sea level rise will be explored. A special look will be taken at the Philippines and its situation with sea level rise." Skip

163

COUNTING DESCENTS, RISES, AND LEVELS, WITH PRESCRIBED FIRST ELEMENT, IN WORDS  

E-Print Network [OSTI]

COUNTING DESCENTS, RISES, AND LEVELS, WITH PRESCRIBED FIRST ELEMENT, IN WORDS Sergey Kitaev1 the distribution of descents, levels, and rises according to whether the first letter of the descent, rise 0654060 1 #12;2 COUNTING DESCENTS, RISES, AND LEVELS, WITH PRESCRIBED FIRST ELEMENT, IN WORDS Subsequently

Kitaev, Sergey

164

Mutational Analysis of the Wilms' Tumor (WTI) Gene  

Science Journals Connector (OSTI)

Mutations of the Wilms’ tumor (WT1) gene have been shown to underlie a proportion of cases of Wilms’ tumor, an embryonal kidney cancer occurring mainly in childhood. The WTl gene comprtses ten exons spanning a...

Linda King-Underwood; Kathy Pritchard-Jones

1996-01-01T23:59:59.000Z

165

Implications of changing correlations between WTI and other commoditie...  

Gasoline and Diesel Fuel Update (EIA)

if the level of correlation is different from quarter to quarter. A two tailed test of the difference between two correlations drawn from a sample is used to check if the...

166

MEAN TEMPERATURE RISE IN A TARGET Keith Symon LS-99  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

KS (7 -24-87) KS (7 -24-87) MEAN TEMPERATURE RISE IN A TARGET Keith Symon LS-99 July 1987 The equation which determines the equilibrium temperature distribution in a cylindrically symmetrical target, if we deposit an average power J(r) inside radius r, is ) = dT J(r -2'ITrtK Or' where K is the thermal conductivity and t is the length of the target. The temperature is then T = T - 1 J J(r)dr o 2'ITKt 0 r If we deposit power uniformly in a cylinder of radius a, then where J o is the total T J 0 r2 I a 2 , r .;; a , J (r) = J o r ) a, power del i vered. The temperature is J r2 T - 0 0 2 , r .;; a, 4'ITda = T - J o (1 + 2 tn ria), r ) a. 0 4'ITKt then If the target boundary at r = b is held at a temperature Tb' then the temperature rise at the center is (1) (2 ) (3)

167

Temperature rise and safety considerations for radiation force ultrasound imaging  

Science Journals Connector (OSTI)

Current models for estimating temperature increase during ultrasound exposure calculate the steady?state rise using time?averaged acoustic output as the worst case for safety consideration. While valid for the typically very short (microsecond) pulses used by conventional diagnostic techniques this analysis does not necessarily correspond to a worst case scenario for the longer pulses or pulse bursts used by a new method radiation force imaging. Radiation force imaging employing ultrasound pulse durations up to hundreds of milliseconds produces and detects motion in solid tissue or acoustic streaming in fluids via a high intensity beam. Models that calculate the transient temperature rise from these pulses are developed for both the bone at focus and soft tissue cases. Based on accepted time–temperature dose criteria it is shown that for pulse lengths and intensities utilized by this technique temperature may increase to levels that raise safety concerns for bone at the focus of the ultrasound beam. Also the impact on this modality of the current U.S. Food and Drug Administration output limits for diagnostic ultrasound devices is discussed.

Bruce A. Herman; Gerald R. Harris

2002-01-01T23:59:59.000Z

168

Questions Rise about Seeding For Ocean C02 Sequestration  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

X-ray Method Shows How Frog Embryos Could Help Thwart Disease X-ray Method Shows How Frog Embryos Could Help Thwart Disease Nanocrystals Grow from Liquid Interface Eleventh Arthur H. Compton Award Announced Borland Awarded ACFA-IPAC'13 Prize for Accelerator Science President Obama at the Advanced Photon Source APS News Archives: 2012 | 2011 | 2010 | 2009 2008 | 2007 | 2006 | 2005 2004 | 2003 | 2002 | 2001 2000 Subscribe to APS News rss feed Questions Rise about Seeding For Ocean C02 Sequestration JUNE 12, 2013 Bookmark and Share X-ray fluorescence micrographs of silicon (Si) and iron (Fe) content in the siliceous phytoplankton specimen Corethron. The number in the lower left corner of each image is the maximum elemental content (ÎĽg cm-2) represented by white (elemental content scales linearly, with black as zero). From E.D. Ingall et al., Nat. Comm. 4, Article number: 1981 (10 June

169

3D printing rises to the occasion | ornl.gov  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Features Features 2014 2013 2012 2011 2010 News Home | ORNL | News | Features | 2013 SHARE 3D printing rises to the occasion ORNL group shows how it's done, one layer at a time A perforated metal box produced by an Arcam 3D printer. This detailed A perforated metal box produced by an Arcam 3D printer. This detailed "calibration" part illustrates some of the versatility of 3D printing. Photo: Jason Richards (hi-res image) Things have come a long way since the mid-1980s when 3D Systems cofounder Chuck Hull worked out the technology to print objects in three dimensions, one very thin layer at a time. Hull called his new technology "stereolithography." In it, a guided beam of ultraviolet light is focused on a vat of liquid polymer, solidifying areas where it hits. When one layer is complete, the

170

Cancer theranostics: the rise of targeted magnetic nanoparticles  

Science Journals Connector (OSTI)

Interest in utilizing magnetic nanoparticles (MNP) for biomedical applications has increased considerably over the past two decades. This excitement has been driven in large part by the success of \\{MNPs\\} as contrast agents in magnetic resonance imaging. The recent investigative trend with respect to cancer has continued down a diagnostic path, but has also turned toward concurrent therapy, giving rise to the distinction of \\{MNPs\\} as potential “theranostics”. Here we review both the key technical principles of \\{MNPs\\} and ongoing advancement toward a cancer theranostic MNP. Recent progress in diagnostics, hyperthermia treatments, and drug delivery are all considered. We conclude by identifying current barriers to clinical translation of \\{MNPs\\} and offer considerations for their future development.

Adam J. Cole; Victor C. Yang; Allan E. David

2011-01-01T23:59:59.000Z

171

Rising Jet-Inflated Bubbles in Clusters of Galaxies  

E-Print Network [OSTI]

We conduct three-dimensional axisymmetric hydrodynamical numerical simulations of bubble evolution in clusters of galaxies. We inflate bubbles using slow, massive jets with a wide opening angle, and follow their evolution as they rise through the intra-cluster medium (ICM). We find that these jet-inflated bubbles are quite stable, and can reach large distances in the cluster while still maintaining their basic structure. The stability of the jet-inflated bubble comes mainly from the dense shell that forms around it during it's inflation stage, and from the outward momentum of the bubble and the shell. On the contrary, bubbles that are inserted by hand onto the grid and not inflated by a jet, i.e., an artificial bubble, lack these stabilizing factors, therefore, they are rapidly destroyed. The stability of the jet-inflated bubble removes the demand for stabilizing magnetic fields in the bubble.

Sternberg, Assaf

2008-01-01T23:59:59.000Z

172

Rising Jet-Inflated Bubbles in Clusters of Galaxies  

E-Print Network [OSTI]

We conduct two-dimensional axisymmetric (referred to as 2.5D) hydrodynamical numerical simulations of bubble evolution in clusters of galaxies. We inflate bubbles using slow, massive jets with a wide opening angle, and follow their evolution as they rise through the intra-cluster medium (ICM). We find that these jet-inflated bubbles are quite stable, and can reach large distances in the cluster while still maintaining their basic structure. The stability of the jet-inflated bubble comes mainly from the dense shell that forms around it during it's inflation stage, and from the outward momentum of the bubble and the shell. On the contrary, bubbles that are inserted by hand onto the grid and not inflated by a jet, i.e., an artificial bubble, lack these stabilizing factors, therefore, they are rapidly destroyed. The stability of the jet-inflated bubble removes the demand for stabilizing magnetic fields in the bubble.

Assaf Sternberg; Noam Soker

2008-05-15T23:59:59.000Z

173

Fact #735: July 9, 2012 U.S. Petroleum Exports Are on the Rise...  

Broader source: Energy.gov (indexed) [DOE]

5: July 9, 2012 U.S. Petroleum Exports Are on the Rise Fact 735: July 9, 2012 U.S. Petroleum Exports Are on the Rise The amount of petroleum that the U.S. exports is small in...

174

Contact and temperature rise of thermal flying height control sliders in hard disk drives  

Science Journals Connector (OSTI)

Contact and interfacial temperature rise upon slider-disk contact in hard disk drives is investigated using thermal flying height control (TFC) sliders. To achieve ... increasing bias. The temperature rise during...

Liane Matthes; Uwe Boettcher; Bernhard Knigge…

2012-09-01T23:59:59.000Z

175

U.S. Solar Manufacturing Rising on the Horizon | Department of...  

Energy Savers [EERE]

Solar Manufacturing Rising on the Horizon U.S. Solar Manufacturing Rising on the Horizon January 29, 2015 - 2:35pm Addthis Solar demand in the U.S. is growing, and U.S. solar...

176

Sun Rises on Tribal Energy Future in Nevada | Department of Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Sun Rises on Tribal Energy Future in Nevada Sun Rises on Tribal Energy Future in Nevada March 24, 2014 - 3:04pm Addthis 1 of 4 On March 21, 2014, tribal leaders and community...

177

Evolution of the Galapagos Rise and the Bauer Microplate: implications for the Nazca plate  

E-Print Network [OSTI]

system between Pacific-Farallon spreading and the current East Pacific Rise (EPR) system. First order age/depth relationships for this area indicate that the Galapagos Rise, the most prominent extinct spreading system within the Nazca plate, accommodated...

Wright, Jennifer Catherine McGuire

2006-04-12T23:59:59.000Z

178

Effect of Sea Level Rise on Energy Infrastructure in Four Major...  

Broader source: Energy.gov (indexed) [DOE]

Effect of Sea Level Rise on Energy Infrastructure in Four Major Metropolitan Areas Effect of Sea Level Rise on Energy Infrastructure in Four Major Metropolitan Areas The Office of...

179

E-Print Network 3.0 - accelerated sea-level rise Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

sea-level rise Search Powered by Explorit Topic List Advanced Search Sample search results for: accelerated sea-level rise Page: << < 1 2 3 4 5 > >> 1 The EGU General Assembly 2009...

180

Fact #652: December 6, 2010 U.S. Crude Oil Production Rises ...  

Energy Savers [EERE]

2: December 6, 2010 U.S. Crude Oil Production Rises Fact 652: December 6, 2010 U.S. Crude Oil Production Rises The production of crude oil in the U.S., including lease...

Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

Earth'sFuture Sea level rise and its coastal impacts  

E-Print Network [OSTI]

Earth'sFuture Sea level rise and its coastal impacts Anny Cazenave1 and Gonéri Le Cozannet2 1LEGOS and land ice melt in turn are causing sea level to rise. Sea level rise and its impacts on coastal zones and public. In this review paper, we summarize the most up-to-date knowledge about sea level rise and its

Paris-Sud XI, Université de

182

Final Report for Sea-level Rise Response Modeling for San Francisco Bay Estuary Tidal  

E-Print Network [OSTI]

i Final Report for Sea-level Rise Response Modeling for San Francisco Bay Estuary Tidal Marshes Refuge in northern San Francisco Bay, California. #12;iii Final Report for Sea-level Rise Response)................................................................... 7 Sea-level rise scenario model inputs

Fleskes, Joe

183

Rapid sea level rise along the Antarctic margins driven by increased glacial1 Supplementary material4  

E-Print Network [OSTI]

Rapid sea level rise along the Antarctic margins driven by increased glacial1 discharge2 3 of the signal of anomalously rapid sea level rise in the41 Antarctic subpolar seas at the core of this study.42, the Antarctic coastal sea level rise signal is significantly different from47 zero with 95% confidence

Naveira Garabato, Alberto

184

Assessment of Inundation Risk from Sea Level Rise and Storm Surge in Northeastern Coastal National Parks  

E-Print Network [OSTI]

Assessment of Inundation Risk from Sea Level Rise and Storm Surge in Northeastern Coastal National of inundation risk from sea level rise and storm surge in northeastern coastal national parks. Journal of Coastal Research, 00(0), 000­000. Coconut Creek (Florida), ISSN 0749-0208. Sea level rise and an increase

Wang, Y.Q. "Yeqiao"

185

Abrupt Climate Change linked to Sea-level Rise from Freshwater  

E-Print Network [OSTI]

Abrupt Climate Change linked to Sea-level Rise from Freshwater Outbursts affecting the THC Matt-sheet decay, sea-level rise and abrupt climate change · Torbjorn E. Tornqvist, Marc P. Hijma, 2012. Reduced) Flesche Kleiven, et al., 2008. #12;Overview · Holocene sea level rise · Tornqvist and Hijima ­ Lake

Fountain, Andrew G.

186

Does sea-level rise have an impact on saltwater intrusion? Sun Woo Chang a  

E-Print Network [OSTI]

Does sea-level rise have an impact on saltwater intrusion? Sun Woo Chang a , T. Prabhakar Clement a 22 June 2011 Keywords: Saltwater intrusion Sea-level rise Coastal aquifer Climate change Confined, the adverse intrusion effects induced by sea-level rise. A detailed numerical study using the MODFLOW

Clement, Prabhakar

187

Spatial variability of sea level rise due to water impoundment behind dams  

E-Print Network [OSTI]

Click Here for Full Article Spatial variability of sea level rise due to water impoundment behind global sea level by 30.0 mm and decreasing the rate of sea level rise. The load from impounded water change on sea level rise sources, which include thermal expansion of seawater and the melting of glaciers

Conrad, Clint

188

Svalbard glacier elevation changes and contribution to sea level rise Christopher Nuth,1  

E-Print Network [OSTI]

Svalbard glacier elevation changes and contribution to sea level rise Christopher Nuth,1 Geir contribution to global sea level rise of 0.026 mm yrĂ?1 sea level equivalent. Citation: Nuth, C., G. Moholdt, J level rise, J. Geophys. Res., 115, F01008, doi:10.1029/2008JF001223. 1. Introduction [2] The most recent

Kääb, Andreas

189

Infilling and flooding of the Mekong River incised valley during deglacial sea-level rise  

E-Print Network [OSTI]

Infilling and flooding of the Mekong River incised valley during deglacial sea-level rise Rik is related with the low shelf gradient and a strong acceleration of the East Asian sea-level rise from 34 depositional systems change into estuaries and eventually drown when sea-level rise overtakes the sediment

Wetzel, Andreas

190

Effective sea-level rise and deltas: Causes of change and human dimension implications  

E-Print Network [OSTI]

Effective sea-level rise and deltas: Causes of change and human dimension implications Jason P January 2006 Abstract An assessment is made of contemporary effective sea-level rise (ESLR) for a sample of eustatic sea-level rise, the natural gross rate of fluvial sediment deposition and subsidence

New Hampshire, University of

191

ENUMERATION OF PARTITIONS BY RISES, LEVELS AND DESCENTS Toufik Mansour and Augustine O. Munagi  

E-Print Network [OSTI]

ENUMERATION OF PARTITIONS BY RISES, LEVELS AND DESCENTS Toufik Mansour and Augustine O. Munagi of integers, we study this statistic among the set partitions, as well as the numbers of rises and levels. We the statistics of numbers of rises, levels and descents among set partitions expressed as canonical sequences

Breuer, Florian

192

Adaptive Management of Migratory Birds Under Sea Level Rise Samuel Nicol  

E-Print Network [OSTI]

Adaptive Management of Migratory Birds Under Sea Level Rise Samuel Nicol CSIRO Ecosystem Sciences the East Asian-Australasian flyway given uncertainty about the rate of sea level rise. The non-Australasian (EAA) fly- way given uncertainty about the rate of sea level rise and its effect on shorebird

Paris-Sud XI, Université de

193

Coastal Inundation due to Tide, Surge, Waves, and Sea Level Rise at Naval Station Norfolk  

E-Print Network [OSTI]

Coastal Inundation due to Tide, Surge, Waves, and Sea Level Rise at Naval Station Norfolk Honghai of future sea level rise (SLR) scenarios and to evaluate the potential coastal inundation at Naval Station and sea level rise threats to coastal residents and coastal military facilities, the US Strategic

US Army Corps of Engineers

194

RISES, LEVELS, DROPS AND "+" SIGNS IN COMPOSITIONS: EXTENSIONS OF A PAPER BY  

E-Print Network [OSTI]

RISES, LEVELS, DROPS AND "+" SIGNS IN COMPOSITIONS: EXTENSIONS OF A PAPER BY ALLADI AND HOGGATT S, levels (a summand followed by itself), rises (a summand followed by a larger one), and drops (a summand of levels, rises and drops for compositions, as well as interesting connections between these quantities

Heubach, Silvia

195

Meteorologically driven trends in sea level rise Alexander S. Kolker1  

E-Print Network [OSTI]

Meteorologically driven trends in sea level rise Alexander S. Kolker1 and Sultan Hameed2 Received] Determining the rate of global sea level rise (GSLR) during the past century is critical to understanding a suite of coastal oceanographic processes. These findings reduce variability in regional sea level rise

Hameed, Sultan

196

Coastal flood damage and adaptation costs under 21st century sea-level rise  

E-Print Network [OSTI]

Coastal flood damage and adaptation costs under 21st century sea-level rise Jochen Hinkela,1st century sea-level rise are assessed on a global scale taking into account a wide range- ment and sea-level rise. Uncertainty in global mean and regional sea level was derived from four

Marzeion, Ben

197

Anthropogenic forcing dominates sea level rise since 1850 S. Jevrejeva,1  

E-Print Network [OSTI]

Anthropogenic forcing dominates sea level rise since 1850 S. Jevrejeva,1 A. Grinsted,2 and J. C October 2009. [1] The rate of sea level rise and its causes are topics of active debate. Here we use 200 years sea level rise is mostly associated with anthropogenic factors. Only 4 ± 1.5 cm (25

Binford, Michael W.

198

Sea level rise implications on shoreline changes: expectations from a retrospective analysis  

E-Print Network [OSTI]

Sea level rise implications on shoreline changes: expectations from a retrospective analysis Gonéri de Recherche et de Formation en Calcul Scientifique (Cerfacs) Sea level rise is a major consequence level rise is up to 3 times the global mean rate (estimated as 3.5 mm per year since the early 1990s

Paris-Sud XI, Université de

199

Estimating the economic cost of sea-level rise Masahiro Sugiyama  

E-Print Network [OSTI]

Estimating the economic cost of sea-level rise by Masahiro Sugiyama Bachelor of Science in Earth To improve the estimate of economic costs of future sea-level rise associated with global climate change, the thesis generalizes the sea-level rise cost function originally proposed by Fankhauser, and applies

200

PALeo-constraints on SEA-level rise (PALSEA) -a PAGES/IMAGES working group  

E-Print Network [OSTI]

PALeo-constraints on SEA-level rise (PALSEA) - a PAGES/IMAGES working group Coordinators: Mark for the reduction in ice sheets and subsequent rise in sea level over the next century are highly uncertain rise. Interglacial sea levels constrain the global sensitivity of sea-level to radiative forcing. Well

Siddall, Mark

Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

ELSEVIER Marine Geology 124 (1995) 137-159 A sea-level rise curve  

E-Print Network [OSTI]

ELSEVIER Marine Geology 124 (1995) 137-159 A sea-level rise curve Koren R. Nydick, Alison B. from emissions of greenhouse gases. 1. Introduction 1.1. Climate and sea-level rise Global sea level has been of peat deposits in salt marshes provide insight into the rates of relative sea-level rise (RSLR

Royer, Dana

202

Thermosteric sea level rise, 19552003 J. I. Antonov, S. Levitus, and T. P. Boyer  

E-Print Network [OSTI]

Thermosteric sea level rise, 1955­­2003 J. I. Antonov, S. Levitus, and T. P. Boyer National/year to global sea level rise. About half of this thermosteric trend is due to warming of the Atlantic Ocean), Thermosteric sea level rise, 1955­2003, Geophys. Res. Lett., 32, L12602, doi:10.1029/2005GL023112. 1

203

Single bubble rising dynamics for moderate Reynolds number using Lattice Boltzmann Method  

E-Print Network [OSTI]

Single bubble rising dynamics for moderate Reynolds number using Lattice Boltzmann Method Luz Amaya November 2009 Accepted 4 March 2010 Available online 18 March 2010 Keywords: Bubble rising Lattice Boltzmann Method Large viscosity ratio a b s t r a c t Dynamics of a single rising gas bubble is studied

Frey, Pascal

204

Faster, cheaper, better  

Science Journals Connector (OSTI)

Following their non-selection for the Halley rendezvous mission’ solar sails’ fell by the wayside, but in the early 1990s there was a brief resurgence of interest, and the deployment of a small sail in space w...

2009-01-01T23:59:59.000Z

205

Solar Smarter Faster  

SciTech Connect (OSTI)

As part of the SunShot Initiative, U.S. Department of Energy Secretary Steven Chu announced on April 15th the selection of up to $112.5 million over five years for funding to support the development of advanced solar photovoltaic (PV)-related manufacturing processes throughout the United States. The effort is led by Sematech, with a proven track record in breathing life back into the US semiconduster industry, and in partnership with CNSE, The College of Nanoscale Science and Engineering, who supplies world class R&D experts and facilities.

Armbrust, Dan; Haldar, Pradeep; Kaloyeros, Alain; Holladay, Dan

2011-01-01T23:59:59.000Z

206

World oil demand’s shift toward faster growing and less price-responsive products and regions  

Science Journals Connector (OSTI)

Using data for 1971–2008, we estimate the effects of changes in price and income on world oil demand, disaggregated by product – transport oil, fuel oil (residual and heating oil), and other oil – for six groups of countries. Most of the demand reductions since 1973–74 were due to fuel-switching away from fuel oil, especially in the OECD; in addition, the collapse of the Former Soviet Union (FSU) reduced their oil consumption substantially. Demand for transport and other oil was much less price-responsive, and has grown almost as rapidly as income, especially outside the OECD and FSU. World oil demand has shifted toward products and regions that are faster growing and less price-responsive. In contrast to projections to 2030 of declining per-capita demand for the world as a whole – by the U.S. Department of Energy (DOE), International Energy Agency (IEA) and OPEC – we project modest growth. Our projections for total world demand in 2030 are at least 20% higher than projections by those three institutions, using similar assumptions about income growth and oil prices, because we project rest-of-world growth that is consistent with historical patterns, in contrast to the dramatic slowdowns which they project.

Joyce M. Dargay; Dermot Gately

2010-01-01T23:59:59.000Z

207

A New Model to Construct Ice Stream Surface Elevation Profiles and Calculate Contributions to Sea-Level Rise  

E-Print Network [OSTI]

to 21st-Century Sea-Level Rise. Science, 321, 1340; DOI:in the Face of Sea-Level Rise: A Hybrid Modeling Approachof ice sheets to sea-level rise. Bibliography Alcamo, J. et

Adachi, Yosuke

2012-01-01T23:59:59.000Z

208

A Comparative Study of Passive versus Dynamic Sea-Level Rise Inundation Models for the Island of Kauai  

E-Print Network [OSTI]

Consequences of sea-level rise and coastal erosion,Cultivated Crops Sea-level rise (m) Table 16 Waimea landCouncil, 2012, Sea-Level Rise for the Coasts of California,

Bezore, Rhiannon Victoria Ann

2014-01-01T23:59:59.000Z

209

Shoreface Morphodynamics, Back Beach Variability, and Implications of Future Sea-Level Rise for California's Sandy Shorelines  

E-Print Network [OSTI]

change scenarios and sea-level rise estimates for thePilkey, O.H. (2004) Sea-level rise and shoreline retreat:and multi-decadal sea-level rise, Nature 453:1090-1093.

Harden, Erika Lynne

2012-01-01T23:59:59.000Z

210

Science Behind the Fiction: The Dark Knight Rises [2012] | Argonne National  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

It makes for good drama, but the "fusion reactor" bomb (above) in The Dark Knight Rises fizzles in the face of physics. It makes for good drama, but the "fusion reactor" bomb (above) in The Dark Knight Rises fizzles in the face of physics. It makes for good drama, but the "fusion reactor" bomb (above) in The Dark Knight Rises fizzles in the face of physics. Science Behind the Fiction: The Dark Knight Rises [2012] Science Behind the Fiction: The Dark Knight Rises [2012] By Louise Lerner * September 13, 2013 Tweet EmailPrint Science Behind the Fiction critiques the science portrayed in popular films and literature. In this issue, Argonne nuclear scientist Keith Bradley debunks the "fusion" bomb in The Dark Knight Rises, the final installment in Christopher Nolan's Batman trilogy. "Theatricality and deception are powerful agents to the uninitiated,"

211

Contribution of Alaskan glaciers to sea-level rise derived from satellite imagery  

E-Print Network [OSTI]

1 Contribution of Alaskan glaciers to sea-level rise derived from satellite imagery BERTHIER E.1 level rise derived from satellite imagery. Nature Geoscience, 3(2), 92-95, doi: 10.1038/ngeo737, 2010 glaciers lost 41.9 ± 8.6 km3 yr-1 of water, and contributed 0.12 ± 0.02mm yr-1 to sea-level rise, 34% less

Paris-Sud XI, Université de

212

Rapid Rise of Sea Level 19,000 Years Ago and Its Global Implications  

E-Print Network [OSTI]

Rapid Rise of Sea Level 19,000 Years Ago and Its Global Implications Peter U. Clark,1* A. Marshall of an abrupt rise in sea level (meltwater pulse) at 19,000 years before the present (B.P.). Climate records level rise of 10 to 15 m at 19,000 years B.P. (1) (Fig. 1). (Unless otherwise indicated, all ages

Kurapov, Alexander

213

Mangroves, Mudbanks and Seawalls: Political Ecology of Adaptation to Sea Level Rise in Suriname.  

E-Print Network [OSTI]

??This study seeks to understand how global discourses of sea level rise (SLR) and mangrove ecology influence national climate change adaptation policy to reduce coastal… (more)

Nijbroek, Ravic

2012-01-01T23:59:59.000Z

214

Ground water of Yucca Mountain: How high can it rise?; Final report  

SciTech Connect (OSTI)

This report describes the geology, hydrology, and possible rise of the water tables at Yucca Mountain. The possibilities of rainfall and earthquakes causing flooding is discussed.

NONE

1992-12-31T23:59:59.000Z

215

Abstract 476: Mammary tumors in lipocalin-2 deficient MMTV-PyVT mice grow faster but show decreased metastasis to lung  

Science Journals Connector (OSTI)

...Mammary tumors in lipocalin-2 deficient MMTV-PyVT mice grow faster but show decreased metastasis to lung Heiman Chow 1 Pengcheng Fan 1 Aimin Xu 1 Wen Laun Wendy Hsiao 2 Yu Wang 1 1Department of Pharmacology and Pharmacy, The University of Hong Kong...

Heiman Chow; Pengcheng Fan; Aimin Xu; Wen Laun Wendy Hsiao; Yu Wang

2011-01-10T23:59:59.000Z

216

Discrete Mathematics and Theoretical Computer Science DMTCS vol. 10:3, 2008, 122 Counting descents, rises, and levels, with  

E-Print Network [OSTI]

, rises, and levels, with prescribed first element, in words Sergey Kitaev1 and Toufik Mansour2 and Jeff of descents, levels, and rises according to whether the first letter of the descent, rise, or level lies in Ni some of the results by Burstein and Mansour. Keywords: descent, level, rise, set partition, word

Paris-Sud XI, Université de

217

Reconciling multidecadal land-sea global temperature with rising CO2  

E-Print Network [OSTI]

Reconciling multidecadal land-sea global temperature with rising CO2 Vaughan Pratt Stanford CO2 1 / 29 #12;Goal Additional insight into 1 Similarity of the 1860-1880 & 1910-1940 rises to 1970-2000. 2 The recent pause (2001-2013). 3 No sign of 3 C per doubling of CO2. Simple reasoning (no opaque

Pratt, Vaughan

218

Reconciling multidecadal land-sea global temperature with rising CO2  

E-Print Network [OSTI]

Reconciling multidecadal land-sea global temperature with rising CO2 Vaughan Pratt Stanford CO2 1 / 35 #12;Goal Additional insight into 1 Similarity of the 1860-1880 & 1910-1940 rises to 1970-2000. 2 The recent pause 3 No sign of 3 C per doubling of CO2. Some applicable audiences: Average reader

Pratt, Vaughan

219

TECHNICAL PAPER Contact and temperature rise of thermal flying height control  

E-Print Network [OSTI]

TECHNICAL PAPER Contact and temperature rise of thermal flying height control sliders in hard disk the flying height in hard disk drives (HDDs) has decreased to only a few nanometers, intermittent contacts Abstract Contact and interfacial temperature rise upon slider-disk contact in hard disk drives

Fainman, Yeshaiahu

220

Submeter bathymetric mapping of volcanic and hydrothermal features on the East Pacific Rise crest at 9500  

E-Print Network [OSTI]

of bathymetric changes associated with active volcanic, hydrothermal and tectonic processes. Components: 15Submeter bathymetric mapping of volcanic and hydrothermal features on the East Pacific Rise crest to produce submeter resolution bathymetric maps of five hydrothermal vent areas at the East Pacific Rise (EPR

Whitcomb, Louis L.

Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

Modelling bubble rise and interaction with a glass Rogerio Manica1*  

E-Print Network [OSTI]

Modelling bubble rise and interaction with a glass surface Rogerio Manica1* , Maurice H. W. Hendrix A theoretical model has been developed to analyse experimental data of millimetre- size bubbles rising under for bubble deformations on the micrometre scale in the interaction zone with quantitative precision

Chan, Derek Y C

222

The role of early fundamental frequency rises and elbows in French word segmentation  

Science Journals Connector (OSTI)

The study examined intonational cues to word beginnings in French. French has an optional ''early rise'' in fundamental frequency (F"0) starting at the beginning of a content word. The role of this rise in segmentation by human listeners had previously ... Keywords: French, Intonation, Prosody, Speech segmentation, Word segmentation

Pauline Welby

2007-01-01T23:59:59.000Z

223

Cycling on the Rise: Public Bicycles and other European Experiences | Open  

Open Energy Info (EERE)

Cycling on the Rise: Public Bicycles and other European Experiences Cycling on the Rise: Public Bicycles and other European Experiences Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Cycling on the Rise: Public Bicycles and other European Experiences Agency/Company /Organization: SpiCycles Focus Area: Transportation Resource Type: Publications, Lessons learned/best practices User Interface: Website Website: spicycles.velo.info/Portals/0/Deliverables/SpicyclesFinal_Booklet_smal Cost: Free Cycling on the Rise: Public Bicycles and other European Experiences Screenshot References: Cycling on the Rise: Public Bicycles and other European Experiences[1] "When the Spicycles project was launched in 2006, cycling was not the "hot" mode of transport that it has become today. As project partners, we wanted to gather experience related to specific areas of cycling policy.

224

New Pilot Study on Sea Level Rise Offers Approach That Can Help Communities Assess Possible Impact of Sea Level Rise on Energy Assets  

Broader source: Energy.gov [DOE]

As part of our commitment to improve the resilience of our electric grid in the face of extreme weather events, OE has released findings of a pilot study that explores the feasibility of assessing the impacts of sea level rise on energy infrastructure. The goal of our study was to develop a method to identify energy facilities exposed to sea level rise (SLR) through 2100 that is flexible and scalable, uses existing and robust data sources, accounts for global and local sea level changes, and can incorporate results from regional studies.

225

Phase change materials for limiting temperature rise in building integrated photovoltaics  

Science Journals Connector (OSTI)

Elevated operating temperatures reduce the solar to electrical conversion efficiency of photovoltaic devices. This paper presents an experimental evaluation of phase change materials for thermal management of photovoltaic devices. Two particular phase change materials were used to moderate the temperature rise of photovoltaics. The thermal performance of different internal fin arrangements for improving bulk PCM thermal conductivity are presented. Using RT25 with internal fins, the temperature rise of the PV/PCM system can be reduced by more than 30 °C when compared with the datum of a single flat aluminium plate during phase change. Phase change materials are shown to be an effective means of limiting temperature rise in photovoltaic devices.

M.J. Huang; P.C. Eames; B. Norton

2006-01-01T23:59:59.000Z

226

Energy Efficiency Standards for New Federal Low-Rise Residential Buildings  

Broader source: Energy.gov (indexed) [DOE]

Standards for New Federal Low-Rise Residential Standards for New Federal Low-Rise Residential Buildings Energy Efficiency Standards for New Federal Low-Rise Residential Buildings October 8, 2013 - 1:57pm Addthis DOE recently updated the requirements for energy efficiency in newly constructed federal buildings. The new rule, 10 CFR 435, Subpart A: Energy Efficiency Standards for New Federal Low-Rise Residential Buildings, applies to residential buildings (one- and two-family dwellings as well as multifamily buildings three stories or less in height) for which design for construction began on or after August 10, 2012. The rule updates the baseline standard in 10 CFR 435, Subpart A to the 2009 IECC. New federal residential buildings are required (effective August 10, 2012) to achieve the 2009 IECC level of energy efficiency or 30% greater

227

Cost-Effective Methods for Accurate Determination of Sea Level Rise Vulnerability: A Solomon Islands Example  

Science Journals Connector (OSTI)

For millions of people living along the coastal fringe, sea level rise is perhaps the greatest threat to livelihoods over the coming century. With the refinement and downscaling of global climate models and increasing availability of airborne-...

Simon Albert; Kirsten Abernethy; Badin Gibbes; Alistair Grinham; Nixon Tooler; Shankar Aswani

2013-10-01T23:59:59.000Z

228

Our winters of discontent: Addressing the problem of rising home-heating costs1  

E-Print Network [OSTI]

by rising fuel prices in international energy markets and the absence of federal and provincial energy: · The cost of motive fuels (gasoline and diesel), electricity, and energy for home space heating will all

Hughes, Larry

229

Swell : a proposition for coastal metropolises in the age of rising seas and distributed centralization  

E-Print Network [OSTI]

Premised upon the certain realities of the rise of urban sprawl, globalized dynamic networks, and sea levels, this thesis seeks to question these forces and mobilize the inherent potentials that lie within their intersections. ...

Dorsey, Talia (Talia H.)

2006-01-01T23:59:59.000Z

230

Asthenospheric flow and asymmetry of the East Pacific Rise, James A. Conder,1  

E-Print Network [OSTI]

Asthenospheric flow and asymmetry of the East Pacific Rise, MELT area James A. Conder,1 Donald W [Evans et al., 1999]. The results of the experi- ment are consistent with a broad zone of melting [MELT

Conder, James

231

Fact #646: October 25, 2010 Prices for Used Vehicles Rise Sharply...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Vehicles Rise Sharply from 2008 to 2010 The collapse of new vehicle sales in 2008 has led to lower sales volumes of new vehicles. Also, consumers and business are holding on to...

232

George Beauchamp and the rise of the electric guitar up to 1939   

E-Print Network [OSTI]

This thesis examines the rise of the electric guitar in the United States – arguably the most iconic and successful musical instrument of the 20th century – and the role of George Beauchamp in its invention and development. ...

Hill, Matthew William

2014-06-27T23:59:59.000Z

233

Ocean Drilling Program (ODP) Leg 207 recently cored sediments on the Demerara Rise at ~9N  

E-Print Network [OSTI]

Rise,north of Suriname and French Guyana, South America,is an ideal drilling target because expanded of Suriname,and is ~220 km wide from the shelf break to the northeastern escarpment. Most of the plateau lies

Bice, Karen L.

234

Effect of Sea Level Rise on Energy Infrastructure in Four Major Metropolitan Areas  

Broader source: Energy.gov [DOE]

The Office of Electricity Delivery and Energy Reliability has released findings of a pilot study that explores the feasibility of assessing the impacts of sea level rise on energy infrastructure....

235

A Single Continuous Function as a Model for Fast Rise Exponential Decay Gamma-Ray Bursts.  

E-Print Network [OSTI]

??A quantitative analysis was performed on a sample of Fast-Rise Exponential-Decay gamma-ray bursts using a continuous fitting function. The data were obtained from the Large… (more)

Logue, Daniel B

2006-01-01T23:59:59.000Z

236

Impact of cladding on mid-rise buildings in the Northridge Earthquake  

E-Print Network [OSTI]

In this thesis, the importance of cladding panels on mid-rise buildings in an earthquake-prone region is investigated. A cladding panel acts as a protective or an insulating layer to control weather infiltration. The ...

Kuo, Chuan-Hua

2009-01-01T23:59:59.000Z

237

Fact #715: February 20, 2012 The Average Age of Light Vehicles Continues to Rise  

Broader source: Energy.gov [DOE]

The average age for cars and light trucks continues to rise as consumers hold onto their vehicles longer. Between 1995 and 2011, the average age for cars increased by 32% from 8.4 years to 11.1...

238

Elemental and isotopic compositions of the hydrothermal sulfide on the East Pacific Rise near 13°N  

Science Journals Connector (OSTI)

The mineralogical, elemental, and isotopic characteristics of a hydrothermal sulfide sample from one dredge station (12°42.30?N, 103°54.48?W, water depth 2655 m) on the East Pacific Rise near 13°N were analyze...

ZhiGang Zeng; DaiGeng Chen; XueBo Yin; XiaoYuan Wang…

2010-02-01T23:59:59.000Z

239

Preliminary global assessment of terrestrial biodiversity consequences of sea level rise mediated by climate change  

E-Print Network [OSTI]

Considerable attention has focused on the climatic effects of global climate change on biodiversity, but few analyses and no broad assessments have evaluated the effects of sea level rise on biodiversity. Taking advantage of new maps of marine...

Menon, Shaily; Soberó n, Jorge; Li, Xingong; Peterson, A. Townsend

2010-02-25T23:59:59.000Z

240

SciTech Connect: Predicting Land-Ice Retreat and Sea-Level Rise...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Conference: Predicting Land-Ice Retreat and Sea-Level Rise with the Community Earth System Model Citation Details In-Document Search Title: Predicting Land-Ice Retreat and...

Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

Energy Performance and Comfort Level in High Rise and Highly Glazed Office Buildings  

E-Print Network [OSTI]

Thermal and visual comfort in buildings play a significant role on occupants' performance but on the other hand achieving energy savings and high comfort levels can be a quite difficult task especially in high rise buildings with highly glazed...

Bayraktar, M.; Perino, M.; Yilmaz, A. Z.

2010-01-01T23:59:59.000Z

242

Crustal low-velocity zone south of Shatsky Rise, northwest Pacific Ocean  

Science Journals Connector (OSTI)

The detailed seismic refraction investigation of the oceanic crust south of Shatsky Rise in the Northwestern Pacific revealed a low velocity zone (LVZ) ... upwelling at the place of now “overdeepened” ocean would...

Gennady I. Anosov; Vladimir V. Argentov; Helios S. Gnibidenko

243

Organ Trade : sea level rise adaptation strategies for the San Francisco Bay Area  

E-Print Network [OSTI]

It is not only coastal conditions, but inland ones, that can inform an approach to and process of wetland adaptation in the face of sea level rise. A particular watershed clip in Alameda County, located in South San Francisco ...

Ungureanu, Cristina

2010-01-01T23:59:59.000Z

244

Effect of Sea Level Rise on Energy Infrastructure in Four Major Metropolitan Areas (September 2014)  

Broader source: Energy.gov [DOE]

The Office of Electricity Delivery and Energy Reliability has released findings of a pilot study that explores the feasibility of assessing the impacts of sea level rise on energy infrastructure. The goal of the study was to develop a method to identify energy facilities exposed to sea level rise (SLR) through 2100 that is flexible and scalable, uses existing and robust data sources, accounts for global and local sea level changes, and can incorporate results from regional studies.

245

20 My of nitrogen fixation during deposition of mid-Cretaceous black shales on the Demerara Rise, equatorial Atlantic Ocean  

E-Print Network [OSTI]

Drilling Pro- gram (ODP) Leg 207 on the Demerara Rise offshore of Surinam is up to 90 m in thickness

Gilli, Adrian

246

Dynamical suppression of sea level rise along the Pacific coast of North America: Indications for imminent acceleration  

E-Print Network [OSTI]

Dynamical suppression of sea level rise along the Pacific coast of North America: Indications changes in global mean sea level (MSL) rise have important practical implications for shoreline and beach occurred after the mid1970s regime shift, can account for the suppression of regional sea level rise along

Bromirski, Peter D.

247

Late Glacial to Preboreal sea-level rise recorded by the previous termRhne deltaic systemnext term  

E-Print Network [OSTI]

Late Glacial to Preboreal sea-level rise recorded by the previous termRhĂ´ne deltaic systemnext term by progradation initiated during the first phase of the Younger Dryas, a period of reduced sea-level rise or stillstand. The delta kept pace with resumed sea-level rise during the Preboreal (which is estimated at about

Paris-Sud XI, Université de

248

Climate scenarios of sea level rise for the northeast Atlantic Ocean: a study including the effects of ocean  

E-Print Network [OSTI]

Climate scenarios of sea level rise for the northeast Atlantic Ocean: a study including the effects. Here we present a set of regional climate scenarios of sea level rise for the northeast Atlantic Ocean best estimate of twenty-first century sea level rise in the northeast Atlantic Ocean, given the current

Drijfhout, Sybren

249

PUBLISHED ONLINE: 26 JULY 2009 | DOI: 10.1038/NGEO587 Constraints on future sea-level rise from past  

E-Print Network [OSTI]

LETTERS PUBLISHED ONLINE: 26 JULY 2009 | DOI: 10.1038/NGEO587 Constraints on future sea-level rise to project sea-level rise in response to warming climates by the end of the century, especially because­24 cm of sea-level rise during the twentieth century, in agreement with the Fourth Assessment Report

Siddall, Mark

250

Shore & Beach Vol. 77, No. 4 Fall 2009 Page 1 ea-level rise (SLR) has received  

E-Print Network [OSTI]

Shore & Beach Vol. 77, No. 4 Fall 2009 Page 1 S ea-level rise (SLR) has received considerable that is typically 50 years, and it Sea level rise and consequences for navigable coastal inlets By Julie D. Rosati.C.Kraus@usace.army.mil ABSTRACT Global sea level is expected to rise over the next 100 years. Changes in sea level will alter

US Army Corps of Engineers

251

19 HASTINGS WEST NORTHWEST J. ENVTL. L. & POL'Y 463 (2013) COMBATING SEA-LEVEL RISE IN SOUTHERN CALIFORNIA  

E-Print Network [OSTI]

19 HASTINGS WEST NORTHWEST J. ENVTL. L. & POL'Y 463 (2013) 1 COMBATING SEA-LEVEL RISE IN SOUTHERN governments will make choices that will shape the region's resilience to sea-level rise. To implement of adaptation actions and sea-level rise itself. This article identifies how local governments can harness legal

Rohs, Remo

252

Bursting the Bubble of Doom and Adapting to Sea Level Rise Randall W. Parkinson, Ph.D., P.G.  

E-Print Network [OSTI]

March 2010 Bursting the Bubble of Doom and Adapting to Sea Level Rise Randall W. Parkinson, Ph of Geological Sciences Florida State University Tallahassee, Florida Introduction Late Holocene sea level rise to adapt to sea level rise or for that matter any of the other elements of climate change. In light

Donoghue, Joseph

253

Gulf Stream's induced sea level rise and variability along the U.S. mid-Atlantic coast  

E-Print Network [OSTI]

Gulf Stream's induced sea level rise and variability along the U.S. mid-Atlantic coast Tal Ezer,1 that the rates of sea level rise (SLR) along the U.S. mid-Atlantic coast have accelerated in recent decades along the coast. The study suggests that regional coastal sea level rise projections due to climate

Ezer,Tal

254

Dynamic response of marshes to perturbations in suspended sediment concentrations and rates of relative sea level rise  

E-Print Network [OSTI]

of relative sea level rise A. D'Alpaos,1 S. M. Mudd,2,3 and L. Carniello4 Received 18 May 2011; revised 5 in suspended sediment concentrations, plant productivity, and the rate of relative sea level rise (RSLR in suspended sediment concentrations and rates of relative sea level rise, J. Geophys. Res., 116, F04020, doi

255

A PRACTICAL APPROACH TO MAPPING EXTREME WAVE INUNDATION: CONSEQUENCES OF SEA-LEVEL RISE AND COASTAL EROSION.  

E-Print Network [OSTI]

A PRACTICAL APPROACH TO MAPPING EXTREME WAVE INUNDATION: CONSEQUENCES OF SEA-LEVEL RISE AND COASTAL and the influence of sea-level rise and coastal erosion. The concept is presented for windward Oahu, Hawai in future inundation levels. INTRODUCTION Sea-level rise of 0.5-1.4 m (Rahmstorf 2007) is expected

Wang, Yuqing

256

Effect of sea-level rise on piping plover (Charadrius melodus) breeding habitat Jennifer R. Seavey a,  

E-Print Network [OSTI]

Effect of sea-level rise on piping plover (Charadrius melodus) breeding habitat Jennifer R. Seavey, threatening many low-lying coastal areas and associated wildlife. We assessed the threat of sea-level rise sys- tems because of their vulnerability to sea-level rise (Farbotko, 2010; Nicholls et al., 2007

McGarigal, Kevin

257

EA-2001: Energy Efficiency Design Standards: New Federal Commercial and Multi-Family High-Rise Residential Buildings and New Federal Low-Rise Residential Buildings  

Broader source: Energy.gov [DOE]

The U.S. Department of Energy (DOE) is publishing this final rule to implement provisions in the Energy Conservation and Production Act (ECPA) that require DOE to update the baseline Federal energy efficiency performance standards for the construction of new Federal commercial and multi-family high-rise residential buildings. This rule updates the baseline Federal commercial standard to the American Society of Heating, Refrigerating, and Air-Conditioning Engineers (ASHRAE) Standard 90.1-2013.

258

90.1 Prototype Building Models Mid-rise Apartment | Building Energy Codes  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Mid-rise Apartment Mid-rise Apartment The ASHRAE Standard 90.1 prototype building models were developed by Pacific Northwest National Laboratory in support of the U.S. Department of Energy's (DOE's) Building Energy Codes Program. These prototype buildings were derived from DOE's Commercial Reference Building Models. This suite of ASHRAE Standard 90.1 prototype buildings covers all the Reference Building types except supermarket, and also adds a new building prototype representing high-rise apartment buildings.The prototype models include 16 building types in 17 climate locations for ASHRAE Standards 90.1-2004, 90.1-2007 and 90.1-2010. This combination leads to a set of 816 building models (in EnergyPlus Version 6.0). Also included is a scorecard for each prototype building. The scorecard is a spreadsheet that summarizes the

259

Experimental Endeavour on a Pillar of Flame: Space Shuttle Rises with  

Broader source: Energy.gov (indexed) [DOE]

Experimental Endeavour on a Pillar of Flame: Space Shuttle Rises Experimental Endeavour on a Pillar of Flame: Space Shuttle Rises with Ambitious Technology Aboard Experimental Endeavour on a Pillar of Flame: Space Shuttle Rises with Ambitious Technology Aboard May 17, 2011 - 5:15pm Addthis Smoke cloud from Endeavour's Final Launge | Photo: NASA, Troy Cryder Smoke cloud from Endeavour's Final Launge | Photo: NASA, Troy Cryder Charles Rousseaux Charles Rousseaux Senior Writer, Office of Science What are the key facts? Space Shuttle Endeavour, which lifted off on its final mission Monday, carrying the Alpha Magnetic Spectrometer (AMS) experiment. In addition to measuring how cosmic rays flow and what they are made of, the AMS will also search for cosmic rays made of a special form of matter known as antimatter. By looking for new particles in space via the AMS, scientists might

260

NAS-NAE National Convocation on "Rising Above the Gathering Storm Two Years  

Broader source: Energy.gov (indexed) [DOE]

NAS-NAE National Convocation on "Rising Above the Gathering Storm NAS-NAE National Convocation on "Rising Above the Gathering Storm Two Years Later: Accelerating Progress toward a Brighter Economic Future" NAS-NAE National Convocation on "Rising Above the Gathering Storm Two Years Later: Accelerating Progress toward a Brighter Economic Future" April 29, 2008 - 11:31am Addthis Remarks As Prepared for Delivery by Secretary Bodman Thank you, Tom for that kind introduction. And I want to commend you, Norm Augustine and Chuck Vest for your continued leadership on these issues. You are powerful voices for urgent and sustained action to preserve this nation's technological preeminence - and our economic competitiveness. It's a pleasure to be here with you all, and with my good friends Margaret and Carlos. It strikes me that we are in the fortunate position of

Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

Fun Fact Friday: U.S. Renewables on the Rise | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Fun Fact Friday: U.S. Renewables on the Rise Fun Fact Friday: U.S. Renewables on the Rise Fun Fact Friday: U.S. Renewables on the Rise November 8, 2013 - 3:00pm Addthis Hydropower is a major source of renewable energy in the United States. | Photo of Wanapum Dam in Washington courtesy of Grant County Public Utility District Hydropower is a major source of renewable energy in the United States. | Photo of Wanapum Dam in Washington courtesy of Grant County Public Utility District Steve Lindenberg Senior Advisor, Renewable Energy Greetings, EERE blog readers! In our inaugural edition of Fun Fact Friday, we compared the ranges of several plug-in hybrid vehicles. Today, we take a quick look at the nation's sources of electricity. In 2012, 12% of our electricity came from U.S. power plants using renewable

262

Rising Solar Energy Science and Technology Co Ltd | Open Energy Information  

Open Energy Info (EERE)

Rising Solar Energy Science and Technology Co Ltd Rising Solar Energy Science and Technology Co Ltd Jump to: navigation, search Name Rising Solar Energy Science and Technology Co Ltd Place Qinhuangdao, Hebei Province, China Zip 66600 Sector Solar Product Chinese solar module laminator manufacturer Coordinates 39.931011°, 119.597221° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":39.931011,"lon":119.597221,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

263

Experimental Endeavour on a Pillar of Flame: Space Shuttle Rises with  

Broader source: Energy.gov (indexed) [DOE]

Experimental Endeavour on a Pillar of Flame: Space Shuttle Rises Experimental Endeavour on a Pillar of Flame: Space Shuttle Rises with Ambitious Technology Aboard Experimental Endeavour on a Pillar of Flame: Space Shuttle Rises with Ambitious Technology Aboard May 17, 2011 - 5:15pm Addthis Smoke cloud from Endeavour's Final Launge | Photo: NASA, Troy Cryder Smoke cloud from Endeavour's Final Launge | Photo: NASA, Troy Cryder Charles Rousseaux Charles Rousseaux Senior Writer, Office of Science What are the key facts? Space Shuttle Endeavour, which lifted off on its final mission Monday, carrying the Alpha Magnetic Spectrometer (AMS) experiment. In addition to measuring how cosmic rays flow and what they are made of, the AMS will also search for cosmic rays made of a special form of matter known as antimatter. By looking for new particles in space via the AMS, scientists might

264

Geothermal Business on the Rise for Kansas Company | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Geothermal Business on the Rise for Kansas Company Geothermal Business on the Rise for Kansas Company Geothermal Business on the Rise for Kansas Company April 16, 2010 - 4:43pm Addthis Paul Lester Communications Specialist, Office of Energy Efficiency and Renewable Energy America's clean energy economy is expanding, and small businesses such as Evans Energy Development of Paola, Kansas, are reaping the benefits as companies and homeowners switch to geothermal energy. Last year, 80 percent of Evans Energy Development's revenue came from installing geothermal loop systems, which cool and heat buildings by using the Earth's stable temperature. Geothermal loop systems consist of pipes buried just below the ground that contain liquid. During winter, the liquid absorbs the Earth's heat and pumps it to a unit located inside the building. In summer, the process

265

Rise Time of the Simulated VERITAS 12 m Davies-Cotton Reflector  

SciTech Connect (OSTI)

The Very Energetic Radiation Imaging Telescope Array System (VERITAS) will utilise Imaging Atmospheric Cherenkov Telescopes (IACTs) based on a Davies-Cotton design with f-number f/1.0 to detect cosmic gamma-rays. Unlike a parabolic reflector, light from the Davies-Cotton does not arrive isochronously at the camera. Here the effect of the telescope geometry on signal rise-time is examined. An almost square-pulse arrival time profile with a rise time of 1.7 ns is found analytically and confirmed through simulation.

White, Richard J. [School of Physics and Astronomy, University of Leeds (United Kingdom)

2005-02-21T23:59:59.000Z

266

China Camp's race against the tides: Predicting tidal marsh survival through comparison of project sea level rise elevations and sediment accretion rates  

E-Print Network [OSTI]

with 55 inches of sea level rise and continued average marshthe Costs of Adapting to Sea Level Rise: A Case Study of San2009. The Impacts of Sea-Level Rise on the California Coast.

Hannah, Whitney; Kuhn, Marlene

2012-01-01T23:59:59.000Z

267

Modeling Tidal Marsh Distribution with Sea-Level Rise: Evaluating the Role of Vegetation, Sediment, and Upland Habitat in Marsh Resiliency  

E-Print Network [OSTI]

and 180 cm/century sea-level rise at mid suspended sedimentCouncil (2012) Sea-level rise for the coasts of California,to projecting future sea-level rise. Science 315: 368–370.

2014-01-01T23:59:59.000Z

268

Evaluating Tidal Marsh Sustainability in the Face of Sea-Level Rise: A Hybrid Modeling Approach Applied to San Francisco Bay  

E-Print Network [OSTI]

wetland losses due to sea-level rise: regional and global2009) The impact of sea level rise on developing countries:Coastal impacts due to sea-level rise. Annu Rev Earth Pl Sc

Kelly, Maggi

2011-01-01T23:59:59.000Z

269

Simplified 1-D Hydrodynamic and Salinity Transport Modeling of the Sacramento–San Joaquin Delta: Sea Level Rise and Water Diversion Effects  

E-Print Network [OSTI]

salinity simulations of sea level rise scenarios. AppendixSan Joaquin Delta: Sea Level Rise and Water Diversiona 1-D model of sea level rise in an estuary must account for

Fleenor, William E.; Bombardelli, Fabian

2013-01-01T23:59:59.000Z

270

The rising cost of warming waters: effects of temperature on the cost of swimming in fishes  

Science Journals Connector (OSTI)

...Global change biology 1001 25 60 14 The rising cost of warming waters: effects of temperature on the cost of swimming in fishes Andrew M. Hein * Katrina...respond to global climate change. Metabolic cost of transport (COT)-a measure of the energy...

2012-01-01T23:59:59.000Z

271

Rapid measurement of minimum miscibility pressure with the rising-bubble apparatus  

SciTech Connect (OSTI)

The minimum miscibility pressure (MMP) for a gas/oil pair can be measured within 1 hour with the rising-bubble apparatus (RBA). Development of miscibility between a gas bubble and an oil can be observed visually. The measurements of the MMP with the RBA compare favorably with those based on slim-tube experiments and predictions from phase-behavior studies.

Christiansen, R.L.; Haines, H.K.

1987-11-01T23:59:59.000Z

272

CBER-DETR Nevada Coincident and Leading Employment Coincident Index Rises, Leading Index Pauses  

E-Print Network [OSTI]

the seasonally adjusted data reported by the Bureau of Labor Statistics. The Nevada Coincident Employment IndexCBER-DETR Nevada Coincident and Leading Employment Indexes1 Coincident Index Rises, Leading Index Pauses The Nevada Coincident Employment Index measures the ups and downs of the Nevada economy using

Ahmad, Sajjad

273

Pertussis is on the rise Whooping Cough (or pertussis) is Not Just For Kids.........  

E-Print Network [OSTI]

Pertussis is on the rise Whooping Cough (or pertussis) is Not Just For Kids......... Pertussis, also known as "whooping cough," is a communicable bacterial disease that is spread through droplets from the mouth and nose when a person with pertussis coughs, sneezes, or talks. This disease has

Wilcock, William

274

Global and regional exposure to large rises in sea-level: a sensitivity analysis  

E-Print Network [OSTI]

, but investment in the protection is required. While the costs of sea-level rise increase due to greater damage protection, investment is diverted from other uses. Much research remains to refine our understanding International Max Planck Research School on Earth System Modelling, Hamburg, Germany Research Unit

Watson, Andrew

275

Lattice Boltzmann simulation of the rise and dissolution of two-1 dimensional immiscible droplets2  

E-Print Network [OSTI]

transport of nonaqueous-phase liquid contaminant in groundwater. For example, in geological45 carbon to buoyancy leads to brine flowing around it, which accelerates the dissolution of47 scCO2. In addition, the dissolved scCO2 slightly increases the density of brine, which might give48 rise to downward density

Zhang, Dongxiao

276

Rise of the Robots A look at the growth of robotics globally  

E-Print Network [OSTI]

Rise of the Robots A look at the growth of robotics globally Minnesota's emerging robotics cluster #12;Global publication based in MN Mike Davin Editor, The Business of Robotics Communications Chair, Association for Unmanned Vehicle Systems International Advisory Committee, Robotics Alley

Levinson, David M.

277

The singularity at the tip of the rising plane bubble: The case of nonzero surface tension  

E-Print Network [OSTI]

The singularity at the tip of the rising plane bubble: The case of nonzero surface tension Prabir pointed bubble in the presenceof surface tension. These bubbles have been recently obtained by Vanden to find the apexangle as a function of the speedof the bubbles for a fixed value of surface tension

Daripa, Prabir

278

To begin, what gave rise to this project on anticipatory learning for climate change  

E-Print Network [OSTI]

To begin, what gave rise to this project on anticipatory learning for climate change adaptation processes for climate change adaptation (CCA) whilst working on a USAID funded project, Climate Change in Africa. From prior work on the USAID project and having studied climate change mitigation among small

Giles, C. Lee

279

Pressure rise generated by the expansion of a local gas volume in a closed vessel  

Science Journals Connector (OSTI)

...rise for partial combustion in closed spherically...ratios of specific heats that were unequal...temperature-dependent specific heats and equilibrium...velocity of three hydrocarbon-air mixtures...expression for partial combustion, Luijten et al...constant specific heats and constant burned...

2009-01-01T23:59:59.000Z

280

Induced abortion ratio in modern Sweden falls with age, but rises again before menopause  

E-Print Network [OSTI]

Induced abortion ratio in modern Sweden falls with age, but rises again before menopause Birgitta S. Tullberga, *, Virpi Lummaab,1 a Department of Zoology, University of Stockholm, S-10691 Stockholm, Sweden b than on age per se. We used data on abortions and births in Sweden during 1994 to investigate how

Tullberg, Birgitta

Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

Sea level rise in the Severn Estuary and Bristol Channel and impacts of a Severn Barrage  

Science Journals Connector (OSTI)

Abstract Many research projects in recent years have focused on marine renewable energy devices and structures due to the growing interest in marine renewable energy. These devices and structures have very different life spans. Schemes such as the Severn Barrage in the UK, as originally proposed by the Severn Tidal Power Group (STPG), would be the largest tidal renewable energy generation project in the world and would be operational for well over a century if built. Due to the long working life of some of these marine renewable energy schemes, it is important to study the impacts of climate change on such schemes, and particularly sea level rise. This study focuses on investigating the impacts of sea level rise due to climate change on the largest macro-tidal estuary in the UK, namely the Severn Estuary and Bristol Channel, and the alterations of the impacts and the performance of the Severn Barrage as a result of climate change. A hierarchy of computer models was implemented to identify the more localised impacts of climate change in the region of the study. Moreover, the potential benefits of the barrage on reducing flood risk, as well as the impact of climate change and the barrage on intertidal mudflats were investigated. The model predictions showed that the barrage would reduce flood risk due to the sea level rise. Furthermore, annual power output and the initial reduction in flood risk of the barrage would not be affected by sea level rise.

Reza Ahmadian; Agnieszka I. Olbert; Michael Hartnett; Roger A. Falconer

2014-01-01T23:59:59.000Z

282

Storm flooding sensitivity to sea level rise for Galveston Bay, Texas  

Science Journals Connector (OSTI)

The combination of sea level rise and population growth in coastal regions makes it essential to continue improving flood management strategies. Flooding estimates must take into account both local vertical land motion and estimated rates of sea level rise linked to global climate change. Several extreme value distributions are compared using multiple statistical measures for the modeling of maximum annual storm surges based on the 105-year record of Galveston Pier 21, Texas. Increases in inundation frequencies are computed based on two possible sea level rise scenarios, a conservative linear continuation of the past century trend, and a scenario based on the upper limit of the sea level range in the IPCC AR4 report, i.e. the A1FI scenario. The research shows that by the year 2100 exceedance probabilities may double for the impact of the largest storms such as Hurricane Ike, but may increase by 6–7 times for the smaller surges associated locally with the impact of storms such as Hurricanes Cindy, Alicia, and Rita. While individually not as devastating or costly as large hurricanes, the cumulative and regular cost of smaller surge events could well be a bigger threat to coastal communities as sea level rises.

Natalya N. Warner; Philippe E. Tissot

2012-01-01T23:59:59.000Z

283

HiRISE observations of new impact craters exposing Martian ground ice  

E-Print Network [OSTI]

ice rather than ice-cemented regolith. Although some clean ice may be produced by the impact processHiRISE observations of new impact craters exposing Martian ground ice Colin M. Dundas1 , Shane craters or clusters have been observed to excavate bright material inferred to be ice at mid

Byrne, Shane

284

initial rise in respiratory quotient (RQ) was also similar in both groups. However, in rats  

E-Print Network [OSTI]

initial rise in respiratory quotient (RQ) was also similar in both groups. However, in rats fed in rats fed the TC diet the decline in RQ was more progressive and began its decrease only 3-4 h after ad libitum to two groups of eight male Wister rats. Rats fed the TD diet showed the first significant

Paris-Sud XI, Université de

285

Response to Comment on "Fate of Rising CO2 Droplets in Seawater"  

E-Print Network [OSTI]

Response to Comment on "Fate of Rising CO2 Droplets in Seawater" I welcome the comment by Alendal is greater than ambient seawater so that CO2 liquid would sink and gradually dissolve in seawater." Alendal by which ocean storage could produce a disaster like that at Lake Nyos". The IPCC report (4

Zhang, Youxue

286

The Rise of Oxygen over the Past 205 Million Years and the Evolution  

E-Print Network [OSTI]

The Rise of Oxygen over the Past 205 Million Years and the Evolution of Large Placental Mammals to the present, we modeled oxygen concentrations over the past 205 million years. Our analysis indicates that atmospheric oxygen approximately doubled over this period, with rela- tively rapid increases in the early

287

Identification of matrix conditions that give rise to the linear coupling resonances  

SciTech Connect (OSTI)

General definitions of horizontal and vertical amplitudes for linear coupled motion are developed from the normal form of the one-turn matrix. This leads to the identification of conditions on the matrix that give rise to the linear coupling sum and difference resonances. The correspondence with the standard hamiltonian treatment of the resonances is discussed.

Gardner,C.J.

2009-03-01T23:59:59.000Z

288

Fact #839: September 22, 2014 World Petroleum Consumption Continues to Rise despite Declines from the United States and Europe- Dataset  

Broader source: Energy.gov [DOE]

Excel file with dataset for Fact #839: World Petroleum Consumption Continues to Rise despite Declines from the United States and Europe

289

Fact #851: December 15, 2014 The Average Number of Gears used in Transmissions Continues to Rise – Dataset  

Broader source: Energy.gov [DOE]

Excel file with dataset for Fact #851: December 15, 2014 The Average Number of Gears used in Transmissions Continues to Rise

290

Sea Level Rise at Sites in UK: 1850 - 2008 | OpenEI  

Open Energy Info (EERE)

13 13 Varnish cache server Browse Upload data GDR 429 Throttled (bot load) Error 429 Throttled (bot load) Throttled (bot load) Guru Meditation: XID: 2142263513 Varnish cache server Sea Level Rise at Sites in UK: 1850 - 2008 Dataset Summary Description This dataset, made available by the UK Department of Energy and Climate Change (DECC), shows sea level rise for the period as early as 1834 through 2008 for the following UK sites: Aberdeen, Liverpool, Newlyn, North Shields, and Sheerness. Data is from the Proudman Oceanographic Laboratory. Earliest year of available data varies by site, beginning between 1834 and 1916. Source UK Department of Energy and Climate Change (DECC) Date Released March 12th, 2010 (4 years ago) Date Updated Unknown Keywords climate change

291

Impact of a sea level rise on the coasts of Singapore: preliminary observations  

Science Journals Connector (OSTI)

Singapore is an island state with important centres of population, industries, commerce, ports and airports concentrated in its coastal areas of less than 2 m in elevation. Although tidal records for almost 20 yr do not show any increase in sea level, this paper considers and examines the possible impact of a sea level rise of one metre in Singapore. To date, the government has not announced any project relating to sea level rise. Specific research needs are difficult to forecast but are likely to be in three areas: coastal protection measures; and the developed or populated areas and reclaimed land; anti-salt intrusion measures for coastal reservoirs: and flood-prevention measures for major canals.

P.P. Wong

1992-01-01T23:59:59.000Z

292

Draft Environmental Assessment for Direct Final Rule, 10 CFR 434, "Energy Standards for New Federal Commercial and High-Rise High-Rise Multi-FamilyResidential Buildings" and 10 CFR 435, "Energy Efficiency Standards for New Federal Residential Low-Rise Re  

Broader source: Energy.gov (indexed) [DOE]

"Energy "Energy Efficiency Standards for New Federal Commercial and High-Rise Multi-Family Residential Buildings" and 10 CFR 435, "Energy Efficiency Standards for New Federal Residential Low-Rise Residential Buildings" Baseline Standards Update (DOE/EA-1871) March 16, 2011 2 Environmental Assessment for Final Rule, 10 CFR 433, "Energy Efficiency Standards for New Federal Commercial and High-Rise Multi-Family Residential Buildings" and 10 CFR 435, "Energy Efficiency Standards for New Federal Residential Low-Rise Residential Buildings" Baseline Standards Update

293

Implementation of plume rise and its impacts on emissions and air quality modelling  

Science Journals Connector (OSTI)

Abstract This work analyses the impact of implementing hourly plume rise calculations over Spain in terms of: i) vertical emission allocations and ii) modelled air quality concentrations. Two air quality simulations (4 km × 4 km, 1 h) were performed for February and June 2009, using the CALIOPE-AQFS system (WRF-ARW/HERMESv2.0/CMAQ/BSC-DREAM8b) differing only by the vertical allocation of point source emissions: i) using fixed vertical profiles based on the stack height of each facility and ii) using an hourly bottom-up calculations of effective emission heights. When using plume rise calculations, emissions are generally allocated to lower altitudes than when using the fixed vertical profiles, showing significant differences depending on source sector and air pollutant (up to 75% between estimated average effective emission heights). In terms of air quality, it is shown that hourly plume rise calculations lead to improved simulation of industrial SO2 concentrations, thus increasing modelled concentrations (1.4 ?g m?3 increase in February, 1.5 ?g m?3 increase in June) and reducing the model biases for both months (31.1% in February, 73.7% in June). The increase of SO2 concentrations leads to an increase of SO 4 ? 2 surface levels that varies according to the season and location (4.3% in February and 0.4% in June, on average). On the other hand, the impact on NO2 and PM10 concentrations is less significant, leading to average changes of a few ?g·m3 at most (0.4 ?g m?3 for NO2 and 0.2 ?g m?3 for PM10). In order to maximize the precision of plume rise calculations, the use of stack parameters based on real-world data is mandatory.

Marc Guevara; Albert Soret; Gustavo Arévalo; Francesc Martínez; José M. Baldasano

2014-01-01T23:59:59.000Z

294

Uranium in iron formations and the rise of atmospheric oxygen C.A. Partin a,  

E-Print Network [OSTI]

Uranium in iron formations and the rise of atmospheric oxygen C.A. Partin a, , S.V. Lalonde b , N.J. Planavsky c , A. Bekker a , O.J. Rouxel b,d , T.W. Lyons e , K.O. Konhauser f a Dept. of Geological Sciences), UMR 6538, Technopôle Brest-Iroise, 29280 Plouzané, France c Department of Geology and Geophysics, Yale

Konhauser, Kurt

295

Development of Sea Level Rise Scenarios for Climate Change Assessments of  

Open Energy Info (EERE)

Development of Sea Level Rise Scenarios for Climate Change Assessments of Development of Sea Level Rise Scenarios for Climate Change Assessments of the Mekong Delta, Vietnam Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Development of Sea Level Rise Scenarios for Climate Change Assessments of the Mekong Delta, Vietnam Agency/Company /Organization: United States Geological Survey Sector: Land, Water, Climate Topics: Baseline projection, GHG inventory, Co-benefits assessment, Background analysis Resource Type: Publications Website: pubs.usgs.gov/of/2010/1165/ Country: Vietnam UN Region: South-Eastern Asia Coordinates: 14.058324°, 108.277199° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":14.058324,"lon":108.277199,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

296

Kinematics and kinetics of single-limb heel rise in diabetes related medial column foot deformity  

Science Journals Connector (OSTI)

AbstractBackground Diabetes-related medial column foot deformities contribute to high plantar pressure, joint instability, ulceration and amputation. Impaired foot function may be an early indicator of foot structural incompetence and contribute to deformity progression. This study examines the ability of single-limb heel rise multi-segmental kinematics and kinetics to identify midfoot and hindfoot dysfunction in those with diabetes-related medial column foot deformity. Methods Single-limb heel rise foot kinematics and kinetics were examined in adults with diabetes mellitus and peripheral neuropathy with and without medial column foot deformity and age-, weight-matched controls. Findings Hindfoot relative to shank plantarflexion, peak and excursion, were reduced in both diabetes groups compared to controls (P power was reduced in the diabetes deformity group compared to controls (P < 0.017). Interpretation The single-limb heel rise task identified movement dysfunction in those with diabetes mellitus and peripheral neuropathy. Failure to plantarflex the forefoot relative to hindfoot may compromise midfoot joint stability and increase the risk of injury and arch collapse.

Mary K. Hastings; James Woodburn; Michael J. Mueller; Michael J Strube; Jeffrey E. Johnson; David R. Sinacore

2014-01-01T23:59:59.000Z

297

Pulse Rise Time Characterization of a High Pressure Xenon Gamma Detector for use in Resolution Enhancement  

SciTech Connect (OSTI)

High pressure xenon ionization chamber detectors are possible alternatives to traditional thallium doped sodium iodide (NaI(Tl)) and hyperpure germanium as gamma spectrometers in certain applications. Xenon detectors incorporating a Frisch grid exhibit energy resolutions comparable to cadmium/zinc/telluride (CZT) (e.g. 2% {at} 662keV) but with far greater sensitive volumes. The Frisch grid reduces the position dependence of the anode pulse risetimes, but it also increases the detector vibration sensitivity, anode capacitance, voltage requirements and mechanical complexity. We have been investigating the possibility of eliminating the grid electrode in high-pressure xenon detectors and preserving the high energy resolution using electronic risetime compensation methods. A two-electrode cylindrical high pressure xenon gamma detector coupled to time-to-amplitude conversion electronics was used to characterize the pulse rise time of deposited gamma photons. Time discrimination was used to characterize the pulse rise time versus photo peak position and resolution. These data were collected to investigate the effect of pulse rise time compensation on resolution and efficiency.

TROYER, G.L.

2000-08-25T23:59:59.000Z

298

Evidence of thermonuclear flame spreading on neutron stars from burst rise oscillations  

E-Print Network [OSTI]

Burst oscillations during the rising phases of thermonuclear X-ray bursts are usually believed to originate from flame spreading on the neutron star surface. However, the decrease of fractional oscillation amplitude with rise time, which provides a main observational support for the flame spreading model, have so far been reported from only a few bursts. Moreover, the non-detection and intermittent detections of rise oscillations from many bursts are not yet understood considering the flame spreading scenario. Here, we report the decreasing trend of fractional oscillation amplitude from an extensive analysis of a large sample of Rossi X-ray Timing Explorer Proportional Counter Array bursts from ten neutron star low-mass X-ray binaries. This trend is 99.99% significant for the best case, which provides, to the best of our knowledge, by far the strongest evidence of such trend. Moreover, it is important to note that an opposite trend is not found from any of the bursts. The concave shape of the fractional ampli...

Chakraborty, Manoneeta

2014-01-01T23:59:59.000Z

299

Charged Particles are Prevented from Going Faster than the Speed of Light by Light Itself: A Biophysical Cell Biologist's Contribution to Physics  

E-Print Network [OSTI]

Investigations of living organisms have led biologists and physicians to introduce fundamental concepts, including Brownian motion, the First Law of Thermodynamics, Poiseuille's Law of fluid flow, and Fick's Law of diffusion into physics. Given the prominence of viscous forces within and around cells and the experience of identifying and quantifying such resistive forces, biophysical cell biologists have an unique perspective in discovering the viscous forces that cause moving particles to respond to an applied force in a nonlinear manner. Using my experience as a biophysical cell biologist, I show that in any space consisting of a photon gas with a temperature above absolute zero, Doppler-shifted photons exert a velocity-dependent viscous force on moving charged particles. This viscous force prevents charged particles from exceeding the speed of light. Consequently, light itself prevents charged particles from moving faster than the speed of light. This interpretation provides a testable alternative to the interpretation provided by the Special Theory of Relativity, which contends that particles are prevented from exceeding the speed of light as a result of the relativity of time.

Randy Wayne

2011-03-18T23:59:59.000Z

300

DETERMINATION OF PROMINENCE PLASMA {beta} FROM THE DYNAMICS OF RISING PLUMES  

SciTech Connect (OSTI)

Observations by the Hinode satellite show in great detail the dynamics of rising plumes, dark in chromospheric lines, in quiescent prominences that propagate from large ({approx}10 Mm) bubbles that form at the base of the prominences. These plumes present a very interesting opportunity to study magnetohydrodynamic (MHD) phenomena in quiescent prominences, but obstacles still remain. One of the biggest issues is that of the magnetic field strength, which is not easily measurable in prominences. In this paper we present a method that may be used to determine a prominence's plasma {beta} when rising plumes are observed. Using the classic fluid dynamic solution for flow around a circular cylinder with an MHD correction, the compression of the prominence material can be estimated. This has been successfully confirmed through simulations; application to a prominence gave an estimate of the plasma {beta} as {beta} = 0.47 {+-} 0.079 to 1.13 {+-} 0.080 for the range {gamma} = 1.4-1.7. Using this method it may be possible to estimate the plasma {beta} of observed prominences, therefore helping our understanding of a prominence's dynamics in terms of MHD phenomena.

Hillier, Andrew [Kwasan and Hida Observatories, Kyoto University, Kyoto (Japan); Hillier, Richard [Department of Aeronautics, Imperial College, London (United Kingdom); Tripathi, Durgesh, E-mail: andrew@kwasan.kyoto-u.ac.jp [Inter-University Centre for Astronomy and Astrophysics, Post Bag 4, Ganeshkhind, Pune 411 007 (India)

2012-12-20T23:59:59.000Z

Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

Experimental Study on the Temperature Distribution in an Emergency Staircase of High-rise Building  

Science Journals Connector (OSTI)

Abstract High-rise building safety has drawn public attention due to the occurrence of many catastrophic fires, to study the temperature distribution in the emergency staircase of a high-rise building in an accident, a set of experiments were conducted in a scaled building model. The window state in the staircase has a significant effect on the temperature distribution. When the window in the staircase is opened, the temperatures below the fire source floor almost maintain the ambient temperature during the whole period, but the temperatures above the fire source increase quickly and finally reach a quasi steady stage due to the stack effect. Moreover, if the doors below the fire source are opened, the fresh air flow into the staircase and decrease the temperature. On the contrary, when all windows in the staircase are closed, the doors state has a slight effect on the temperature distribution in the staircase. Because of the absence of the stack effect, the temperatures are low and the temperature attenuation coefficient ? is larger.

W.X. Shi; J. Ji; J.H. Sun; S.M. Lo; C.G. Fan; L.J. Li

2014-01-01T23:59:59.000Z

302

Impact of flood defences and sea-level rise on the European Shelf tidal regime  

Science Journals Connector (OSTI)

Abstract The tidal response of the European Shelf to moderate ( < 1 m ) levels of sea level rise is investigated using a high resolution, well established tidal model. The model is validated for present day conditions and the tidal response to sea level rise by comparing the modelled response to long term tide gauge data. The effects of coastal defence schemes are tested, with three levels of present day coastal defences simulated. Full walls are added at the present day coastline, no coast defence schemes are used and a set of present day coastal defence schemes is simulated. The simulations show that there is a significant tidal response to moderate levels of SLR and that the response is strongly dependant on level of coastal defence simulated. The simulation using coastal defence data resulted in the strongest response as the tide was able to build up behind the coastal defence walls and create a patchwork of sea and land at the coastline. This had a strong impact on the spatial tidal energy dissipation field and in turn this has large effects on the tidal regime throughout the domain.

Holly E. Pelling; J.A. Mattias Green

2014-01-01T23:59:59.000Z

303

Measuring-up in timber: A critical perspective on mid- and high-rise timber building design  

E-Print Network [OSTI]

timber elements in high-rise buildings is still in its infancy. This paper offers a new perspective on building with wood at this scale, beyond carbon sequestration and construction. Criticism of existing projects and proposals, including the authors’ own...

Fleming, Patrick; Smith, Simon; Ramage, Michael

2014-07-07T23:59:59.000Z

304

Sensitivity of Twenty-First-Century Global-Mean Steric Sea Level Rise to Ocean Model Formulation  

Science Journals Connector (OSTI)

Two comprehensive Earth system models (ESMs), identical apart from their oceanic components, are used to estimate the uncertainty in projections of twenty-first-century sea level rise due to representational choices in ocean physical formulation. ...

Robert Hallberg; Alistair Adcroft; John P. Dunne; John P. Krasting; Ronald J. Stouffer

2013-05-01T23:59:59.000Z

305

Influence of the Pacific Decadal Oscillation on regional sea level rise in the Pacific Ocean from 1993 to 2012  

Science Journals Connector (OSTI)

The rate of regional sea level rise (SLR) provides important information about the impact of human activities on climate change. However, accurate estimation of regional SLR can be severely affected by sea sur...

Zongshang Si ???; Yongsheng Xu ???

2014-11-01T23:59:59.000Z

306

Biotic and abiotic interactions of deep-sea hydrothermal vent-endemic fish on the East Pacific Rise  

E-Print Network [OSTI]

A study of the ecology of fish endemic to hydrothermal vents on the East Pacific Rise was undertaken utilizing a variety of techniques, focusing on the bythitid Thermichthys hollisi. Stable isotope and gut content analyses ...

Buckman, Kate Lynn

2009-01-01T23:59:59.000Z

307

Draft Environmental Assessment for Direct Final Rule, 10 CFR 434, ÂŤEnergy Standards for New Federal Commercial and High-Rise High-Rise Multi-FamilyResidential BuildingsÂŽ and 10 CFR 435, ÂŤEnergy Efficiency Standards for New Federal Residential Low-Rise Re  

Broader source: Energy.gov (indexed) [DOE]

7 7 Environmental Assessment for Final Rule, 10 CFR 433, "Energy Efficiency Standards for New Federal Commercial and High-Rise Multi-Family Residential Buildings" and 10 CFR 435, "Energy Efficiency Standards for New Federal Residential Low-Rise Residential Buildings" (DOE/EA-1463) Environmental Assessment for Final Rule, 10 CFR 433, "Energy Efficiency Standards for New Federal Commercial and High-Rise Multi-Family Residential Buildings" and 10 CFR 435, "Energy Efficiency Standards for New Federal Residential Low-Rise Residential Buildings" (DOE/EA-1463) SUMMARY The U.S. Department of Energy (DOE) has prepared this Environmental Assessment (EA) for DOE's Final Rule, 10 CFR 433, "Energy Efficiency Standards for

308

Hydronic Controls Retrofits for Low-Rise Multi-Famiy Buildings  

Broader source: Energy.gov (indexed) [DOE]

Residential Integrated Energy Solutions Residential Integrated Energy Solutions Building America Stakeholder Meeting Austin, Texas February 29 to March 2, 2012 Hugh Henderson, CDH Energy Corp. Jordan Dentz, The Levy Partnership, Inc. Hydronic Controls Retrofits for Low-Rise Multi-Family Buildings Research Objective * Determine the impact of control strategies that use apartment temperatures for central boiler control on energy consumption, comfort and cost. * Compare energy performance, comfort and cost to individual radiator valve controls in each apartment. Background * Most multi-family boiler systems have: - No zone/apartment level control, or - Non-electric thermostats on radiator valves * Central boiler system resets hot water based on outdoor temperature * Problem: - apartments are often too hot or too cold.

309

Transient temperature rise due to ultrasound absorption at a bone/soft-tissue interface  

Science Journals Connector (OSTI)

Thermal effects due to high ultrasound absorption in bone pose an ongoing safety issue. Of considerable concern is the heating of the soft tissue adjacent to the bone surface. Mathematical models can be useful in predicting the transient temperature near the interface during insonation. This paper develops a model that provides the temperature field in terms of simple expressions that convey the functional dependence of the material properties and are easily incorporated into standards and ultrasound machine software yet are able to incorporate the material properties of both bone and soft tissue. The model contains an asymptotic theory based upon a “high-attenuation” assumption: the distance diffused by heat over the time of interest is large compared to the ultrasound attenuation length. Model predictions of temperature rise and location of maximum temperature were in close agreement with finite-element calculations using parameters appropriate for radiation-force imaging and focused-ultrasound surgery.

Matthew R. Myers

2004-01-01T23:59:59.000Z

310

Airflow Characteristics of Direct-Type Kitchen Hood Systems in High-Rise Apartment Buildings  

E-Print Network [OSTI]

, Samsung C&T, South Korea 2 Introduction ? Today?s high-rise apartment buildings exhibit high degree of air-tightness. ? They are also subjected to stack effect and seasonal, unpredictable, wind pressure variations. ? Therefore, it is questionable... characteristics for alt0 16 32CMH 0Pa 42CMH 0Pa 74CMH 16Pa 477CMH 984CMH 355CMH 815CMH 173CMH 26Pa 0CMH 0CMH 0CMH 54CMH 0Pa 158CMH 1Pa 35CMH 0Pa 74CMH 18Pa (a)?On?3rd?floor?at?12:00,?Jan?1st 1.5m/s North 50CMH 1Pa 23CMH 0Pa 75CMH 18Pa...

Park, M.

2011-01-01T23:59:59.000Z

311

Predicting Land-Ice Retreat and Sea-Level Rise with the Community Earth System Model  

SciTech Connect (OSTI)

Coastal stakeholders need defensible predictions of 21st century sea-level rise (SLR). IPCC assessments suggest 21st century SLR of {approx}0.5 m under aggressive emission scenarios. Semi-empirical models project SLR of {approx}1 m or more by 2100. Although some sea-level contributions are fairly well constrained by models, others are highly uncertain. Recent studies suggest a potential large contribution ({approx}0.5 m/century) from the marine-based West Antarctic Ice Sheet, linked to changes in Southern Ocean wind stress. To assess the likelihood of fast retreat of marine ice sheets, we need coupled ice-sheet/ocean models that do not yet exist (but are well under way). CESM is uniquely positioned to provide integrated, physics based sea-level predictions.

Lipscomb, William [Los Alamos National Laboratory

2012-06-19T23:59:59.000Z

312

Drivers of rising global energy demand: The importance of spatial lag and error dependence  

Science Journals Connector (OSTI)

Abstract This paper analyzes key factors that led to rising global energy demand in recent decades. In addition to income and price elasticities traditionally examined, this research takes into account the effects of structural, demographic, technological and temperature changes on energy demand. Using newly developed panel data techniques allowing for spatial error and/or spatial lag dependence, this research finds evidence for the existence of spatial lag dependence, a positive but declining income elasticity, a negative price elasticity, and the significant effects of industry/service value added, urbanization and technical innovations on energy demand. This research has important implications for public policies that aim to encourage energy savings, develop service sector and promote energy-efficient technologies towards a sustainable energy future.

Yongfu Huang

2014-01-01T23:59:59.000Z

313

Microsoft Word - Price Uncertainty Supplement.doc  

Gasoline and Diesel Fuel Update (EIA)

November 2010 November 2010 Short-Term Energy Outlook Energy Price Volatility and Forecast Uncertainty 1 November 9, 2010 Release Crude Oil Prices. WTI crude oil spot prices averaged almost $82 per barrel in October, about $7 per barrel higher than the September average, as expectations of higher oil demand pushed up prices. EIA has raised the average fourth quarter 2010 WTI spot price forecast to about $83 per barrel compared with $79 per barrel in last monthĘąs Outlook. WTI spot prices rise to $87 per barrel by the fourth quarter of next year. Projected WTI prices average $79 per barrel in 2010 and $85 per barrel in 2011. WTI futures for January 2011 delivery (for the 5-day period ending November 4)

314

Microsoft Word - Price Uncertainty Supplement.doc  

Gasoline and Diesel Fuel Update (EIA)

December 2010 Short-Term Energy Outlook Energy Price Volatility and Forecast Uncertainty 1 December 7, 2010 Release Crude Oil Prices. West Texas Intermediate (WTI) crude oil spot prices averaged over $84 per barrel in November, more than $2 per barrel higher than the October average. EIA has raised the average winter 2010-2011 period WTI spot price forecast by $1 per barrel from the last monthĘąs Outlook to $84 per barrel. WTI spot prices rise to $89 per barrel by the end of next year, $2 per barrel higher than in the last Outlook. Projected WTI prices average $79 per barrel in 2010 and $86 per barrel in 2011. WTI futures for February 2011 delivery during the 5-day period ending December 2

315

Speculation and Return Volatility: Evidence from the WTI Crude Oil Market.  

E-Print Network [OSTI]

??Based on the data of the Commitments of Traders reports from 2000 to 2013, this paper investigates the impact of speculative futures trading on the… (more)

Wang, Rui

2013-01-01T23:59:59.000Z

316

Explaining the convenience yield in the WTI crude oil market using realized volatility and jumps  

Science Journals Connector (OSTI)

Abstract In this paper, we first provide an empirical evidence of the existence of intraday jumps in the crude oil price series. We then show that these jumps, in conjunction with realized volatility measures, are important in modeling the convenience yield over the 2001–2010 period. Our empirical results indicate that lagged jump mean only explains around 16% of the weekly convenience yield. Our best specification, including variation in inventories, 8-week realized variance and the 250-day jump mean is able to explain around 61% of the weekly convenience yield. Importantly, our results are not driven by the simultaneous determination of the various variables at work as we only use lagged variables in all regressions.

Benoît Sévi

2015-01-01T23:59:59.000Z

317

The role of trader positions in spot and futures prices for WTI  

Science Journals Connector (OSTI)

Abstract We extend the analysis of causal relations between trader positions and oil prices and the process of price discovery by estimating a cointegrating vector autoregression (CVAR) model that expands the cash-and-carry relation between spot and futures prices to quantify long- and short-run relations among oil prices, trader positions, interest rates, and oil inventories. Results indicate that oil inventories and trader positions are needed to generate cointegration between spot and futures prices. The presence of trader positions and oil inventories suggest that both play a role in price discovery. Furthermore, the cointegrating relation for price loads into the equation for both oil prices and trader positions. This suggests a bi-directional simultaneous adjustment process between oil prices and trader positions. This expands the unidirectional causal relation from oil prices to trader positions that is generated by previous studies. Additional results suggest that price discovery occurs in the market for heavily traded near-month futures contracts, but discovery for thin far-month futures markets occurs in the spot market. Together, these results suggest mechanisms by which speculation could affect oil prices but the results presented here are moot regarding their effects.

Marek Kolodziej; Robert K. Kaufmann

2013-01-01T23:59:59.000Z

318

Sea Level Rise Summit June 20-22 in Boca Raton FAU's Center for Environmental Studies within the Charles E. Schmidt College of Science will host a "Risk  

E-Print Network [OSTI]

Sea Level Rise Summit June 20-22 in Boca Raton FAU's Center for Environmental Studies within the Charles E. Schmidt College of Science will host a "Risk and Response: Sea Level Rise Summit" on Wednesday planning of agencies, institutions and civic society to sea level rise and compare the Florida situation

Fernandez, Eduardo

319

Modeling of Coastal Inundation, Storm Surge, and Relative Sea-Level Rise at Naval Station Norfolk, Norfolk, Virginia, U.S.A.  

E-Print Network [OSTI]

Modeling of Coastal Inundation, Storm Surge, and Relative Sea- Level Rise at Naval Station Norfolk. Modeling of coastal inundation, storm surge, and relative sea-level rise at Naval Station Norfolk, Norfolk, and relative sea-level-rise (RSLR) scenarios were examined at the U.S. Naval Station, Norfolk, Virginia

US Army Corps of Engineers

320

Sea Level Rise, Green Greenland & Fantabulous Inference To be removed from Jim Hansen's e-mail list respond to sender with REMOVE as subject  

E-Print Network [OSTI]

Sea Level Rise, Green Greenland & Fantabulous Inference To be removed from Jim Hansen's e-mail list respond to sender with REMOVE as subject Sea Level Rise: I confess to collaborating with Michael Le Page in making an abbreviated version of "Scientific reticence and sea level rise" http

Hansen, James E.

Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

GEOPHYSICAL RESEARCH LETTERS, VOL. 24, NO.12, PAGES 1503-1506, JUNE 15, 1997 Spatial variations in the rate of sea level rise caused by  

E-Print Network [OSTI]

in the rate of sea level rise caused by the present-day melting of glaciers and ice sheets Clinton P. Conrad. Becausemostlong duration tide gaugesarein.the northernhemisphere,if the sources of sea level rise are unbalanced between the two hemispheres,estimates of global sea level rise could be in error by 10 to 20%. Individual

Conrad, Clint

322

Is sea level rise accelerating in the Chesapeake Bay? A demonstration of a novel new approach for analyzing sea level data  

E-Print Network [OSTI]

Is sea level rise accelerating in the Chesapeake Bay? A demonstration of a novel new approach are used to test a novel new analysis method for studies of sea level rise (SLR). The method, based of flooding in recent years. Because of sea level rise (SLR), high tides or storm surges that caused little

Ezer,Tal

323

Impact of dynamic feedbacks between sedimentation, sea-level rise, and biomass production on near-surface marsh stratigraphy and carbon accumulation  

E-Print Network [OSTI]

Impact of dynamic feedbacks between sedimentation, sea-level rise, and biomass production on near Keywords: salt marsh organic sediments accretion sea-level rise belowground biomass carbon storage a b model we explore how marsh stratigraphy responds to sediment supply and the rate of sea- level rise

324

The Resilience of the Indian Economy to Rising Oil Prices as a Validation Test for a Global Energy-Environment-Economy CGE Model  

E-Print Network [OSTI]

1 The Resilience of the Indian Economy to Rising Oil Prices as a Validation Test for a Global., 2009, `The resilience of the Indian economy to rising oil prices as a validation test for a global so, it compares the modeled and observed responses of the Indian economy to the rise of oil price

Paris-Sud XI, Université de

325

Derivation and generalization of the dispersion relation of rising-sun magnetron with sectorial and rectangular cavities  

SciTech Connect (OSTI)

Field analysis method is used to derive the dispersion relation of rising-sun magnetron with sectorial and rectangular cavities. This dispersion relation is then extended to the general case in which the rising-sun magnetron can be with multi-group cavities of different shapes and sizes, and from which the dispersion relations of conventional magnetron, rising-sun magnetron, and magnetron-like device can be obtained directly. The results show that the relative errors between the theoretical and simulation values of the dispersion relation are less than 3%, the relative errors between the theoretical and simulation values of the cutoff frequencies of ? mode are less than 2%. In addition, the influences of each structure parameter of the magnetron on the cutoff frequency of ? mode and on the mode separation are investigated qualitatively and quantitatively, which may be of great interest to designing a frequency tuning magnetron.

Shi, Di-Fu; Qian, Bao-Liang; Wang, Hong-Gang; Li, Wei [College of Opto-electric Science and Engineering, National University of Defense Technology, Changsha 410073 (China)] [College of Opto-electric Science and Engineering, National University of Defense Technology, Changsha 410073 (China)

2013-12-15T23:59:59.000Z

326

Mineral accretion technology for coral reef restoration, shore protection, and adaptation to rising sea level  

SciTech Connect (OSTI)

Electrolysis of seawater is used to precipitate limestone on top of underwater steel structures to create growing artificial reefs to enhance coral growth, restore coral reef habitat, provide shelter for fish, shellfish, and other marine organisms, generate white sand for beach replenishment, and protect shore lines from wave erosion. Films and slides will be shown of existing structures in Jamaica, Panama, and the Maldives, and projects being developed in these and other locations will be evaluated. The method is unique because it creates the only artificial reef structures that generate the natural limestone substrate from which corals and coral reefs are composed, speeding the settlement and growth of calcareous organisms, and attracting the full range of other reef organisms. The structures are self-repairing and grow stronger with age. Power sources utilized include batteries, battery chargers, photovoltaic panels, and windmills. The cost of seawalls and breakwaters produced by this method is less than one tenth that of conventional technology. Because the technology is readily scaled up to build breakwaters and artificial islands able to keep pace with rising sea level it is capable of playing an important role in protecting low lying coastal areas from the effects of global climate change.

Goreau, T.J.; Hilbertz, W. [Global Coral Reef Alliance, Chappaqua, NY (United States)

1997-12-31T23:59:59.000Z

327

The rise of low-cost sensing for managing air pollution in cities  

Science Journals Connector (OSTI)

Abstract Ever growing populations in cities are associated with a major increase in road vehicles and air pollution. The overall high levels of urban air pollution have been shown to be of a significant risk to city dwellers. However, the impacts of very high but temporally and spatially restricted pollution, and thus exposure, are still poorly understood. Conventional approaches to air quality monitoring are based on networks of static and sparse measurement stations. However, these are prohibitively expensive to capture tempo-spatial heterogeneity and identify pollution hotspots, which is required for the development of robust real-time strategies for exposure control. Current progress in developing low-cost micro-scale sensing technology is radically changing the conventional approach to allow real-time information in a capillary form. But the question remains whether there is value in the less accurate data they generate. This article illustrates the drivers behind current rises in the use of low-cost sensors for air pollution management in cities, while addressing the major challenges for their effective implementation.

Prashant Kumar; Lidia Morawska; Claudio Martani; George Biskos; Marina Neophytou; Silvana Di Sabatino; Margaret Bell; Leslie Norford; Rex Britter

2015-01-01T23:59:59.000Z

328

Fractal and Multifractal Analysis of the Rise of Oxygen in Earth's Early Atmosphere  

E-Print Network [OSTI]

The rise of oxygen in Earth's atmosphere that occurred 2.4 to 2.2 billion years ago is known as the Earth's Great Oxidation, and its impact on the development of life on Earth has been profound. Thereafter, the increase in Earth's oxygen level persisted, though at a more gradual pace. The proposed underlying mathematical models for these processes are based on physical parameters whose values are currently not well-established owing to uncertainties in geological and biological data. In this paper, a previously developed model of Earth's atmosphere is modified by adding different strengths of noise to account for the parameters' uncertainties. The effects of the noise on the time variations of oxygen, carbon and methane for the early Earth are investigated by using fractal and multifractal analysis. We show that the time variations following the Great Oxidation cannot properly be described by a single fractal dimension because they exhibit multifractal characteristics. The obtained results demonstrate that the time series as obtained exhibit multifractality caused by long-range time correlations.

Satish Kumar; Manfred Cuntz; Zdzislaw E. Musielak

2014-12-16T23:59:59.000Z

329

Vehicle type choice under the influence of a tax reform and rising fuel prices  

Science Journals Connector (OSTI)

Abstract Differentiated vehicle taxes are considered by many a useful tool for promoting environmentally friendly vehicles. Various structures have been implemented in several countries, e.g. Ireland, France, The Czech Republic, and Denmark. In many countries the tax reforms have been followed by a steep change in new vehicle purchases toward more diesel vehicles and more fuel-efficient vehicles. The paper analyses to what extent a vehicle tax reform similar to the Danish 2007 reform may explain changes in purchasing behaviour. The paper investigates the effects of a tax reform, fuel price changes, and technological development on vehicle type choice using a mixed logit model. The model allows a simulation of the effect of car price changes that resemble those induced by the tax reform. This effect is compared to the effects of fuel price changes and technology improvements. The simulations show that the effect of the tax reform on fuel efficiency is similar to the effect of rising fuel prices while the effect of technological development is much larger. The conclusion is that while the tax reform appeared in the same year as a large increase in fuel efficiency, it seems likely that it only explains a small part of the shift in fuel efficiency that occurred and that the main driver was the technological development.

Stefan L. Mabit

2014-01-01T23:59:59.000Z

330

The potential future influence of sea level rise on leatherback turtle nests  

Science Journals Connector (OSTI)

Abstract Climate change models predict sea level rise and increased intensity of storms and hurricanes in tropical sea turtle nesting areas. These factors could significantly increase beach inundation and erosion, thus affecting water content of sea turtle nesting beaches. Here, we conducted a field and laboratory study of how sand water content is related to embryonic development and hatching success of leatherback turtle nests. Moreover, we have experimentally incubated eggs of this species in beach sand under standardized conditions, but at different realistic levels of sand water content, varying from 1% to 12%. On the beaches, females nested from the intertidal zone to the lower part of the sand vegetation dunes, where nests were exposed to a wide range of sand water contents that ranged from 0.8% to 22%. However, both field and experimental studies revealed a strong negative correlation between sand water content and emergence success (field study: r = ? 0.73, P turtle nesting success should be expected to decrease.

Juan Patino-Martinez; Adolfo Marco; Liliana Quińones; Lucy A. Hawkes

2014-01-01T23:59:59.000Z

331

Study on Smoke Control Strategy in a High-rise Building Fire  

Science Journals Connector (OSTI)

Abstract During the high-rise building fire, it is crucial to win the time for occupant evacuation. One of the possible methods is to utilize HVAC operations to control/slow down smoke propagation on the fire floor. It is also possible to supply fresh air to the path of the evacuation so that occupants will not breathe into the poison gases. HVAC operations can control heat change and smoke conditions and change the fluid flow directionally so that it is possible to optimize the HVAC operations to make the building safer during fire. In this paper, the effects of HVAC operations, air supply system and mechanical smoke exhaust system will be studied. A smoke propagation model using the Large Eddy Simulation will be developed to study the smoke propagation under different HVAC operations. Simulation results show the temperatures at the fire room exit for different supply air quantities. Results also show that smoke propagation method is affected by the building construction, air supply and smoke exhaust system. The smoke control strategy is investigated.

Yuan Yu; Yan-yan Chu; Dong Liang

2014-01-01T23:59:59.000Z

332

A Model for Collaboration Networks Giving Rise to a Power Law Distribution with an Exponential Cutoff  

E-Print Network [OSTI]

Recently several authors have proposed stochastic evolutionary models for the growth of complex networks that give rise to power-law distributions. These models are based on the notion of preferential attachment leading to the ``rich get richer'' phenomenon. Despite the generality of the proposed stochastic models, there are still some unexplained phenomena, which may arise due to the limited size of networks such as protein, e-mail, actor and collaboration networks. Such networks may in fact exhibit an exponential cutoff in the power-law scaling, although this cutoff may only be observable in the tail of the distribution for extremely large networks. We propose a modification of the basic stochastic evolutionary model, so that after a node is chosen preferentially, say according to the number of its inlinks, there is a small probability that this node will become inactive. We show that as a result of this modification, by viewing the stochastic process in terms of an urn transfer model, we obtain a power-law...

Fenner, T; Loizou, G; Fenner, Trevor; Levene, Mark; Loizou, George

2005-01-01T23:59:59.000Z

333

Apparatus for preventing the rise of oil in a Stirling engine  

SciTech Connect (OSTI)

An apparatus for preventing lubricating oil from rising to the working spaces of a Stirling engine, the Stirling engine having a rod which reciprocates inside a cylindrical member is described comprising: a first oil-absorbing member which has an annular shape and which is secured to the rod so as to reciprocate therewith, the outer periphery of the first oil-absorbing member being in sliding contact with the inner surface of the cylindrical member; an oil scattering-preventing plate which has an annular shape and which is mounted on the rod above the first oil-absorbing member in intimate contact with the first oil-absorbing member, the outer diameter of the scattering-preventing plate being smaller than the inner diameter of the cylindrical member; a second oil-absorbing member which has an annular shape, which is permeable to air, and which is secured along its outer periphery to the inner surface of the cylindrical member above and separated from the oil scattering-preventing plate, the inner periphery of the second oil-absorbing member being in sliding contact with the outer surface of the rod; means for making the flow speed of gas which through the second oil-absorbing member during the operation of the Stirling engine higher from above to below the second oil-absorbing member than from below to above the second oil-absorbing member; and an annular baffle which is secured to the rod above and separated from the second oil-absorbing member, the outer diameter of the annular baffle being smaller than the inner diameter of the cylindrical member.

Kawajiri, K.; Fujiwara, M.; Tsuchino, K.; Hisamori, Y.

1987-12-08T23:59:59.000Z

334

Australasian Conference on Information Systems The rise of ICT for commerce 3-5 Dec 2008, Christchurch  

E-Print Network [OSTI]

processes operating through informal networks and practices, often times in specific spatio, Christchurch ` The Rise of ICT for Commerce in Small Product Offerings Case studies from India Nimmi Rangaswamy Technology for emerging markets Microsoft Research India Bangalore Abstract The paper makes a case

Rajamani, Sriram K.

335

Process for Scheduling Electives The Student Affairs/MSP Office collects core clerkship scheduling requests from rising M-3 and  

E-Print Network [OSTI]

rotations for this time and have no control over other schools' scheduling processes. wwwUICOM - UC Process for Scheduling Electives The Student Affairs/MSP Office collects core clerkship scheduling requests from rising M-3 and M-4 students. Individual clinical departments arrange other

Gilbert, Matthew

336

Demolition of High-Rise Public Housing Increases Particulate Matter Air Pollution in Communities of High-Risk Asthmatics  

E-Print Network [OSTI]

) air pollution, which may ad- versely affect the respiratory health of nearby residents. DemolitionDemolition of High-Rise Public Housing Increases Particulate Matter Air Pollution in Communities of High-Risk Asthmatics Samuel Dorevitch Division of Environmental and Occupational Health Sciences

Illinois at Chicago, University of

337

The timing of the rise of the Isthmus of Panama: Inferences from qualitative and quantitative Sreepat Jain  

E-Print Network [OSTI]

The timing of the rise of the Isthmus of Panama: Inferences from qualitative and quantitative data Miocene to the early Pliocene, the Panama seaway was an interoceanic exchange route. For the middle straits were closed. Thus, the closure of the Panama Seaway severed the exchange between the Equatorial

Sukop, Mike

338

EA-1926: Energy Efficiency Design Standards for New Federal Low-Rise Residential Buildings (RIN# 1904-AC61)  

Broader source: Energy.gov [DOE]

This EA will evaluate the potential environmental impacts of implementing the provisions in the Energy Conservation and Production Act (ECPA) that require DOE to update the baseline Federal energy efficiency performance standards for the construction of new Federal buildings, including low-rise residential buildings.

339

Sea-level rise and its possible impacts given a ‘beyond 4°C world’ in the twenty-first century  

Science Journals Connector (OSTI)

...is increasing in per capita income and population...proportion of the demand for safety is applied...persons km2 and 90 per cent at a population...population and GDP scenarios are essentially...about the main energy sources. The A1...sea-level rise (metre per century) according...

2011-01-01T23:59:59.000Z

340

Landscape Scale Impacts of Sea Level Rise and Elevation Changes Along the Matagorda Fault in Matagorda, Texas  

E-Print Network [OSTI]

of this study was to quantify land cover change within a Matagorda, Texas wetland that results from sea level rise and elevation change over time due to coastal faulting. The closing objective of this study was to simulate land cover conversion as a function...

Cline, Marie

2012-10-19T23:59:59.000Z

Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

This Letter presented projections of future sea-level rise based on simulations of the past 22,000 years of sea-level history using a simple, empirical model linking sea-level rise to global mean-temperature anomalies. One of the main conclusions of the L  

E-Print Network [OSTI]

This Letter presented projections of future sea-level rise based on simulations of the past 22,000 years of sea-level history using a simple, empirical model linking sea-level rise to global mean of sea-level rise during the twenty-first century that are reported in the Fourth Assessment Report

Siddall, Mark

342

Universitt Tbingen Mathematisches Institut  

E-Print Network [OSTI]

Approximation S() := m-1 i=0 [(1 - )Wti + Wti+1 ](Wti+1 - Wti ) des Integrals t 0 WsdWs. Zeigen Sie lim ||||0 S

Tübingen, Universität

343

THE HIGH-LATITUDE BRANCH OF THE SOLAR TORSIONAL OSCILLATION IN THE RISING PHASE OF CYCLE 24  

SciTech Connect (OSTI)

We use global heliseismic data from the Global Oscillation Network Group, the Michelson Doppler Imager on board the Solar and Heliospheric Observatory, and the Helioseismic and Magnetic Imager on board the Solar Dynamics Observatory, to examine the behavior, during the rising phase of Solar Cycle 24, of the migrating zonal flow pattern known as the torsional oscillation. Although the high-latitude part of the pattern appears to be absent in the new cycle when the flows are derived by subtracting a mean across a full solar cycle, it can be seen if we subtract the mean over a shorter period in the rising phase of each cycle, and these two mean rotation profiles differ significantly at high latitudes. This indicates that the underlying high-latitude rotation has changed; we speculate that this is in response to weaker polar fields, as suggested by a recent model.

Howe, R. [School of Physics and Astronomy, University of Birmingham, Edgbaston, Birmingham B15 2TT (United Kingdom); Christensen-Dalsgaard, J. [Stellar Astrophysics Centre, Department of Physics and Astronomy, Ny Munkegade 120, Aarhus University, DK-8000 Aarhus C (Denmark); Hill, F.; Komm, R. [National Solar Observatory, P.O. Box 26732, Tucson, AZ 85726-6732 (United States); Larson, T. P.; Schou, J. [HEPL Solar Physics, 452 Lomita Mall, Stanford University, Stanford, CA 94305-4085 (United States); Rempel, M.; Thompson, M. J., E-mail: rhowe@nso.edu [High Altitude Observatory, National Center for Atmospheric Research, P.O. Box 3000, Boulder, CO 80307-3000 (United States)

2013-04-10T23:59:59.000Z

344

A medium-rise 1970’s maternity hospital in the east of England: resilience and adaptation to climate change  

E-Print Network [OSTI]

.Thomas’s tower on the Thames and Oxford’s John Radcliffe Hospital. The essential framed, glazed treatment is consistent. Writing particularly of F.R.S.Yorke, YRM’S founder and an important publicist for modern architecture, Worsley wrote,” it was the rise... a huge barrier to achieving adaptation of the public non-domestic building stock, unfortunate given that the NHS Retained Estate would seem to be a particularly promising place to implement a public sector adaptation scheme...

Short, C. Alan; Giridharan, Renganathan; Lomas, Kevin J.

2014-01-01T23:59:59.000Z

345

Finite element modeling of the temperature rise due to the propagation of ultrasonic waves in viscoelastic materials and experimental validation  

Science Journals Connector (OSTI)

The ultrasound stimulated thermography method is usually used to detect the temperature rise at a defect position. The temperature rise can be due to the friction between the edges of the defect and/or the plastic deformation around the defect. This paper presents another aspect of the method when the ultrasounds are propagating in a viscoelasticanisotropicmaterial such as polymers or fiber-reinforced polymers. The attenuation of the waves produces a distributed temperature field. Therefore even a defect that does not produce some heat can be detected the ultrasonic field is modified. A finite element model is used for computing the temperature field and for predicting the possibility for an infrared camera of detecting the temperature rise and its modification due to a defect. The model computes the stress and displacement fields associated with the propagation and the loss of energy. Then the heat equation is solved with this loss as a source of heating. An experiment is done with a sonotrode that excites a PVC plate. The ultrasonic displacement at the top of the plate is measured with a laser velocimeter and introduced in the model. Finally the model result is compared to the image produced by the camera.

B. Hosten; C. Bacon; C. Biateau

2008-01-01T23:59:59.000Z

346

9 - Climate Change and Sea Level Rise in the Mekong Delta: Flood, Tidal Inundation, Salinity Intrusion, and Irrigation Adaptation Methods  

Science Journals Connector (OSTI)

The Mekong Delta of Vietnam extends over an extensive, low-lying flat area, with an average elevation of only about 1 m above mean sea level. It is considered the country’s main rice bowl, as it contributes 48% of national food production and more than 85% of annual rice exports. However, the Mekong Delta currently faces a number of challenges, as it is affected by annual floods, drought, and salinity intrusion. In the context of climate change and sea water level rise, these natural problems may become more severe, with inundation and salinity intrusion eventually becoming the norm under severe scenarios of sea level rise. In the future, salinity intrusion is expected to gradually start earlier in the dry season, posing a threat to the sustainable agricultural development of the Mekong Delta and food security in Vietnam. Through an in-depth analysis of different scenarios of sea level rise, this chapter proposes several measures for flood, tidal inundation, and salinity intrusion protection, while considering the sustainable development of the Mekong Delta in the context of climate change.

To Quang Toan

2014-01-01T23:59:59.000Z

347

The use of ducts to improve the control of supply air temperature rise in UFAD systems: CFD and lab study  

Science Journals Connector (OSTI)

Abstract Cool supply air flowing through the underfloor plenum is exposed to heat gain from both the concrete slab (conducted from the warm return air on the adjacent floor below the slab) and the raised floor panels (conducted from the warmer room above). The magnitude of this heat gain can be quite high, resulting in undesirable loss of control of the supply air temperature from the plenum into the occupied space. These warmer supply air temperatures can make it more difficult to maintain comfort in the occupied space (without increasing airflow rates), particularly in perimeter zones where cooling loads reach their highest levels. How to predict plenum thermal performance is one of the key design issues facing practicing engineers – evidence from completed projects indicates that excessive temperature rise in the plenum can be a problem. One of the recommended strategies for addressing temperature rise in UFAD systems is the use of ductwork (flexible or rigid) within the underfloor plenum to deliver cool air preferentially to perimeter zones or other critical areas of high cooling demand. Several experiments were carried out in a full-scale underfloor plenum test facility, in order to characterize all the phenomena that take place in an underfloor plenum equipped with a fabric or metal duct. Experimental data were collected for validation of a computational fluid dynamics (CFD) model of the plenum. This paper describes the first part of a more comprehensive work, whose aim is to use the validated CFD plenum model to conduct simulations of a broader range of plenum design and operational parameters. This work proves that using ductwork within the underfloor plenum reduce the temperature rise in the plenum.

Wilmer Pasut; Fred Bauman; Michele De Carli

2014-01-01T23:59:59.000Z

348

Magnesium Isotopes in Metal-Poor Dwarfs, the Rise of AGB Stars and the Formation Timescale of the Galactic Halo  

E-Print Network [OSTI]

We have determined magnesium isotopic ratios (^{25,26}Mg/Mg) in metal-poor (-2.6 [Fe/H] -1.3) halo dwarfs employing high S/N (90-280) high spectral resolution (R = 10^5) Keck HIRES spectra. Unlike previous claims of an important contribution from intermediate-mass AGB stars at low metallicities, we find that the rise of the AGB contribution in the Galactic halo did not occur until intermediate metallicities ([Fe/H] ~> -1.5).

Jorge Melendez; Judith G. Cohen

2007-02-24T23:59:59.000Z

349

EA-1871: Environmental Assessment for Final Rule, 10 CFR 433, “EE Standards for New Federal Commercial and High-Rise Multi-Family Residential Buildings” and 10 CFR 435, “EE Standards for New Federal Residential Low-Rise Residential Buildings"  

Broader source: Energy.gov [DOE]

The U.S. Department of Energy (DOE) has prepared this Environmental Assessment (EA) for DOE‘s Final Rule, 10 CFR 433, ?Energy Efficiency Standards for New Federal Commercial and High-Rise Multi-Family Residential Buildings? and 10 CFR 435, ?Energy Efficiency Standards for New Federal Residential Low-Rise Residential Buildings? Baseline Standards Update. The final rule updates the baseline standards in 10 CFR 433 and 10 CFR 435 to the latest private sector standards based on the cost-effectiveness of the latest private sector standards and DOE‘s determination that energy efficiency has been improved in these codes as required by 42 U.S.C 6831 et seq. DOE is issuing its final determinations on American National Standards Institute (ANSI)/American Society of Heating, Refrigerating and Air-Conditioning Engineers, Inc. (ASHRAE)/Illuminating Engineering Society of North America (IESNA) Standard 90.1-2007 (ASHRAE 2007) and the International Code Council‘s 2009 International Energy Conservation Code (IECC) in the same edition of the Federal Register as this final rule.

350

A Faster Algorithm for Computing Motorcycle Graphs  

Science Journals Connector (OSTI)

We present a new algorithm for computing motorcycle graphs that runs in $$O(n^{4/3+\\varepsilon })$$O(n4/3+ż) time for any $$\\varepsilon >0$$ż>0, improving on all previously known algorithms. The main application of this result is to computing the straight ... Keywords: 65D18, 68Q25, 68U05, Algorithms design and analysis, Medial axis, Motorcycle graph, Polygon, Straight skeleton

Antoine Vigneron, Lie Yan

2014-10-01T23:59:59.000Z

351

Program Optimization for Faster Genetic Programming  

E-Print Network [OSTI]

There are six operations that map an index (i, j, k) to an index: ... These wavelets have arbitrarily high approximation power even though they ... It is possible that an evolving genetic programming system will choose the ..... In CRC Handbook of.

1998-04-24T23:59:59.000Z

352

Faster Compressed Dictionary Matching (extended abstract)  

E-Print Network [OSTI]

The past few years have witnessed several exciting results on compressed represen- tation of a string T that supports e±cient pattern matching, and the space complexity has been reduced to jTjHk(T)+o(jTj log ľ) bits [8, ...

Hon, Wing-Kai; Lam, Tak-Wah; Shah, Rahul; Tam, Siu-Lung; Vitter, Jeffrey Scott

2010-01-01T23:59:59.000Z

353

What is faster -- light or gravity?  

E-Print Network [OSTI]

General relativity lacks the notion of the speed of gravity. This is inconvenient and the present paper is aimed at filling this gap up. To that end I introduce the concept of the "alternative" and argue that its variety called the "superluminal alternative" describes exactly what one understands by the "superluminal gravitational signal". Another, closely related, object called the "semi-superluminal alternative" corresponds to the situation in which a massive (and therefore gravitating) body reaches its destination sooner than a photon \\emph{would}, be the latter sent \\emph{instead} of the body. I prove that in general relativity constrained by the condition that only globally hyperbolic spacetimes are allowed 1) semi-superluminal alternatives are absent and 2) under some natural conditions and conventions admissible superluminal alternative are absent too.

S. Krasnikov

2014-08-28T23:59:59.000Z

354

Krill (Meganyctiphanes norvegica) swim faster at night  

Science Journals Connector (OSTI)

We document a consistent and marked diel signal in swimming speed of krill ... Swimming speed was assessed using acoustic target tracking of individual krill.

355

Microsoft Word - Price Uncertainty Supplement.doc  

Gasoline and Diesel Fuel Update (EIA)

October 2010 October 2010 Short-Term Energy Outlook Energy Price Volatility and Forecast Uncertainty 1 October 13, 2010 Release Crude Oil Prices. WTI oil prices averaged $75 per barrel in September but rose above $80 at the end of the month and into early October. EIA has raised the average fourth- quarter 2010 forecasted WTI spot price to $79 per barrel compared with $77 per barrel in last monthĘąs Outlook. WTI spot prices are projected to rise to $85 per barrel by the fourth quarter of next year. As has been the case for most of 2010, WTI futures traded with a notable lack of volatility during the third quarter of 2010 (Figure 1). However, prices did bounce in

356

The Technical and Economical Analysis of a Centralized Air-Conditioning System with Cold Storage Refrigeration in High-Rise Residential Buildings  

E-Print Network [OSTI]

In recent years, the application of a centralized air-conditioning system (CACS) with cold storage refrigeration in high-rise residential buildings has gradually increased. Due to the large difference between civil residential buildings...

Xiang, C.; Xie, G.

2006-01-01T23:59:59.000Z

357

Influence of pH of the BSA solutions on velocity of the rising bubbles and stability of the thin liquid films and foams  

Science Journals Connector (OSTI)

Influence of pH of the BSA solutions on velocity of the rising bubbles, stability of foams, and properties of single foam...IEP...=4.8) the BSA showed the highest surface activity. The equilibrium microscopic foa...

J. Zawala; R. Todorov; A. Olszewska; D. Exerowa; K. Malysa

2010-10-01T23:59:59.000Z

358

On October 21, 2011 "Glacier Melt, Early Snowmelt and Sea Level Rise" will examine issues of defining science, law, governance, the role of civil society, and present case studies on all three  

E-Print Network [OSTI]

On October 21, 2011 "Glacier Melt, Early Snowmelt and Sea Level Rise" will examine issues interrelated topics: glacier melt, early snowmelt and sea level rise. A concluding panel will discuss

Stanford, Kyle

359

COSTS RISE IN CHINA  

Science Journals Connector (OSTI)

On July 1, the Chinese government reduced the tax rebate it provides to exporters of many types of products, including most chemicals, from 13% to 5%. ...

2007-07-23T23:59:59.000Z

360

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incineration facility (East Liverpool, Ohio). Volume 1. Executive summary  

SciTech Connect (OSTI)

Contents: Introduction and Summary of Results; Facility Background; Facility Emissions; Atmospheric Dispersion and Deposition Modeling of Emissions; Human Health Risk Assessment; Screening Ecological Risk Assessment; Accident Analysis; Additional Analysis in Response to Peer Review Recommendations; References.

NONE

1997-05-01T23:59:59.000Z

Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

Volatility regimes, asymmetric basis effects and forecasting performance: An empirical investigation of the WTI crude oil futures market  

Science Journals Connector (OSTI)

This study employs a flexible regime-switching EGARCH model with Student-t distributed error terms to investigate whether volatility regimes and basis affect the behavior of crude oil futures returns, including the conditional mean, variance, skewness, kurtosis as well as the extent of heavy-tailedness. The study also examines whether volatility regimes and asymmetric basis effects can improve the forecasting accuracy. The main merit of the empirical model is that the basis effect is allowed to be asymmetric and to vary across volatility regimes. Empirical results suggest that the conditional mean and variance respond to the basis asymmetrically and nonlinearly, and that the responses of transition probabilities to the basis are symmetric. Furthermore, the conditional higher moments are sensitive to the absolute value of basis, and the heavy tailed characteristic can be greatly alleviated by taking into account the asymmetric basis effects and regime switches. Finally, the regime switches and asymmetric basis effects play decisive roles in forecasting return, volatility and tail distribution.

Kuang-Liang Chang

2012-01-01T23:59:59.000Z

362

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incinerator facility (east Liverpool, Ohio). Volume 2. Introduction. Draft report  

SciTech Connect (OSTI)

This volume provides a description of the facility, and its location and setting in the three-state area of Ohio, Pennsylvania, and West Virginia; an overview of previous risk assessments conducted by U.S. EPA for this site, including the preliminary assessment of inhalation exposure and the screening-level risk analyses of indirect exposure; and a summary of comments provided by the Peer Review Panel on the Project Plan.

NONE

1995-11-01T23:59:59.000Z

363

Final Report on "Rising CO2 and Long-term Carbon Storage in Terrestrial Ecosystems: An Empirical Carbon Budget Validation"  

SciTech Connect (OSTI)

The primary goal of this report is to report the results of Grant DE-FG02-97ER62458, which began in 1997 as Grant DOE-98-59-MP-4 funded through the TECO program. However, this project has a longer history because DOE also funded this study from its inception in 1985 through 1997. The original grant was focused on plant responses to elevated CO2 in an intact ecosystem, while the latter grant was focused on belowground responses. Here we summarize the major findings across the 25 years this study has operated, and note that the experiment will continue to run through 2020 with NSF support. The major conclusions of the study to date are: (1 Elevated CO2 stimulated plant productivity in the C3 plant community by ~30% during the 25 year study. The magnitude of the increase in productivity varied interannually and was sometime absent altogether. There is some evidence of down-regulation at the ecosystem level across the 25 year record that may be due to interactions with other factors such as sea-level rise or long-term changes in N supply; (2) Elevated CO2 stimulated C4 productivity by <10%, perhaps due to more efficient water use, but C3 plants at elevated CO2 did not displace C4 plants as predicted; (3) Increased primary production caused a general stimulation of microbial processes, but there were both increases and decreases in activity depending on the specific organisms considered. An increase in methanogenesis and methane emissions implies elevated CO2 may amplify radiative forcing in the case of wetland ecosystems; (4) Elevated CO2 stimulated soil carbon sequestration in the form of an increase in elevation. The increase in elevation is 50-100% of the increase in net ecosystem production caused by elevated CO2 (still under analysis). The increase in soil elevation suggests the elevated CO2 may have a positive outcome for the ability of coastal wetlands to persist despite accelerated sea level rise; (5) Crossing elevated CO2 with elevated N causes the elevated CO2 effect to diminish, with consequences for change in soil elevation.

J. Patrick Megonigal; Bert G. Drake

2010-08-27T23:59:59.000Z

364

Minimization of the external heating power by long fusion power rise-up time for self-ignition access in the helical reactor FFHR2m  

Science Journals Connector (OSTI)

Minimization of the external heating power to access self-ignition is advantageous to increase the reactor design flexibility and to reduce the capital and operating costs of the plasma heating device in a helical reactor. In this work we have discovered that a larger density limit leads to a smaller value of the required confinement enhancement factor, a lower density limit margin reduces the external heating power and over 300?s of the fusion power rise-up time makes it possible to reach a minimized heating power. While the fusion power rise-up time in a tokamak is limited by the OH transformer flux or the current drive capability, any fusion power rise-up time can be employed in a helical reactor for reducing the thermal stresses of the blanket and shields, because the confinement field is generated by the external helical coils.

O. Mitarai; A. Sagara; H. Chikaraishi; S. Imagawa; K. Watanabe; A.A. Shishkin; O. Motojima

2007-01-01T23:59:59.000Z

365

The potential impact on socio-economic groups of rising energy prices due to the Kuwaiti crisis  

SciTech Connect (OSTI)

The Iraqi invasion of the kingdom of Kuwait on August 2, 1990, triggered immediate increases in the world price of petroleum. With US imports of petroleum and residential, commercial, and industrial consumption of petroleum products on the rise, these price increases are already evident in the US. The differential impact of these increases on poor and minority households raises significant and potentially long-term research and policy issues for various government agencies, including the US Department of Energy. The purpose of this paper is to provide a preliminary analysis of the nature and extent of the potential impact of Iraqi-induced petroleum price changes on majority, black, and Hispanic households, as well as on poor and non-poor households. As this paper is written, the US is continuing the deployment of several hundred thousand troops, aircraft, naval vessels, and other equipment to the Persian Gulf. The objectives of this deployment are to deter Iraqi invasion of Saudi Arabia and to encourage Iraqi withdrawal from Kuwait. The outcome of these initiatives, particularly the response of the government of Iraq, could stimulate additional changes in world petroleum prices and subsequent impacts on the household energy consumption and expenditure patterns of US black, Hispanic, and poor households. 8 refs., 16 figs., 5 tabs.

Henderson, L. (Baltimore Univ., MD (USA)); Poyer, D.; Teotia, A.

1990-01-01T23:59:59.000Z

366

Buoyancy driven bubble rise and deformation in milli/micro channels filled with shear-thinning nanofluids  

Science Journals Connector (OSTI)

Abstract The motion and deformation characteristics of buoyancy driven air bubbles in milli- and micro- channels filled with nanofluids have been numerically investigated over wide range of Eotvos number using COMSOL Multiphysics 4.3a. The two dimensional unsteady simulations are carried out by adopting a level set method available in the solver. Experimental rheological properties of water based alumina nanofluids are adopted from the literature and these nanofluids obey shear-thinning power-law type non-Newtonian behavior. The range of volume fraction of nanoparticles considered in this work is ? = 0.015–0.035 which correspond to the power-law behavior index of shear-thinning nanofluid in the range n = 0.78–0.58 respectively. The motion and deformation characteristics of bubbles in nanofluids are elucidated by presenting volume fraction images, streamline patterns and viscosity distributions around the rising bubbles. The volume fractions of nanoparticles present in the nanofluids play different roles on the deformation of mono-size bubbles in milli- and micro- channels. The deformation and breakup of bubbles are realized early in the case of milli-channels as compared to the case of micro-channels for a fixed Eotvos number. Further the Eotvos number at which bubble breakup occurs in both milli- and micro- channels is very different.

K. Dilleswara Rao; M. Vasukiran; A.R.K. Gollakota; Nanda Kishore

2015-01-01T23:59:59.000Z

367

A modeling study of coastal inundation induced by storm surge, sea-level rise, and subsidence in the Gulf of Mexico  

SciTech Connect (OSTI)

The northern coasts of the Gulf of Mexico are highly vulnerable to the direct threats of climate change, such as hurricane-induced storm surge, and such risks can be potentially exacerbated by land subsidence and global sea level rise. This paper presents an application of a coastal storm surge model to study the coastal inundation process induced by tide and storm surge, and its response to the effects of land subsidence and sea level rise in the northern Gulf coast. An unstructured-grid Finite Volume Coastal Ocean Model was used to simulate tides and hurricane-induced storm surges in the Gulf of Mexico. Simulated distributions of co-amplitude and co-phase of semi-diurnal and diurnal tides are in good agreement with previous modeling studies. The storm surges induced by four historical hurricanes (Rita, Katrina, Ivan and Dolly) were simulated and compared to observed water levels at National Oceanic and Atmospheric Administration tide stations. Effects of coastal subsidence and future global sea level rise on coastal inundation in the Louisiana coast were evaluated using a parameter “change of inundation depth” through sensitivity simulations that were based on a projected future subsidence scenario and 1-m global sea level rise by the end of the century. Model results suggested that hurricane-induced storm surge height and coastal inundation could be exacerbated by future global sea level rise and subsidence, and that responses of storm surge and coastal inundation to the effects of sea level rise and subsidence are highly nonlinear and vary on temporal and spatial scales.

Yang, Zhaoqing; Wang, Taiping; Leung, Lai-Yung R.; Hibbard, Kathleen A.; Janetos, Anthony C.; Kraucunas, Ian P.; Rice, Jennie S.; Preston, Benjamin; Wilbanks, Thomas

2013-12-10T23:59:59.000Z

368

Environmental Assessment for Direct Final Rule, 10 CFR 434, ÂŤEnergy Standards for New Federal Commercial and High-Rise Multi-FamilyResidential BuildingsÂŽ and 10 CFR 435, ÂŤEnergy Efficiency Standards for New Federal Residential Low-Rise Residential Buildings"  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Proposed Rule, 10 CFR 433, Proposed Rule, 10 CFR 433, "Sustainable Design and Energy Efficiency Standards for New Federal Commercial and High-Rise Multi-Family Residential Buildings" and 10 CFR 435, "Sustainable Design and Energy Efficiency Standards for New Federal Residential Low-Rise Residential Buildings" (DOE/EA-1463) 2 SUMMARY The U.S. Department of Energy (DOE) has prepared this Environmental Assessment (EA) for DOE's Proposed Rule, 10 CFR 433, "Sustainable Design and Energy Efficiency Standards for the Design and Construction of New Federal Commercial and High-Rise Multi-Family Residential Buildings" and 10 CFR 435, "Sustainable Design and Energy Efficiency Standards for New Federal Residential Low- Rise Residential Buildings". Section 305(a) of the Energy Conservation and Production

369

Environmental Assessment for Direct Final Rule, 10 CFR 434, ÂŤEnergy Standards for New Federal Commercial and High-Rise Multi-FamilyResidential BuildingsÂŽ and 10 CFR 435, ÂŤEnergy Efficiency Standards for New Federal Residential Low-Rise Residential Buildings"  

Broader source: Energy.gov (indexed) [DOE]

Proposed Rule, 10 CFR 433, Proposed Rule, 10 CFR 433, "Sustainable Design and Energy Efficiency Standards for New Federal Commercial and High-Rise Multi-Family Residential Buildings" and 10 CFR 435, "Sustainable Design and Energy Efficiency Standards for New Federal Residential Low-Rise Residential Buildings" (DOE/EA-1463) 2 SUMMARY The U.S. Department of Energy (DOE) has prepared this Environmental Assessment (EA) for DOE's Proposed Rule, 10 CFR 433, "Sustainable Design and Energy Efficiency Standards for the Design and Construction of New Federal Commercial and High-Rise Multi-Family Residential Buildings" and 10 CFR 435, "Sustainable Design and Energy Efficiency Standards for New Federal Residential Low- Rise Residential Buildings". Section 305(a) of the Energy Conservation and Production

370

CBER-DETR Nevada Coincident and Leading Employment Both Indexes Rise on a Year-over-Year and Month-over-Month Basis  

E-Print Network [OSTI]

the seasonally adjusted data reported by the Bureau of Labor Statistics. The Nevada Coincident Employment IndexCBER-DETR Nevada Coincident and Leading Employment Indexes1 Both Indexes Rise on a Year-over-Year and Month-over-Month Basis The Nevada Coincident Employment Index measures the ups and downs of the Nevada

Ahmad, Sajjad

371

Magnetic properties of Pleistocene-Pliocene sediments from hole 810C, Shatsky Rise, and implications for the origin and correlatibility of their magnetic susceptibility variations  

E-Print Network [OSTI]

the summit of the rise, using the advanced hydraulic piston corer to achieve virtually complete recovery in the upper 127 meters below the sea floor. The down-core stratigraphy of whole-core magnetic susceptibility displayed peaks with amplitudes of 30-40 x...

Polgreen, Evelyn Louise

2012-06-07T23:59:59.000Z

372

Abstract--Since the rise in popularity of type-2 fuzzy logic systems a reoccurring problem has been the transition from  

E-Print Network [OSTI]

for type-1 fuzzy logic, in particular in the areas of fuzzy logic systems and fuzzy logic control. More]. While fuzzy logic control has remained at the forefront of type-2 fuzzy logic applications, the focusi Abstract-- Since the rise in popularity of type-2 fuzzy logic systems a reoccurring problem has

Aickelin, Uwe

373

Heart-shaped bubbles rising in anisotropic liquids Chunfeng Zhou1, Pengtao Yue1,2, James J. Feng1,2 , Chun Liu3, Jie Shen4  

E-Print Network [OSTI]

Heart-shaped bubbles rising in anisotropic liquids Chunfeng Zhou1, Pengtao Yue1,2, James J. Feng1 - This Letter reports numerical simulations motivated by experimental ob- servations of an unusual inverted-heart). Such a bubble assumes a peculiar shape while in the near wake, resembling an inverted heart or a spade (a

Shen, Jie

374

lackouts, rising gas prices, changes to the Clean Air Act, proposals to open wilderness and protected offshore areas to gas drilling, and increasing  

E-Print Network [OSTI]

B lackouts, rising gas prices, changes to the Clean Air Act, proposals to open wilderness, author Julian Darley takes a hard-hitting look at natural gas as an energy source that rapidly went from nuisance to crutch. Darley outlines the implications of our increased dependence on this energy source

Keeling, Stephen L.

375

N,N,NV,NV-tetramethyl-p-phenylenediamine initiates the appearance of a well-resolved I peak in the kinetics of chlorophyll fluorescence rise  

E-Print Network [OSTI]

fluorescence; Fm (=P)maximum level of chlorophyll fluorescence; Fv (=FmĂ?Fo), variable fluorescence; OEC, oxygen-evolving tissues, the initial fluorescence measured with all reaction centers in open state, Fo (O), rises to a peak level, Fm ( = P), observed when all reaction centers are closed, with two intermediate steps J (I1

Carpentier, Robert

376

The strontium isotopic composition of basalts from the East Pacific and Chile Rises and abyssal hills in the Eastern Pacific Ocean  

Science Journals Connector (OSTI)

Strontium isotopic differences between the basalts from the East Pacific and the Chile Rises (0.7026–0.7035, average 0.7028) and abyssal hills (0.7025–0.7037, average 0.7033) suggest that these are produced fr...

K. V. Subbarao

377

Increasing Gas Prices: Good Economics, but Bad Public Relations Rising gasoline prices captured the attention of the press and politicians in recent months,  

E-Print Network [OSTI]

Increasing Gas Prices: Good Economics, but Bad Public Relations Rising gasoline prices captured interest during our current gasoline shortage. That is, a higher price rations the product to the best use the supply of gasoline become relatively scarcer? First, the growth of the Chinese and Indian economies

Ahmad, Sajjad

378

Innovative Power?Augmentation?Guide?Vane Design of Wind?Solar Hybrid Renewable Energy Harvester for Urban High Rise Application  

Science Journals Connector (OSTI)

To generate greater quantities of energy from wind the most efficient solution would be by increasing the wind speed. Also due to the decreasing number of economic wind energy sites there are plans to place wind turbines closer to populated areas. To site wind turbines out from rural areas the current problems of wind turbines need to be resolved especially visual impact poor starting behaviour in low wind speeds noise and danger caused by blade failure. In this paper a patented wind?solar hybrid renewable energy harvester is introduced. It is a compact system that integrates and optimizes several green elements and can be built on the top (or between upper levels) of high rise buildings or structures. This system can be used in remote and urban areas particularly at locations where the wind speed is lower and more turbulent. It overcomes the inferior aspect on the low wind speed by guiding and increasing the speed of the high altitude free?stream wind through fixed or yaw?able power?augmentation?guide?vane (PAGV) before entering the wind turbine (straight?bladed vertical axis wind turbine VAWT in this project) at center portion. PAGV is a new and innovative design where its appearance or outer design can be blended into the building architecture without negative visual impact. From the studies it is shown that the wind speed increment in the PAGV can be produced according to the Bernoulli’s principle. Computational fluid dynamics (CFD) simulation is used to optimize the geometry of the PAGV and the simulation results demonstrated the technical possibility of this innovative concept. The PAGV replaces the free air?stream from wind by multiple channels of speed?increased and directional?controlled air?stream. With the PAGV this lift?type VAWT can be self?started and its size can be reduced for a given power output. The design is also safer since the VAWT is enclosed by the PAGV. By integrating the PAGV with the VAWT (the diameter and height of PAGV are 2 times larger than the VAWT’s) the predicted power generated (at free?stream wind speed ?=?3.5? m / s ) is 1.25 times higher than the VAWT that has the same size as the PAGV. This new wind energy generation configuration should generate interest in the international market even for regions with weaker winds. The correlation between CFD simulation and wind tunnel test will be carried out and reported elsewhere.

Chong Wen Tong; M. Z. Zainon; Poh Sin Chew; Soo Chun Kui; Wee Seng Keong; Pan Kok Chen

2010-01-01T23:59:59.000Z

379

Rising Above the Water: New Orleans Implements Energy Efficiency and Sustainability Practices Following Hurricanes Katrina and Rita (Fact Sheet), Integrated Deployment: Disaster Recovery (ID)  

Broader source: Energy.gov (indexed) [DOE]

Rising Above the Water: Rising Above the Water: New Orleans Implements Energy Efficiency and Sustainability Practices Following Hurricanes Katrina and Rita On August 29, 2005, Hurricane Katrina, the single largest catastrophe in U.S. history, struck the Gulf Coast, flooding 80% of New Orleans, Louisiana, and causing $89.6 billion in damages. Three weeks later, the city was flooded again by Hurricane Rita. Beginning in 2007, the U.S. Department of Energy, through its National Renewable Energy Laboratory (NREL), provided technical assistance that helped the city incorporate energy effi- ciency into its rebuilding efforts for K-12 schools and homes, as well as technical support and analysis on energy policy efforts. K-12 Schools In August 2007, DOE/NREL and the Louisiana Department

380

As the world economy continues to expand the demand for petroleum based fuel increases and the price of these fuels rises  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

4 4 Structural Studies of Catalytically Stabilized Industrial Hydrotreating Catalysts Myriam Perez De la Rosa 1 , Gilles Berhault 2 , Apurva Mehta 3 , Russell R. Chianelli 1 1 University of Texas at El Paso, Materials Research Technology Institute, El Paso, TX 2 Institut de Recherches sur la Catalyse, CNRS, Villeurbanne cedex, France 3 Stanford Synchrotron Radiation Laboratory, Menlo Park, CA Figure 1: MoS 2 layered structure. As the world economy continues to expand the demand for petroleum based fuel increases and the price of these fuels rises. The rising price of fuel has another consequence: refiners tend to purchase cheaper fuels of poorer quality. These poor quality fuels contain increasing amounts of sulfur and other pollutants leading to a decline

Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

Rising Above the Water: New Orleans Implements Energy Efficiency and Sustainability Practices Following Hurricanes Katrina and Rita (Fact Sheet), Integrated Deployment: Disaster Recovery (ID)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Rising Above the Water: Rising Above the Water: New Orleans Implements Energy Efficiency and Sustainability Practices Following Hurricanes Katrina and Rita On August 29, 2005, Hurricane Katrina, the single largest catastrophe in U.S. history, struck the Gulf Coast, flooding 80% of New Orleans, Louisiana, and causing $89.6 billion in damages. Three weeks later, the city was flooded again by Hurricane Rita. Beginning in 2007, the U.S. Department of Energy, through its National Renewable Energy Laboratory (NREL), provided technical assistance that helped the city incorporate energy effi- ciency into its rebuilding efforts for K-12 schools and homes, as well as technical support and analysis on energy policy efforts. K-12 Schools In August 2007, DOE/NREL and the Louisiana Department

382

Construction cost impact analysis of the U.S. Department of Energy mandatory performance standards for new federal commercial and multi-family, high-rise residential buildings  

SciTech Connect (OSTI)

In accordance with federal legislation, the U.S. Department of Energy (DOE) has conducted a project to demonstrate use of its Energy Conservation Voluntary Performance Standards for Commercial and Multi-Family High-Rise Residential Buildings; Mandatory for New Federal Buildings; Interim Rule (referred to in this report as DOE-1993). A key requisite of the legislation requires DOE to develop commercial building energy standards that are cost effective. During the demonstration project, DOE specifically addressed this issue by assessing the impacts of the standards on (1) construction costs, (2) builders (and especially small builders) of multi-family, high-rise buildings, and (3) the ability of low-to moderate-income persons to purchase or rent units in such buildings. This document reports on this project.

Di Massa, F.V.; Hadley, D.L.; Halverson, M.A.

1993-12-01T23:59:59.000Z

383

Viability of exterior shading devices for high-rise residential buildings: Case study for cooling energy saving and economic feasibility analysis  

Science Journals Connector (OSTI)

Abstract Proper use of building shading devices can only improve the thermal comfort in indoor environment, but also reduce cooling energy consumption effectively. Researches on this topic have been mostly conducted for office buildings, but were limited for exterior shading devices of high-rise buildings, where cooling is a major energy consumer. This paper presents an integrated approach for exterior shading design analysis about energy performance and economic feasibility in a high-rise residential building (Seoul, Korea) by both numerical simulations and field mock-up test for possibility of installing. The sun-shading/daylighting performance analysis of the 48 exterior shading devices was measured with 4.0 m × 3.2 m window module size during the period of May–September. Furthermore, quantitative analysis of the cooling energy saving potential of solar radiation controls was conducted with DOE-2.1E simulation program. The cooling energy saving potential was about 20%, while the reducing of solar heat gain by the two exterior shading devices (the horizontal overhang and the vertical panel) would lead to a decrease of the cooling energy demand 19.7% and 17.3%, respectively. Cost benefit and economic feasibility was also analyzed, in consideration of the OPEX and CAPEX, depending on the shading type. The significance of this study lies in providing basic information for rational exterior shading planning, when designing high-rise residential buildings.

Jinkyun Cho; Changwoo Yoo; Yundeok Kim

2014-01-01T23:59:59.000Z

384

Variability assessment and mitigation in advanced VLSI manufacturing through design-manufacturing co-optimization  

E-Print Network [OSTI]

related to read stability; WTI (WTV) is write trip current (SINM increases and WTI decreases, as the transistor widthread ability and smaller WTI represents worse writeability.

Jeong, Kwangok

2011-01-01T23:59:59.000Z

385

Theory of Topological Phenomena in Condensed Matter Systems  

E-Print Network [OSTI]

topological insulators (WTI). However, a more surprisingBurgers vector and three WTI indices[144] is nonzero - whichin the case of the WTI. Thus far, the characterization of

Zhang, Yi

2012-01-01T23:59:59.000Z

386

The Smell of Petroleum: Health, Insecurity, and Citizenship in "Revolutionary" Ecuador  

E-Print Network [OSTI]

in relation to the international WTI price benchmark. 3 Inproducts, and can The WTI index is one of two internationalfor crude petroleum. WTI, the West Texas Intermediate, is

Welcome, Nicholas Scott

2013-01-01T23:59:59.000Z

387

Go Global Newsletter, Winter/Spring 2006  

E-Print Network [OSTI]

The World Tribunal on Iraq (WTI) held its final session inits inception and conduct. The WTI is one expression of themoral globalization. ” The WTI generated intense interest in

Global & International Studies

2006-01-01T23:59:59.000Z

388

Microsoft Word - Highlights.docx  

Gasoline and Diesel Fuel Update (EIA)

11 11 1 Independent Statistics & Analysis U.S. Energy Information Administration April 2011 Short-Term Energy and Summer Fuels Outlook April 12, 2011 Release Highlights  West Texas Intermediate (WTI) crude oil spot prices averaged $89 per barrel in February and $103 per barrel in March. The WTI price has continued to rise in recent days, reaching $112 on April 8. Crude oil prices are currently at their highest level since 2008. EIA expects oil markets to continue to tighten over the next two years given expected robust growth in world oil demand and slow growth in supply from non-Organization of the Petroleum Exporting Countries

389

Microsoft Word - Highlights.doc  

Gasoline and Diesel Fuel Update (EIA)

7 7 1 ` September 2007 Short-Term Energy Outlook September 11, 2007 Release Highlights * Oil market fundamentals will likely remain tight reflecting continued production restraint by members of OPEC, rising consumption, moderate growth in non- OPEC supply, and falling inventories. Barring a slowdown in oil demand growth, continued high demand and low surplus capacity leave the market vulnerable to unexpected supply disruptions through 2008. * The price of West Texas Intermediate (WTI) crude oil dropped by about $2 per barrel in August from the record-high monthly average price of over $74 per barrel set in July. Tight world oil markets are expected to keep WTI prices around $71

390

Observation and Measurement of Temperature Rise and Distribution on GaAs Photo-cathode Wafer with a 532nm Drive Laser and a Thermal Imaging Camera  

SciTech Connect (OSTI)

Significant temperature rise and gradient are observed from a GaAs photo-cathode wafer irradiated at various power levels with over 20W laser power at 532nm wavelength. The laser power absorption and dissipated thermal distribution are measured. The result shows a clear indication that proper removal of laser induced heat from the cathode needs to be considered seriously when designing a high average current or low quantum efficiency photo-cathode electron gun. The measurement method presented here provides a useful way to obtain information about both temperature and thermal profiles, it also applies to cathode heating study with other heating devices such as electrical heaters.

Shukui Zhang, Stephen Benson, Carlos Hernandez-Garcia

2011-03-01T23:59:59.000Z

391

Variations in the shape of the outer rise seaward of the central Aleutian trench: implications for the rheology of oceanic lithosphere  

E-Print Network [OSTI]

ss (4) the most successfu' model . o explain the varia. 'ors in the amplitude of zhe outs rise ' =- pa ? = ly elas, ic p a. e model wi h varyin?bending mcmen';. I'he pr dieted. va ue- of the dips o the subcucting plate r ted . cc nding momen.... of each mechanism Apparent lexural ri-id' ty as a function ci age of . . "e surface lead with data taken ro, a var ' e y cf' areas . The apparent ' lexural rig' dity is the f'lexural rigidity of th= elas . ic plate that mos . closely agrees...

Huang, Hong-Hsi

2012-06-07T23:59:59.000Z

392

Energy conservation in high-rise buildings: Changes in air conditioning load induced by vertical temperature and humidity profile in Delhi  

Science Journals Connector (OSTI)

Temperature and humidity profiles in the upper atmosphere are different from those observed by ground level meteorological stations and used to design HVAC systems for high-rise buildings. There exist correlations among solar energy, atmospheric turbidity and pollutants in urban areas, affecting the temperature and humidity profiles with variation in height. In the present study, a theoretical model is developed considering these parameters, and the HVAC load is calculated. The results are compared with the HVAC load calculated from data obtained from the meteorological station, and the comparison showed that the results differ significantly (20%) for a hypothetical 200 m high office building.

S. Sinha; Sanjay Kumar; N. Kumar

1998-01-01T23:59:59.000Z

393

Microsoft Word - MPUR_Aug2012_final.docx  

Gasoline and Diesel Fuel Update (EIA)

2 1 2 1 August 2012 Short-Term Energy Outlook Market Prices and Uncertainty Report 1 Crude Oil Prices: July crude oil futures prices showed the largest monthly rise in prices since February of this year. The Brent and WTI crude oil benchmarks settled at $105.90 and $87.13 per barrel, respectively, on August 2, with Brent increasing $8.56 per barrel and WTI increasing by $3.38 per barrel since July 2 (Figure 1). Brent crude oil prices are currently just below the level that they ended the 2011 year at while WTI is $12 below its settle price on December 30, 2011. Positive news for economic growth and several supply side factors contributed to higher

394

Microsoft Word - Price Uncertainty Supplement.doc  

Gasoline and Diesel Fuel Update (EIA)

March 2010 March 2010 Short-Term Energy Outlook Energy Price Volatility and Forecast Uncertainty 1 March 9, 2010 Release Crude Oil Prices. WTI crude oil spot prices averaged $76.39 per barrel in February 2010, almost $2 per barrel lower than the prior month's average and very near the $76 per barrel forecast in last month's Outlook. Last month, the WTI spot price reached a low of $71.15 on February 5 and peaked at $80.04 on February 22. EIA expects WTI prices to average above $80 per barrel this spring, rising to an average of about $82 per barrel by the end of the year and to $85 per barrel by the end of 2011 (West Texas Intermediate Crude Oil Price Chart).

395

Microsoft Word - Highlights.doc  

Gasoline and Diesel Fuel Update (EIA)

9 9 1 August 2009 Short-Term Energy Outlook August 11, 2009 Release Highlights Crude oil prices continue to be very volatile. The West Texas Intermediate (WTI) crude oil spot price fell from $71.47 on June 29 to $59.62 on July 14 and then increased to $71.59 by August 3. EIA expects the price of WTI crude oil to stay roughly flat at an average of $70 per barrel in the fourth quarter of 2009, an increase of about $27 compared with the average for the first quarter of the year. The WTI spot price is projected to rise slowly as economic conditions improve, to an average of about $72 per barrel in 2010. U.S average prices for regular-grade gasoline, which reached an earlier

396

Microsoft Word - Price Uncertainty Supplement.doc  

Gasoline and Diesel Fuel Update (EIA)

0 0 1 July 2010 Short-Term Energy Outlook Energy Price Volatility and Forecast Uncertainty 1 July 7, 2010 Release Crude Oil Prices. WTI crude oil spot prices averaged $75.34 per barrel in June 2010 ($1.60 per barrel above the prior month's average), close to the $76 per barrel projected in the forecast in last month's Outlook. EIA projects WTI prices will average about $79 per barrel over the second half of this year and rise to $84 by the end of next year (West Texas Intermediate Crude Oil Price Chart). Energy price forecasts are highly uncertain, as history has shown (Energy Price Volatility and Forecast Uncertainty). WTI futures for September 2010 delivery for the

397

Microsoft Word - MPUR_Mar2011_final.docx  

Gasoline and Diesel Fuel Update (EIA)

March 2011 March 2011 1 March 2011 Short-Term Energy Outlook Market Prices and Uncertainty Report 1 March 8, 2011 Release Crude Oil Prices. West Texas Intermediate (WTI) crude oil spot prices averaged $88.58 per barrel in February, slightly lower than the January average, while over the same time period the estimated average cost of all crude oil to U.S. refineries increased by about $4.50 per barrel to $92.50. Growing volumes of Canadian crude oil imported into the United States contributed to record-high storage levels at Cushing, Oklahoma, and a price discount for WTI compared with similar quality world crudes such as Brent crude oil. Projected WTI spot prices rise to an average of $105 per barrel in December

398

Microsoft Word - Highlights.docx  

Gasoline and Diesel Fuel Update (EIA)

February 2012 February 2012 1 Independent Statistics & Analysis U.S. Energy Information Administration February 2012 Short-Term Energy Outlook February 7, 2012 Release Highlights ď‚· EIA expects the price of West Texas Intermediate (WTI) crude oil to average about $100 per barrel in 2012, almost $6 per barrel higher than the average price last year. Based on recent futures and options data, the market believes there is about a one-in-fifteen chance that the average WTI price in June 2012 will exceed $125 per barrel, and about a one-in-fifty chance that it would exceed $140 per barrel. For 2013, EIA expects WTI prices to continue to rise,

399

Microsoft Word - Highlights.doc  

Gasoline and Diesel Fuel Update (EIA)

9 9 1 July 2009 Short-Term Energy Outlook July 7, 2009 Release Highlights After climbing for much of the year, the spot price of West Texas Intermediate (WTI) crude oil hovered around $70 per barrel through most of June. The price of WTI crude oil is expected to average near $70 per barrel through the second half of 2009, an increase of about $18 compared with the average for the first half of the year. The WTI spot price is projected to rise slowly as economic conditions improve, and to average about $72 per barrel in 2010. U.S average prices for regular-grade gasoline, which reached $2.69 per gallon in EIA's June 22 weekly survey, have fallen back slightly. Gasoline prices are

400

Microsoft Word - MPUR_Feb2011_final_rh.docx  

Gasoline and Diesel Fuel Update (EIA)

11 11 1 February 2011 Short-Term Energy Outlook Market Prices and Uncertainty Report 1 February 8, 2011 Release Crude Oil Prices. WTI crude oil spot prices averaged $89 per barrel in January, about the same as the December average, while over the same time period the estimated average cost of all crude oil to U.S. refineries increased by about $1 per barrel. Growing volumes of Canadian crude oil imported into the United States contributed to record-high storage levels at Cushing, Oklahoma, and a price discount for WTI compared with similar quality world crudes such as Brent crude oil. Projected WTI spot prices rise to an average of $95 per barrel in December 2011 and continue to increase to $99 per barrel by the

Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

Microsoft Word - Price Uncertainty Supplement .docx  

Gasoline and Diesel Fuel Update (EIA)

1 1 1 January 2011 Short-Term Energy Outlook Energy Price Volatility and Forecast Uncertainty 1 January 11, 2011 Release Crude Oil Prices. West Texas Intermediate (WTI) crude oil spot prices averaged over $89 per barrel in December, about $5 per barrel higher than the November average. Expectations of higher oil demand, combined with unusually cold weather in both Europe and the U.S. Northeast, contributed to prices. EIA has raised the first quarter 2011 WTI spot price forecast by $8 per barrel from last monthĘąs Outlook to $92 per barrel with a continuing rise to an average $99 per barrel in the fourth quarter of 2012. The projected annual average WTI price is $93 per barrel in 2011 and $98 per barrel in

402

Microsoft Word - feb10-Price Uncertainty Supplement.doc  

Gasoline and Diesel Fuel Update (EIA)

February 2010 February 2010 Short-Term Energy Outlook Energy Price Volatility and Forecast Uncertainty 1 February 12, 2010 Release Crude Oil Prices. WTI crude oil spot prices averaged $78.33 per barrel in January 2010, almost $4 per barrel higher than the prior month's average and matching the $78-per-barrel forecast in last month's Outlook. The WTI spot price peaked at $83.12 on January 6 and then fell to $72.85 on January 29 as the weather turned warm and concerns about the strength of world economic recovery increased. EIA forecasts that WTI spot prices will remain near current levels over the next few months, averaging $76 per barrel in February and March, before rising to about $82 per barrel in the late

403

Structural and Morphologic Study of Shatsky Rise Oceanic Plateau in the Northwest Pacific Ocean from 2D Multichannel Seismic Reflection and Bathymetry Data and Implications for Oceanic Plateau Evolution  

E-Print Network [OSTI]

Shatsky Rise is one of the largest oceanic plateaus, a class of volcanic features whose formation is poorly understood. It is also a plateau that was formed near spreading ridges, but the connection is unclear. The geologic structure and morphology...

Zhang, Jinchang

2014-04-10T23:59:59.000Z

404

Bern, 5. Juli 2010 Nachhaltige Entwicklung an der Universitt Bern  

E-Print Network [OSTI]

...............................................................................................................37 3.3 World Trade Institute (WTI), Prof. Matthi

Richner, Heinz

405

U.S. Energy Information Administration (EIA) - Sector  

Gasoline and Diesel Fuel Update (EIA)

2025, 2035, and 2040 (2011 dollars per barrel) Projections 2011 2025 2035 2040 WTI Brent WTI Brent WTI Brent WTI Brent AEO2013 (Reference case) 94.86 111.26 115.36 117.36...

406

Universit'es de Paris 6 & Paris 7 -CNRS (UMR 7599) PR'EPUBLICATIONS DU LABORATOIRE  

E-Print Network [OSTI]

) "Zti-1 * * (Wti Wti-1) , together with the final data "Ytssn= g(Xsstn). Of course, given (Y= (ti ti-1) E Yti(Wti Wti-1)jFti-1 ss ss ss ss

Université Pierre-et-Marie-Curie, Paris 6

407

America and the Misshaping of a New World Order  

E-Print Network [OSTI]

the World Tribunal on Iraq (WTI) held in Istanbul in Juneinternational criminal law. The WTI heard testimony from ?

Gunn, Giles; Gutiérrez-Jones, Carl

2010-01-01T23:59:59.000Z

408

Uranium: Prices, rise, then fall  

SciTech Connect (OSTI)

Uranium prices hit eight-year highs in both market tiers, $16.60/lb U{sub 3}O{sub 8} for non-former Soviet Union (FSU) origin and $15.50 for FSU origin during mid 1996. However, they declined to $14.70 and $13.90, respectively, by the end of the year. Increased uranium prices continue to encourage new production and restarts of production facilities presently on standby. Australia scrapped its {open_quotes}three-mine{close_quotes} policy following the ouster of the Labor party in a March election. The move opens the way for increasing competition with Canada`s low-cost producers. Other events in the industry during 1996 that have current or potential impacts on the market include: approval of legislation outlining the ground rules for privatization of the US Enrichment Corp. (USEC) and the subsequent sales of converted Russian highly enriched uranium (HEU) from its nuclear weapons program, announcement of sales plans for converted US HEU and other surplus material through either the Department of Energy or USEC, and continuation of quotas for uranium from the FSU in the United States and Europe. In Canada, permitting activities continued on the Cigar Lake and McArthur River projects; and construction commenced on the McClean Lake mill.

Pool, T.C.

1997-03-01T23:59:59.000Z

409

Environmental Assessment for Final Rule, 10 CFR 433, "Energy Efficiency Standards for New Federal Commercial and Multi-Family High-Rise Residential Buildings" (DOE/EA-1918)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Environmental Assessment for Final Rule, 10 CFR 433, "Energy Environmental Assessment for Final Rule, 10 CFR 433, "Energy Efficiency Standards for New Federal Commercial and Multi-Family High-Rise Residential Buildings" (DOE/EA-1918) June 28, 2013 1 Environmental Assessment for Final Rule, 10 CFR 433, "Energy Efficiency Standards for New Federal Commercial and Multi-Family High-Rise Residential Buildings" (DOE/EA-1918) SUMMARY The U.S. Department of Energy (DOE) has prepared this environmental assessment (EA) for DOE's Final Rule, 10 CFR Part 433, "Energy Efficiency Standards for New Federal Commercial and Multi-Family High-Rise Residential Buildings". The Final Rule updates the baseline standard in 10 CFR 433 to the latest private sector standard based on cost-effectiveness and DOE's determination that energy efficiency has

410

Environmental Assessment for Final Rule, 10 CFR 433, "Energy Efficiency Standards for New Federal Commercial and Multi-Family High-Rise Residential Buildings" (DOE/EA-1918)  

Broader source: Energy.gov (indexed) [DOE]

Environmental Assessment for Final Rule, 10 CFR 433, "Energy Environmental Assessment for Final Rule, 10 CFR 433, "Energy Efficiency Standards for New Federal Commercial and Multi-Family High-Rise Residential Buildings" (DOE/EA-1918) June 28, 2013 1 Environmental Assessment for Final Rule, 10 CFR 433, "Energy Efficiency Standards for New Federal Commercial and Multi-Family High-Rise Residential Buildings" (DOE/EA-1918) SUMMARY The U.S. Department of Energy (DOE) has prepared this environmental assessment (EA) for DOE's Final Rule, 10 CFR Part 433, "Energy Efficiency Standards for New Federal Commercial and Multi-Family High-Rise Residential Buildings". The Final Rule updates the baseline standard in 10 CFR 433 to the latest private sector standard based on cost-effectiveness and DOE's determination that energy efficiency has

411

Faster PDE-based simulations using robust composite linear solvers  

Science Journals Connector (OSTI)

Many large-scale scientific simulations require the solution of nonlinear partial differential equations (PDEs). The effective solution of such nonlinear PDEs depends to a large extent on efficient and robust sparse linear system solution. In this paper, ... Keywords: Newton-Krylov methods, composite methods, large-scale PDE-based simulations, multi-algorithms, sparse linear solution

S. Bhowmick; P. Raghavan; L. McInnes; B. Norris

2004-04-01T23:59:59.000Z

412

Faster information dissemination in dynamic networks via network coding  

E-Print Network [OSTI]

We use network coding to improve the speed of distributed computation in the dynamic network model of Kuhn, Lynch and Oshman [STOC '10]. In this model an adversary adaptively chooses a new network topology in every round, ...

Haeupler, Bernhard

413

300x Faster Matlab using MatlabMPI  

E-Print Network [OSTI]

The true costs of high performance computing are currently dominated by software. Addressing these costs requires shifting to high productivity languages such as Matlab. MatlabMPI is a Matlab implementation of the Message Passing Interface (MPI) standard and allows any Matlab program to exploit multiple processors. MatlabMPI currently implements the basic six functions that are the core of the MPI point-to-point communications standard. The key technical innovation of MatlabMPI is that it implements the widely used MPI ``look and feel'' on top of standard Matlab file I/O, resulting in an extremely compact (~250 lines of code) and ``pure'' implementation which runs anywhere Matlab runs, and on any heterogeneous combination of computers. The performance has been tested on both shared and distributed memory parallel computers (e.g. Sun, SGI, HP, IBM and Linux). MatlabMPI can match the bandwidth of C based MPI at large message sizes. A test image filtering application using MatlabMPI achieved a speedup of ~300 using 304 CPUs and ~15% of the theoretical peak (450 Gigaflops) on an IBM SP2 at the Maui High Performance Computing Center. In addition, this entire parallel benchmark application was implemented in 70 software-lines-of-code (SLOC) yielding 0.85 Gigaflop/SLOC or 4.4 CPUs/SLOC, which are the highest values of these software price performance metrics ever achieved for any application. The MatlabMPI software will be available for download.

Jeremy Kepner; Stan Ahalt

2002-07-18T23:59:59.000Z

414

Faster document navigation with space-filling thumbnails  

Science Journals Connector (OSTI)

Scrolling is the standard way to navigate through many types of digital documents. However, moving more than a few pages can be slow because all scrolling techniques constrain visual search to only a small document region. To improve document navigation, ... Keywords: document navigation, scrolling, thumbnails, zooming

Andy Cockburn; Carl Gutwin; Jason Alexander

2006-04-01T23:59:59.000Z

415

Electronic Job Submission For faster job submission, email your jobs  

E-Print Network [OSTI]

Hall--Room V103 303-273-3202 copycenter@mines.edu http://inside.mines.edu/Copy_Center Hours: Spring-up and delivery times are: Fall & Spring Monday thru Thursday 9am to 10am and 3pm to 4pm Summer Monday thru--8.5x11" & 11x17" Matte or Gloss $0.12 Black Leatherette Cover Stock 8.5x11" (for coil and comb bound

Szymczak, Andrzej

416

Electronic Job Submission For faster job submission, email your jobs  

E-Print Network [OSTI]

Hall--Room V103 303-273-3202 copycenter@mines.edu http://inside.mines.edu/Copy_Center Hours: Spring the walking. Delivery times are: Fall & Spring Monday--Thursday 9am to 10am and 3pm to 4pm Friday 9:30am to 10 Stock 8.5x11" (for coil and comb bound books) $0.29 Stapling Binding Options Price includes clear front

417

Production of quantum degenerate strontium gases: Larger, better, faster, colder  

E-Print Network [OSTI]

We report on an improved scheme to generate Bose-Einstein condensates (BECs) and degenerate Fermi gases of strontium. This scheme allows us to create quantum gases with higher atom number, a shorter time of the experimental cycle, or deeper quantum degeneracy than before. We create a BEC of 84-Sr exceeding 10^7 atoms, which is a 30-fold improvement over previously reported experiments. We increase the atom number of 86-Sr BECs to 2.5x10^4 (a fivefold improvement), and refine the generation of attractively interacting 88-Sr BECs. We present a scheme to generate 84-Sr BECs with a cycle time of 2s, which, to the best of our knowledge, is the shortest cycle time of BEC experiments ever reported. We create deeply-degenerate 87-Sr Fermi gases with T/T_F as low as 0.10(1), where the number of populated nuclear spin states can be set to any value between one and ten. Furthermore, we report on a total of five different double-degenerate Bose-Bose and Bose-Fermi mixtures. These studies prepare an excellent starting poi...

Stellmer, Simon; Schreck, Florian

2012-01-01T23:59:59.000Z

418

Innovative Cathode Coating Enables Faster Battery Charging, Dischargin...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

available for licensing: Coating increases electrical conductivity of cathode materials Coating does not hinder battery performance Provides two coating processes that...

419

Toward Faster Nonnegative Matrix Factorization: A New Algorithm and Comparisons  

E-Print Network [OSTI]

for various tasks including text mining, pattern analysis, clustering, and cancer class discovery mining [19], text clustering [21], computer vision [14], and cancer class discovery [4, 9 squares problem that overcomes some limitations of active set methods. We introduce ideas to efficiently

Park, Haesun

420

Energy transport faster than light in good conductors and superconductors  

E-Print Network [OSTI]

People need a model to study tachyons whose prediction can be tested easily. The dispersion relation w^2=k^2C^2-a^2C^2 of a low-frequency electromagnetic field in good conductors is equivalent to the energy-momentum equation E^2=p^2C^2-m^2C^4 of a tachyon where the proportionality coefficient is h^2. An experiment in 1980s to measure the phase velocity Vp [1] can be regarded as an indirect evidence of the superluminal velocity V>>c of those photons just equals the rate of energy flow S/w of the field.Instability of the tachyonic field corresponds to the Joule heat. To detect the speed of energy is difficult and we plan to modulate signals to observe the information velocity (speed of points of non-analyticity)[2].

Z. Y. Wang

2011-01-07T23:59:59.000Z

Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

Hubble's law and faster than light expansion speeds  

E-Print Network [OSTI]

Naively applying Hubble's law to a sufficiently distant object gives a receding velocity larger than the speed of light. By discussing a very similar situation in special relativity, we argue that Hubble's law is meaningful only for nearby objects with non-relativistic receding speeds. To support this claim, we note that in a curved spacetime manifold it is not possible to directly compare tangent vectors at different points, and thus there is no natural definition of relative velocity between two spatially separated objects in cosmology. We clarify the geometrical meaning of the Hubble's receding speed v by showing that in a Friedmann-Robertson-Walker spacetime if the four-velocity vector of a comoving object is parallel-transported along the straight line in flat comoving coordinates to the position of a second comoving object, then v/c actually becomes the rapidity of the local Lorentz transformation, which maps the fixed four-velocity vector to the transported one.

Ali Kaya

2011-07-26T23:59:59.000Z

422

{sup 226}Ra and {sup 231}Pa systematics of axial MORB, crustal residence ages, and magma chamber characteristics at 9--10{degree}N East Pacific Rise  

SciTech Connect (OSTI)

Mass spectrometric measurements of {sup 30}Th-22{sup 226}Ra and {sup 235}-U{sup 231}Pa disequilibria for axial basalts are used to determine crustal residence ages for MORB magma and investigate the temporal and spatial characteristics of axial magma chambers (AMC) at 9--10{degrees}N East Pacific Rise (EPR). Relative crustal residence ages can be calculated from variations in {sup 226}Ra/{sup 230}Th and {sup 231}Pa/{sup 235}U activity ratios for axial lavas, if (1) mantle sources and melting are uniform, and mantle transfer times are constant or rapid for axial N-MORB, and (2) {sup 231}Pa/{sup 235}U and {sup 226}Ra/{sup 230}Th in the melt are unaffected by shallow level fractional crystallization. Uniform Th, Sr, and Nd isotopic systematics and incompatible element ratios for N-MORB along the 9--10{degrees}N segment indicate that mantle sources and transfer times are similar. In addition, estimated bulk solid/melt partition coefficients for U, Th, and Pa are small, hence effects of fractional crystallization on {sup 231}Pa/{sup 235}U ratios for the melt are expected to be negligible. However, fractional crystallization of plagioclase in the AMC would lower {sup 226}Ra/{sup 230}Th ratios in the melt and produce a positive bias in {sup 226}Ra crustal residence ages for fractionated lavas.

Goldstein, S.J.; Murrell, M.T. [Los Alamos National Lab., NM (United States); Perfit, M.R. [Univ., of Florida, Gainesville, FL (United States). Dept. of Geology; Batiza, R. [Univ., of Hawaii, Honolulu, HI (United States); Fornari, D.J. [Woods Hole Oceanographic Institution, MA (United States). Dept. of Geology and Geophysics

1994-06-01T23:59:59.000Z

423

12 - Investigation on Floods in Can Tho City: Influence of Ocean Tides and Sea Level Rise for the Mekong Delta’s Largest City  

Science Journals Connector (OSTI)

The present chapter investigates seasonal fluvial flood hazards to the city of Can Tho in the Mekong Delta, a phenomenon which is likely to be exacerbated by future sea level rise (SLR). Unlike past research, which has mainly focused on flooding due to river discharge from upstream or heavy precipitation, the present chapter scrutinizes the influence of ocean tides, revealing how these can determine water elevation even in an upstream location such as Can Tho city, 80 km inland from the river mouth. In fact, river flow causes tidal damping and effectively reduces the energy of the incoming tides, an effect especially pronounced during the rainy season. Analysis based on the water levels monitored by the Mekong River Commission revealed that the ground near the riverbank of Can Tho had experienced inundation for a total of 215 h between July 2009 and June 2010 (2.5% of the time over a 1-year period). Assuming two scenarios of SLR, of 25 cm by 2050 and 60 cm by 2100, all based on the IPCC AR5’s projections, it was found that the duration of inundation will be prolonged from the present percentage of 2.5% to 7.5% and 24% of the year, respectively. Furthermore, field surveys carried out by the authors showed that recent inundation episodes reached a height of up to 47 cm above the roads of Can Tho’s downtown, highlighting the need for future adaptation measures in the city.

Hiroshi Takagi; Tran Van Ty; Nguyen Danh Thao

2014-01-01T23:59:59.000Z

424

The impact of rising energy prices on household energy consumption and expenditure patterns: The Persian Gulf crisis as a case example  

SciTech Connect (OSTI)

The Iraqi invasion of Kuwait and the subsequent war between Iraq and an international alliance led by the United States triggered immediate increases in world oil prices. Increases in world petroleum prices and in US petroleum imports resulted in higher petroleum prices for US customers. In this report, the effects of the Persian Gulf War and its aftermath are used to demonstrate the potential impacts of petroleum price changes on majority, black, and Hispanic households, as well as on poor and nonpoor households. The analysis is done by using the Minority Energy Assessment Model developed by Argonne National Laboratory for the US Department of Energy (DOE). The differential impacts of these price increases and fluctuations on poor and minority households raise significant issues for a variety of government agencies, including DOE. Although the Persian Gulf crisis is now over and world oil prices have returned to their prewar levels, the differential impacts of rising energy prices on poor and minority households as a result of any future crisis in the world oil market remains a significant long-term issue.

Henderson, L.J. (Baltimore Univ., MD (United States)); Poyer, D.A.; Teotia, A.P.S. (Argonne National Lab., IL (United States). Energy Systems Div.)

1992-09-01T23:59:59.000Z

425

Sea-floor spreading during the past 10 million years on the East Pacific Rise between 35 p0 sS and 53 p0 sS, and the identification of short period pole reversal events  

E-Print Network [OSTI]

the East Pacific Rise between 35 S 0 and 53 S, and the Identification of Short Period Pole Reversal Events (Nay 1974) Robert Joseph Woodward, B. S. Florida State University Chairman of Advisory Committee: Dr. James N. Shapiro Twelve magnetic anomaly..., and activation of the East Pacific Rise 0 north of 35 S. 63 Figure 31. A model showing the resultant anomaly pattern that would occur if a fracture zone is assumed between the EL 28 and FL 20N profiles 65 Figure 32. EL 21 profile compared with a ridge Jump...

Woodward, Robert Joseph

1974-01-01T23:59:59.000Z

426

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incineration facility (East Liverpool, Ohio). Volume 8. Additional analysis in response to peer review recommendations  

SciTech Connect (OSTI)

Contents: Introduction; Combustion Engineering; Air Dispersion and Deposition Modeling; Accident Analysis; Exposure Assessment; Toxicology; and Ecological Risk Assessment.

NONE

1997-05-01T23:59:59.000Z

427

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incineration facility (East Liverpool, Ohio). Volume 7. Accident analysis; selection and assessment of potential release scenarios  

SciTech Connect (OSTI)

In this part of the assessment, several accident scenarios are identified that could result in significant releases of chemicals into the environment. These scenarios include ruptures of storage tanks, large magnitude on-site spills, mixing of incompatible wastes, and off-site releases caused by tranpsortation accidents. In evaluating these scenarios, both probability and consequence are assessed, so that likelihood of occurrence is coupled with magnitude of effect in characterizing short term risks.

NONE

1997-05-01T23:59:59.000Z

428

Risk assessment for the Waste Technologies Industries (WTI) Hazardous Waste Incineration Facility (East Liverpool, Ohio). Volume 3. Characterization of the nature and magnitude of emissions  

SciTech Connect (OSTI)

Contents: Introduction; Data Used in Characterizing Emissions; Incinerator Stack Emissions; Fugitive Emissions; Uncertainty in Emissions Characterization; and References.

NONE

1997-05-01T23:59:59.000Z

429

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incineration facility (East Liverpool, Ohio). Volume 4. Atmospheric dispersion and deposition modeling of emissions  

SciTech Connect (OSTI)

Contents: Introduction; Technical Description of ISC-COMPDEP; Modeling Input Parameters; Discussion of Modeling Results; Summary and Major Assumptions; and References.

NONE

1997-05-01T23:59:59.000Z

430

High-resolution survey of tidal energy towards power generation and influence of sea-level-rise: A case study at coast of New Jersey, USA  

Science Journals Connector (OSTI)

Abstract The first and a crucial step in development of tidal power, which is now attracting more and more attention worldwide, is a reliable survey of temporal and spatial distribution of tidal energy along coastlines. This paper first reviews the advance in assessment of tidal energy, in particular marine hydrokinetic (MHK) energy, and discusses involved challenges and necessary approaches, and then it makes a thorough survey as an illustrative case study on distributions and top sites of MHK energy within the Might-Atlantic-Bight (MAB) with emphasis on the New Jersey (NJ) coastlines. In view of the needs in actual development of tidal power generation and sensitivity of tidal power to flow speed, the former being proportional to the third power of the latter, a high-resolution and detailed modeling is desired. Data with best available accuracy for coastlines, bathymetry, tributaries, etc. are used, meshes as fine as 20 m and less for the whole NJ coast are generated, and the unstructured grid finite volume coastal ocean model (FVCOM) and high performance computing (HPC) facilities are employed. Besides comparison with observation data, a series of numerical tests have been made to ensure reliability of the modeling results. A detailed tidal energy distribution and a list of top sites for tidal power are presented. It is shown that indeed sea-level-rise (SLR) affects the tidal energy distribution significantly. With SLR of 0.5 m and 1 m, tidal energy in NJ coastal waters increases by 21% and 43%, respectively, and the number of the top sties tends to decrease along the barrier islands facing the Atlantic Ocean and increase in the Delaware Bay and the Delaware River. On the basis of these results, further discussions are made on future development for accurate assessment of tidal energy.

H.S. Tang; S. Kraatz; K. Qu; G.Q. Chen; N. Aboobaker; C.B. Jiang

2014-01-01T23:59:59.000Z

431

Stress in the lithosphere from non-tectonic loads with implications for plate boundary processes  

E-Print Network [OSTI]

subduction system Rapid sea level rise at the Black SeaAlso, in cases where sea level rise is much faster than theinstance of rapid sea level rise at the Black Sea, the

Luttrell, Karen Marie

2010-01-01T23:59:59.000Z

432

12/2/08 11:41 AMOpen Membership -Rise of College Club Teams Creates a Whole New Level of Success -NYTimes.com Page 1 of 5http://www.nytimes.com/2008/12/02/sports/02club.html?_r=1&th=&emc=th&pagewanted=print  

E-Print Network [OSTI]

12/2/08 11:41 AMOpen Membership - Rise of College Club Teams Creates a Whole New Level of Success Membership - Rise of College Club Teams Creates a Whole New Level of Success - NYTimes.com Page 2 of 5http=&emc=th&pagewanted=print Open Membership Playing for the Love of the Sport December 2, 2008 OPEN MEMBERSHIP Rise of College Club

Bradley, Elizabeth

433

Abstract crystals Department of Mathematics  

E-Print Network [OSTI]

is a normal crystal define a bijection si : B B by sib = ~f wti(b) i b, if wti(b) 0, ~e -wti(b) i b, if wti, b2 B2} with wti(b1 b2) = wti(b1) + wti(b2), i(b1 b2) = max{i(b1), i(b2) - wt(b1), i }, i(b1 b2

Ram, Arun

434

Fig1.xls  

Gasoline and Diesel Fuel Update (EIA)

December 2009 December 2009 1 December 2009 Short-Term Energy Outlook December 8, 2009 Release Highlights  EIA expects the price of West Texas Intermediate (WTI) crude oil will average about $76 per barrel this winter (October-March). The forecast for the monthly average WTI price dips to $75 early next year then rises to $82 per barrel by December 2010, assuming U.S. and world economic conditions continue to improve. EIA's forecast assumes that U.S. real gross domestic product (GDP) grows by 1.9 percent in 2010 and world oil-consumption-weighted real GDP grows by 2.6 percent.  Rising crude oil prices contribute to an increase in the annual average regular-

435

Microsoft Word - Highlights rev.doc  

Gasoline and Diesel Fuel Update (EIA)

9 9 1 April 2009 Short-Term Energy and Summer Fuels Outlook April 14, 2009 Release Highlights The price of West Texas Intermediate (WTI) crude oil averaged $100 per barrel in 2008. The global economic slowdown is projected to reduce the average price to $53 per barrel this year. Assuming an economic recovery next year, WTI prices are expected to average $63 in 2010. Regular-grade gasoline prices have increased to more than $2 per gallon, rising slowly but steadily since the beginning of the year in conjunction with rising crude oil prices and refiner margins recovering from recent near-historic lows. During this summer driving season (April through September) regular gasoline

436

Peptide translocation by variants of the transporter associated with antigen processing  

Science Journals Connector (OSTI)

...test the transactivational properties of WTI-del2, we used transient transfections...level. In contrast, trans-fection of WTi-del2 led to twofold greater transcriptional...antagonistic effect of wild-type W/Ti and WTI-del2 suggests that W/Ti function may...

MT Heemels; TN Schumacher; K Wonigeit; HL Ploegh

1993-12-24T23:59:59.000Z

437

The impact of uncertainty and risk measures  

E-Print Network [OSTI]

West Texas Intermediate (WTI) price series begins in 1983,West Texas In- termediate (WTI) is used to estimate theof data sets by using WTI for both the main VAR and realized

Jo, Soojin; Jo, Soojin

2012-01-01T23:59:59.000Z

438

Animal-Vehicle Collision Data Collection Throughout the United States and Canada  

E-Print Network [OSTI]

Montana State University (WTI-MSU), P.O. Box 174250,and population dynamics. At WTI-MSU, Julie worked withroad ecology projects at WTI-MSU. She is currently working

Huijser, Marcel P.; Wagner, Meredith E.; Hardy, Amanda; Clevenger, Anthony P.; Fuller, Julie A.

2007-01-01T23:59:59.000Z

439

Large-Scale Variability Characterization and Robust Design Techniques for Nanoscale SRAM  

E-Print Network [OSTI]

2.22 Definition of WTV and WTI from measured N-DD . The write trip current (WTI) is defined as the currentthe definitions of WTV and WTI on the N-curve. One important

Guo, Zheng

2009-01-01T23:59:59.000Z

440

ARE Update Volume 11, Number 5  

E-Print Network [OSTI]

West Texas Intermediate (WTI), which describes the grade ofarticle, we describe how the WTI spot price relates to worldCushing is a hub at which WTI and other domestic crude oils

de Wit, Joeri; Smith, Aaron; Kovacs, Kent; Simon, Leo K.; Stratton, Susan

2008-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

Classification and characterization of topological insulators and superconductors  

E-Print Network [OSTI]

Weak topological insulators (WTI) . . . . . 1.4 Topologicalweak topological insulators (WTI). The surfaces of STIs haveSTI STM TI TRIM/TRIMs TRS TKNN VPT WTI one-dimension, two-

Mong, Roger

2012-01-01T23:59:59.000Z

442

Comparison of measured and calculated dose rates for the castor® HAW 20/28 CG  

Science Journals Connector (OSTI)

......Scheib 2 A. Rimpler 2 Corresponding author: kuehl@wti.wse.de 1 WTI Wissenschaftlich-Technische Ingenieurberatung GmbH...10) dose rate from the Bonner sphere system. | WTI Wissenschaftlich-Technische Ingenieurberatung GmbH......

O. Ringleb; H. Kühl; H. Scheib; A. Rimpler

2005-12-20T23:59:59.000Z

443

354 2010 IEEE International Solid-State Circuits Conference ISSCC 2010 / SESSION 19 / HIGH-PERFORMANCE EMBEDDED MEMORY / 19.7  

E-Print Network [OSTI]

.92) with the write trip current (WTI) met- ric. Although WTI is a static current metric [4], it reflects dynamic WTI, however, requires access to internal nodes, which is impractical in dense SRAM arrays. Figure 19

Nikolic, Borivoje

444

Expression of the Wilms' tumor suppressor gene WT1 during mouse embryogenesis  

Science Journals Connector (OSTI)

...ifferential Regulation of the Wilms' Tumor Gene, WTI, during Differentiation of Embryonal Carcinoma...pattern of the Wilms' tumor suppressor gene, WTI, during embryonal development suggests a role for the WTI proteins in the differentiation of specific...

RR Rackley; AM Flenniken; NP Kuriyan; PM Kessler; MH Stoler; BR Williams

1993-12-01T23:59:59.000Z

445

General Langevin Equation and Anomaly  

Science Journals Connector (OSTI)

......anomalous chiral Ward- Takahashi identity (WTI). Thus, we have found out that the anomalous chiral WTI is obtained by rewriting the trivial stationary...obtain the conventional regularized chiral WTI, (2 12) Next, let us consider how the above......

Satoshi Tanaka

1993-01-01T23:59:59.000Z

446

Increased expression of the insulin-like growth factor I receptor gene, IGF1R, in Wilms tumor is correlated with modulation of IGF1R promoter activity by the WT1 Wilms tumor gene product  

Science Journals Connector (OSTI)

...expression of the Wilms tumor suppressor gene WTI, whose inactivation appears to be a key step...constructs driving luciferase reporter genes and with WTI expression vectors showed that the active WTI gene product represses IGF-IR promoter activity...

H Werner; G G Re; I A Drummond; V P Sukhatme; F J Rauscher; 3rd; D A Sens; A J Garvin; D LeRoith; C T Roberts; Jr

1993-01-01T23:59:59.000Z

447

Homozygous somatic Wt1 point mutations in sporadic unilateral Wilms tumor.  

Science Journals Connector (OSTI)

...1993 Medical Sciences Homozygous somatic WTI point mutations in sporadic unilateral...loci. A Wilms tumor suppressor gene, WTI, at chromosome 11 band p13, has recently been cloned and characterized. WTI has been implicated in the develop- ment...

M J Coppes; G J Liefers; P Paul; H Yeger; B R Williams

1993-01-01T23:59:59.000Z

448

Microsoft Word - Highlights.doc  

Gasoline and Diesel Fuel Update (EIA)

10 10 1 November 2010 Short-Term Energy Outlook November 9, 2010 Release Highlights  EIA expects the price of West Texas Intermediate (WTI) crude oil to average about $83 per barrel this winter (October 1 to March 31), a $5.50-per-barrel increase over last winter and $3 per barrel more than in last month's Outlook. Projected WTI prices rise gradually to $87 per barrel by the fourth quarter of 2011 as U.S. and global economic conditions improve. EIA's forecast assumes U.S. gross domestic product (GDP) grows by 2.6 percent in 2010 and 2.2 percent in 2011, while world real GDP weighted by oil consumption grows by 3.9 percent and 3.3 percent, respectively.

449

Microsoft Word - Highlights.docx  

Gasoline and Diesel Fuel Update (EIA)

January 2012 January 2012 1 Independent Statistics & Analysis U.S. Energy Information Administration January 2012 Short-Term Energy Outlook January 10, 2012 Release Highlights  This edition of the Short-Term Energy Outlook is the first to include forecasts for 2013.  EIA expects the price of West Texas Intermediate (WTI) crude oil to average about $100 per barrel in 2012, $5 per barrel higher than the average price last year. For 2013, EIA expects WTI prices to continue to rise, reaching $106 per barrel in the fourth quarter of next year. EIA's forecast assumes that U.S. real gross domestic product (GDP) grows by 1.8 percent in 2012 and 2.5 percent in

450

Microsoft Word - Highlights.doc  

Gasoline and Diesel Fuel Update (EIA)

10 10 1 December 2010 Short-Term Energy Outlook December 7, 2010 Release Highlights  EIA expects the price of West Texas Intermediate (WTI) crude oil to average about $84 per barrel this winter (October 1 to March 31), more than $6 higher than the average price last winter. Projected WTI prices rise to $89 per barrel by the end of 2011, a $2 per barrel increase from last month's Outlook, as U.S. and global economic conditions improve. EIA's forecast assumes U.S. real gross domestic product (GDP) grows 2.7 percent in 2010 and 2.1 percent in 2011, while world real GDP (weighted by oil consumption) grows by 4.0 percent and 3.2 percent, in 2010 and 2011, respectively.

451

Microsoft Word - Price Uncertainty Supplement.doc  

Gasoline and Diesel Fuel Update (EIA)

May 2010 May 2010 Short-Term Energy Outlook Energy Price Volatility and Forecast Uncertainty 1 May 11, 2010 Release Crude Oil Prices. WTI crude oil spot prices averaged $84 per barrel in April 2010, about $3 per barrel above the prior month's average and $2 per barrel higher than forecast in last month's Outlook. EIA projects WTI prices will average about $84 per barrel over the second half of this year and rise to $87 by the end of next year, an increase of about $2 per barrel from the previous Outlook (West Texas Intermediate Crude Oil Price Chart). Energy price forecasts are highly uncertain, as history has shown. Prices for near-term futures options contracts suggest that the market attaches

452

Microsoft Word - MPUR_Aug2011_review.docx  

Gasoline and Diesel Fuel Update (EIA)

1 1 1 August 2011 Short-Term Energy Outlook Market Prices and Uncertainty Report 1 August 9, 2011 Release Crude Oil Prices. West Texas Intermediate (WTI) crude oil front month futures prices remained in a tight range for the month of July, rising from a low of $94.94 at the beginning of the month to just under $100 on July 22 (Figure 1). However, after downward revisions to first half U.S. GDP, released on July 29, WTI prices fell dramatically to settle at $86.63 on August 4. The first quarter U.S. growth estimate was cut sharply to a level of 0.4 percent by the Department of Commerce, well under both the economist survey expectations and the previous estimate of 1.9

453

Microsoft Word - Highlights.doc  

Gasoline and Diesel Fuel Update (EIA)

9 9 1 November 2009 Short-Term Energy Outlook November 10, 2009 Release Highlights  EIA is raising the forecast price of West Texas Intermediate (WTI) crude oil by $7 per barrel compared with the last Outlook, to average about $77 per barrel this winter (October-March). The forecast for monthly average WTI prices rises to about $81 per barrel by December 2010, assuming U.S. and world economic conditions continue to improve, particularly in Asia, where current growth has been stronger than expected. EIA's forecast assumes U.S. real gross domestic product (GDP) grows by 1.9 percent in 2010 and world oil-consumption- weighted real GDP grows by 2.6 percent.

454

Microsoft Word - Highlights.doc  

Gasoline and Diesel Fuel Update (EIA)

11 11 1 January 2011 Short-Term Energy Outlook January 11, 2011 Release Highlights  This edition of the Short-Term Energy Outlook is the first to include forecasts (monthly, quarterly and annual) through December 2012.  EIA expects the price of West Texas Intermediate (WTI) crude oil to average about $93 per barrel in 2011, $14 higher than the average price last year. For 2012, EIA expects WTI prices to continue to rise, with a forecast average price of $99 per barrel in the fourth quarter 2012. EIA's forecast assumes U.S. real gross domestic product (GDP) grows 2.2 percent in 2011 and 2.9 percent in 2012, while world real GDP (weighted by oil consumption) grows by 3.3

455

EIA - Annual Energy Outlook 2012 Early Release  

Gasoline and Diesel Fuel Update (EIA)

Prices Prices Crude Oil figure dataPrices for crude oil3 in 2011 remained generally in a range between $85 and $110 per barrel. In 2011, WTI prices were lower than Brent prices because of pipeline capacity constraints that prevented complete arbitrage between WTI and Brent prices. Real imported sweet crude oil prices (2010 dollars) in the AEO2012 Reference case rise to $120 per barrel in 2016 (Figure 5) as pipeline capacity from Cushing, Oklahoma, to the Gulf Coast increases, the world economy recovers, and global demand grows more rapidly than the available supplies of liquids from producers outside the Organization of the Petroleum Exporting Countries (OPEC). In 2035, the average real price of crude oil in the Reference case is about $145 per barrel in 2010 dollars, or about $230 per barrel in nominal dollars.

456

Short Term Energy Outlook ,November 2002  

Gasoline and Diesel Fuel Update (EIA)

November 2002 November 2002 1 Short-Term Energy Outlook November 2002 Overview World Oil Markets: During the past 3-4 months, OPEC 10 production has risen more quickly than projected, thus reducing upward pressure on prices. More specifically, while the West Texas Intermediate (WTI) crude oil spot price averaged $28.84 in October, about $6.70 per barrel above the year-ago level (Figure 1), the WTI average price for fourth quarter 2002 is now projected to soften to $28.20, which is about $2 per barrel below our fourth-quarter projection from last month. Meanwhile, OECD inventory levels, which are now approaching 5 -year lows, should begin to rise over the next few months as additional supplies reach markets, and return to the middle of their observed range by spring.

457

Highlights.doc  

Gasoline and Diesel Fuel Update (EIA)

Short-Term Energy Outlook April 2002 Overview World Oil Markets: Average crude oil prices moved up strongly in March, rising nearly $4 from the average February level to $24.50 per barrel for West Texas Intermediate (WTI). A stronger sentiment on the side of OPEC production discipline, a growing sense by the market that economic growth may accelerate more rapidly than previously thought, and continued uncertainty surrounding tensions in the Middle East have elevated near-term prices above previous expectations and have caused us to raise expected average WTI prices for 2002 by about $2 per barrel from last month's projected $22.80. Continued strong compliance by OPEC producers to meet current quotas through the second quarter of this year and continued momentum toward economic

458

Highlights.doc  

Gasoline and Diesel Fuel Update (EIA)

July 2003 July 2003 1 Short-Term Energy Outlook July 2003 Overview World Oil Markets. The average West Texas Intermediate (WTI) crude oil price for June was up by about $2.50 per barrel from the May average, in part because OECD oil inventories remain low by historical standards. Oil prices are not likely to fall significantly until commercial inventories rise to levels observed in recent years. EIA's Outlook is for prices to remain firm throughout the rest of 2003 (in the $29- $30 per barrel range for WTI) then gradually slide toward $26 per barrel by the end of 2004 as Iraqi oil exports return to near pre-war levels (Figure1). U.S. Natural Gas Markets. Working gas storage injections for June made up considerable ground following a slow start in early spring, posting a record increase of 487 billion cubic feet for the month and

459

Microsoft Word - Highlights.doc  

Gasoline and Diesel Fuel Update (EIA)

February 2010 February 2010 1 February 2010 Short-Term Energy Outlook February 10, 2010 Release Highlights  Crude oil prices continue to fluctuate. The West Texas Intermediate (WTI) spot price increased from $69.48 per barrel on December 14 to $83.12 on January 6 and then fell to $72.85 on January 29. EIA expects the crude oil market to strengthen again this spring with WTI rising to an average of about $81 per barrel over the second half of this year and $84 per barrel in 2011. The crude oil price forecast is unchanged from last month's Outlook. EIA's forecast assumes that U.S. real gross domestic product (GDP) grows by 2.3 percent in 2010 and

460

Microsoft PowerPoint - gallery-cover page.ppt  

Gasoline and Diesel Fuel Update (EIA)

March 2010 March 2010 1 March 2010 Short-Term Energy Outlook March 9, 2010 Release Highlights  Although spot crude oil prices continue to fluctuate on a daily basis, EIA's projections for West Texas Intermediate (WTI) crude oil spot prices have remained relatively stable over the last 4 Outlooks. EIA expects WTI prices to average above $80 per barrel this spring, rising to an average of about $82 per barrel by the end of the year and to $85 per barrel by the end of 2011.  Projected economic growth this year is higher in this forecast, with U.S. real gross domestic product (GDP) growing by 2.8 percent and world oil- consumption-weighted real GDP growing by 3.4 percent, compared with 2.3

Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

Microsoft Word - Highlights.doc  

Gasoline and Diesel Fuel Update (EIA)

11 11 1 February 2011 Short-Term Energy Outlook February 8, 2011 Release Highlights  EIA expects the price of WTI crude oil to average about $93 per barrel in 2011, $14 higher than the average price last year. For 2012, EIA projects that WTI prices will continue to rise, averaging $98 per barrel. EIA's forecast assumes U.S. real gross domestic product (GDP) grows 3.0 percent in 2011 and 2.8 percent in 2012, while world real GDP (weighted by oil consumption) grows by 3.9 percent and 4.0 percent, respectively, in 2011 and 2012.  EIA expects regular-grade motor gasoline retail prices to average $3.15 per gallon in 2011, 37 cents per gallon higher than the 2010 average, and $3.30 per

462

Microsoft Word - Price Uncertainty Supplement.doc  

Gasoline and Diesel Fuel Update (EIA)

0 0 1 June 2010 Short-Term Energy Outlook Energy Price Volatility and Forecast Uncertainty 1 June 8, 2010 Release Crude Oil Prices. WTI crude oil spot prices averaged less than $74 per barrel in May 2010, almost $11 per barrel below the prior month's average and $7 per barrel lower than forecast in last month's Outlook. EIA projects WTI prices will average about $79 per barrel over the second half of this year and rise to $84 by the end of next year, a decrease of about $3 per barrel from the previous Outlook (West Texas Intermediate Crude Oil Price Chart). Energy price forecasts are highly uncertain, as history has shown. Prices for near-term futures options contracts suggest that the market attaches

463

Microsoft Word - Price Uncertainty Supplement.doc  

Gasoline and Diesel Fuel Update (EIA)

April 2010 April 2010 Short-Term Energy Outlook Energy Price Volatility and Forecast Uncertainty 1 April 6, 2010 Release Crude Oil Prices. WTI crude oil spot prices averaged $81 per barrel in March 2010, almost $5 per barrel above the prior month's average and $3 per barrel higher than forecast in last month's Outlook. Oil prices rose from a low this year of $71.15 per barrel on February 5 to $80 per barrel by the end of February, generally on news of robust economic and energy demand growth in non-OECD Asia and the Middle East, and held near $81 until rising to $85 at the start of April. EIA expects WTI prices to average above $81 per barrel this summer, slightly less that $81 for 2010 as a whole,

464

Discrete Time Approximation and Monte-Carlo Simulation of Backward Stochastic Differential Equations  

E-Print Network [OSTI]

, ~Z ti-1 )(ti - ti-1) - ~Zti-1 · (Wti - Wti-1 ) , together with the final data ~Y tn = g(X tn-time approximation (Y , Z) : Y tn = g X tn , Z ti-1 = (ti - ti-1)-1 E Y ti (Wti - Wti-1 )|Fti-1 Y ti-1 = E Y ti, involved in the above discretization scheme, reduce to the regression of Y ti and Y ti (Wti - Wti-1

Université Pierre-et-Marie-Curie, Paris 6

465

Dielectric-wall linear accelerator with a high voltage fast rise time switch that includes a pair of electrodes between which are laminated alternating layers of isolated conductors and insulators  

DOE Patents [OSTI]

A dielectric-wall linear accelerator is improved by a high-voltage, fast rise-time switch that includes a pair of electrodes between which are laminated alternating layers of isolated conductors and insulators. A high voltage is placed between the electrodes sufficient to stress the voltage breakdown of the insulator on command. A light trigger, such as a laser, is focused along at least one line along the edge surface of the laminated alternating layers of isolated conductors and insulators extending between the electrodes. The laser is energized to initiate a surface breakdown by a fluence of photons, thus causing the electrical switch to close very promptly. Such insulators and lasers are incorporated in a dielectric wall linear accelerator with Blumlein modules, and phasing is controlled by adjusting the length of fiber optic cables that carry the laser light to the insulator surface. 12 figs.

Caporaso, G.J.; Sampayan, S.E.; Kirbie, H.C.

1998-10-13T23:59:59.000Z

466

Influence of Dynamic Land Use and Land Cover Change on Simulated Global Terrestrial Carbon and Nitrogen Cycles, Climate-carbon Cycle Feedbacks, and Interactions with Rising CO2 and Anthropogenic Nitrogen Deposition  

SciTech Connect (OSTI)

Previous work has demonstrated the sensitivity of terrestrial net carbon exchange to disturbance history and land use patterns at the scale of individual sites or regions. Here we show the influence of land use and land cover dynamics over the historical period 1850-present on global-scale carbon, nutrient, water, and energy fluxes. We also explore the spatial and temporal details of interactions among land use and disturbance history, rising atmospheric carbon dioxide consentation, and increasing anthropogenic nitrogen deposition. Our simulations show that these interactions are significant, and that their importance grows over time, expressed as a fraction of the independent forcing terms. We conclude with an analysis of the influence of these interactions on the sign and magnitude of global climate-carbon cycle feedbacks.

Thornton, Peter E [ORNL; Hoffman, Forrest M [ORNL; Hurtt, George C [University of Hew Hampshire

2009-12-01T23:59:59.000Z

467

DC SQUID spectrometers for nuclear quadrupole and low-field nuclear magnetic resonance spectroscopy  

E-Print Network [OSTI]

as dpJdt + O, where The thermal transition rates Wti can bewritten as Wti = By Wji , where By is the Boltzmann ratio (

TonThat, D.H.

2011-01-01T23:59:59.000Z

468

Menace and Management: Power in the Human-Monkey Social Worlds of Delhi and Shimla  

E-Print Network [OSTI]

time. According to the WTI report, the monkey facilities at86 All of this, claims the WTI report, was jeopardized by

Solomon, Daniel Allen

2013-01-01T23:59:59.000Z

469

2006 Long Range Development Plan Final Environmental Impact Report  

E-Print Network [OSTI]

Glenwood, New Mexico, [WTI 02-1], 1995. Zeiner, D.C. , W.F.Manual, Glenwood, New Mexico, [WTI 02-1], 1995. Yee, Henry,

Philliber, Jeff

2007-01-01T23:59:59.000Z

470

In the Beginnings: The Apotropaic Use of Scriptural Incipits in Late Antique Egypt  

E-Print Network [OSTI]

katafugh~j tou~ sw~sai/ me. wti krataiwsij k(ai\\ ) katafugh/read me); me (read moi); wti (read o#ti) krataiwsij (read

Sanzo, Joseph Emanuel

2012-01-01T23:59:59.000Z

471

R.H. Shumway and D.S. Stoffer Time Series Analysis and Its Applications  

E-Print Network [OSTI]

.1) and below: Write wti instead of wit, and write cov(wti, wtj) instead of cov(wit, wjt) for consistency. · p

472

Generalized fractional smoothness and Lp-variation of BSDEs with non-Lipschitz  

E-Print Network [OSTI]

-distance between the stochastic integral T 0 ZsdWs and its discrete counterpart n i=1 Zti-1 (Wti -Wti-1 ) is upper

Paris-Sud XI, Université de

473

Universitat Tubingen Mathematisches Institut  

E-Print Network [OSTI]

i=0 Wi (Wti+1 - Wti ) des Integrals t 0 WsdWs, wobei i = (1 - )ti + ti+1. Zeigen Sie lim 0 R = 1 2 W

Tübingen, Universität

474

Isolation and characterization of a cDNA clone for the Cat2 gene in maize and its homology with other catalases  

Science Journals Connector (OSTI)

...EAVIY|CKFHYKTDQGIIKNIL|PVEEA|GRLAQEDjPIDYGLRbDLIFNAIAS|G|NYIPS|WTI BWV LVINADIGIEAVIY|CKFHYKTDQIGIIKNIL|SVEDA|ARLAHEDIP|DYGLRIDLIFNAIAT|G|NYIPS|WTI HNIM LEVINANIGEAVIYICKFNYKTDQGIIKNIL|SVEDA|ARLSQED PIDYGIR[LIFNAIAT...

L A Bethards; R W Skadsen; J G Scandalios

1987-01-01T23:59:59.000Z

475

Effective Rural ITS Outreach: The California Program for  

E-Print Network [OSTI]

stakeholder involvement methods, and examples of how the Western Transportation Institute (WTI), Montana State were prioritized to local conditions, WTI and Caltrans conducted a of pilot workshop. Based

McGowen, Patrick

476

Analyzing Static and Dynamic Write Margin for Nanometer  

E-Print Network [OSTI]

: Static Approaches `0' `1' BL Sweep (VBL) N-Curve (WTV,WTI) WM WM WTI WTV #12;10/6/2008 ISLPED 2008 5

Calhoun, Benton H.

477

BROWNIAN MOTION INDEXED BY A TIME SCALE DAVID GROW AND SUMAN SANYAL  

E-Print Network [OSTI]

on the proba- bility space (C0[0, ), P) and the increments Wti - Wti-1 are normally distributed with mean zero

Sanyal, Suman

478

Discrete-time approximation of doubly reflected BSDEs Jean-Franois Chassagneux  

E-Print Network [OSTI]

} such that and define (Y , ÂŻZ) by the backward induction: ÂŻZ ti = (ti+1 - ti)-1 E (Wti+1 - Wti )(Y ti+1 ) | Fti

Paris-Sud XI, Université de

479

Microsoft Word - Highlights.doc  

Gasoline and Diesel Fuel Update (EIA)

7 7 1 November 2007 Short-Term Energy Outlook November 6, 2007 Release Highlights Global oil markets will likely remain stretched, as world oil demand has continued to grow much faster than oil supply outside of the Organization of the Petroleum Exporting Countries (OPEC), putting pressure on OPEC and inventories to bridge the gap. Additional fundamental factors contributing to price volatility include ongoing geopolitical risks, OECD inventory tightness, and worldwide refining bottlenecks. As a consequence, crude oil prices are expected to remain high and volatile. (See this month's supplemental report, Why are oil prices so high?). This situation has resulted in West Texas Intermediate (WTI) crude oil prices

480

Why Are Gasoline Prices Rising so Fast  

Gasoline and Diesel Fuel Update (EIA)

Statement of John Cook Statement of John Cook Before the Committee on Government Reform Subcommittee on Energy Policy, Natural Resources and Regulatory Affairs U.S. House of Representatives June 14, 2001 Thank you Mr. Chairman and members of the Committee for the opportunity to testify today. Gasoline prices have begun declining, as expected, from this spring's apparent peak price of $1.71 on May 14, with the national average for regular gasoline at $1.65 per gallon as of June 11 (Figure 1). Between late March and mid-May, retail prices rose 31 cents per gallon, with some regions experiencing even greater increases. Like last year, Midwest consumers saw some of the largest increases, and along with California, some of the highest prices. Prices in the Midwest increased 43 cents per

Note: This page contains sample records for the topic "wti rising faster" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

Washington: Seattle Rises Above with Alternative Fuels  

Office of Energy Efficiency and Renewable Energy (EERE)

From the airport's baggage carriers to the taxis, Seattle's efforts to reduce petroleum in transportation will improve their local energy and environmental security, as well as help tourists realize the benefits of alternative fuels.

482

Methane on the Rise—Again  

Science Journals Connector (OSTI)

...hydraulic fracturing is increasingly important. In Utah, fracking may locally leak 6 to 12% of gas production to the air (13). A full understanding of the greenhouse impact of fracking requires monitoring over the gas-well lifetime and analysis...

Euan G. Nisbet; Edward J. Dlugokencky; Philippe Bousquet

2014-01-31T23:59:59.000Z

483

Rise-M-2173 ACCELERATOR DEPARTMENT  

E-Print Network [OSTI]

conductivity equipment 5 2.5 Flash-photolysis equipment 5 2.6 Accelerator exit window assembly S 2.7 High.1 Radiochromic dye film dose meters 8 3.2 Dose measurements 9 3.3 Microdosimetry 9 3.4 Dosimetry at low energy 11

484

Syncreticity rising: Elizabeth Peabody's Aesthetic papers  

E-Print Network [OSTI]

up to them "exclusively male intellectual milieus, " while at the same time allowing them to enrich their own knowledge (187). Peabody and Margaret Fuller, she adds, were h&stru- mental in disseminating f'oreign works to members... for Aesthetic F'o)iei. s and serves as their unifying element. Clarence Gohdes in The Periodicals of American Transcen dentalism writes that this introductory essay on aesthetics was unlikely to ) 7 attract popular interest and indicates "bv its decidedly...

Schultz, Catherine Antoinette

2012-06-07T23:59:59.000Z

485

i W Rise-R-421 Environmental  

E-Print Network [OSTI]

diet, and human bone. Further- 90 more, Sr was determined in local samples of air, rain water, grass, sea plants, fish, and meat. Cesium-137 was determined in sea water, sediments, milk, grain products products ( Co, Co, Zn, Mn). Finally the report includes routine surveys of environmental samples from

486

The Rising Tide of Patent Damages  

E-Print Network [OSTI]

infringement on a reasonable royalty of 0.5% per licensedby multiplying the 0.5% royalty times the average price of aapparently applied the 0.5% royalty to each of the infringed

Gilbert, Richard J

2010-01-01T23:59:59.000Z

487

Empire Rising: International Law & (and) Imperial Japan  

E-Print Network [OSTI]

I saw the terrible lightning flash five times; five times Iand raises his weapon-a flash of lightning, a clean slash, a

Lee, David S.

2006-01-01T23:59:59.000Z

488

Rise of interdisciplinary research on climate  

Science Journals Connector (OSTI)

...professional meteorology program at the Massachusetts Institute of Technology. After his...Mandans,” remarked J. A. Eddy, a solar physicist who took up climate studies...An astrophysicist studying changes in solar energy, a geochemist studying the movements...

Spencer Weart

2013-01-01T23:59:59.000Z

489

Delayed carbon sequestration and rising carbon prices  

Science Journals Connector (OSTI)

We set out a dynamic model to investigate optimal time paths of emissions, carbon stocks and carbon sequestration by land conversion, allowing for non-instantaneous carbon sequestration. Previous research in a dy...

Alejandro Caparrós

2009-10-01T23:59:59.000Z

490

Methane on the Rise—Again  

Science Journals Connector (OSTI)

...increasingly important. In Utah, fracking may locally leak 6 to 12% of...understanding of the greenhouse impact of fracking requires monitoring over the...Supported in part by the UK Natural Environment Research Council MAMM and Tropical...

Euan G. Nisbet; Edward J. Dlugokencky; Philippe Bousquet

2014-01-31T23:59:59.000Z

491

Britain Rises to Japan's Computer Challenge  

Science Journals Connector (OSTI)

...natural gas production to be released...1-million-barrel-a-day increase in oil...following: * Per capita energy...Btu's-was reached in 1973, just before...2 percent. OPEC production was at its lowest...million barrels a day. * The use of...

DAVID DICKSON

1983-05-20T23:59:59.000Z

492

Rise Report No. 358 Ris National Laboratory  

E-Print Network [OSTI]

. Discussion of the Spin Wave Spectrum and Neutron Scattering Cross Section for a Cone Structure 51 General Dispersion Relations and Neutron Scattering Cross Section with Special Attention to Anisotropy Effects: by P. LindgĂĄrd, IAEA Symposium on Neutron Inelastic Scattering, Copenhagen 1968, Vienna, IAEA, 93

493

Rise of interdisciplinary research on climate  

Science Journals Connector (OSTI)

...climatologists about the largest floods that could be expected according...only to suffer 50-year floods in each of the next 3 years...what factors contributed to floods, and so forth (32...at a 1965 symposium held in Boulder, Colorado, on “Causes of Climate...

Spencer Weart

2013-01-01T23:59:59.000Z

494

Rise of interdisciplinary research on climate  

Science Journals Connector (OSTI)

...climatologists about the largest floods that could be expected...only to suffer 50-year floods in each of the next 3 years...factors contributed to floods, and so forth (32...1965 symposium held in Boulder, Colorado, on “Causes of Climate Change...

Spencer Weart

2013-01-01T23:59:59.000Z

495

Rise of interdisciplinary research on climate  

Science Journals Connector (OSTI)

...climatologists about the largest floods that could be expected according...only to suffer 50-year floods in each of the next 3 years...what factors contributed to floods, and so forth (32...symposium held in Boulder, Colorado, on “Causes of Climate Change...

Spencer Weart

2013-01-01T23:59:59.000Z

496

Worker productivity rises with energy efficiency  

SciTech Connect (OSTI)

Many American companies have found that saving energy and cutting pollution dramatically improves the bottom line. But beyond these gains, businesses that launch energy efficiency programs to save money are often astonished to discover unforeseen benefits: energy efficient lighting, heating, cooling, motors, and industrial processes can increase worker productivity, decrease absenteeism, and improve the quality of work performed. Profits created by the jump in worker productivity can exceed energy savings by a factor of ten. Energy efficiency and pollution prevention represent the next wave in manufacturing, following the quality revolution launched by the Japanese in the 1960s. Unless America leads the lean and clean revolution, economic health will be undermined as other countries develop clean processes and products and US companies suffer competitively. Also, developing countries will leapfrog their wasteful model and buy products and manufacturing processes from foreign firms already practicing lean and clean.

Romm, J.J. (Dept. of Energy, Washington, DC (United States))

1995-01-01T23:59:59.000Z

497

-> Rise Report No. 355 Ris National Laboratory  

E-Print Network [OSTI]

Survey 5 2. I. Geology and Mineralogy of the Ore 5 2. 2. Recovery of Uranium, Choice of Method 11 2 of a Greenlandic Uranium Ore, F Reactivity of Minerals and Recovery o o \\J by J. K. Gamborg Hansen ft March 1977 REFRACTORIES ROASTING SULFATES SULFUR OXIDES THERMAL GRAVIMETRIC ANALYSIS URANIUM ORES X-RAY DIFFRACTION UDC

498

Draft Environmental Assessment for Proposed Rule, 10 CFR Part 433, ÂŤEnergy Conservation and Fossil Fuel-Generated Energy Consumption Reduction Standards for the Design and Construction of New Federal Commercial and Multi-Family High-Rise Residential BuildingsÂŽ  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Draft Environmental Assessment for Proposed Rule, 10 CFR Part 433, Draft Environmental Assessment for Proposed Rule, 10 CFR Part 433, "Energy Conservation and Fossil Fuel-Generated Energy Consumption Reduction Standards for the Design and Construction of New Federal Commercial and Multi-Family High-Rise Residential Buildings" and 10 CFR Part 435 "Energy Conservation and Fossil Fuel-Generated Energy Consumption Reduction Standards for the Design and Construction of New Federal Low-Rise Residential Buildings" (DOE/EA-1778) 2 SUMMARY The U.S. Department of Energy (DOE) has prepared this Environmental Assessment (EA) for DOE's Proposed Rule, 10 CFR Part 433, "Energy Conservation and Fossil Fuel-Generated Energy Consumption Reduction Standards for the Design and Construction of New Federal Commercial and Multi-Family High-Rise Residential

499

Draft Environmental Assessment for Proposed Rule, 10 CFR Part 433, ÂŤEnergy Conservation and Fossil Fuel-Generated Energy Consumption Reduction Standards for the Design and Construction of New Federal Commercial and Multi-Family High-Rise Residential BuildingsÂŽ  

Broader source: Energy.gov (indexed) [DOE]

Draft Environmental Assessment for Proposed Rule, 10 CFR Part 433, Draft Environmental Assessment for Proposed Rule, 10 CFR Part 433, "Energy Conservation and Fossil Fuel-Generated Energy Consumption Reduction Standards for the Design and Construction of New Federal Commercial and Multi-Family High-Rise Residential Buildings" and 10 CFR Part 435 "Energy Conservation and Fossil Fuel-Generated Energy Consumption Reduction Standards for the Design and Construction of New Federal Low-Rise Residential Buildings" (DOE/EA-1778) 2 SUMMARY The U.S. Department of Energy (DOE) has prepared this Environmental Assessment (EA) for DOE's Proposed Rule, 10 CFR Part 433, "Energy Conservation and Fossil Fuel-Generated Energy Consumption Reduction Standards for the Design and Construction of New Federal Commercial and Multi-Family High-Rise Residential

500

Psychological barriers in oil futures markets  

Science Journals Connector (OSTI)

Abstract WTI and Brent futures are tested for the presence of psychological barriers around $10 price levels, applying a multiple hypothesis testing approach for statistical robustness. Psychological barriers are found to be present in Brent prices but not in WTI prices, which is argued to be due to the more prominent role that Brent plays as a global benchmark and, based on recent behavioural finance research, the greater complexity inherent in Brent fundamental value determination. Brent particularly displays evidence that when breaching a $10 barrier level from below with rising prices, the trend is for prices to fall on average subsequently. Similar behavioural-based patterns are evidenced at the $1 barrier level for the WTI–Brent spread. We show that psychological barriers only appear to influence prices in the pre-credit crisis period of 1990–2006, with such effects dissipating during the crisis and as markets reverted back to wider economy focused fundamentals. A range of reaction windows are applied with the main finding being that the trading potential around such psychological barrier levels is primarily in the immediate 1–5 days following a breach. The research contributes to the scant existing research on psychological influences on energy market traders, and suggests strong potential for further application of behavioural finance theories to improving understanding of energy markets price dynamics.

Michael Dowling; Mark Cummins; Brian M. Lucey

2014-01-01T23:59:59.000Z