National Library of Energy BETA

Sample records for water heating market

  1. The Market - Who Needs Heat Pump Water Heaters? (Journal Article) | SciTech

    Office of Scientific and Technical Information (OSTI)

    Connect Journal Article: The Market - Who Needs Heat Pump Water Heaters? Citation Details In-Document Search Title: The Market - Who Needs Heat Pump Water Heaters? Heat pump water heaters use less power than traditional ones, but they cost more. Does the investment make sense for you? for your neighbor? Well, it depends, and it's a question not only for consumers, but also for manufacturers, retailers and efficiency programs seeking to understand their markets, set prices and incentives, and

  2. Total Space Heating Water Heating Cook-

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Commercial Buildings Energy Consumption Survey: Energy End-Use Consumption Tables Total Space Heating Water Heating Cook- ing Other Total Space Heating Water Heating Cook- ing...

  3. Total Space Heating Water Heating Cook-

    Gasoline and Diesel Fuel Update (EIA)

    Released: September, 2008 Total Space Heating Water Heating Cook- ing Other Total Space Heating Water Heating Cook- ing Other All Buildings* ... 1,870 1,276...

  4. Total Space Heating Water Heating Cook-

    Gasoline and Diesel Fuel Update (EIA)

    Energy Consumption Survey: Energy End-Use Consumption Tables Total Space Heating Water Heating Cook- ing Other Total Space Heating Water Heating Cook- ing Other All...

  5. Total Space Heating Water Heating Cook-

    Gasoline and Diesel Fuel Update (EIA)

    Released: September, 2008 Total Space Heating Water Heating Cook- ing Other Total Space Heating Water Heating Cook- ing Other All Buildings* ... 1,602 1,397...

  6. Total Space Heating Water Heating Cook-

    Gasoline and Diesel Fuel Update (EIA)

    Released: September, 2008 Total Space Heating Water Heating Cook- ing Other Total Space Heating Water Heating Cook- ing Other All Buildings ... 2,037...

  7. Heat Pump Water Heaters

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    & Events Expand News & Events Skip navigation links Residential Residential Lighting Energy Star Appliances Consumer Electronics Heat Pump Water Heaters Electric Storage Water...

  8. Water-heating dehumidifier

    DOE Patents [OSTI]

    Tomlinson, John J.


    A water-heating dehumidifier includes a refrigerant loop including a compressor, at least one condenser, an expansion device and an evaporator including an evaporator fan. The condenser includes a water inlet and a water outlet for flowing water therethrough or proximate thereto, or is affixed to the tank or immersed into the tank to effect water heating without flowing water. The immersed condenser design includes a self-insulated capillary tube expansion device for simplicity and high efficiency. In a water heating mode air is drawn by the evaporator fan across the evaporator to produce cooled and dehumidified air and heat taken from the air is absorbed by the refrigerant at the evaporator and is pumped to the condenser, where water is heated. When the tank of water heater is full of hot water or a humidistat set point is reached, the water-heating dehumidifier can switch to run as a dehumidifier.

  9. Water Heating | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Public Services Homes Water Heating Water Heating Infographic: Water Heaters 101 Infographic: Water Heaters 101 Everything you need to know about saving money on water...

  10. Total Space Heating Water Heating Cook-

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Tables Total Space Heating Water Heating Cook- ing Other Total Space Heating Water Heating Cook- ing Other All Buildings* ... 634 578 46 1 Q 116.4 106.3...

  11. Absorption Heat Pump Water Heater

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Absorption Heat Pump Water Heater Kyle Gluesenkamp Building Equipment Group, ETSD ... tested in early April An absorption heat pump transfers heat to the water from fuel and ...

  12. Sandia Energy - Conventional Water Power: Market Acceleration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Market Acceleration Home Stationary Power Energy Conversion Efficiency Water Power Conventional Water Power: Market Acceleration Conventional Water Power: Market AccelerationTara...

  13. Water Heating | Department of Energy

    Energy Savers [EERE]

    Water Heating Water Heating September 2, 2015 - 11:07am Addthis Low-flow fixtures will help you reduce your hot water use and save money on your water heating bills. | Photo...

  14. NREL and Industry Advance Low-Cost Solar Water Heating R&D (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available


    NREL and Rhotech develop cost-effective solar water heating prototype to rival natural gas water heater market.

  15. Water-Heating Dehumidifier - Energy Innovation Portal

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Industrial Technologies Industrial Technologies Building Energy Efficiency Building Energy Efficiency Find More Like This Return to Search Water-Heating Dehumidifier Oak Ridge National Laboratory Contact ORNL About This Technology Technology Marketing SummaryA small appliance developed at ORNL dehumidifies air and then recycles heat to warm water in a water heater. The device circulates cool, dry air in summer and warm air in winter. In addition, the invention can cut the energy required to run

  16. Waste Heat to Power Market Assessment

    SciTech Connect (OSTI)

    Elson, Amelia; Tidball, Rick; Hampson, Anne


    Waste heat to power (WHP) is the process of capturing heat discarded by an existing process and using that heat to generate electricity. In the industrial sector, waste heat streams are generated by kilns, furnaces, ovens, turbines, engines, and other equipment. In addition to processes at industrial plants, waste heat streams suitable for WHP are generated at field locations, including landfills, compressor stations, and mining sites. Waste heat streams are also produced in the residential and commercial sectors, but compared to industrial sites these waste heat streams typically have lower temperatures and much lower volumetric flow rates. The economic feasibility for WHP declines as the temperature and flow rate decline, and most WHP technologies are therefore applied in industrial markets where waste heat stream characteristics are more favorable. This report provides an assessment of the potential market for WHP in the industrial sector in the United States.

  17. Heat Pump Water Heaters | Department of Energy

    Office of Environmental Management (EM)

    Heat & Cool Water Heating Heat Pump Water Heaters Heat Pump Water Heaters A diagram of a heat pump water heater. A diagram of a heat pump water heater. Most homeowners who...

  18. Combined Heat and Power Market Potential for Opportunity Fuels...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Combined Heat and Power Market Potential for Opportunity Fuels, August 2004 Combined Heat and Power Market Potential for Opportunity Fuels, August 2004 The purpose of this 2004...

  19. Water Heating | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Water Heating Water Heating Infographic: Water Heaters 101 Infographic: Water Heaters 101 Everything you need to know about saving money on water heating costs. Read more Selecting a New Water Heater Selecting a New Water Heater Tankless? Storage? Solar? Save money on your water heating bill by choosing the right type of energy-efficient water heater for your needs. Read more Sizing a New Water Heater Sizing a New Water Heater When buying a new water heater, bigger is not always better. Learn

  20. Water Heating | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Water Heating Water Heating Low-flow fixtures will help you reduce your hot water use and save money on your water heating bills. | Photo courtesy of Huntington Veterans Medical Ctr. Low-flow fixtures will help you reduce your hot water use and save money on your water heating bills. | Photo courtesy of Huntington Veterans Medical Ctr. Water heating accounts for about 18% of your home's energy use. Reducing your hot water use, employing energy-saving strategies, and choosing an energy efficient

  1. Heat Exchangers for Solar Water Heating Systems | Department...

    Energy Savers [EERE]

    Heat Exchangers for Solar Water Heating Systems Heat Exchangers for Solar Water Heating Systems Image of a heat exchanger. | Photo from Image of a heat exchanger. |...

  2. Central Multifamily Water Heating Systems

    Broader source: [DOE]

    The Building America Program is hosting a no-cost, webinar-based training on Central Multifamily Water Heating Systems. The webinar will focus the effective use of central heat pump water heaters...

  3. Energy Saving Absorption Heat Pump Water Heater - Energy Innovation Portal

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Building Energy Efficiency Building Energy Efficiency Find More Like This Return to Search Energy Saving Absorption Heat Pump Water Heater Oak Ridge National Laboratory Contact ORNL About This Technology Technology Marketing SummaryORNL's new absorption heat pump and water heater technology offers substantial energy savings and can reduce the use of fossil fuels by buildings. While conventional heat pump water heater designs are limited to using toxic ammonia water systems, this system uses heat

  4. Water Heating Standing Technical Committee Presentation | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Water Heating Standing Technical Committee Presentation Water Heating Standing Technical Committee Presentation This presentation outlines the goals of the Water Heating Standing...

  5. Research & Development Roadmap: Emerging Water Heating Technologies...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Water Heating Technologies Research & Development Roadmap: Emerging Water Heating Technologies The Research and Development (R&D) Roadmap for Emerging Water Heating Technologies ...

  6. Building America Standing Technical Committee- Water Heating

    Broader source: [DOE]

    The Building America program is focused on delivering market acceptable energy efficiency solutions to homeowners, builders, and contractors. Near term goals of 30-50% source energy savings are currently targeted. This document examines water heating gaps and barriers, and is updated as of Feb. 2012.

  7. Heat Exchangers for Solar Water Heating Systems | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Exchangers for Solar Water Heating Systems Heat Exchangers for Solar Water Heating Systems Image of a heat exchanger. | Photo from Image of a heat exchanger. | Photo from Solar water heating systems use heat exchangers to transfer solar energy absorbed in solar collectors to the liquid or air used to heat water or a space. Heat exchangers can be made of steel, copper, bronze, stainless steel, aluminum, or cast iron. Solar heating systems usually use copper,


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Water Heating SPECIFICATION, CHECKLIST AND GUIDE Renewable Energy Ready Home Table of ... Assumptions of the RERH Solar Water Heating Specification ...

  9. Heat Pump Water Heaters | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Heat Pump Water Heaters Heat Pump Water Heaters A diagram of a heat pump water heater. A diagram of a heat pump water heater. Most homeowners who have heat pumps use them to heat and cool their homes. But a heat pump also can be used to heat water -- either as stand-alone water heating system, or as combination water heating and space conditioning system. How They Work Heat pump water heaters use electricity to move heat from one place to another instead of generating heat directly. Therefore,

  10. Combined Heat And Power Installation Market Analysis | OpenEI...

    Open Energy Info (EERE)

    Combined Heat And Power Installation Market Analysis Home There are currently no posts in this category. Syndicate...

  11. Combined Heat And Power Installation Market Forecast | OpenEI...

    Open Energy Info (EERE)

    Combined Heat And Power Installation Market Forecast Home There are currently no posts in this category. Syndicate...

  12. Cooling, heating, and power for industry: A market assessment

    SciTech Connect (OSTI)

    None, None


    The focus of this study was to assess the market for cooling, heating, and power applications in the industrial sector.

  13. Water Heating | Department of Energy

    Broader source: (indexed) [DOE]

    Low-flow fixtures will help you reduce your hot water use and save money on your water heating bills. | Photo courtesy of Huntington Veterans Medical Ctr. Low-flow fixtures will...

  14. Low-Cost Solar Water Heating Research and Development Roadmap

    SciTech Connect (OSTI)

    Hudon, K.; Merrigan, T.; Burch, J.; Maguire, J.


    The market environment for solar water heating technology has changed substantially with the successful introduction of heat pump water heaters (HPWHs). The addition of this energy-efficient technology to the market increases direct competition with solar water heaters (SWHs) for available energy savings. It is therefore essential to understand which segment of the market is best suited for HPWHs and focus the development of innovative, low-cost SWHs in the market segment where the largest opportunities exist. To evaluate cost and performance tradeoffs between high performance hot water heating systems, annual energy simulations were run using the program, TRNSYS, and analysis was performed to compare the energy savings associated with HPWH and SWH technologies to conventional methods of water heating.

  15. Heat Transfer Fluids for Solar Water Heating Systems | Department...

    Broader source: (indexed) [DOE]

    Illustration of a solar water heater. Illustration of a solar water heater. Heat-transfer fluids carry heat through solar collectors and a heat exchanger to the heat storage tanks...

  16. Water Heating Basics | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Water Heating Basics Water Heating Basics August 19, 2013 - 11:15am Addthis A variety of systems are available for water heating in homes and buildings. Learn about: Conventional Storage Water Heaters Demand (Tankless or Instantaneous) Water Heaters Heat Pump Water Heaters Solar Water Heaters Tankless Coil and Indirect Water Heaters Addthis Related Articles Tankless Demand Water Heater Basics Solar Water Heater Basics Heat Pump Water Heater Basics Energy Basics Home Renewable Energy Homes &

  17. Consolidated Electric Cooperative- Heat Pump and Water Heating Rebates

    Broader source: [DOE]

    Consolidated Electric Cooperative provides rebates to residential customers who install electric water heaters, dual-fuel heating system or geothermal heat pumps. A dual-fuel heating systems...

  18. Laboratory Performance Evaluation of Residential Integrated Heat Pump Water Heaters

    SciTech Connect (OSTI)

    Sparn, B.; Hudon, K.; Christensen, D.


    This report discusses how a significant opportunity for energy savings is domestic hot water heating, where an emerging technology has recently arrived in the U.S. market: the residential integrated heat pump water heater. A laboratory evaluation is presented of the five integrated HPWHs available in the U.S. today.

  19. Cost Effective Water Heating Solutions

    Broader source: [DOE]

    This presentation was given at the Summer 2012 DOE Building America meeting on July 25, 2012, and addressed the question"Are high-efficiency hot water heating systems worth the cost?"

  20. Tips: Water Heating | Department of Energy

    Energy Savers [EERE]

    Water Heating Tips: Water Heating Keep your energy bills out of hot water. Insulate your water heater to save energy and money, or choose an on-demand hot water heater to save even ...

  1. Tips: Water Heating | Department of Energy

    Office of Environmental Management (EM)

    Water Heating Tips: Water Heating Keep your energy bills out of hot water. Insulate your water heater to save energy and money, or choose an on-demand hot water heater to save even...

  2. Solar Water Heat | Open Energy Information

    Open Energy Info (EERE)

    Water Heat Jump to: navigation, search TODO: Add description List of Solar Water Heat Incentives Retrieved from "http:en.openei.orgwindex.php?titleSolarWaterHeat&oldid26719...

  3. Energy Saver 101: Water Heating Infographic

    Broader source: [DOE]

    Looking for ways to save money on water heating? Energy Saver 101: Water Heating infographic lays out evergything you need to know about water heating and shares ways to save energy and money.

  4. Heat Pump Water Heaters | Department of Energy

    Broader source: (indexed) [DOE]

    A diagram of a heat pump water heater. A diagram of a heat pump water heater. What does this mean for me? Heat pump water heaters can be two to three times more energy efficient...

  5. Solar Hot Water Market Development in Knoxville, TN

    Broader source: [DOE]

    Assessment of local solar hot water markets, market variables, market barriers, and suggested strategies to increase solar hot water deployment in the city and county.

  6. HVAC, Water Heating, and Appliance Overview - 2016 BTO Peer Review |

    Energy Savers [EERE]

    market entry & acceptance of technologies & products Competitive & shared R&D funding focused on tech. performance by researchers in lab / field facilities Technology pathway & research reports Improve performance & cost of heat pump & water heating technologies Researchers equipped with validated solutions to develop or improve components & optimize tech. systems at reduced cost High-efficiency HVAC, water heating & appliance technologies & products are

  7. HVAC, Water Heating and Appliances Sub-Program Logic Model

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    market entry & acceptance of technologies & products Competitive & shared R&D funding focused on tech. performance by researchers in lab / field facilities Technology pathway & research reports Improve performance & cost of heat pump & water heating technologies Researchers equipped with validated solutions to develop or improve components & optimize tech. systems at reduced cost High-efficiency HVAC, water heating & appliance technologies & products are

  8. Savings Project: Lower Water Heating Temperature | Department...

    Energy Savers [EERE]

    Lower Water Heating Temperature Savings Project: Lower Water Heating Temperature Addthis Project Level Easy Energy Savings 12-30 annually for each 10F reduction Time to ...

  9. CO2 Heat Pump Water Heater

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CO 2 Heat Pump Water Heater 2016 Building Technologies Office Peer Review Kyle ... Purpose and Objectives Problem Statement: - Heat pump water heaters can save significant ...

  10. Building America Webinar: Central Multifamily Water Heating Systems...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Multifamily Central Heat Pump Water Heating Building America Webinar: Central Multifamily Water Heating Systems - Multifamily Central Heat Pump Water Heating This presentation will ...

  11. Geothermal Heat Pumps: Market Status, Barriers to Adoption, and...

    Open Energy Info (EERE)

    search Tool Summary LAUNCH TOOL Name: Geothermal Heat Pumps: Market Status, Barriers to Adoption, and Actions to Overcome Barriers AgencyCompany Organization: Oak Ridge...

  12. The Market and Technical Potential for Combined Heat and Power...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industrial Sector, January 2000 The Market and Technical Potential for Combined Heat and ... and developed estimates of additional technical potential for CHP in industry. ...

  13. Cooling, Heating, and Power for Industry: A Market Assessment...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    The focus of this study was to assess the market for cooling, heating, and power applications in the industrial sector. PDF icon chpindustrymarketassessment0803.pdf More ...

  14. An Assessment of Heating Fuels And Electricity Markets During...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PDF icon An Assessment of Heating Fuels And Electricity Markets During the Winters of 2013... Before the House Subcommittee on Energy and Power - Committee on Energy and Commerce

  15. Solar water heating: FEMP fact sheet

    SciTech Connect (OSTI)

    Clyne, R.


    Using the sun to heat domestic water makes sense in almost any climate. Solar water heaters typically provide 40 to 80{percent} of a building's annual water-heating needs. A solar water-heating system's performance depends primarily on the outdoor temperature, the temperature to which the water is heated, and the amount of sunlight striking the collector.

  16. Promising Technology: Heat Pump Water Heaters

    Broader source: [DOE]

    A heat pump water heater uses electricity to transfer heat from the ambient air to stored water, as opposed to an electric resistance water heater, which uses electricity to generate the heat directly. This enables the heat pump water heater to be 2 to 3 times as efficient as an electric resistance water heater.

  17. Bio-Oil Deployment in the Home Heating Market

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Bio-Oil Deployment in the Home Heating Market March 23, 2015 Dr. Thomas A. Butcher ... and end user acceptance. * Heating oil and diesel transportation both use the same ...

  18. Energy Saver 101: Water Heating Infographic | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Saver 101: Water Heating Infographic Energy Saver 101: Water Heating Infographic Looking for ways to save money on water heating? Energy Saver 101: Water Heating infographic ...

  19. Condensing Heating and Water Heating Equipment Workshop Location...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Condensing Heating and Water Heating Equipment Workshop Location: Washington Gas Light Appliance Training Facility 6801 Industrial Road Springfield, VA Date: October 9, 2014 Time: ...

  20. Workshop on Condensing Heating and Water Heating Equipment

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Workshop on Condensing Heating and Water Heating Equipment Thursday, October 9, 2014 List of Attendees OrganizationAttendees DOE - John Cymbalsky - Ashley Armstrong - Johanna ...

  1. Solar Water Heater Roadmap Leads Path to Market Expansion (Fact Sheet), Highlights in

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Innovative strategy to reduce installed cost of solar water heater systems can rival conventional natural gas water heaters in the marketplace. Researchers in the Residential Buildings group at the National Renewable Energy Laboratory (NREL) have developed an R&D roadmap outlining a path for innovative, cost-effective solar water heating solutions for the U.S. market. Solar water heaters (SWHs) currently make up less than 1% of the U.S. residential water heating market, leaving a significant

  2. Drain-Water Heat Recovery | Department of Energy

    Energy Savers [EERE]

    Heat & Cool Water Heating Drain-Water Heat Recovery Drain-Water Heat Recovery Diagram of a drain water heat recovery system. Diagram of a drain water heat recovery system. ...

  3. Drain-Water Heat Recovery | Department of Energy

    Office of Environmental Management (EM)

    Heat & Cool Water Heating Drain-Water Heat Recovery Drain-Water Heat Recovery Diagram of a drain water heat recovery system. Diagram of a drain water heat recovery system....

  4. Heat Exchangers for Solar Water Heating Systems | Department...

    Broader source: (indexed) [DOE]

    from Image of a heat exchanger. | Photo from Solar water heating systems use heat exchangers to transfer solar energy absorbed in solar...

  5. Water Heating Standing Technical Committee Presentation

    Energy Savers [EERE]

    HVAC, Water Heating, Appliances R&D » Water Heating Projects Water Heating Projects Figure 1: The system model for the combined Water heater, dehumidifier and cooler (WHDC). A Combined Water Heater, Dehumidifier, and Cooler (WHDC) Lead Performer: University of Florida, Gainesville, Florida Partners: -- Oak Ridge National Laboratory - Oak Ridge, TN -- Stony Brook University - Stony Brook, NY Adsorption Heat Pump Water Heater Lead Performer: Oak Ridge National Laboratory - Oak Ridge, TN Xergy

  6. Water Heating Projects | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HVAC, Water Heating, & Appliances » Water Heating Projects Water Heating Projects Figure 1: The system model for the combined Water heater, dehumidifier and cooler (WHDC). A Combined Water Heater, Dehumidifier, and Cooler (WHDC) Lead Performer: University of Florida, Gainesville, Florida Partners: -- Oak Ridge National Laboratory - Oak Ridge, TN -- Stony Brook University - Stony Brook, NY Xergy is using its Electro Chemical Compression (ECC) technology to operate a heat pump cycle using

  7. Commercial Absorption Heat Pump Water Heater | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Absorption Heat Pump Water Heater Commercial Absorption Heat Pump Water Heater Lead Performer: Oak Ridge National Laboratory - Oak Ridge, TN Partner: A.O. Smith Inc. - Milwaukee, WI DOE Funding: $2,000,000 Cost Share: Provided by CRADA partners Project Term: October 1, 2013 - September 30, 2016 Project Objective The objective of this project is to develop a gas-fired absorption heat pump water heater for the commercial market, capable of an energy factor greater than 1.0 as determined by the

  8. CO2 Heat Pump Water Heater

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CO 2 Heat Pump Water Heater 2014 Building Technologies Office Peer Review Evaporator Kyle ... GE Appliances CRADA partner Project Goal: Develop CO 2 heat pump water heater that meets ...

  9. Protective tubes for sodium heated water tubes

    DOE Patents [OSTI]

    Essebaggers, Jan


    A heat exchanger in which water tubes are heated by liquid sodium which minimizes the results of accidental contact between the water and the sodium caused by failure of one or more of the water tubes. A cylindrical protective tube envelopes each water tube and the sodium flows axially in the annular spaces between the protective tubes and the water tubes.

  10. The Market and Technical Potential for Combined Heat and Power...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Domestic hot water, space heating, pools Museums 100 kW - 1+ MW Space heating, domestic ... 15 0 Golf Clubs 14,040 3,800 820 205 30 Museums 9,090 330 290 50 0 Correctional ...

  11. Santa Clara Water & Sewer- Solar Water Heating Program

    Broader source: [DOE]

    In 1975, the City of Santa Clara established the nation's first municipal solar utility. Under the Solar Water Heating Program, the Santa Clara Water & Sewer Utilities Department supplies,...

  12. Heat Transfer Fluids for Solar Water Heating Systems | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Solar Water Heaters » Heat Transfer Fluids for Solar Water Heating Systems Heat Transfer Fluids for Solar Water Heating Systems Illustration of a solar water heater. Illustration of a solar water heater. Heat-transfer fluids carry heat through solar collectors and a heat exchanger to the heat storage tanks in solar water heating systems. When selecting a heat-transfer fluid, you and your solar heating contractor should consider the following criteria: Coefficient of expansion - the fractional

  13. CO2 Heat Pump Water Heater | Department of Energy

    Energy Savers [EERE]

    CO2 Heat Pump Water Heater CO2 Heat Pump Water Heater CO2 Heat Pump Water Heater Prototype
    Credit: Oak Ridge National Lab CO2 Heat Pump Water Heater Prototype Credit: Oak ...

  14. An analysis of heating fuel market behavior, 1989--1990

    SciTech Connect (OSTI)

    Not Available


    The purpose of this report is to fully assess the heating fuel crisis from a broader and longer-term perspective. Using EIA final, monthly data, in conjunction with credible information from non-government sources, the pricing phenomena exhibited by heating fuels in late December 1989 and early January 1990 are described and evaluated in more detail and more accurately than in the interim report. Additionally, data through February 1990 (and, in some cases, preliminary figures for March) make it possible to assess the market impact of movements in prices and supplies over the heating season as a whole. Finally, the longer time frame and the availability of quarterly reports filed with the Securities and Exchange Commission make it possible to weigh the impact of revenue gains in December and January on overall profits over the two winter quarters. Some of the major, related issues raised during the House and Senate hearings in January concerned the structure of heating fuel markets and the degree to which changes in this structure over the last decade may have influenced the behavior and financial performance of market participants. Have these markets become more concentrated Was collusion or market manipulation behind December's rising prices Did these, or other, factors permit suppliers to realize excessive profits What additional costs were incurred by consumers as a result of such forces These questions, and others, are addressed in the course of this report.

  15. Heat Pump Water Heaters | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Heat Pump Water Heaters Heat Pump Water Heaters The Department of Energy (DOE) develops standardized data templates for reporting the results of tests conducted in accordance with current DOE test procedures. Templates may be used by third-party laboratories under contract with DOE that conduct testing in support of ENERGY STAR® verification, DOE rulemakings, and enforcement of the federal energy conservation standards. File Heat Pump Water Heaters -- v1.7 More Documents & Publications

  16. Solar Water Heating Webinar | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Weatherization Assistance Program » Pilot Projects » Solar Water Heating Webinar Solar Water Heating Webinar Watch a recording of National Renewable Energy Laboratory (NREL) Senior Engineer Andy Walker's Nov. 16, 2010, presentation about residential solar water heating technologies and applications. It's one in a series of Webinars to support state and local projects funded by Sustainable Energy Resources for Consumers Grants. You can also read a transcript of the Webinar. More Information For

  17. Water Heating Standing Technical Committee Presentation

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Standing Technical Committee Water Heating Residential Energy Efficiency Stakeholder's Meeting February 29, 2012 - Austin, Texas 2 STC Chairman Responsibilities * To maintain the...

  18. Valley Electric Association- Solar Water Heating Program

    Broader source: [DOE]

    Valley Electric Association (VEA), a nonprofit member owned cooperative, developed the domestic solar water heating program to encourage energy efficiency at the request of the membership. VEA...

  19. EWEB- Residential Solar Water Heating Loan Program

    Broader source: [DOE]

    Eugene Water & Electric Board (EWEB) offers residential customers a loan and cash discount program called, "The Bright Way To Heat Water." The program is designed to promote the installation of...

  20. Hot New Advances in Water Heating Technology

    Broader source: [DOE]

    Need to replace your water heater? Learn how to choose the right model for you and what the Energy Department is doing to develop the next generation of energy-efficient and affordable water heating technologies.

  1. [Waste water heat recovery system

    SciTech Connect (OSTI)

    Not Available


    The production capabilities for and field testing of the heat recovery system are described briefly. Drawings are included.

  2. Impacts of Water Quality on Residential Water Heating Equipment

    SciTech Connect (OSTI)

    Widder, Sarah H.; Baechler, Michael C.


    Water heating is a ubiquitous energy use in all residential housing, accounting for 17.7% of residential energy use (EIA 2012). Today, there are many efficient water heating options available for every fuel type, from electric and gas to more unconventional fuel types like propane, solar, and fuel oil. Which water heating option is the best choice for a given household will depend on a number of factors, including average daily hot water use (total gallons per day), hot water draw patterns (close together or spread out), the hot water distribution system (compact or distributed), installation constraints (such as space, electrical service, or venting accommodations) and fuel-type availability and cost. While in general more efficient water heaters are more expensive than conventional water heating technologies, the savings in energy use and, thus, utility bills can recoup the additional upfront investment and make an efficient water heater a good investment over time in most situations, although the specific payback period for a given installation will vary widely. However, the expected lifetime of a water heater in a given installation can dramatically influence the cost effectiveness and savings potential of a water heater and should be considered, along with water use characteristics, fuel availability and cost, and specific home characteristics when selecting the optimum water heating equipment for a particular installation. This report provides recommendations for selecting and maintaining water heating equipment based on local water quality characteristics.

  3. Solar Water Heating System Maintenance and Repair | Department...

    Energy Savers [EERE]

    Water Heating System Maintenance and Repair Solar Water Heating System Maintenance and Repair Rooftop solar water heaters need regular maintenance to operate at peak efficiency. | ...

  4. Solar Water Heating System Maintenance and Repair | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Water Heating System Maintenance and Repair Solar Water Heating System Maintenance and Repair Rooftop solar water heaters need regular maintenance to operate at peak efficiency. |...

  5. Field Performance of Heat Pump Water Heaters in the Northeast

    SciTech Connect (OSTI)

    Shapiro, C.; Puttagunta, S.


    Heat pump water heaters (HPWHs) are finally entering the mainstream residential water heater market. Potential catalysts are increased consumer demand for higher energy efficiency electric water heating and a new Federal water heating standard that effectively mandates use of HPWHs for electric storage water heaters with nominal capacities greater than 55 gallons. When compared to electric resistance water heating, the energy and cost savings potential of HPWHs is tremendous. Converting all electric resistance water heaters to HPWHs could save American consumers 7.8 billion dollars annually ($182 per household) in water heating operating costs and cut annual residential source energy consumption for water heating by 0.70 quads. Steven Winter Associates, Inc. embarked on one of the first in situ studies of these newly released HPWH products through a partnership with two sponsoring electric utility companies, National Grid and NSTAR, and one sponsoring energy efficiency service program administrator, Cape Light Compact. Recent laboratory studies have measured performance of HPWHs under various operating conditions, but publicly available field studies have not been as available. This evaluation attempts to provide publicly available field data on new HPWHs by monitoring the performance of three recently released products (General Electric GeoSpring(tm), A.O. Smith Voltex(r), and Stiebel Eltron Accelera(r)300). Fourteen HPWHs were installed in Massachusetts and Rhode Island and monitored for over a year. Of the 14 units, ten were General Electric models (50 gallon units), two were Stiebel Eltron models (80 gallon units), and two were A.O. Smith models (one 60-gallon and one 80-gallon unit).

  6. Cooling, Heating, and Power for Industry: A Market Assessment, August 2003

    Broader source: [DOE]

    The focus of this study was to assess the market for cooling, heating, and power applications in the industrial sector.

  7. Lakeland Electric- Solar Water Heating Program

    Broader source: [DOE]

    Lakeland Electric, a municipal utility in Florida, is the nation's first utility to offer solar-heated domestic hot water on a "pay-for-energy" basis. The utility has contracted with a solar...

  8. Report on Solar Water Heating Quantitative Survey

    SciTech Connect (OSTI)

    Focus Marketing Services


    This report details the results of a quantitative research study undertaken to better understand the marketplace for solar water-heating systems from the perspective of home builders, architects, and home buyers.

  9. Drain-Water Heat Recovery | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Water Heating » Drain-Water Heat Recovery Drain-Water Heat Recovery Diagram of a drain water heat recovery system. Diagram of a drain water heat recovery system. Any hot water that goes down the drain carries away energy with it. That's typically 80%-90% of the energy used to heat water in a home. Drain-water (or greywater) heat recovery systems capture this energy from water you've already used (for example, to shower, wash dishes, or wash clothing) to preheat cold water entering the water

  10. Siting Your Solar Water Heating System | Department of Energy

    Energy Savers [EERE]

    Siting Your Solar Water Heating System Siting Your Solar Water Heating System Before you buy and install a solar water heating system, you need to first consider your site's solar ...

  11. Siting Your Solar Water Heating System | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Siting Your Solar Water Heating System Siting Your Solar Water Heating System Before you buy and install a solar water heating system, you need to first consider your site's solar...

  12. Subcooled Flow Boiling Heat Transfer to Water and Ethylene Glycol...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Subcooled Flow Boiling Heat Transfer to Water and Ethylene GlycolWater Mixtures in a Bottom-Heated Tube Title Subcooled Flow Boiling Heat Transfer to Water and Ethylene Glycol...

  13. Preliminary Market Assessment for Cold Climate Heat Pumps

    SciTech Connect (OSTI)

    Sikes, Karen; Khowailed, Gannate; Abdelaziz, Omar


    Cold climate heat pump (HP) technology is relevant to a substantial portion of the U.S. population, especially with more than one-third of U.S. housing stock concentrated in colder regions of the country and another 31% in the mixed-humid climate region. Specifically, it is estimated that in 2010 almost 1.37 million heating equipment units were shipped to the cold/very cold climate regions and that 1.41 million were shipped to the nation s mixed-humid region. On a national level, the trend in the last decade has indicated that shipments of gas furnaces have grown at a slower rate than HPs. This indicates a potential opportunity for the cold climate HP, a technology that may be initially slow to penetrate its potential market because of the less expensive operating and first costs of gas furnaces. Anticipated implementation of regional standards could also negatively affect gas furnace shipments, especially with the higher initial cost for more efficient gas furnaces. However, as of 2011, the fact that there are more than 500 gas furnace product models that already achieve the expected efficiency standard indicates that satisfying the regional standard will be a challenge but not an obstacle. A look at the heating fuel and equipment currently being used in the housing stock provides an insight into the competing equipment that cold climate HPs hope to replace. The primary target market for the cold climate HP is the 2.6 million U.S. homes using electric furnaces and HPs in the cold/very cold region. It is estimated that 4.75% of these homeowners either replace or buy new heating equipment in a given year. Accordingly, the project team could infer that the cold climate HP primary market is composed of 123,500 replacements of electric furnaces and conventional air-to-air HPs annually. A secondary housing market for the cold climate HP comprises homes in the mixed-humid region of the country that are using electric furnaces. Homes using gas furnaces across both the cold/very cold and mixed-humid regions represent another secondary market for the cold climate HP. The cold climate HP could also target as a secondary market homes across both the cold/very cold and mixed-humid regions that use propane and fuel oil as their primary heating fuel. The combined total of homes in these three secondary markets is 46 million, and we can also infer that about 2.2 million of these systems are replaced annually. When comparing heating equipment stock in 2001, 2005, and 2009 in the cold/very cold region of the country, it appears that gas furnaces are slowly losing market share and that electric furnaces and HPs are making gains. The fact that electricity-dependent heating equipment is rising in preference among homeowners in the colder regions of the country shows that future penetration of the cold climate HP holds promise. Accordingly, cold climate HP technology could achieve an attractive position, given certain favorable market conditions such as reaching a competitive cost point, strong federal incentives, a consistent level of reliable performance, and a product rollout by a credible market leader. The project team relied on payback analysis to estimate the potential market penetration for the cold climate HP in each of its primary and secondary markets. In this analysis, we assumed a $250 price premium for the cold climate HP over the baseline HP. Electricity and gas prices and emissions were based on the 2010 Buildings Energy Data Book. The average heating load was calculated as 25.2 MMBTU per year in the cold/very cold and mixed-humid regions of the United States. Typical installed costs were obtained from the technical document supporting the U.S. Department of Energy rulemaking. The analysis showed that the cold climate HP will have a 2.2 year payback period when replacing an existing electric HP in the colder regions of the nation. The cold climate HP will have a 6 year payback period when replacing gas furnaces in the same climate regions. Accordingly, we estimated that the cold climate HP will have a penetration ratio ranging between 5% and 35% in its potential primary and secondary markets, resulting in a total annual estimated shipment of 298,000 units to both targeted regions of the nation. Once the cold climate HP technology meets its potential market penetration, it would contribute to annual site energy savings of 3,664,405 MMBTU and a CO2 emission reduction of 470,000 Ton.


    DOE Patents [OSTI]

    Simmons, W.R.; Koch, L.J.


    A heat exchanger comprising a tank for hot liquid and a plurality of concentric, double tubes for cool liquid extending vertically through the tank is described. These tubes are bonded throughout most of their length but have an unbonded portion at both ends. The inner tubes extend between headers located above and below the tanmk and the outer tubes are welded into tube sheets forming the top and bottom of the tank at locations in the unbonded portions of the tubes. (AEC)

  15. Warm Springs Water District District Heating Low Temperature...

    Open Energy Info (EERE)

    Water District District Heating Low Temperature Geothermal Facility Jump to: navigation, search Name Warm Springs Water District District Heating Low Temperature Geothermal...

  16. Expansion and Improvement of Solar Water Heating Technology in...

    Open Energy Info (EERE)

    and Improvement of Solar Water Heating Technology in China Project Management Office Jump to: navigation, search Name: Expansion and Improvement of Solar Water Heating Technology...

  17. HVAC, Water Heating, and Appliance Subprogram Overview - 2016...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Appliance Subprogram Overview - 2016 BTO Peer Review HVAC, Water Heating, and Appliance ... Office's Emerging Technologies: HVAC, Water Heating, and Appliance subprogram. ...

  18. Covered Product Category: Residential Heat Pump Water Heaters...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Heat Pump Water Heaters Covered Product Category: Residential Heat Pump Water Heaters The Federal Energy Management Program (FEMP) provides acquisition guidance and Federal ...

  19. Building America Webinar: Central Multifamily Water Heating Systems...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Central Multifamily Water Heating Systems Building America Webinar: Central Multifamily Water Heating Systems The webinar was presented on January 21, 2015, and focused on the ...

  20. Building America Case Study: Indirect Solar Water Heating Systems...

    Energy Savers [EERE]

    Indirect Solar Water Heating Systems in Single-Family Homes Greenfield, Massachusetts ... Building Component: Solar water heating Application: Single-family Years Tested: 2010-2013 ...

  1. HVAC, Water Heating, and Appliance Overview - 2016 BTO Peer Review...

    Energy Savers [EERE]

    HVAC, Water Heating, and Appliance Overview - 2016 BTO Peer Review HVAC, Water Heating, and Appliance Overview - 2016 BTO Peer Review Presenter: Antonio M. Bouza, U.S. Department ...

  2. HVAC, Water Heating, and Appliances Overview - 2015 BTO Peer...

    Energy Savers [EERE]

    HVAC, Water Heating, and Appliances Overview - 2015 BTO Peer Review Presenter: Tony Bouza, U.S. Department of Energy View the Presentation PDF icon HVAC, Water Heating, and ...

  3. Building Codes and Regulations for Solar Water Heating Systems...

    Office of Environmental Management (EM)

    Building Codes and Regulations for Solar Water Heating Systems Building Codes and Regulations for Solar Water Heating Systems June 24, 2012 - 1:50pm Addthis Photo Credit:...

  4. Direct Use for Building Heat and Hot Water Presentation Slides...

    Energy Savers [EERE]

    Direct Use for Building Heat and Hot Water Presentation Slides and Text Version Direct Use for Building Heat and Hot Water Presentation Slides and Text Version Download ...

  5. Building America Webinar: Central Multifamily Water Heating Systems -

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Multifamily Central Heat Pump Water Heating | Department of Energy Multifamily Central Heat Pump Water Heating Building America Webinar: Central Multifamily Water Heating Systems - Multifamily Central Heat Pump Water Heating This presentation will be delivered by Elizabeth Weitzel, Davis Energy Group, at the U.S. Department of Energy Building America webinar on January 21, 2015.The presentation will focus on the findings of an evaluation effort of a nominal 10.5 ton central HPWH installed at

  6. Assessing Consumer Values and the Supply-Chain Market for the Integrated Water Heater/Dehumidifier

    SciTech Connect (OSTI)

    Ashdown, BG


    This paper presents a case study of the potential market for the dual-service residential integrated water heater/dehumidifier (WHD). Its principal purpose is to evaluate the extent to which this integrated appliance might penetrate the residential market sector, given current market trends, producer and consumer attributes, and technical parameters. The report's secondary purpose is to gather background information leading to a generic framework for conducting market analyses of technologies. This framework can be used to assess market readiness as well as factor preferred product attributes into the design to drive consumer demand for this product. This study also supports analysis for prototype design. A full market analysis for potential commercialization should be conducted after prototype development. The integrated WHD is essentially a heat-pump water heater (HPWH) with components and controls that allow dedicated dehumidification. Adequate residential humidity control is a growing issue for newly constructed residential homes, which are insulated so well that mechanical ventilation may be necessary to meet fresh air requirements. Leveraging its successful experience with the energy-efficient design improvement for the residential HPWH, the Oak Ridge National Laboratory's (ORNL's) Engineering Science and Technology Division's (ESTD's) Building Equipment Group designed a water-heating appliance that combines HPWH efficiency with dedicated dehumidification. This integrated appliance could be a low-cost solution for dehumidification and efficient electric water heating. ORNL is partnering with Western Carolina University, Asheville-Buncombe Technical Community College, American Carolina Stamping Company, and Clemson University to develop this appliance and assess its market potential. For practical purposes, consumers are indifferent to how water is heated but are very interested in product attributes such as initial first cost, operating cost, performance, serviceability, product size, and installation costs. The principal drivers for penetrating markets are demonstrating reliability, leveraging the dehumidification attributes of the integrated WHD, and creating programs that embrace first-cost and life-cycle cost principles.

  7. Combined Heat and Power Market Potential for Opportunity Fuels

    SciTech Connect (OSTI)

    Jones, David; Lemar, Paul


    This report estimates the potential for opportunity fuel combined heat and power (CHP) applications in the United States, and provides estimates for the technical and economic market potential compared to those included in an earlier report. An opportunity fuel is any type of fuel that is not widely used when compared to traditional fossil fuels. Opportunity fuels primarily consist of biomass fuels, industrial waste products and fossil fuel derivatives. These fuels have the potential to be an economically viable source of power generation in various CHP applications.

  8. Combined heat recovery and make-up water heating system

    SciTech Connect (OSTI)

    Kim, S.Y.


    A cogeneration plant is described comprising in combination: a first stage source of hot gas; a duct having an inlet for receiving the hot gas and an outlet stack open to the atmosphere; a second stage recovery heat steam generator including an evaporator situated in the duct, and economizer in the duct downstream of the evaporator, and steam drum fluidly connected to the evaporator and the economizer; feedwater supply means including a deaerator heater and feedwater pump for supplying deaerated feedwater to the steam drum through the economizer; makeup water supply means including a makeup pump for delivering makeup water to the deaerator heater; means fluidly connected to the steam drum for supplying auxiliary steam to the deaerator heater; and heat exchanger means located between the deaerator and the economizer, for transferring heat from the feedwater to the makeup water, thereby increasing the temperature of the makeup water delivered to the deaerator and decreasing the temperature of the feedwater delivered to the economizer, without fluid exchange.

  9. Market development directory for solar industrial process heat systems

    SciTech Connect (OSTI)


    The purpose of this directory is to provide a basis for market development activities through a location listing of key trade associations, trade periodicals, and key firms for three target groups. Potential industrial users and potential IPH system designers were identified as the prime targets for market development activities. The bulk of the directory is a listing of these two groups. The third group, solar IPH equipment manufacturers, was included to provide an information source for potential industrial users and potential IPH system designers. Trade associates and their publications are listed for selected four-digit Standard Industrial Code (SIC) industries. Since industries requiring relatively lower temperature process heat probably will comprise most of the near-term market for solar IPH systems, the 80 SIC's included in this chapter have process temperature requirements less than 350/sup 0/F. Some key statistics and a location list of the largest plants (according to number of employees) in each state are included for 15 of the 80 SIC's. Architectural/engineering and consulting firms are listed which are known to have solar experience. Professional associated and periodicals to which information on solar IPH sytstems may be directed also are included. Solar equipment manufacturers and their associations are listed. The listing is based on the SERI Solar Energy Information Data Base (SEIDB).

  10. Water Heating Products and Services | Department of Energy

    Energy Savers [EERE]

    Water Heating Products and Services Water Heating Products and Services Choosing an efficient water heater will help you save money and Energy. | Photo Credit Energy Department Choosing an efficient water heater will help you save money and Energy. | Photo Credit Energy Department Use the following links to get product information and locate professional services for water heating. Product Information Solar Pool Heating Systems Florida Solar Energy Center Listing of solar pool heating systems

  11. Water Heating Products and Services | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Water Heating Products and Services Water Heating Products and Services Choosing an efficient water heater will help you save money and Energy. | Photo Credit Energy Department Choosing an efficient water heater will help you save money and Energy. | Photo Credit Energy Department Use the following links to get product information and locate professional services for water heating. Product Information Solar Pool Heating Systems Florida Solar Energy Center Listing of solar pool heating systems

  12. Residential Absorption Heat Pump Water Heater | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Residential Absorption Heat Pump Water Heater Residential Absorption Heat Pump Water Heater Photo credit: Oak Ridge National Lab Photo credit: Oak Ridge National Lab Diagram of absorption heat pump water heater. <br /> Photo credit: Oak Ridge National Lab Diagram of absorption heat pump water heater. Photo credit: Oak Ridge National Lab Photo credit: Oak Ridge National Lab Diagram of absorption heat pump water heater. <br /> Photo credit: Oak Ridge National Lab Lead Performer: Oak

  13. Water Heating Products and Services | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Water Heating Products and Services Water Heating Products and Services May 29, 2012 - 7:04pm Addthis Choosing an efficient water heater will help you save money and Energy. |...

  14. Solar Water Heating System Maintenance and Repair | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Water Heating System Maintenance and Repair Solar Water Heating System Maintenance and Repair May 30, 2012 - 2:35pm Addthis Rooftop solar water heaters need regular maintenance to...

  15. Sustainable Energy Resources for Consumers Webinar on Solar Water Heating

    Energy Savers [EERE]

    Transcript | Department of Energy Solar Water Heating Transcript Sustainable Energy Resources for Consumers Webinar on Solar Water Heating Transcript Video recording transcript of a Webinar on Nov. 16, 2010 about residential solar water heating applications PDF icon solar_water_heating_webinar.pdf More Documents & Publications Sustainable Energy Resources for Consumers (SERC) - Solar Hot Water Sustainable Energy Resources for Consumers Webinar on Residential Water Heaters Sustainable

  16. The market and technical potential for combined heat and power in the commercial/institutional sector

    SciTech Connect (OSTI)

    None, None


    Report of an analysis to determine the potential for cogeneration or combined heat and power (CHP) in the commercial/institutional market.

  17. HVAC, Water Heating, and Appliances | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Emerging Technologies » HVAC, Water Heating, and Appliances HVAC, Water Heating, and Appliances About the Portfolio The HVAC/Water Heating/Appliance subprogram develops cost effective, energy efficient technologies with national labs and industry partners. Technical analysis has shown that heat pumps have the technical potential to save up to 50% of the energy used by conventional HVAC technologies in residential buildings. Our focus is on the introduction of new heat pumping technologies, heat

  18. Heat Pump Water Heater Using Solid-State Energy Converters

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Heat Pump Water Heater Using Solid-State Energy Converters 2015 Building Technologies ... Bottom Mount 4-Engine Thermoelectric Heat Pump; 5142014 2. Development of High Cooling ...

  19. Heat Pump Water Heater Using Solid-State Energy Converters

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Heat Pump Water Heater Using Solid-State Energy Converters 2016 Building Technologies ... Bottom Mount 4-Engine Thermoelectric Heat Pump; 5142014 2. Development of High Cooling ...

  20. List of Solar Water Heat Incentives | Open Energy Information

    Open Energy Info (EERE)

    Photovoltaics Solar Water Heat Ground Source Heat Pumps Yes City and County of Denver - Solar Panel Permitting (Colorado) SolarWind Permitting Standards Colorado Commercial...

  1. Heat Pump Water Heaters and American Homes: A Good Fit?

    SciTech Connect (OSTI)

    Franco, Victor; Lekov, Alex; Meyers, Steve; Letschert, Virginie


    Heat pump water heaters (HPWHs) are over twice as energy-efficient as conventional electric resistance water heaters, with the potential to save substantial amounts of electricity. Drawing on analysis conducted for the U.S. Department of Energy's recently-concluded rulemaking on amended standards for water heaters, this paper evaluates key issues that will determine how well, and to what extent, this technology will fit in American homes. The key issues include: 1) equipment cost of HPWHs; 2) cooling of the indoor environment by HPWHs; 3) size and air flow requirements of HPWHs; 4) performance of HPWH under different climate conditions and varying hot water use patterns; and 5) operating cost savings under different electricity prices and hot water use. The paper presents the results of a life-cycle cost analysis of the adoption of HPWHs in a representative sample of American homes, as well as national impact analysis for different market share scenarios. Assuming equipment costs that would result from high production volume, the results show that HPWHs can be cost effective in all regions for most single family homes, especially when the water heater is not installed in a conditioned space. HPWHs are not cost effective for most manufactured home and multi-family installations, due to lower average hot water use and the water heater in the majority of cases being installed in conditioned space, where cooling of the indoor environment and size and air flow requirements of HPWHs increase installation costs.

  2. Refrigerant charge management in a heat pump water heater

    DOE Patents [OSTI]

    Chen, Jie; Hampton, Justin W.


    Heat pumps that heat or cool a space and that also heat water, refrigerant management systems for such heat pumps, methods of managing refrigerant charge, and methods for heating and cooling a space and heating water. Various embodiments deliver refrigerant gas to a heat exchanger that is not needed for transferring heat, drive liquid refrigerant out of that heat exchanger, isolate that heat exchanger against additional refrigerant flowing into it, and operate the heat pump while the heat exchanger is isolated. The heat exchanger can be isolated by closing an electronic expansion valve, actuating a refrigerant management valve, or both. Refrigerant charge can be controlled or adjusted by controlling how much liquid refrigerant is driven from the heat exchanger, by letting refrigerant back into the heat exchanger, or both. Heat pumps can be operated in different modes of operation, and segments of refrigerant conduit can be interconnected with various components.

  3. NREL and Industry Advance Low-Cost Solar Water Heating R&D (Fact Sheet), NREL Highlights in Research & Development, NREL (National Renewable Energy Laboratory)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and Rhotech develop cost-effective solar water heating prototype to rival natural gas water heaters. Water heating energy use represents the second largest energy demand for homes nationwide, offering an opportunity for innovative solar water heating (SWH) technologies to offset energy use and costs. In the Low-Cost Solar Water Heating Research and Development Roadmap, researchers at the National Renewable Energy Laboratory (NREL) outlined a strategy to expand the SWH market. Recognizing that

  4. The Market and Technical Potential for Combined Heat and Power...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CommercialInstitutional Sector, January 2000 The Market and Technical Potential for ... and developed estimates of additional technical potential for CHP in these markets. ...

  5. Field Monitoring Protocol: Heat Pump Water Heaters

    SciTech Connect (OSTI)

    "B. Sparn, L. Earle, D. Christensen, J. Maguire, and E. Wilson, C.E. Hancock


    This document provides a standard field monitoring protocol for evaluating the installed performance of Heat Pump Water Heaters in residential buildings. The report is organized to be consistent with the chronology of field test planning and execution. Research questions are identified first, followed by a discussion of analysis methods, and then the details of measuring the required information are laid out. A field validation of the protocol at a house near the NREL campus is included for reference.

  6. Field Monitoring Protocol: Heat Pump Water Heaters

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Field Monitoring Protocol: Heat Pump Water Heaters B. Sparn, L. Earle, D. Christensen, J. Maguire, and E. Wilson National Renewable Energy Laboratory C.E. Hancock Mountain Energy Partnership Technical Report NREL/TP-5500-57698 February 2013 NREL is a national laboratory of the U.S. Department of Energy, Office of Energy Efficiency & Renewable Energy, operated by the Alliance for Sustainable Energy, LLC. National Renewable Energy Laboratory 15013 Denver West Parkway Golden, Colorado 80401

  7. Assessment of Large Combined Heat and Power Market, April 2004 | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy Large Combined Heat and Power Market, April 2004 Assessment of Large Combined Heat and Power Market, April 2004 This 2004 report summarizes an assessment of the 2-50 MW combined heat and power (CHP) market and near-term opportunities for a fixed set of CHP technologies. This size range has been the biggest contributor to the traditional inside-the-fence CHP market to date. PDF icon chp_large.pdf More Documents & Publications CHP Assessment, California Energy Commission, October

  8. Heat Pump Water Heater using Solid-State Energy Converters |...

    Energy Savers [EERE]

    Heat Pump Water Heater using Solid-State Energy Converters Heat Pump Water Heater using Solid-State Energy Converters Sheetak will work on developing a full scale prototype of its ...

  9. A Consumer's Guide: Heat Your Water with the Sun (Brochure)

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Cover photo: The people living in this house enjoy hot water that is heated with a solar ... keep swimming pools warm- they can also heat much of your home's water and interior space. ...

  10. Solar Water Heating with Low-Cost Plastic Systems (Brochure)

    SciTech Connect (OSTI)

    Not Available


    Newly developed solar water heating technology can help Federal agencies cost effectively meet the EISA requirements for solar water heating in new construction and major renovations. This document provides design considerations, application, economics, and maintenance information and resources.

  11. Building America Webinar: Central Multifamily Water Heating Systems...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy-Efficient Controls for Multifamily Domestic Hot Water Building America Webinar: Central Multifamily Water Heating Systems - Energy-Efficient Controls for Multifamily ...

  12. Grid-Interactive Renewable Water Heating Economic and Environmental...

    Energy Savers [EERE]

    1 Grid-Interactive Renewable Water Heating Economic and Environmental Value Grid-interactive renewable water heaters have smart controls that quickly change their charge rate and ...

  13. Recovery of Water from Boiler Flue Gas Using Condensing Heat...

    Office of Scientific and Technical Information (OSTI)

    Technical Report: Recovery of Water from Boiler Flue Gas Using Condensing Heat Exchangers Citation Details In-Document Search Title: Recovery of Water from Boiler Flue Gas Using ...

  14. Heat Pump Water Heaters: Controlled Field Research of Impact...

    Office of Scientific and Technical Information (OSTI)

    Water Heaters: Controlled Field Research of Impact on Space Conditioning and Demand Response Characteristics Citation Details In-Document Search Title: Heat Pump Water Heaters: ...

  15. NREL Evaluates Performance of Heat Pump Water Heaters (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available


    NREL evaluates energy savings potential of heat pump water heaters in homes throughout all U.S. climate zones.

  16. Research & Development Roadmap: Emerging Water Heating Technologies |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Water Heating Technologies Research & Development Roadmap: Emerging Water Heating Technologies The Research and Development (R&D) Roadmap for Emerging Water Heating Technologies provides recommendations to the Building Technologies Office (BTO) on R&D activities to pursue that will aid in achieving BTO's energy savings goals. For water heating, BTO targets 19% and 37% primary energy savings by 2020 and 2030, respectively. Each recommendation is built on

  17. Solar Domestic Water Heating: a Roof-Integrated Evaluation

    SciTech Connect (OSTI)


    This fact sheet describes an evaluation of the performance of a roof-integrated solar water heating system.

  18. Deep Water Drilling to Catalyze the Global Drilling Fluids Market...

    Open Energy Info (EERE)

    Deep Water Drilling to Catalyze the Global Drilling Fluids Market Home > Groups > Renewable Energy RFPs John55364's picture Submitted by John55364(100) Contributor 13 May, 2015 -...

  19. Combined Heat and Power Market Potential for Opportunity Fuels, August 2004

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    | Department of Energy Power Market Potential for Opportunity Fuels, August 2004 Combined Heat and Power Market Potential for Opportunity Fuels, August 2004 The purpose of this 2004 report was to determine the best opportunity fuel(s) for distributed energy resources and combined heat and power (DER/CHP) applications, examine the DER/CHP technologies that can use them, and assess the potential market impacts of opportunity fueled DER/CHP applications. PDF icon chp_opportunityfuels.pdf More

  20. Development and Validation of a Gas-Fired Residential Heat Pump Water Heater - Final Report

    SciTech Connect (OSTI)

    Michael Garrabrant; Roger Stout; Paul Glanville; Janice Fitzgerald; Chris Keinath


    For gas-fired residential water heating, the U.S. and Canada is predominantly supplied by minimum efficiency storage water heaters with Energy Factors (EF) in the range of 0.59 to 0.62. Higher efficiency and higher cost ($700 - $2,000) options serve about 15% of the market, but still have EFs below 1.0, ranging from 0.65 to 0.95. To develop a new class of water heating products that exceeds the traditional limit of thermal efficiency, the project team designed and demonstrated a packaged water heater driven by a gas-fired ammonia-water absorption heat pump. This gas-fired heat pump water heater can achieve EFs of 1.3 or higher, at a consumer cost of $2,000 or less. Led by Stone Mountain Technologies Inc. (SMTI), with support from A.O. Smith, the Gas Technology Institute (GTI), and Georgia Tech, the cross-functional team completed research and development tasks including cycle modeling, breadboard evaluation of two cycles and two heat exchanger classes, heat pump/storage tank integration, compact solution pump development, combustion system specification, and evaluation of packaged prototype GHPWHs. The heat pump system extracts low grade heat from the ambient air and produces high grade heat suitable for heating water in a storage tank for domestic use. Product features that include conventional installation practices, standard footprint and reasonable economic payback, position the technology to gain significant market penetration, resulting in a large reduction of energy use and greenhouse gas emissions from domestic hot water production.

  1. Northeast Heating Fuel Market The, Assessment and Options

    Reports and Publications (EIA)


    In response to the President's request, this study examines how the distillate fuel oil market (and related energy markets) in the Northeast behaved in the winter of 1999-2000, explains the role played by residential, commercial, industrial, and electricity generation sector consumers in distillate fuel oil markets and describes how that role is influenced by the structure of the energy markets in the Northeast

  2. Building America Webinar: Central Multifamily Water Heating Systems |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Central Multifamily Water Heating Systems Building America Webinar: Central Multifamily Water Heating Systems The webinar was presented on January 21, 2015, and focused on the effective use of central heat pump water heaters (HPWHs) and control systems to reduce the energy use in hot water distribution. Presenters and specific topics for this webinar included: Elizabeth Weitzel from the Building America team, Alliance for Residential Building Innovation, presenting

  3. HVAC, Water Heating, and Appliances Overview - 2015 BTO Peer Review |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Appliances Overview - 2015 BTO Peer Review HVAC, Water Heating, and Appliances Overview - 2015 BTO Peer Review Presenter: Tony Bouza, U.S. Department of Energy View the Presentation PDF icon HVAC, Water Heating, and Appliances Overview - 2015 BTO Peer Review More Documents & Publications HVAC, Water Heater and Appliance R&D - 2014 BTO Peer Review HVAC, Water Heating, and Appliance Subprogram Overview - 2016 BTO Peer Review Research & Development Roadmap:

  4. Solar Water Heating: SPECIFICATION, CHECKLIST AND GUIDE | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Water Heating: SPECIFICATION, CHECKLIST AND GUIDE Solar Water Heating: SPECIFICATION, CHECKLIST AND GUIDE Solar Water Heating: SPECIFICATION, CHECKLIST AND GUIDE, from the U.S. Environmental Protection Agency (EPA) PDF icon rerh_swh_guide.pdf More Documents & Publications Renewable Energy Ready Home Solar Photovoltaic Specifications DOE Zero Energy Ready Home Solar Hot Water-Ready Checklist DOE Zero Energy Ready Home PV-Ready Checklist

  5. Combined Heat and Power Market Potential for Opportunity Fuels...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CHP and Bioenergy for Landfills and Wastewater Treatment Plants: Market Opportunities Biomass Program Perspectives on Anaerobic Digestion and Fuel Cell Integration at Biorefineries ...

  6. NREL Evaluates Performance of Heat Pump Water Heaters (Fact Sheet), NREL Highlights, Research & Development, NREL (National Renewable Energy Laboratory)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    evaluates energy savings potential of heat pump water heaters in homes throughout all U.S. climate zones. Heat pump water heaters (HPWHs) have the potential to significantly reduce energy use in homes compared to traditional electric resistance water heaters. Researchers at the National Renewable Energy Laboratory (NREL) completed thorough laboratory testing of five integrated HPWHs-all available in the U.S. market-to evaluate the cost of saved energy as a function of climate. The performance of

  7. Heat Pump Water Heater Basics | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Water Heating » Heat Pump Water Heater Basics Heat Pump Water Heater Basics August 19, 2013 - 2:59pm Addthis Illustration of a heat pump water heater, which looks like a tall cylinder with a small chamber on top and a larger one on the bottom. In the top chamber are a fan, a cylindrical compressor, and an evaporator that runs along the inside of the chamber. Jutting out from the exterior of the bottom chamber is a temperature and pressure relief valve. This valve has a tube called a hot water

  8. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  9. Questar Gas- Residential Solar Assisted Water Heating Rebate Program

    Broader source: [DOE]

    Questar gas provides incentives for residential customers to purchase and install solar water heating systems (both for domestic and pool heating uses) on their newly-constructed homes. Rebates of...

  10. Rock Hill Utilities- Water Heater and Heat Pump Rebate Program

    Broader source: [DOE]

    Through the SmartChoice program, Rock Hill Utilities offers rebates for water heater and heat pump replacements. Information on financing for heat pumps can also be found on the web site listed...

  11. The Market and Technical Potential for Combined Heat and Power in the

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Commercial/Institutional Sector, January 2000 | Department of Energy Commercial/Institutional Sector, January 2000 The Market and Technical Potential for Combined Heat and Power in the Commercial/Institutional Sector, January 2000 ONSITE SYCOM Energy Corporation (OSEC) assisted the U.S. Department of Energy's Energy Information Administration in determining the potential for cogeneration or combined heat and power (CHP) in the commercial/institutional market. As part of this effort, in this

  12. The Market and Technical Potential for Combined Heat and Power in the

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industrial Sector, January 2000 | Department of Energy Industrial Sector, January 2000 The Market and Technical Potential for Combined Heat and Power in the Industrial Sector, January 2000 This January 2000 ONSITE SYCOM Energy Corporation (OSEC) report provides information on the potential for cogeneration or combined heat and power (CHP) in the industrial market. As part of this effort, OSEC has characterized typical technologies used in industrial CHP, analyzed existing CHP capacity in

  13. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  14. #AskEnergySaver: Home Water Heating | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Water Heating #AskEnergySaver: Home Water Heating March 24, 2014 - 11:35am Addthis Did you know: Water heaters account for nearly 17 percent of a home’s energy use, consuming more energy than all other household appliances combined. For more about water heaters, check out our <a href="/node/612476">Energy Saver 101 home water heating infographic</a>. | Photo by Eric Grigorian, U.S. Department of Energy Solar Decathlon. Did you know: Water heaters account for nearly 17

  15. Water Heating R&D | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    R&D Water Heating R&D Lead Performer: Oak Ridge National Laboratory (ORNL) - Oak Ridge, TN FY16 DOE Funding: $1,684,000 Project Term: Ongoing Funding Type: Direct Lab Funding PROJECT OBJECTIVE Water heating accounts for 13% of primary energy consumption in residential buildings and 4% in commercial buildings. The commercial building energy savings opportunity is larger and more easily accessible than it would appear because water heating energy use is concentrated in only a few building

  16. Water Heating Standing Technical Committee Presentation | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Standing Technical Committee Presentation Water Heating Standing Technical Committee Presentation This presentation outlines the goals of the Water Heating Standing Technical Committee, as presented at the Building America Spring 2012 Stakeholder meeting on February 29, 2012, in Austin, Texas. PDF icon hot_water_stc.pdf More Documents & Publications Standing Technical Committee Working Sessions Building America Technology Solutions for New and Existing Homes: Performance of a Heat

  17. Building Codes and Regulations for Solar Water Heating Systems | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy Codes and Regulations for Solar Water Heating Systems Building Codes and Regulations for Solar Water Heating Systems Photo Credit: iStockphoto Photo Credit: iStockphoto Before installing a solar water heating system, you should investigate local building codes, zoning ordinances, and subdivision covenants, as well as any special regulations pertaining to the site. You will probably need a building permit to install a solar energy system onto an existing building. Not every

  18. Covered Product Category: Residential Heat Pump Water Heaters | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy Heat Pump Water Heaters Covered Product Category: Residential Heat Pump Water Heaters The Federal Energy Management Program (FEMP) provides acquisition guidance and Federal efficiency requirements for residential heat pump water heaters, which are an ENERGY STAR-qualified product category. Federal laws and requirements mandate that agencies meet these efficiency requirements in all procurement and acquisition actions that are not specifically exempted by law. The following guidance

  19. The Northeast heating fuel market: Assessment and options

    SciTech Connect (OSTI)


    In response to a Presidential request, this study examines how the distillate fuel oil market (and related energy markets) in the Northeast behaved in the winter of 1999-2000, explains the role played by residential, commercial, industrial, and electricity generation sector consumers in distillate fuel oil markets and describes how that role is influenced by the structure of tie energy markets in the Northeast. In addition, this report explores the potential for nonresidential users to move away from distillate fuel oil and how this might impact future prices, and discusses conversion of distillate fuel oil users to other fuels over the next 5 years. Because the President's and Secretary's request focused on converting factories and other large-volume users of mostly high-sulfur distillate fuel oil to other fuels, transportation sector use of low-sulfur distillate fuel oil is not examined here.

  20. Combined Heat and Power: Connecting the Gap between Markets and...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... In theory, these changes opened the market to competing ... to the electric power transmission and distribution (T&D) ... is dangerous both to utility line workers and the public. ...

  1. Condensing Heating and Water Heating Equipment Workshop Location: Washington Gas Light Appliance Training Facility

    Energy Savers [EERE]

    Condensing Heating and Water Heating Equipment Workshop Location: Washington Gas Light Appliance Training Facility 6801 Industrial Road Springfield, VA Date: October 9, 2014 Time: 10:00 am - 12:30 pm EDT Purpose: To convene representatives from stakeholder organizations in order to enhance their understanding of the characteristics of condensing natural gas heating and water heating equipment that contribute to the unique installation requirements and challenges of this equipment compared to

  2. Austin Energy - Solar Water Heating Rebate | Department of Energy

    Broader source: (indexed) [DOE]

    Federal Government Multifamily Residential Institutional Savings Category Solar Water Heat Maximum Rebate Rebate: 2,000 Loan: 10,000 for duplex; 5,000 for single family...

  3. Maricopa Assn. of Governments - PV and Solar Domestic Water Heating...

    Broader source: (indexed) [DOE]

    June 18, 2003, MAG passed permit submission requirements for residential solar domestic water heating systems. This is in addition to the existing standards for residential and...

  4. Building Codes and Regulations for Solar Water Heating Systems...

    Broader source: (indexed) [DOE]

    Photo Credit: iStockphoto Photo Credit: iStockphoto Before installing a solar water heating system, you should investigate local building codes, zoning ordinances, and subdivision...

  5. Duquesne Light Company - Residential Solar Water Heating Program...

    Broader source: (indexed) [DOE]

    rebates to its residential customers for purchasing and installing qualifying solar water heating systems. Eligible systems may receive a flat rebate of 286 per qualifying...

  6. Everything You Wanted to Know About Solar Water Heating Systems |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Everything You Wanted to Know About Solar Water Heating Systems Everything You Wanted to Know About Solar Water Heating Systems October 7, 2014 - 2:39pm Q&A What do you want to know about solar at home? Tell Us Addthis Solar panels heat water that is delivered to a storage tank. | Photo courtesy of David Springer, National Renewable Energy Laboratory Solar panels heat water that is delivered to a storage tank. | Photo courtesy of David Springer, National Renewable

  7. Ashland Electric Utility - Bright Way to Heat Water Loan | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Type Loan Program Summary The City of Ashland Conservation Division offers a solar water heating program to residential electric customers who currently use an electric...

  8. NREL Develops Heat Pump Water Heater Simulation Model (Fact Sheet)

    SciTech Connect (OSTI)

    Hudon, K.


    A new simulation model helps researchers evaluate real-world impacts of heat pump water heaters in U.S. homes.

  9. Residential CO2 Heat Pump Water Heater | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CO2 Heat Pump Water Heater Residential CO2 Heat Pump Water Heater CO2 Heat Pump Water Heater Prototype<br /> Credit: Oak Ridge National Lab CO2 Heat Pump Water Heater Prototype Credit: Oak Ridge National Lab Lead Performer: Oak Ridge National Laboratory - Oak Ridge, TN Partner: General Electric Appliances - Louisville, KY DOE Funding: $2,147,000 Cost Share: Provided by CRADA partner Project Term: October 1, 2009 - September 30, 2015 Project Objective This project is developing a carbon

  10. natural gas+ condensing flue gas heat recovery+ water creation...

    Open Energy Info (EERE)

    natural gas+ condensing flue gas heat recovery+ water creation+ CO2 reduction+ cool exhaust gases+ Energy efficiency+ commercial building energy efficiency+ industrial energy...

  11. Building America Webinar: Central Multifamily Water Heating Systems

    Broader source: [DOE]

    This U.S. Department of Energy Building America webinar, Central Multifamily Water Heating Systems, will take place on January 21, 2015.


    SciTech Connect (OSTI)



    Although heat pump water heaters are today widely accepted in Japan, where energy costs are high and government incentives for their use exist, acceptance of such a product in the U.S. has been slow. This trend is slowly changing with the introduction of heat pump water heaters into the residential market, but remains in the commercial sector. Barriers to heat pump water heater acceptance in the commercial market have historically been performance, reliability and first/operating costs. The use of carbon dioxide (R744) as the refrigerant in such a system can improve performance for relatively small increase in initial cost and make this technology more appealing. What makes R744 an excellent candidate for use in heat pump water heaters is not only the wide range of ambient temperatures within which it can operate, but also the excellent ability to match water to refrigerant temperatures on the high side, resulting in very high exit water temperatures of up to 82?ºC (180?ºF), as required by sanitary codes in the U.S.(Food Code, 2005), in a single pass, temperatures that are much more difficult to reach with other refrigerants. This can be especially attractive in applications where this water is used for the purpose of sanitation. While reliability has also been of concern historically, dramatic improvements have been made over the last several years through research done in the automotive industry and commercialization of R744 technology in residential water heating mainly in Japan. This paper presents the performance results from the development of an R744 commercial heat pump water heater of approximately 35kW and a comparison to a baseline R134a unit of the same capacity and footprint. In addition, recommendations are made for further improvements of the R744 system which could result in possible energy savings of up to 20%.

  13. Heat Transfer Fluids for Solar Water Heating Systems | Department...

    Broader source: (indexed) [DOE]

    a high boiling point. Viscosity and thermal capacity determine the amount of pumping energy required. A fluid with low viscosity and high specific heat is easier to pump, because...

  14. Analysis of space heating and domestic hot water systems for energy-efficient residential buildings

    SciTech Connect (OSTI)

    Dennehy, G


    An analysis of the best ways of meeting the space heating and domestic hot water (DHW) needs of new energy-efficient houses with very low requirements for space heat is provided. The DHW load is about equal to the space heating load in such houses in northern climates. The equipment options which should be considered are discussed, including new equipment recently introduced in the market. It is concluded that the first consideration in selecting systems for energy-efficient houses should be identification of the air moving needs of the house for heat distribution, heat storage, ventilation, and ventilative cooling. This is followed, in order, by selection of the most appropriate distribution system, the heating appliances and controls, and the preferred energy source, gas, oil, or electricity.

  15. Renewable energy technologies for federal facilities: Solar water heating

    SciTech Connect (OSTI)


    This sheet presents information on solar water heaters (passive and active), solar collectors (flat plate, evacuated tube, parabolic trough), lists opportunities for use of solar water heating, and describes what is required and the costs. Important terms are defined.

  16. Residential Gas-Fired Adsorption Heat Pump Water Heater | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of residential natural gas water heating has plateaued at a primary energy factor (EF) of under 1.0, since best-in-class condensing water heaters cannot exceed this value. ...

  17. Technology Solutions Case Study: Heat Pump Water Heater Retrofit

    SciTech Connect (OSTI)



    In this project, Pacific Northwest National Laboratory studied heat pump water heaters, an efficient, cost-effective alternative to traditional electric resistance water heaters that can improve energy efficiency by up to 62%.

  18. Save on Home Water Heating | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    on Home Water Heating Save on Home Water Heating August 19, 2014 - 10:46am Addthis Purchasing a water heater with the ENERGY STAR® label ensures you are buying an energy efficient appliance designed to save consumers money. | Photo courtesy of Dennis Schroeder, National Renewable Energy Labs Purchasing a water heater with the ENERGY STAR® label ensures you are buying an energy efficient appliance designed to save consumers money. | Photo courtesy of Dennis Schroeder, National Renewable

  19. Workshop on Condensing Heating and Water Heating Equipment

    Energy Savers [EERE]

    Conferences & Meetings » Workshop and Meeting Proceedings Workshop and Meeting Proceedings This page contains links to information from workshops and meetings funded by the U.S. Department of Energy Hydrogen and Fuel Cells Program. Hydrogen Production Hydrogen Delivery Hydrogen Storage Fuel Cells Safety, Codes and Standards Market Transformation Manufacturing Systems Analysis Energy Storage Basic Research Vision and Roadmaps Hydrogen Production Hydrogen, Hydrocarbons, and Bioproduct

  20. Global Heat Exchangers Market to be driven by Rapidly Expanding...

    Open Energy Info (EERE)

    by Rapidly Expanding End-user Industries Home > Groups > Renewable Energy RFPs Wayne31jan's picture Submitted by Wayne31jan(150) Contributor 2 July, 2015 - 00:43 Heat...

  1. Data-Driven Mailing Helps Heat Up Untapped Seattle Market

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... you're probably reaching folks who aren't strong prospects for energy efficiency upgrades. ... Whether it's the age of the home, heating source, or age of the families living there, use ...

  2. Research and Development Roadmap for Water Heating Technologies

    SciTech Connect (OSTI)

    Goetzler, William; Gagne, Claire; Baxter, Van D; Lutz, James; Merrigan, Tim; Katipamula, Srinivas


    Although water heating is an important energy end-use in residential and commercial buildings, efficiency improvements in recent years have been relatively modest. However, significant advancements related to higher efficiency equipment, as well as improved distribution systems, are now viable. DOE support for water heating research, development and demonstration (RD&D) could provide the impetus for commercialization of these advancements.

  3. Energy Savings and Breakeven Costs for Residential Heat Pump Water Heaters in the United States

    SciTech Connect (OSTI)

    Maguire, Jeff; Burch, Jay; Merrigan, Tim; Ong, Sean


    Heat pump water heaters (HPWHs) have recently re-emerged in the U.S. residential water heating market and have the potential to provide homeowners with significant energy savings. However, there are questions as to the actual performance and energy savings potential of these units, in particular in regards to the heat pump's performance in unconditioned space and the impact of the heat pump on space heating and cooling loads when it is located in conditioned space. To help answer these questions, NREL performed simulations of a HPWH in both conditioned and unconditioned space at over 900 locations across the continental United States and Hawaii. Simulations included a Building America benchmark home so that any interaction between the HPWH and the home's HVAC equipment could be captured. Comparisons were performed to typical gas and electric water heaters to determine the energy savings potential and cost effectiveness of a HPWH relative to these technologies. HPWHs were found to have a significant source energy savings potential when replacing typical electric water heaters, but only saved source energy relative to gas water heater in the most favorable installation locations in the southern United States. When replacing an electric water heater, the HPWH is likely to break even in California, the southern United States, and parts of the northeast in most situations. However, the HPWH will only break even when replacing a gas water heater in a few southern states.

  4. Energy Savings and Breakeven Cost for Residential Heat Pump Water Heaters in the United States

    SciTech Connect (OSTI)

    Maguire, J.; Burch, J.; Merrigan, T.; Ong, S.


    Heat pump water heaters (HPWHs) have recently reemerged in the U.S. residential water heating market and have the potential to provide homeowners with significant energy savings. However, there are questions as to the actual performance and energy savings potential of these units, in particular in regards to the heat pump's performance in unconditioned space and the impact of the heat pump on space heating and cooling loads when it is located in conditioned space. To help answer these questions, simulations were performed of a HPWH in both conditioned and unconditioned space at over 900 locations across the continental United States and Hawaii. Simulations included a Building America benchmark home so that any interaction between the HPWH and the home's HVAC equipment could be captured. Comparisons were performed to typical gas and electric water heaters to determine the energy savings potential and cost effectiveness of a HPWH relative to these technologies. HPWHs were found to have a significant source energy savings potential when replacing typical electric water heaters, but only saved source energy relative to gas water heater in the most favorable installation locations in the southern US. When replacing an electric water heater, the HPWH is likely to break even in California, the southern US, and parts of the northeast in most situations. However, the HPWH will only break even when replacing a gas water heater in a few southern states.

  5. Heat exchanger and water tank arrangement for passive cooling system

    DOE Patents [OSTI]

    Gillett, James E. (Greensburg, PA); Johnson, F. Thomas (Baldwin Boro, PA); Orr, Richard S. (Pittsburgh, PA); Schulz, Terry L. (Murrysville Boro, PA)


    A water storage tank in the coolant water loop of a nuclear reactor contains a tubular heat exchanger. The heat exchanger has tubesheets mounted to the tank connections so that the tubesheets and tubes may be readily inspected and repaired. Preferably, the tubes extend from the tubesheets on a square pitch and then on a rectangular pitch therebetween. Also, the heat exchanger is supported by a frame so that the tank wall is not required to support all of its weight.

  6. Waste heat from kitchen cuts hot water electricity 23%

    SciTech Connect (OSTI)

    Barber, J.


    Heat recovered from the Hamburger Hamlet's kitchen in Bethesada, Maryland and used to pre-heat the million gallons of hot water used annually reduced hot water costs 23% and paid off the investment in 1.5 years. Potomac Electric initiated the installation of an air-to-water heat pump in the restaurant kitchen above the dishwasher at a cost of about $5300, with the restaurant obliged to reimburse the utility if performance was satisfactory. Outside water recirculates through storage tanks and the ceiling heat pump until it reaches the required 140/sup 0/F. The amount of electricity needed to bring the preheated water to that temperature was $3770 lower after the installation. Cooled air exhausted from the heat pump circulates throughout the kitchen.

  7. Heat Pump Water Heater Technology: Experiences of Residential Consumers and Utilities

    SciTech Connect (OSTI)

    Ashdown, BG


    This paper presents a case study of the residential heat pump water heater (HPWH) market. Its principal purpose is to evaluate the extent to which the HPWH will penetrate the residential market sector, given current market trends, producer and consumer attributes, and technical parameters. The report's secondary purpose is to gather background information leading to a generic framework for conducting market analyses of technologies. This framework can be used to compare readiness and to factor attributes of market demand back into product design. This study is a rapid prototype analysis rather than a detailed case analysis. For this reason, primary data collection was limited and reliance on secondary sources was extensive. Despite having met its technical goals and having been on the market for twenty years, the HPWH has had virtually no impact on contributing to the nation's water heating. In some cases, HPWH reliability and quality control are well below market expectations, and early units developed a reputation for unreliability, especially when measured against conventional water heaters. In addition to reliability problems, first costs of HPWH units can be three to five times higher than conventional units. Without a solid, well-managed business plan, most consumers will not be drawn to this product. This is unfortunate. Despite its higher first costs, efficiency of an HPWH is double that of a conventional water heater. The HPWH also offers an attractive payback period of two to five years, depending on hot water usage. On a strict life-cycle basis it supplies hot water very cost effectively. Water heating accounts for 17% of the nation's residential consumption of electricity (see chart at left)--water heating is second only to space heating in total residential energy use. Simple arithmetic suggests that this figure could be reduced to the extent HPWH technology displaces conventional water heating. In addition, the HPWH offers other benefits. Because it produces hot water by extracting heat from the air it tends to dehumidify and cool the room in which it is placed. Moreover, it tends to spread the water heating load across utility non-peak periods. Thus, electric utilities with peak load issues could justify internal programs to promote this technology to residential and commercial customers. For practical purposes, consumers are indifferent to the manner in which water is heated but are very interested in product attributes such as initial first cost, operating cost, performance, serviceability, product size, and installation costs. Thus, the principal drivers for penetrating markets are demonstrating reliability, leveraging the dehumidification attributes of the HPWH, and creating programs that embrace life-cycle cost principles. To supplement this, a product warranty with scrupulous quality control should be implemented; first-price reduction through engineering, perhaps by reducing level of energy efficiency, should be pursued; and niche markets should be courted. The first step toward market penetration is to address the HPWH's performance reliability. Next, the manufacturers could engage select utilities to aggressively market the HPWH. A good approach would be to target distinct segments of the market with the potential for the highest benefits from the technology. Communications media that address performance issues should be developed. When marketing to new home builders, the HPWH could be introduced as part of an energy-efficient package offered as a standard feature by builders of new homes within a community. Conducting focus groups across the United States to gather input on HPWH consumer values will feed useful data back to the manufacturers. ''Renaming'' and ''repackaging'' the HPWH to improve consumer perception, appliance aesthetics, and name recognition should be considered. Once an increased sales volume is achieved, the manufacturers should reinvest in R&D to lower the price of the units. The manufacturers should work with ''do-it-yourself'' (DIY) stores to facilitate introduction of the technology to these sales venues. The HPWH is an excellent example of a technology that would have benefited from the implementation of a market research program run in parallel with the technology R&D program. Understanding consumer values and ''willingness to pay'' for product attributes and recognizing the corresponding influences those values have on purchase decisions are crucial. This knowledge should be incorporated into the R&D process with continuous dialogue between the market research and the R&D programs. Partnerships among stakeholders to gather consumer feedback and market analysis during R&D will facilitate a strong framework for successful market penetration of energy-efficient technologies.

  8. Tips: Water Heating | Department of Energy

    Broader source: (indexed) [DOE]

    Keep your energy bills out of hot water. Insulate your water heater to save energy and money, or choose an on-demand hot water heater to save even more. Keep your energy bills out...

  9. Buildings","All Buildings with Water Heating","Water-Heating Energy Sources Used

    U.S. Energy Information Administration (EIA) Indexed Site

    5. Water-Heating Energy Sources, Number of Buildings, 1999" ,"Number of Buildings (thousand)" ,"All Buildings","All Buildings with Water Heating","Water-Heating Energy Sources Used (more than one may apply)" ,,,"Electricity","Natural Gas","Fuel Oil","District Heat","Propane" "All Buildings ................",4657,3239,1546,1520,110,62,130 "Building Floorspace" "(Square

  10. Advanced Energy and Water Recovery Technology from Low Grade Waste Heat

    SciTech Connect (OSTI)

    Dexin Wang


    The project has developed a nanoporous membrane based water vapor separation technology that can be used for recovering energy and water from low-temperature industrial waste gas streams with high moisture contents. This kind of exhaust stream is widely present in many industrial processes including the forest products and paper industry, food industry, chemical industry, cement industry, metal industry, and petroleum industry. The technology can recover not only the sensible heat but also high-purity water along with its considerable latent heat. Waste heats from such streams are considered very difficult to recover by conventional technology because of poor heat transfer performance of heat-exchanger type equipment at low temperature and moisture-related corrosion issues. During the one-year Concept Definition stage of the project, the goal was to prove the concept and technology in the laboratory and identify any issues that need to be addressed in future development of this technology. In this project, computational modeling and simulation have been conducted to investigate the performance of a nanoporous material based technology, transport membrane condenser (TMC), for waste heat and water recovery from low grade industrial flue gases. A series of theoretical and computational analyses have provided insight and support in advanced TMC design and experiments. Experimental study revealed condensation and convection through the porous membrane bundle was greatly improved over an impermeable tube bundle, because of the membrane capillary condensation mechanism and the continuous evacuation of the condensate film or droplets through the membrane pores. Convection Nusselt number in flue gas side for the porous membrane tube bundle is 50% to 80% higher than those for the impermeable stainless steel tube bundle. The condensation rates for the porous membrane tube bundle also increase 60% to 80%. Parametric study for the porous membrane tube bundle heat transfer performance was also done, which shows this heat transfer enhancement approach works well in a wide parameters range for typical flue gas conditions. Better understanding of condensing heat transfer mechanism for porous membrane heat transfer surfaces, shows higher condensation and heat transfer rates than non-permeable tubes, due to existence of the porous membrane walls. Laboratory testing has documented increased TMC performance with increased exhaust gas moisture content levels, which has exponentially increased potential markets for the product. The TMC technology can uniquely enhance waste heat recovery in tandem with water vapor recovery for many other industrial processes such as drying, wet and dry scrubber exhaust gases, dewatering, and water chilling. A new metallic substrate membrane tube development and molded TMC part fabrication method, provides an economical way to expand this technology for scaled up applications with less than 3 year payback expectation. A detailed market study shows a broad application area for this advanced waste heat and water recovery technology. A commercialization partner has been lined up to expand this technology to this big market. This research work led to new findings on the TMC working mechanism to improve its performance, better scale up design approaches, and economical part fabrication methods. Field evaluation work needs to be done to verify the TMC real world performance, and get acceptance from the industry, and pave the way for our commercial partner to put it into a much larger waste heat and waste water recovery market. This project is addressing the priority areas specified for DOE Industrial Technologies Program's (ITP's): Energy Intensive Processes (EIP) Portfolio - Waste Heat Minimization and Recovery platform.

  11. Retrofitting Combined Space and Water Heating Systems: Laboratory Tests

    SciTech Connect (OSTI)

    Schoenbauer, B.; Bohac, D.; Huelman, P.; Olson, R.; Hewitt, M.


    Better insulated and tighter homes can often use a single heating plant for both space and domestic water heating. These systems, called dual integrated appliances (DIA) or combination systems, can operate at high efficiency and eliminate combustion safety issues associated by using a condensing, sealed combustion heating plant. Funds were received to install 400 DIAs in Minnesota low-income homes. The NorthernSTAR DIA laboratory was created to identify proper system components, designs, operating parameters, and installation procedures to assure high efficiency of field installed systems. Tests verified that heating loads up to 57,000 Btu/hr can be achieved with acceptable return water temperatures and supply air temperatures.

  12. Retrofitting Combined Space and Water Heating Systems. Laboratory Tests

    SciTech Connect (OSTI)

    Schoenbauer, B.; Bohac, D.; Huelman, P.; Olsen, R.; Hewett, M.


    Better insulated and tighter homes can often use a single heating plant for both space and domestic water heating. These systems, called dual integrated appliances (DIA) or combination systems, can operate at high efficiency and eliminate combustion safety issues associated by using a condensing, sealed combustion heating plant. Funds were received to install 400 DIAs in Minnesota low-income homes. The NorthernSTAR DIA laboratory was created to identify proper system components, designs, operating parameters, and installation procedures to assure high efficiency of field installed systems. Tests verified that heating loads up to 57,000 Btu/hr can be achieved with acceptable return water temperatures and supply air temperatures.

  13. Building America Webinar: Central Multifamily Water Heating Systems -

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy-Efficient Controls for Multifamily Domestic Hot Water | Department of Energy Energy-Efficient Controls for Multifamily Domestic Hot Water Building America Webinar: Central Multifamily Water Heating Systems - Energy-Efficient Controls for Multifamily Domestic Hot Water This presentation will be delivered at the U.S. Department of Energy Building America webinar on January 21, 2015, by Jordan Dentz and Eric Ansanelli of the Levy Partnership. Central domestic hot water (CDHW) systems are

  14. Florida Sunshine -- Natural Source for Heating Water

    SciTech Connect (OSTI)

    Not Available


    This brochure, part of the State Energy Program (SEP) Stellar Project series, describes a utility solar hot water program in Lakeland, Florida. It is the first such utility-run solar hot water program in the country.

  15. Field Performance of Heat Pump Water Heaters in the Northeast, Massachusetts and Rhode Island (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available


    Heat pump water heaters (HPWHs) are finally entering the mainstream residential water heater market. Potential catalysts are increased consumer demand for higher energy efficiency electric water heating and a new Federal water heating standard that effectively mandates use of HPWHs for electric storage water heaters with nominal capacities greater than 55 gallons. When compared to electric resistance water heating, the energy and cost savings potential of HPWHs is tremendous. Converting all electric resistance water heaters to HPWHs could save American consumers 7.8 billion dollars annually ($182 per household) in water heating operating costs and cut annual residential source energy consumption for water heating by 0.70 quads. Steven Winter Associates, Inc. embarked on one of the first in situ studies of these newly released HPWH products through a partnership with two sponsoring electric utility companies, National Grid and NSTAR, and one sponsoring energy efficiency service program administrator, Cape Light Compact. Recent laboratory studies have measured performance of HPWHs under various operating conditions, but publicly available field studies have not been as available. This evaluation attempts to provide publicly available field data on new HPWHs by monitoring the performance of three recently released products (General Electric GeoSpring, A.O. Smith Voltex, and Stiebel Eltron Accelera 300). Fourteen HPWHs were installed in Massachusetts and Rhode Island and monitored for over a year. Of the 14 units, ten were General Electric models (50 gallon units), two were Stiebel Eltron models (80 gallon units), and two were A.O. Smith models (one 60-gallon and one 80-gallon unit).

  16. Comparison of natural convection heat exchangers for solar water heating systems

    SciTech Connect (OSTI)

    Davidson, J.; Liu, W.


    Thermosyphon heat exchangers are used in indirect solar water heating systems to avoid using a pump to circulate water from the storage tank to the heat exchanger. In this study, the authors consider the effect of heat exchanger design on system performance. They also compare performance of a system with thermosyphon flow to the same system with a 40W pump in the water loop. In the first part of the study, the authors consider the impact of heat exchanger design on the thermal performance of both one- and two-collector solar water heaters. The comparison is based on Solar Rating and Certification Corporation (SRCC) OG300 simulations. The thermosyphon heat exchangers considered are (1) a one-pass, double wall, 0.22 m{sup 2}, four tube-in-shell heat exchanger manufactured by AAA Service and Supply, Inc., (the Quad-Rod); (2) a two-pass, double wall, 0.2 m{sup 2}, tube-in-shell made by Heliodyne, Inc., but not intended for commercial development; (3) a one-pass, single wall, 0.28 m{sup 2}, 31 tube-in-shell heat exchanger from Young Radiator Company, and (4) a one-pass single-wall, 0.61 m{sup 2}, four coil-in-shell heat exchanger made by ThermoDynamics Ltd. The authors compare performance of the systems with thermosyphon heat exchangers to a system with a 40 W pump used with the Quad-Rod heat exchanger. In the second part of the study, the effects of reducing frictional losses through the heat exchanger and/or the pipes connecting the heat exchanger to the storage tank, and increasing heat transfer area are evaluated in terms of OG300 ratings.

  17. Marketing the Klamath Falls Geothermal District Heating system

    SciTech Connect (OSTI)

    Rafferty, K.


    The new marketing strategy for the Klamath Falls system has concentrated on offering the customer an attractive and easy to understand rate structure, reduced retrofit cost and complexity for his building along with an attractive package of financing and tax credits. Initial retrofit costs and life-cycle cost analysis have been conducted on 22 buildings to date. For some, the retrofit costs are simply too high for the conversion to make sense at current geothermal rates. For many, however, the prospects are good. At this writing, two new customers are now connected and operating with 5 to 8 more buildings committed to connect this construction season after line extensions are completed. This represents nearly a 60% increase in the number of buildings connected to the system and a 40% increase in system revenue.

  18. Water recovery using waste heat from coal fired power plants.

    SciTech Connect (OSTI)

    Webb, Stephen W.; Morrow, Charles W.; Altman, Susan Jeanne; Dwyer, Brian P.


    The potential to treat non-traditional water sources using power plant waste heat in conjunction with membrane distillation is assessed. Researchers and power plant designers continue to search for ways to use that waste heat from Rankine cycle power plants to recover water thereby reducing water net water consumption. Unfortunately, waste heat from a power plant is of poor quality. Membrane distillation (MD) systems may be a technology that can use the low temperature waste heat (<100 F) to treat water. By their nature, they operate at low temperature and usually low pressure. This study investigates the use of MD to recover water from typical power plants. It looks at recovery from three heat producing locations (boiler blow down, steam diverted from bleed streams, and the cooling water system) within a power plant, providing process sketches, heat and material balances and equipment sizing for recovery schemes using MD for each of these locations. It also provides insight into life cycle cost tradeoffs between power production and incremental capital costs.

  19. City of Palo Alto Utilities- Solar Water Heating Program

    Broader source: [DOE]

    City of Palo Alto Utilities is offering incentives for their residential, commercial and industrial customers to install solar water heating systems on their homes and facilities with a goal of 1...

  20. South River EMC- Solar Water Heating Rebate Program

    Broader source: [DOE]

    South River Electric Membership Corporation (EMC) is providing rebates to encourage their customers to install solar water heating systems. To be eligible for the rebate solar collectors must have...

  1. Questar Gas- Residential Solar Assisted Water Heating Rebate Program

    Broader source: [DOE]

    Questar Gas provides incentives for residential customers to purchase and install solar water heating systems on their homes. Rebates of $750 per system are provided to customers of Questar who...

  2. Ashland Electric Utility - Bright Way to Heat Water Rebate |...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    average 800 to 1,000) Summary The City of Ashland Conservation Division offers a solar water heating program to its residential electric customers who currently use an electric...

  3. Temperatures, heat flow, and water chemistry from drill holes...

    Open Energy Info (EERE)

    Temperatures, heat flow, and water chemistry from drill holes in the Raft River geothermal system, Cassia County, Idaho Jump to: navigation, search OpenEI Reference LibraryAdd to...

  4. Minnesota Power- Solar-Thermal Water Heating Rebate Program

    Office of Energy Efficiency and Renewable Energy (EERE)

    Minnesota Power offers a 25% rebate for qualifying solar thermal water heating systems. The maximum award for single-family customers is $2,000 per customer; $4,000 for 2-3 family unit buildings;...

  5. GreyStone Power- Solar Water Heating Program

    Broader source: [DOE]

    GreyStone Power, an electricity cooperative serving 103,000 customers in Georgia, introduced a solar water heating rebate in March 2009. This $500 rebate is available to customers regardless of...

  6. Siting Your Solar Water Heating System | Department of Energy

    Broader source: (indexed) [DOE]

    and Photovoltaic Modules. North Carolina Solar Center Heat Your Water with the Sun (PDF). U.S. Department of Energy Addthis Related Articles An example of a solar pool...

  7. Corrosion protection of steel in ammonia/water heat pumps

    DOE Patents [OSTI]

    Mansfeld, Florian B.; Sun, Zhaoli


    Corrosion of steel surfaces in a heat pump is inhibited by adding a rare earth metal salt to the heat pump's ammonia/water working fluid. In preferred embodiments, the rare earth metal salt includes cerium, and the steel surfaces are cerated to enhance the corrosion-inhibiting effects.

  8. HVAC, Water Heating, and Appliance Publications | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HVAC, Water Heating, and Appliance Publications HVAC, Water Heating, and Appliance Publications October 15, 2015 Alternative Refrigerant Evaluation for High-Ambient-Temperature Environments: R-22 and R-410A Alternatives for Mini-Split Air Conditioners This publication is a final report for Oak Ridge National Laboratory's High-Ambient-Temperature Evaluation Program for Low Global Warming Potential (Low-GWP) Refrigerants project. October 9, 2015 Pump and Fan Technology Characterization and

  9. Energy Department Releases Roadmaps on HVAC Technologies, Water Heating,

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Appliances, and Low-GWP Refrigerants | Department of Energy Releases Roadmaps on HVAC Technologies, Water Heating, Appliances, and Low-GWP Refrigerants Energy Department Releases Roadmaps on HVAC Technologies, Water Heating, Appliances, and Low-GWP Refrigerants December 18, 2014 - 4:50pm Addthis The Research & Development Roadmap for Next-Generation Low Global Warming Potential Refrigerants provides recommendations on R&D activities that will help accelerate the transition to low-GWP

  10. Development of High Efficiency Carbon Dioxide Commercial Heat Pump Water Heater

    SciTech Connect (OSTI)

    Michael PETERSEN; Chad D. BOWERS; Stefan ELBEL; Pega HRNJAK


    Although heat pump water heaters are today widely accepted in both Japan and Europe, where energy costs are high and government incentives for their use exist, acceptance of such products in the US has been limited. While this trend is slowly changing with the introduction of heat pump water heaters into the residential market, but acceptance remains low in the commercial sector. The objective of the presented work is the development of a high efficiency R744 heat pump water heater for commercial applications with effective utilization of the cooling capability for air conditioning and/or refrigeration. The ultimate goal is to achieve total system COP of up to 8. This unit will be targeted at commercial use where some cooling load is typically needed year round, such as restaurants, hotels, nursing homes, and hospitals. This paper presents the performance results from the development of four R744 commercial heat pump water heater packages of approximately 35 kW and comparison to a commercially available baseline R134a unit of the same capacity and footprint. In addition, the influences of an internal heat exchanger and an enhanced evaporator on the system performance are described and recommendations are made for further improvements of the R744 system.

  11. Development of a High Performance Air Source Heat Pump for the US Market

    SciTech Connect (OSTI)

    Abdelaziz, Omar; Shen, Bo; Gao, Zhiming; Baxter, Van D; Iu, Ipseng


    Heat pumps present a significant advantage over conventional residential heating technologies due to higher energy efficiencies and less dependence on imported oil. The US development of heat pumps dates back to the 1930 s with pilot units being commercially available in the 1950 s. Reliable and cost competitive units were available in the US market by the 1960 s. The 1973 oil embargo led to increased interest in heat pumps prompting significant research to improve performance, particularly for cold climate locations. Recent increasing concerns on building energy efficiency and environmental emissions have prompted a new wave of research in heat pump technology with special emphasis on reducing performance degradation at colder outdoor air temperatures. A summary of the advantages and limitations of several performance improvement options sought for the development of high performance air source heat pump systems for cold climate applications is the primary focus of this paper. Some recommendations for a high performance cold climate heat pump system design most suitable for the US market are presented.

  12. Heat exchanger and water tank arrangement for passive cooling system

    DOE Patents [OSTI]

    Gillett, J.E.; Johnson, F.T.; Orr, R.S.; Schulz, T.L.


    A water storage tank in the coolant water loop of a nuclear reactor contains a tubular heat exchanger. The heat exchanger has tube sheets mounted to the tank connections so that the tube sheets and tubes may be readily inspected and repaired. Preferably, the tubes extend from the tube sheets on a square pitch and then on a rectangular pitch there between. Also, the heat exchanger is supported by a frame so that the tank wall is not required to support all of its weight. 6 figures.

  13. Heat Pump Water Heaters: Controlled Field Research of Impact on Space Conditioning and Demand Response Characteristics

    SciTech Connect (OSTI)

    Parker, Graham B.; Widder, Sarah H.; Eklund, Ken; Petersen, Joseph M.; Sullivan, Greg


    A new generation of heat pump water heaters (HPWH) has been introduced into the U.S. market that promises to provide significant energy savings for water heating. Many electric utilities are promoting their widespread adoption as a key technology for meeting energy conservation goals and reducing greenhouse gas emissions. There is, however, considerable uncertainty regarding the space conditioning impact of an HPWH installed in a conditioned space. There is also uncertainty regarding the potential for deployment of HPWHs in demand response (DR) programs to help manage and balance peak utility loads in a similar manner as conventional electric resistance water heaters (ERWH). To help answer these uncertainties, controlled experiments have been undertaken over 30 months in a matched pair of unoccupied Lab Homes located on the campus of the Pacific Northwest National Laboratory (PNNL) in Richland, Washington.

  14. Piedmont EMC- Solar Water Heating Rebate Program

    Office of Energy Efficiency and Renewable Energy (EERE)

    Piedmont Electric Membership Corporation is offering a $500 rebate to its residential members who install solar water heaters on their homes. The utility recommends but does not require the system...

  15. Heat pump water heater and method of making the same

    DOE Patents [OSTI]

    Mei, Viung C.; Tomlinson, John J.; Chen, Fang C.


    An improved heat pump water heater wherein the condenser assembly of the heat pump is inserted into the water tank through an existing opening in the top of the tank, the assembly comprising a tube-in-a-tube construction with an elongated cylindrical outer body heat exchanger having a closed bottom with the superheated refrigerant that exits the compressor of the heat pump entering the top of the outer body. As the refrigerant condenses along the interior surface of the outer body, the heat from the refrigerant is transferred to the water through the outer body. The refrigerant then enters the bottom of an inner body coaxially disposed within the outer body and exits the top of the inner body into the refrigerant conduit leading into the expansion device of the heat pump. The outer body, in a second embodiment of the invention, acts not only as a heat exchanger but also as the sacrificial anode in the water tank by being constructed of a metal which is more likely to corrode than the metal of the tank.

  16. Low Cost Solar Water Heating R&D | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Solar Water Heating R&D Low Cost Solar Water Heating R&D Emerging Technologies Project for ... More Documents & Publications Atmospheric Pressure Deposition for Electrochromic Windows ...

  17. Innovative Miniaturized Heat Pumps for Buildings: Modular Thermal Hub for Building Heating, Cooling and Water Heating

    SciTech Connect (OSTI)



    BEETIT Project: Georgia Tech is using innovative components and system design to develop a new type of absorption heat pump. Georgia Techs new heat pumps are energy efficient, use refrigerants that do not emit greenhouse gases, and can run on energy from combustion, waste heat, or solar energy. Georgia Tech is leveraging enhancements to heat and mass transfer technology possible in microscale passages and removing hurdles to the use of heat-activated heat pumps that have existed for more than a century. Use of microscale passages allows for miniaturization of systems that can be packed as monolithic full-system packages or discrete, distributed components enabling integration into a variety of residential and commercial buildings. Compared to conventional heat pumps, Georgia Techs design innovations will create an absorption heat pump that is much smaller, has higher energy efficiency, and can also be mass produced at a lower cost and assembly time.

  18. High Water Heating Bills on Lockdown at Idaho Jail

    Broader source: [DOE]

    Using funds from the American Recovery and Reinvestment Act, the county is installing a solar thermal hot water system that will provide nearly 70 percent of the power required for heating 600,000 gallons of water for the jail annually.

  19. Residential Absorption Water Heater

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Residential Absorption Water Heater 2014 Building Technologies Office Peer Review Kyle ... Target MarketAudience: Residential gas water heating Key Partners: GE CRADA partner SRA ...

  20. Ground-Source Heat Pumps. Overview of Market Status, Barriers to Adoption, and Options for Overcoming Barriers

    SciTech Connect (OSTI)

    Goetzler, William; Zogg, Robert; Lisle, Heather; Burgos, Javier


    February 2009 final report submitted to DOE by Navigant Consulting, Inc. This report summarizes the status of ground-source heat pump (GSHP) technology and market penetration globally, estimates the energy saving potential of GSHPs in the U.S., identifies key market barriers that are inhibiting wider market adoption of GSHPs, and recommends initiatives that can be implemented or facilitated by the DOE to accelerate market adoption.

  1. Overheating in Hot Water- and Steam-Heated Multifamily Buildings

    SciTech Connect (OSTI)

    Dentz, J.; Varshney, K.; Henderson, H.


    Apartment temperature data have been collected from the archives of companies that provide energy management systems (EMS) to multifamily buildings in the Northeast U.S. The data have been analyzed from more than 100 apartments in eighteen buildings where EMS systems were already installed to quantify the degree of overheating. This research attempts to answer the question, 'What is the magnitude of apartment overheating in multifamily buildings with central hot water or steam heat?' This report provides valuable information to researchers, utility program managers and building owners interested in controlling heating energy waste and improving resident comfort. Apartment temperature data were analyzed for deviation from a 70 degrees F desired setpoint and for variation by heating system type, apartment floor level and ambient conditions. The data shows that overheating is significant in these multifamily buildings with both hot water and steam heating systems.

  2. Development of an Air-Source Heat Pump Integrated with a Water Heating / Dehumidification Module

    SciTech Connect (OSTI)

    Rice, C Keith; Uselton, Robert B.; Shen, Bo; Baxter, Van D; Shrestha, Som S


    A residential-sized dual air-source integrated heat pump (AS-IHP) concept is under development in partnership between ORNL and a manufacturer. The concept design consists of a two-stage air-source heat pump (ASHP) coupled on the air distribution side with a separate novel water heating/dehumidification (WH/DH) module. The motivation for this unusual equipment combination is the forecast trend for home sensible loads to be reduced more than latent loads. Integration of water heating with a space dehumidification cycle addresses humidity control while performing double-duty. This approach can be applied to retrofit/upgrade applications as well as new construction. A WH/DH module capable of ~1.47 L/h water removal and ~2 kW water heating capacity was assembled by the manufacturer. A heat pump system model was used to guide the controls design; lab testing was conducted and used to calibrate the models. Performance maps were generated and used in a TRNSYS sub-hourly simulation to predict annual performance in a well-insulated house. Annual HVAC/WH energy savings of ~35% are predicted in cold and hot-humid U.S. climates compared to a minimum efficiency baseline.

  3. High Efficiency R-744 Commercial Heat Pump Water Heaters

    SciTech Connect (OSTI)

    Elbel, Dr. Stefan W.; Petersen, Michael


    The project investigated the development and improvement process of a R744 (CO2) commercial heat pump water heater (HPWH) package of approximately 35 kW. The improvement process covered all main components of the system. More specific the heat exchangers (Internal heat exchanger, Evaporator, Gas cooler) as well as the expansion device and the compressor were investigated. In addition, a comparison to a commercially available baseline R134a unit of the same capacity and footprint was made in order to compare performance as well as package size reduction potential.

  4. Utilization of Heat Pump Water Heaters for Load Management

    SciTech Connect (OSTI)

    Boudreaux, Philip R; Jackson, Roderick K; Munk, Jeffrey D; Gehl, Anthony C; Lyne, Christopher T


    The Energy Conservation Standards for Residential Water Heaters require residential electric storage water heaters with volumes larger than 55 gallons to have an energy factor greater than 2.0 after April 2015. While this standard will significantly increase the energy efficiency of water heaters, large electric storage water heaters that do not use heat pump technologies may no longer be available. Since utilities utilize conventional large-volume electric storage water heaters for thermal storage in demand response programs, there is a concern that the amended standard will significantly limit demand response capacity. To this end, Oak Ridge National Laboratory partnered with the Tennessee Valley Authority to investigate the load management capability of heat pump water heaters that meet or exceed the forthcoming water heater standard. Energy consumption reduction during peak periods was successfully demonstrated, while still meeting other performance criteria. However, to minimize energy consumption, it is important to design load management strategies that consider the home s hourly hot water demand so that the homeowner has sufficient hot water.

  5. Covered Product Category: Residential Heat Pump Water Heaters

    Broader source: [DOE]

    FEMP provides acquisition guidance and Federal efficiency requirements across a variety of product categories, including residential heat pump water heaters, which are an ENERGY STAR®-qualified product category. Federal laws and requirements mandate that agencies meet these efficiency requirements in all procurement and acquisition actions that are not specifically exempted by law.

  6. Laboratory Performance Evaluation of Residential Integrated Heat Pump Water Heaters

    SciTech Connect (OSTI)

    Sparn, B.; Hudon, K.; Christensen, D.


    This paper explores the laboratory performance of five integrated Heat Pump Water Heaters (HPWHs) across a wide range of operating conditions representative of US climate regions. HPWHs are expected to provide significant energy savings in certain climate zones when compared to typical electric resistance water heaters. Results show that this technology is a viable option in most climates, but differences in control schemes and design features impact the performance of the units tested. Tests were conducted to map heat pump performance across the operating range and to determine the logic used to control the heat pump and the backup electric heaters. Other tests performed include two unique draw profile tests, reduced air flow performance tests and the standard DOE rating tests. The results from all these tests are presented here for all five units tested. The results of these tests will be used to improve the EnergyPlus heat pump water heater for use in BEopt(tm) whole-house building simulations.

  7. Laboratory Performance Evaluation of Residential Integrated Heat Pump Water Heaters

    SciTech Connect (OSTI)

    Sparn, B.; Hudon, K.; Christensen, D.


    This paper explores the laboratory performance of five integrated Heat Pump Water Heaters (HPWHs) across a wide range of operating conditions representative of U.S. climate regions. HPWHs are expected to provide significant energy savings in certain climate zones when compared to typical electric resistance water heaters. Results show that this technology is a viable option in most climates, but differences in control schemes and design features impact the performance of the units tested. Tests were conducted to map heat pump performance across the operating range and to determine the logic used to control the heat pump and the backup electric heaters. Other tests performed include two unique draw profile tests, reduced air flow performance tests and the standard DOE rating tests. The results from all these tests are presented here for all five units tested. The results of these tests will be used to improve the EnergyPlus heat pump water heater for use in BEopt™ whole-house building simulations.

  8. Overheating in Hot Water- and Steam-Heated Multifamily Buildings

    SciTech Connect (OSTI)

    Dentz, J.; Varshney, K.; Henderson, H.


    In this project, the ARIES Building America team collected apartment temperature data from the archives of companies that provide energy management systems (EMS) to multifamily buildings in the Northeast U.S. Data was analyzed from more than 100 apartments in eighteen buildings where EMS systems were already installed to quantify the degree of overheating in an effort to answer the question, "What is the magnitude of apartment overheating in multifamily buildings with central hot water or steam heat?" This report provides valuable information to researchers, utility program managers and building owners interested in controlling heating energy waste and improving resident comfort.

  9. CenterPoint Energy (Gas)- Residential Heating and Hot Water Rebates

    Broader source: [DOE]

    CenterPoint Energy offers gas heating and water heating equipment rebates to its residential customers. Eligible equipment includes furnaces, back-up furnace systems, hydronic heaters, storage...

  10. Technical Highlight: NREL Tests Integrated Heat Pump Water Heater Performance in Different Climates

    SciTech Connect (OSTI)

    Sparn, Bethany


    This technical highlight describes NREL tests to capture information about heat pump performance across a wide range of ambient conditions for five heat pump water heaters.

  11. Improved Design Tools for Surface Water and Standing Column Well Heat Pump Systems

    Broader source: [DOE]

    This project will improve the capability of engineers to design heat pump systems that utilize surface water or standing column wells (SCW) as their heat sources and sinks.

  12. Study of a water-to-water heat pump using hydrocarbon and hydrofluorocarbon zeotropic mixtures

    SciTech Connect (OSTI)

    Payne, W.V.; Domanski, P.A.; Muller, J.


    This investigation compared the performance of R22 to the performance of propane (R290) and zeotropic mixtures of HFC's and hydrocarbons in a water-to-water heat pump. Baseline testing began with R22 and proceeded to R290, R32/290, R32/152a, and R290/600a. The use of brazed plate heat exchangers arranged in counterflow for both heating and cooling allowed glide matching using the zeotropic refrigerant mixtures. The performance of the system was characterized by air-side capacity, air-side Coefficient of Performance (COP), compressor RPM, and refrigerant conditions.

  13. Demand Response Performance of GE Hybrid Heat Pump Water Heater

    SciTech Connect (OSTI)

    Widder, Sarah H.; Parker, Graham B.; Petersen, Joseph M.; Baechler, Michael C.


    This report describes a project to evaluate and document the DR performance of HPWH as compared to ERWH for two primary types of DR events: peak curtailments and balancing reserves. The experiments were conducted with GE second-generation “Brillion”-enabled GeoSpring hybrid water heaters in the PNNL Lab Homes, with one GE GeoSpring water heater operating in “Standard” electric resistance mode to represent the baseline and one GE GeoSpring water heater operating in “Heat Pump” mode to provide the comparison to heat pump-only demand response. It is expected that “Hybrid” DR performance, which would engage both the heat pump and electric elements, could be interpolated from these two experimental extremes. Signals were sent simultaneously to the two water heaters in the side-by-side PNNL Lab Homes under highly controlled, simulated occupancy conditions. This report presents the results of the evaluation, which documents the demand-response capability of the GE GeoSpring HPWH for peak load reduction and regulation services. The sections describe the experimental protocol and test apparatus used to collect data, present the baselining procedure, discuss the results of the simulated DR events for the HPWH and ERWH, and synthesize key conclusions based on the collected data.

  14. Solar Water Heating with Low-Cost Plastic Systems

    SciTech Connect (OSTI)


    Federal buildings consumed over 392,000 billion Btu of site delivered energy for buildings during FY 2007 at a total cost of $6.5 billion. Earlier data indicate that about 10% of this is used to heat water.[2] Targeting energy consumption in Federal buildings, the Energy Independence and Security Act of 2007 (EISA) requires new Federal buildings and major renovations to meet 30% of their hot water demand with solar energy, provided it is cost-effective over the life of the system. In October 2009, President Obama expanded the energy reduction and performance requirements of EISA and its subsequent regulations with his Executive Order 13514.

  15. The Technical Potential of Solar Water Heating to Reduce Fossil Fuel Use and Greenhouse Gas Emissions in the United States

    SciTech Connect (OSTI)


    Use of solar water heating (SWH) in the United States grew significantly in the late 1970s and early 1980s, as a result of increasing energy prices and generous tax credits. Since 1985, however, expiration of federal tax credits and decreased energy prices have virtually eliminated the U.S. market for SWH. More recently, increases in energy prices, concerns regarding emissions of greenhouse gases, and improvements in SWH systems have created new interest in the potential of this technology. SWH,

  16. Geothermal(Ground-Source)Heat Pumps: Market Status, Barriers to Adoption, and Actions to Overcome Barriers

    SciTech Connect (OSTI)

    Hughes, Patrick


    More effective stewardship of our resources contributes to the security, environmental sustainability, and economic well-being of the nation. Buildings present one of the best opportunities to economically reduce energy consumption and limit greenhouse gas emissions. Geothermal heat pumps (GHPs), sometimes called ground-source heat pumps, have been proven capable of producing large reductions in energy use and peak demand in buildings. However, GHPs have received little attention at the policy level as an important component of a national strategy. Have policymakers mistakenly overlooked GHPs, or are GHPs simply unable to make a major contribution to the national goals for various reasons? This brief study was undertaken at DOE's request to address this conundrum. The scope of the study includes determining the status of global GHP markets and the status of the GHP industry and technology in the United States, assembling previous estimates of GHP energy savings potential, identifying key barriers to application of GHPs, and identifying actions that could accelerate market adoption of GHPs. The findings are documented in this report along with conclusions and recommendations.

  17. Mexico-GTZ Support for the Programme to Promote Solar Water Heating...

    Open Energy Info (EERE)

    Support for the Programme to Promote Solar Water Heating Jump to: navigation, search Logo: Mexico-GTZ Support for the Programme to Promote Solar Water Heating Name Mexico-GTZ...

  18. Issue #4: Are High Efficiency Hot Water Heating Systems Worth the Cost? |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy 4: Are High Efficiency Hot Water Heating Systems Worth the Cost? Issue #4: Are High Efficiency Hot Water Heating Systems Worth the Cost? What are realistic energy savings associated with the latest advanced and forthcoming water heating technologies and are they cost effective? PDF icon issue4_gasfired_waterheater.pdf PDF icon issue4_tankless_wh.pdf PDF icon issue4_waterhtg_solutions.pdf More Documents & Publications Cost Effective Water Heating Solutions Tankless

  19. Field Testing of Pre-Production Prototype Residential Heat Pump Water Heaters

    Broader source: [DOE]

    Provides and overview of field testing of 18 pre-production prototype residential heat pump water heaters

  20. Direct Use for Building Heat and Hot Water Presentation Slides and Text Version

    Office of Energy Efficiency and Renewable Energy (EERE)

    Download presentation slides from the DOE Office of Indian Energy webinar on direct use for building heat and hot water.

  1. Regional Variation in Residential Heat Pump Water Heater Performance in the U.S.: Preprint

    SciTech Connect (OSTI)

    Maguire, J.; Burch, J.; Merrigan, T.; Ong, S.


    Residential heat pump water heaters (HPWHs) have recently reemerged on the U.S. market. These units have the potential to provide homeowners significant cost and energy savings. However, actual in use performance of a HPWH will vary significantly with climate, installation location, HVAC equipment, and hot water use. To determine what actual in use energy consumption of a HPWH may be in different regions of the U.S., annual simulations of both 50 and 80 gallon HPWHs as well as a standard electric water heater were performed for over 900 locations across the U.S. The simulations included a benchmark home to take into account interactions between the space conditioning equipment and the HPWH and a realistic hot water draw profile. It was found that the HPWH will always save some source energy when compared to a standard electric resistance water heater, although savings varies widely with location. In addition to looking at source energy savings, the breakeven cost (the net installed cost a HPWH would have to have to be a cost neutral replacement for a standard water heater) was also examined. The highest breakeven costs were seen in cases with high energy savings, such as the southeastern U.S., or high energy costs, such as New England and California. While the breakeven cost is higher for 80 gallon units than 50 gallon units, the higher net installed costs of an 80 gallon unit lead to the 50 gallon HPWHs being more likely to be cost effective.

  2. Regional Variation in Residential Heat Pump Water Heater Performance in the U.S.

    SciTech Connect (OSTI)

    Maguire, Jeff; Burch, Jay; Merrigan, Tim; Ong, Sean


    Residential heat pump water heaters (HPWHs) have recently re-emerged on the U.S. market, and they have the potential to provide homeowners significant cost and energy savings. However, actual in use performance of a HPWH will vary significantly with climate, installation location, HVAC equipment, and hot water use. To determine the actual energy consumption of a HPWH in different U.S. regions, annual simulations of both 50 and 80 gallon HPWHs as well as a standard electric water heater were performed for over 900 locations across the United States. The simulations included a benchmark home to take into account interactions between the space conditioning equipment and the HPWH and a realistic hot water draw profile. It was found that the HPWH will always save some source energy when compared to a standard electric resistance water heater, although savings varies widely with location. In addition to looking at source energy savings, the breakeven cost (the net installed cost a HPWH would have to have to be a cost neutral replacement for a standard water heater) was also examined. The highest breakeven costs were seen in cases with high energy savings, such as the southeastern U.S., or high energy costs, such as New England and California. While the breakeven cost is higher for 80 gallon units than 50 gallon units, the higher net installed costs of an 80 gallon unit lead to the 50 gallon HPWHs being more likely to be cost effective.

  3. Heat pump water heater and storage tank assembly

    DOE Patents [OSTI]

    Dieckmann, John T.; Nowicki, Brian J.; Teagan, W. Peter; Zogg, Robert


    A water heater and storage tank assembly comprises a housing defining a chamber, an inlet for admitting cold water to the chamber, and an outlet for permitting flow of hot water from the chamber. A compressor is mounted on the housing and is removed from the chamber. A condenser comprises a tube adapted to receive refrigerant from the compressor, and winding around the chamber to impart heat to water in the chamber. An evaporator is mounted on the housing and removed from the chamber, the evaporator being adapted to receive refrigerant from the condenser and to discharge refrigerant to conduits in communication with the compressor. An electric resistance element extends into the chamber, and a thermostat is disposed in the chamber and is operative to sense water temperature and to actuate the resistance element upon the water temperature dropping to a selected level. The assembly includes a first connection at an external end of the inlet, a second connection at an external end of the outlet, and a third connection for connecting the resistance element, compressor and evaporator to an electrical power source.

  4. Market Assessment for Capturing Water Conservation Opportunities in the Federal Sector

    SciTech Connect (OSTI)

    Parker, Graham B.; Mcmordie, Katherine; Sullivan, Gregory P.; Elliott, Douglas B.


    The Department of Energy's Federal Energy Management Program (FEMP) is considering the development of a technology-specific Super-Energy Saving Performance Contract (ESPC) for water conservation. Prior to the development however, FEMP requires the completion of a market assessment to better understand the water conservation opportunities and the strategies available for capturing them. Thus, this market assessment has been undertaken to evaluate the water conservation opportunities and answer the key questions necessary for FEMP to make recommendations on whether or not to proceed with strategies for water conservation primarily through the development of a water conservation technology-specific performance contract.

  5. Fluidized bed heat exchanger with water cooled air distributor and dust hopper

    DOE Patents [OSTI]

    Jukkola, Walfred W.; Leon, Albert M.; Van Dyk, Jr., Garritt C.; McCoy, Daniel E.; Fisher, Barry L.; Saiers, Timothy L.; Karstetter, Marlin E.


    A fluidized bed heat exchanger is provided in which air is passed through a bed of particulate material containing fuel. A steam-water natural circulation system is provided for heat exchange and the housing of the heat exchanger has a water-wall type construction. Vertical in-bed heat exchange tubes are provided and the air distributor is water-cooled. A water-cooled dust hopper is provided in the housing to collect particulates from the combustion gases and separate the combustion zone from a volume within said housing in which convection heat exchange tubes are provided to extract heat from the exiting combustion gases.

  6. Technology Case Studies: Retrofit Integrated Space and Water Heating - Field Assessment

    SciTech Connect (OSTI)


    Better insulation and tighter envelopes are reducing space heating loads for new and existing homes. For many homes, decreased space heating loads make it possible for both space and domestic water heating loads to be provided with a single heating plant. This project analyzed combined condensing water heaters or boilers and hydronic air coils to provide high efficiency domestic hot water and forced air space heating. Called 'Combi' systems, they provided similar space and water heating performance less expensively than installing two condensing appliances. These systems can also eliminate safety issues associated with natural draft appliances through the use of one common sealed combustion vent.

  7. Absorption Heat Pump Water Heater - 2013 Peer Review | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Absorption Heat Pump Water Heater - 2013 Peer Review Absorption Heat Pump Water Heater - 2013 Peer Review Emerging Technologies Project for the 2013 Building Technologies Office's Program Peer Review PDF icon emrgtech10_gluesenkamp_040313.pdf More Documents & Publications Photo credit: Oak Ridge National Lab Residential Absorption Heat Pump Water Heater Figure 1: The system model for the combined Water heater, dehumidifier and cooler (WHDC). A Combined Water Heater, Dehumidifier, and Cooler

  8. Technical Potential of Solar Water Heating to Reduce Fossil Fuel Use and Greenhouse Gas Emissions in the United States

    SciTech Connect (OSTI)

    Denholm, P.


    Use of solar water heating (SWH) in the United States grew significantly in the late 1970s and early 1980s, as a result of increasing energy prices and generous tax credits. Since 1985, however, expiration of federal tax credits and decreased energy prices have virtually eliminated the U.S. market for SWH. More recently, increases in energy prices, concerns regarding emissions of greenhouse gases, and improvements in SWH systems have created new interest in the potential of this technology. SWH, which uses the sun to heat water directly or via a heat-transfer fluid in a collector, may be particularly important in its ability to reduce natural gas use. Dependence on natural gas as an energy resource in the United States has significantly increased in the past decade, along with increased prices, price volatility, and concerns about sustainability and security of supply. One of the readily deployable technologies available to decrease use of natural gas is solar water heating. This report provides an overview of the technical potential of solar water heating to reduce fossil fuel consumption and associated greenhouse gas emissions in U.S. residential and commercial buildings.

  9. Expert Meeting Report: Recommendations for Applying Water Heaters in Combination Space and Domestic Water Heating Systems

    SciTech Connect (OSTI)

    Rudd, A.; Ueno, K.; Bergey, D.; Osser, R.


    The topic of this meeting was 'Recommendations For Applying Water Heaters In Combination Space And Domestic Water Heating Systems.' Presentations and discussions centered on the design, performance, and maintenance of these combination systems, with the goal of developing foundational information toward the development of a Building America Measure Guideline on this topic. The meeting was held at the Westford Regency Hotel, in Westford, Massachusetts on 7/31/2011.

  10. Expert Meeting Report: Recommendations for Applying Water Heaters in Combination Space and Domestic Water Heating Systems

    Energy Savers [EERE]

    Recommendations for Applying Water Heaters in Combination Space and Domestic Water Heating Systems A. Rudd, K. Ueno, D. Bergey, R. Osser Building Science Corporation June 2012 i This report received minimal editorial review at NREL. NOTICE This report was prepared as an account of work sponsored by an agency of the United States government. Neither the United States government nor any agency thereof, nor any of their employees, subcontractors, or affiliated partners makes any warranty, express

  11. Table B37. Water Heating Equipment, Number of Buildings and Floorspace, 1999

    U.S. Energy Information Administration (EIA) Indexed Site

    7. Water Heating Equipment, Number of Buildings and Floorspace, 1999" ,"Number of Buildings (thousand)",,,,,"Total Floorspace (million square feet)" ,"All Buildings","All Buildings with Water Heating","Type of Water Heating Equipment",,,"All Buildings","All Buildings with Water Heating","Type of Water Heating Equipment" ,,,"Central-ized System","Distri-buted System","Combination

  12. Heat Pump Water Heater using Solid-State Energy Converters | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Water Heater using Solid-State Energy Converters Heat Pump Water Heater using Solid-State Energy Converters Sheetak will work on developing a full scale prototype of its low cost heat pump water heater. These solid state heat pumping elements can be implemented in low cost manner which have the potential to dramatically change the way in which he heat water.<BR />Image: Sheetak Sheetak will work on developing a full scale prototype of its low cost heat pump water heater. These

  13. Hot water tank for use with a combination of solar energy and heat-pump desuperheating

    DOE Patents [OSTI]

    Andrews, J.W.


    A water heater or system is described which includes a hot water tank having disposed therein a movable baffle to function as a barrier between the incoming volume of cold water entering the tank and the volume of heated water entering the tank which is heated by the circulation of the cold water through a solar collector and/or a desuperheater of a heat pump so as to optimize the manner in which heat is imparted to the water in accordance to the demand on the water heater or system. A supplemental heater is also provided and it is connected so as to supplement the heating of the water in the event that the solar collector and/or desuperheater cannot impart all of the desired heat input into the water.

  14. Hot water tank for use with a combination of solar energy and heat-pump desuperheating

    DOE Patents [OSTI]

    Andrews, John W.


    A water heater or system which includes a hot water tank having disposed therein a movable baffle to function as a barrier between the incoming volume of cold water entering the tank and the volume of heated water entering the tank which is heated by the circulation of the cold water through a solar collector and/or a desuperheater of a heat pump so as to optimize the manner in which heat is imparted to the water in accordance to the demand on the water heater or system. A supplemental heater is also provided and it is connected so as to supplement the heating of the water in the event that the solar collector and/or desuperheater cannot impart all of the desired heat input into the water.

  15. An Assessment of Heating Fuels And Electricity Markets During the Winters of 2013-2014 and 2014-2015

    Broader source: [DOE]

    Cold weather that blanketed much of the Eastern United States in 2013-2014 and 2014-2015 exhibited unique characteristics that prompted different — but related — challenges across heating fuels and electricity markets. In an effort to understand the impacts of the winter conditions on these markets, the Office of Electricity Delivery and Energy Reliability conducted an in-depth analysis of regional fuel and electricity sectors during the winters of 2013-2014 and 2014-2015 to assess market behavior and performance.

  16. 2014-04-28 Issuance: Certification of Commercial HVAC, Water Heating, and

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Refrigeration Equipment; Final Rule | Department of Energy 28 Issuance: Certification of Commercial HVAC, Water Heating, and Refrigeration Equipment; Final Rule 2014-04-28 Issuance: Certification of Commercial HVAC, Water Heating, and Refrigeration Equipment; Final Rule This document is a pre-publication Federal Register final rule regarding the certification of commercial heating, ventilation, and air-conditioning (HVAC), water heating (WH), and refrigeration (CRE) equipment, as issued by

  17. Do Heat Pump Clothes Dryers Make Sense for the U.S. Market

    SciTech Connect (OSTI)

    Meyers, Steve; Franco, Victor; Lekov, Alex; Thompson, Lisa; Sturges, Andy


    Heat pump clothes dryers (HPCDs) can be as much as 50percent more energy-efficient than conventional electric resistance clothes dryers, and therefore have the potential to save substantial amounts of electricity. While not currently available in the U.S., there are manufacturers in Europe and Japan that produce units for those markets. Drawing on analysis conducted for the U.S. Department of Energy's (DOE) current rulemaking on amended standards for clothes dryers, this paper evaluates the cost-effectiveness of HPCDs in American homes, as well as the national impact analysis for different market share scenarios. In order to get an accurate measurement of real energy savings potential, the paper offers a new energy use calculation methodology that takes into account the most current data on clothes washer cycles, clothes dryer usage frequency, remaining moisture content, and load weight per cycle, which is very different from current test procedure values. Using the above methodology along with product cost estimates developed by DOE, the paper presents the results of a life-cycle cost analysis of the adoption of HPCDs in a representative sample of American homes. The results show that HPCDs have positive economic benefits only for households with high clothes dryer usage or for households with high electricity prices and moderately high utilization.

  18. Guide to Geothermal Heat Pumps

    SciTech Connect (OSTI)


    Geothermal heat pumps, also known as ground source heat pumps, geoexchange, water-source, earth-coupled, and earth energy heat pumps, take advantage of this resource and represent one of the most efficient and durable options on the market to heat and cool your home.

  19. Designing a water leasing market for the Mimbres River, New Mexico.

    SciTech Connect (OSTI)

    Reno-Trujillo, Marissa Devan; Tidwell, Vincent Carroll; Broadbent, Craig; Brookshire, David; Coursey, Don; Jackson, Charles.; Polley, Adam; Stevenson, Bryan


    The objective of this study is to develop a conceptual framework for establishing water leasing markets in New Mexico using the Mimbres River as a test case. Given the past and growing stress over water in New Mexico and the Mimbres River in particular, this work will develop a mechanism for the short term, efficient, temporary transfer of water from one user to another while avoiding adverse effects on any user not directly involved in the transaction (i.e., third party effects). Toward establishing a water leasing market, five basic tasks were performed, (1) a series of stakeholder meetings were conducted to identify and address concerns and interests of basin residents, (2) several gauges were installed on irrigation ditches to aid in the monitoring and management of water resources in the basin, (3) the hydrologic/market model and decision support interface was extended to include the Middle and Lower reaches of the Mimbres River, (4) experiments were conducted to aid in design of the water leasing market, and (5) a set of rules governing a water leasing market was drafted for future adoption by basin residents and the New Mexico Office of the State Engineer.

  20. Estimating Costs and Efficiency of Storage, Demand, and Heat Pump Water

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Heaters | Department of Energy Costs and Efficiency of Storage, Demand, and Heat Pump Water Heaters Estimating Costs and Efficiency of Storage, Demand, and Heat Pump Water Heaters A water heater's energy efficiency is determined by the energy factor (EF), which is based on the amount of hot water produced per unit of fuel consumed over a typical day. The higher the energy factor, the more efficient the water heater. A water heater's energy efficiency is determined by the energy factor (EF),

  1. Estimating Costs and Efficiency of Storage, Demand, and Heat Pump Water

    Energy Savers [EERE]

    Heaters | Department of Energy Estimating Costs and Efficiency of Storage, Demand, and Heat Pump Water Heaters Estimating Costs and Efficiency of Storage, Demand, and Heat Pump Water Heaters A water heater's energy efficiency is determined by the energy factor (EF), which is based on the amount of hot water produced per unit of fuel consumed over a typical day. The higher the energy factor, the more efficient the water heater. A water heater's energy efficiency is determined by the energy

  2. Passive decay heat removal system for water-cooled nuclear reactors

    DOE Patents [OSTI]

    Forsberg, Charles W.


    A passive decay-heat removal system for a water-cooled nuclear reactor employs a closed heat transfer loop having heat-exchanging coils inside an open-topped, insulated box located inside the reactor vessel, below its normal water level, in communication with a condenser located outside of containment and exposed to the atmosphere. The heat transfer loop is located such that the evaporator is in a position where, when the water level drops in the reactor, it will become exposed to steam. Vapor produced in the evaporator passes upward to the condenser above the normal water level. In operation, condensation in the condenser removes heat from the system, and the condensed liquid is returned to the evaporator. The system is disposed such that during normal reactor operations where the water level is at its usual position, very little heat will be removed from the system, but during emergency, low water level conditions, substantial amounts of decay heat will be removed.

  3. 15 Ways to Save on Your Water Heating Bill | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    15 Ways to Save on Your Water Heating Bill 15 Ways to Save on Your Water Heating Bill October 26, 2009 - 3:49pm Addthis Allison Casey Senior Communicator, NREL Sometimes it surprises me to see that the most popular pages on the site are the ones about solar water heaters and demand (or tankless) water heaters. But considering that water heating can account for around 12% of a family's utility bill-the biggest chunk after space heating and cooling-it really shouldn't be that surprising that you

  4. Max Tech Electric Heat Pump Water Heater with Lower GWP Halogenated

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Refrigerant | Department of Energy Max Tech Electric Heat Pump Water Heater with Lower GWP Halogenated Refrigerant Max Tech Electric Heat Pump Water Heater with Lower GWP Halogenated Refrigerant Information flow schematic for an integrated heat pump design model and wrapped tank model. Image credit: Oak Ridge National Laboratory. Information flow schematic for an integrated heat pump design model and wrapped tank model. Image credit: Oak Ridge National Laboratory. Information flow schematic

  5. Influence of district heating water temperatures on the fuel saving and reduction of ecological cost of the heat generation

    SciTech Connect (OSTI)

    Portacha, J.; Smyk, A.; Zielinski, A.; Misiewicz, L.


    Results of examinations carried out on the district heating water temperature influence in the cogeneration plant with respect to both the fuel economy and the ecological cost reduction of heat generation for the purposes of heating and hot service water preparation are presented in this paper. The decrease of water return temperature effectively contributes to the increase of fuel savings in all the examined cases. The quantitative savings depend on the outlet water temperature of the cogeneration plant and on the fuel type combusted at the alternative heat generating plant. A mathematical model and a numerical method for calculations of annual cogeneration plant performance, e.g. annual heat and electrical energy produced in cogeneration mode, and the annual fuel consumption, are also discussed. In the discussed mathematical model, the variable operating conditions of cogeneration plant vs. outside temperature and method of control can be determined. The thermal system of cogeneration plant was decomposed into subsystems so as to set up the mathematical model. The determination of subsystem tasks, including a method of convenient aggregation thereof is an essential element of numerical method for calculations of a specific cogeneration plant thermal system under changing conditions. Costs of heat losses in the environment, resulting from the pollutants emission, being formed in the fuel combustion process in the heat sources, were defined. In addition, the environment quantitative and qualitative pollution characteristics were determined both for the heat generation in a cogeneration plant and for an alternative heat-generating plant. Based on the calculations, a profitable decrease of ecological costs is achieved in the cogeneration economy even if compared with the gas-fired heat generating plant. Ecological costs of coal-fired heat generating plant are almost three time higher than those of the comparable cogeneration plant.

  6. Retrofit Integrated Space & Water Heating: Field Assessment, Minneapolis, Minnesota (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available


    This project analyzed combined condensing water heaters or boilers and hydronic air coils to provide high efficiency domestic hot water and forced air space heating. Called 'Combi' systems, they provided similar space and water heating performance less expensively than installing two condensing appliances. The system's installed costs were cheaper than installing a condensing furnace and either a condensing tankless or condensing storage water heater. However, combi costs must mature and be reduced before they are competitive with a condensing furnace and power vented water heater (EF of 0.60). Better insulation and tighter envelopes are reducing space heating loads for new and existing homes. For many homes, decreased space heating loads make it possible for both space and domestic water heating loads to be provided with a single heating plant. These systems can also eliminate safety issues associated with natural draft appliances through the use of one common sealed combustion vent.

  7. Measure Guideline. Combination Forced-Air Space and Tankless Domestic Hot Water Heating Systems

    SciTech Connect (OSTI)

    Rudd, Armin


    This document describes design and application guidance for combination space and tankless domestic hot water heating systems (combination systems) used in residential buildings, based on field evaluation, testing, and industry meetings conducted by Building Science Corporation. As residential building enclosure improvements continue to drive heating loads down, using the same water heating equipment for both space heating and domestic water heating becomes attractive from an initial cost and space-saving perspective. This topic is applicable to single- and multi-family residential buildings, both new and retrofitted.

  8. Measure Guideline: Combination Forced-Air Space and Tankless Domestic Hot Water Heating Systems

    SciTech Connect (OSTI)

    Rudd, A.


    This document describes design and application guidance for combination space and tankless domestic hot water heating systems (combination systems) used in residential buildings, based on field evaluation, testing, and industry meetings conducted by Building Science Corporation. As residential building enclosure improvements continue to drive heating loads down, using the same water heating equipment for both space heating and domestic water heating becomes attractive from an initial cost and space-saving perspective. This topic is applicable to single- and multi-family residential buildings, both new and retrofitted.

  9. Experimental investigation on the photovoltaic-thermal solar heat pump air-conditioning system on water-heating mode

    SciTech Connect (OSTI)

    Fang, Guiyin; Hu, Hainan; Liu, Xu


    An experimental study on operation performance of photovoltaic-thermal solar heat pump air-conditioning system was conducted in this paper. The experimental system of photovoltaic-thermal solar heat pump air-conditioning system was set up. The performance parameters such as the evaporation pressure, the condensation pressure and the coefficient of performance (COP) of heat pump air-conditioning system, the water temperature and receiving heat capacity in water heater, the photovoltaic (PV) module temperature and the photovoltaic efficiency were investigated. The experimental results show that the mean photovoltaic efficiency of photovoltaic-thermal (PV/T) solar heat pump air-conditioning system reaches 10.4%, and can improve 23.8% in comparison with that of the conventional photovoltaic module, the mean COP of heat pump air-conditioning system may attain 2.88 and the water temperature in water heater can increase to 42 C. These results indicate that the photovoltaic-thermal solar heat pump air-conditioning system has better performances and can stably work. (author)

  10. Break-Even Cost for Residential Solar Water Heating in the United...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Break-even Cost for Residential Solar Water Heating in the United States: Key Drivers and Sensitivities Hannah Cassard, Paul Denholm, and Sean Ong Technical Report NREL...

  11. #tipsEnergy: Ways to Save on Water Heating Costs | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Water Heating Costs #tipsEnergy: Ways to Save on Water Heating Costs February 20, 2013 - 5:09pm Addthis Rebecca Matulka Rebecca Matulka Former Digital Communications Specialist, Office of Public Affairs #tipsEnergy: Ways to Save on Water Heating Costs Every month we ask the larger energy community to share their energy-saving tips, and we feature some of our favorite tips in a Storify. For this month's #tipsEnergy, we wanted to know how you save energy and money on water heating. Storified by

  12. Update of Market Assessment for Capturing Water Conservation Opportunities in the Federal Sector

    SciTech Connect (OSTI)

    Mcmordie, Katherine; Solana, Amy E.; Elliott, Douglas B.; Sullivan, Gregory P.; Parker, Graham B.


    This updated market assessment for capturing water conservation opportunities in the Federal sector is based on a new analytical approach that utilizes newly available data and technologies. The new approach fine-tunes the original assessment by using actual Federal water use, which is now tracked by DOE (as compared to using estimated water use). Federal building inventory data is also used to disseminate water use by end-use technology in the Federal sector. In addition, this analysis also examines the current issues and obstacles that face performance contracting of water efficiency projects at Federal sites.

  13. [Waste water heat recovery system]. Final report, September 30, 1992

    SciTech Connect (OSTI)

    Not Available


    The production capabilities for and field testing of the heat recovery system are described briefly. Drawings are included.

  14. Technology data characterizing water heating in commercial buildings: Application to end-use forecasting

    SciTech Connect (OSTI)

    Sezgen, O.; Koomey, J.G.


    Commercial-sector conservation analyses have traditionally focused on lighting and space conditioning because of their relatively-large shares of electricity and fuel consumption in commercial buildings. In this report we focus on water heating, which is one of the neglected end uses in the commercial sector. The share of the water-heating end use in commercial-sector electricity consumption is 3%, which corresponds to 0.3 quadrillion Btu (quads) of primary energy consumption. Water heating accounts for 15% of commercial-sector fuel use, which corresponds to 1.6 quads of primary energy consumption. Although smaller in absolute size than the savings associated with lighting and space conditioning, the potential cost-effective energy savings from water heaters are large enough in percentage terms to warrant closer attention. In addition, water heating is much more important in particular building types than in the commercial sector as a whole. Fuel consumption for water heating is highest in lodging establishments, hospitals, and restaurants (0.27, 0.22, and 0.19 quads, respectively); water heating`s share of fuel consumption for these building types is 35%, 18% and 32%, respectively. At the Lawrence Berkeley National Laboratory, we have developed and refined a base-year data set characterizing water heating technologies in commercial buildings as well as a modeling framework. We present the data and modeling framework in this report. The present commercial floorstock is characterized in terms of water heating requirements and technology saturations. Cost-efficiency data for water heating technologies are also developed. These data are intended to support models used for forecasting energy use of water heating in the commercial sector.

  15. "Table B26. Water-Heating Energy Sources, Floorspace, 1999"

    U.S. Energy Information Administration (EIA) Indexed Site

    6. Water-Heating Energy Sources, Floorspace, 1999" ,"Total Floorspace (million square feet)" ,"All Buildings","All Buildings with Water Heating","Water-Heating Energy Sources Used (more than one may apply)" ,,,"Electricity","Natural Gas","Fuel Oil","District Heat","Propane" "All Buildings ................",67338,56115,24171,29196,2218,4182,1371 "Building Floorspace" "(Square

  16. Solar water heating technical support. Technical report for November 1997--April 1998 and final report

    SciTech Connect (OSTI)

    Huggins, J.


    This progress report covers the time period November 1, 1997 through April 30, 1998, and also summarizes the project as the final report. The topics of the report include certification of solar collectors for water heating systems, modeling and testing of solar collectors and gas water heater backup systems, ratings of collectors for specific climates, and solar pool heating systems.

  17. Comparison of Advanced Residential Water Heating Technologies in the United States

    SciTech Connect (OSTI)

    Maguire, J.; Fang, X.; Wilson, E.


    Gas storage, gas tankless, condensing, electric storage, heat pump, and solar water heaters were simulated in several different climates across the US installed in both conditioned and unconditioned space and subjected to several different draw profiles. While many preexisting models were used, new models of condensing and heat pump water heaters were created specifically for this work.

  18. Using Solar Hot Water to Address Piping Heat Losses in Multifamily Buildings

    SciTech Connect (OSTI)

    Springer, David; Seitzler, Matt; Backman, Christine; Weitzel, Elizabeth


    Solar thermal water heating is most cost effective when applied to multifamily buildings and some states offer incentives or other inducements to install them. However, typical solar water heating designs do not allow the solar generated heat to be applied to recirculation losses, only to reduce the amount of gas or electric energy needed for hot water that is delivered to the fixtures. For good reasons, hot water that is recirculated through the building is returned to the water heater, not to the solar storage tank. The project described in this report investigated the effectiveness of using automatic valves to divert water that is normally returned through the recirculation piping to the gas or electric water heater instead to the solar storage tank. The valves can be controlled so that the flow is only diverted when the returning water is cooler than the water in the solar storage tank.

  19. A Consumer's Guide: Heat Your Water with the Sun

    SciTech Connect (OSTI)


    This publication introduces consumers to solar heating technologies, and guides them through the basics of the technology and how to purchase it for the home.

  20. A Consumer's Guide: Heat Your Water with the Sun (Brochure)

    Broader source: [DOE]

    This publication introduces consumers to solar heating technologies, and guides them through the basics of the technology and how to purchase it for the home.

  1. A Novel Absorption Cycle for Combined Water Heating, Dehumidification, and Evaporative Cooling

    SciTech Connect (OSTI)

    CHUGH, Devesh; Gluesenkamp, Kyle R; Abdelaziz, Omar; Moghaddam, Saeed


    In this study, development of a novel system for combined water heating, dehumidification, and space evaporative cooling is discussed. Ambient water vapor is used as a working fluid in an open system. First, water vapor is absorbed from an air stream into an absorbent solution. The latent heat of absorption is transferred into the process water that cools the absorber. The solution is then regenerated in the desorber, where it is heated by a heating fluid. The water vapor generated in the desorber is condensed and its heat of phase change is transferred to the process water in the condenser. The condensed water can then be used in an evaporative cooling process to cool the dehumidified air exiting the absorber, or it can be drained if primarily dehumidification is desired. Essentially, this open absorption cycle collects space heat and transfers it to process water. This technology is enabled by a membrane-based absorption/desorption process in which the absorbent is constrained by hydrophobic vapor-permeable membranes. Constraining the absorbent film has enabled fabrication of the absorber and desorber in a plate-and-frame configuration. An air stream can flow against the membrane at high speed without entraining the absorbent, which is a challenge in conventional dehumidifiers. Furthermore, the absorption and desorption rates of an absorbent constrained by a membrane are greatly enhanced. Isfahani and Moghaddam (Int. J. Heat Mass Transfer, 2013) demonstrated absorption rates of up to 0.008 kg/m2s in a membrane-based absorber and Isfahani et al. (Int. J. Multiphase Flow, 2013) have reported a desorption rate of 0.01 kg/m2s in a membrane-based desorber. The membrane-based architecture also enables economical small-scale systems, novel cycle configurations, and high efficiencies. The absorber, solution heat exchanger, and desorber are fabricated on a single metal sheet. In addition to the open arrangement and membrane-based architecture, another novel feature of the cycle is recovery of the solution heat energy exiting the desorber by process water (a process-solution heat exchanger ) rather than the absorber exiting solution (the conventional solution heat exchanger ). This approach has enabled heating the process water from an inlet temperature of 15 C to 57 C (conforming to the DOE water heater test standard) and interfacing the process water with absorbent on the opposite side of a single metal sheet encompassing the absorber, process-solution heat exchanger, and desorber. The system under development has a 3.2 kW water heating capacity and a target thermal coefficient of performance (COP) of 1.6.

  2. Method and apparatus for enhanced heat recovery from steam generators and water heaters

    DOE Patents [OSTI]

    Knight, Richard A.; Rabovitser, Iosif K.; Wang, Dexin


    A heating system having a steam generator or water heater, at least one economizer, at least one condenser and at least one oxidant heater arranged in a manner so as to reduce the temperature and humidity of the exhaust gas (flue gas) stream and recover a major portion of the associated sensible and latent heat. The recovered heat is returned to the steam generator or water heater so as to increase the quantity of steam generated or water heated per quantity of fuel consumed. In addition, a portion of the water vapor produced by combustion of fuel is reclaimed for use as feed water, thereby reducing the make-up water requirement for the system.

  3. Simulation of water transport in heated rock salt

    SciTech Connect (OSTI)

    Schlich, M.; Jockwer, N.


    This paper summarizes computer simulation studies on water transport in German rock salt. Based on JOCKWERS experimental investigations on water content and water liberation, the object of these studies was to select a water transport model, that matches the water inflow which was measured in some heater experiments in the Asse Salt Mine. The main result is, that an evaporation front model, with Knudsen-type vapor transport combined with fluid transport by thermal expansion of the adsorbed water layers in the non evaporated zone, showed the best agreement with experimental evidence.

  4. Experience with thermal storage in tanks of stratified water for solar heating and load management

    SciTech Connect (OSTI)

    Wildin, M.W.; Witkofsky, M.P.; Noble, J.M.; Hopper, R.E.; Stromberg, P.G.


    Results have been obtained for performance of stratified tanks of water used to store heating and cooling capacity in a 5574 m/sup 2/ university building. The major sources of energy used to charge the heated tanks were solar energy, obtained via collectors on the roof of the building, and excess heat recovered from the interior of the building via thermal storage and electric-driven heat pump/chillers. Through stratification of the water in the storage tanks and an appropriate system operating strategy, 40 percent of the building's total heating needs were supplied by solar energy during the first four months of 1981. Month-long thermal efficiencies of the storage array ranging from 70 percent during the heating season to nearly 90 percent during the cooling season, were measured. Work is underway to improve the performance of thermal storage.

  5. HVAC, Water Heating, and Appliance Subprogram Overview — 2016 BTO Peer Review

    Broader source: [DOE]

    This presentation at the 2016 Peer Review provided an overview of the Building Technologies Office’s Emerging Technologies: HVAC, Water Heating, and Appliance subprogram. Through robust feedback, the BTO Program Peer Review enhances existing efforts and improves future designs.

  6. 2014-02-21 Issuance: Test Procedure for Commercial Water Heating Equipment; Request for Information

    Broader source: [DOE]

    This document is a pre-publication Federal Register request for information regarding test procedures for commercial water heating equipment, as issued by the Deputy Assistant Secretary for Energy Efficiency (February 21, 2014).

  7. California Solar Initiative- Low-Income Solar Water Heating Rebate Program

    Broader source: [DOE]

    The program is only available to customers who currently heat their water with natural gas in the service territories of Pacific Gas and Electric Company (PG&E), San Diego Gas & Electric ...

  8. Duke Energy Florida- SunSense Solar Water Heating with EnergyWise

    Broader source: [DOE]

    Duke Energy Florida (DEF) launched the Solar Water Heating with EnergyWise Program in February 2007 to encourage its residential customers to participate in its load control program and install a...

  9. Clean Boiler Water-side Heat Transfer Surfaces - Steam Tip Sheet #7

    SciTech Connect (OSTI)


    This revised AMO tip sheet on cleaning boiler water-side heat transfer surfaces provides how-to advice for improving industrial steam systems using low-cost, proven practices and technologies.

  10. Tribal Renewable Energy Foundational Course: Direct Use for Building Heat and Hot Water

    Broader source: [DOE]

    Watch the U.S. Department of Energy Office of Indian Energy foundational course webinar on direct use for building heat and hot water by clicking on the .swf link below. You can also download the...

  11. Ocala Utility Services- Solar Hot Water Heating Rebate Program

    Broader source: [DOE]

    The Solar Water Heater Rebate Program is offered to residential retail electric customers by the City of Ocala Utility Services. Interested customers must complete an application and receive...

  12. Comparison of Advanced Residential Water Heating Technologies in the United States

    SciTech Connect (OSTI)

    Maguire, Jeff; Fang, Xia; Wilson, Eric


    In this study, gas storage, gas tankless, condensing, electric storage, heat pump, and solar water heaters were simulated in several different climates across the United States, installed in both conditioned and unconditioned space and subjected to several different draw profiles. While many pre-existing models were used, new models of condensing and heat pump water heaters were created specifically for this work. In each case modeled, the whole house was simulated along with the water heater to capture any interactions between the water heater and the space conditioning equipment.

  13. Nuclear reactor with makeup water assist from residual heat removal system

    DOE Patents [OSTI]

    Corletti, M.M.; Schulz, T.L.


    A pressurized water nuclear reactor uses its residual heat removal system to make up water in the reactor coolant circuit from an in-containment refueling water supply during staged depressurization leading up to passive emergency cooling by gravity feed from the refueling water storage tank, and flooding of the containment building. When depressurization commences due to inadvertence or a manageable leak, the residual heat removal system is activated manually and prevents flooding of the containment when such action is not necessary. Operation of the passive cooling system is not impaired. A high pressure makeup water storage tank is coupled to the reactor coolant circuit, holding makeup coolant at the operational pressure of the reactor. The staged depressurization system vents the coolant circuit to the containment, thus reducing the supply of makeup coolant. The level of makeup coolant can be sensed to trigger opening of successive depressurization conduits. The residual heat removal pumps move water from the refueling water storage tank into the coolant circuit as the coolant circuit is depressurized, preventing reaching the final depressurization stage unless the makeup coolant level continues to drop. The residual heat removal system can also be coupled in a loop with the refueling water supply tank, for an auxiliary heat removal path. 2 figures.

  14. Nuclear reactor with makeup water assist from residual heat removal system

    DOE Patents [OSTI]

    Corletti, Michael M.; Schulz, Terry L.


    A pressurized water nuclear reactor uses its residual heat removal system to make up water in the reactor coolant circuit from an in-containment refueling water supply during staged depressurization leading up to passive emergency cooling by gravity feed from the refueling water storage tank, and flooding of the containment building. When depressurization commences due to inadvertence or a manageable leak, the residual heat removal system is activated manually and prevents flooding of the containment when such action is not necessary. Operation of the passive cooling system is not impaired. A high pressure makeup water storage tank is coupled to the reactor coolant circuit, holding makeup coolant at the operational pressure of the reactor. The staged depressurization system vents the coolant circuit to the containment, thus reducing the supply of makeup coolant. The level of makeup coolant can be sensed to trigger opening of successive depressurization conduits. The residual heat removal pumps move water from the refueling water storage tank into the coolant circuit as the coolant circuit is depressurized, preventing reaching the final depressurization stage unless the makeup coolant level continues to drop. The residual heat removal system can also be coupled in a loop with the refueling water supply tank, for an auxiliary heat removal path.

  15. Commercial CO2 Electric Heat Pump Water Heater | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CO2 Electric Heat Pump Water Heater Commercial CO2 Electric Heat Pump Water Heater Planned enhanced modeling approach to facilitate analyses of wrapped-tank options for the project. Image credit: Oak Ridge National Laboratory. Planned enhanced modeling approach to facilitate analyses of wrapped-tank options for the project. Image credit: Oak Ridge National Laboratory. Lead Performer: Oak Ridge National Laboratory - Oak Ridge, TN FY16 DOE Funding: $150,000 Project Term: October 1, 2015 - TBD

  16. Evaluation of water source heat pumps for the Juneau, Alaska Area

    SciTech Connect (OSTI)

    Jacobsen, J.J.; King, J.C.; Eisenhauer, J.L.; Gibson, C.I.


    The purposes of this project were to evaluate the technical and economic feasibility of water source heat pumps (WSHP) for use in Juneau, Alaska and to identify potential demonstration projects to verify their feasibility. Information is included on the design, cost, and availability of heat pumps, possible use of seawater as a heat source, heating costs with WSHP and conventional space heating systems, and life cycle costs for WSHP-based heating systems. The results showed that WSHP's are technically viable in the Juneau area, proper installation and maintenance is imperative to prevent equipment failures, use of WSHP would save fuel oil but increase electric power consumption. Life cycle costs for WSHP's are about 8% above that for electric resistance heating systems, and a field demonstration program to verify these results should be conducted. (LCL)

  17. Recovery of Water from Boiler Flue Gas Using Condensing Heat Exchangers

    SciTech Connect (OSTI)

    Levy, Edward; Bilirgen, Harun; DuPont, John


    Most of the water used in a thermoelectric power plant is used for cooling, and DOE has been focusing on possible techniques to reduce the amount of fresh water needed for cooling. DOE has also been placing emphasis on recovery of usable water from sources not generally considered, such as mine water, water produced from oil and gas extraction, and water contained in boiler flue gas. This report deals with development of condensing heat exchanger technology for recovering moisture from flue gas from coal-fired power plants. The report describes: • An expanded data base on water and acid condensation characteristics of condensing heat exchangers in coal-fired units. This data base was generated by performing slip stream tests at a power plant with high sulfur bituminous coal and a wet FGD scrubber and at a power plant firing highmoisture, low rank coals. • Data on typical concentrations of HCl, HNO{sub 3} and H{sub 2}SO{sub 4} in low temperature condensed flue gas moisture, and mercury capture efficiencies as functions of process conditions in power plant field tests. • Theoretical predictions for sulfuric acid concentrations on tube surfaces at temperatures above the water vapor dewpoint temperature and below the sulfuric acid dew point temperature. • Data on corrosion rates of candidate heat exchanger tube materials for the different regions of the heat exchanger system as functions of acid concentration and temperature. • Data on effectiveness of acid traps in reducing sulfuric acid concentrations in a heat exchanger tube bundle. • Condensed flue gas water treatment needs and costs. • Condensing heat exchanger designs and installed capital costs for full-scale applications, both for installation immediately downstream of an ESP or baghouse and for installation downstream of a wet SO{sub 2} scrubber. • Results of cost-benefit studies of condensing heat exchangers.

  18. Lumbee River EMC- Solar Water Heating Rebate Program

    Office of Energy Efficiency and Renewable Energy (EERE)

    Lumbee River EMC is offering $850 rebates to residential customers who install solar water heaters on their homes. To qualify, the systems must be certified OG-300 by the Solar Ratings and...

  19. Lumbee River EMC- Solar Water Heating Loan Program

    Broader source: [DOE]

    Lumbee River EMC is offering 6% loans to residential customers for the installation of solar water heaters on their homes.  To qualify, the systems must be certified OG-300 by the Solar Ratings and...

  20. City of Tallahassee Utilities- Solar Water Heating Rebate

    Broader source: [DOE]

    The homeowner must allow the City of Tallahassee to conduct an energy audit on the home in order to make a preliminary assessment of sun exposure and to provide program guidance. All solar water...

  1. Grid-Interactive Renewable Water Heating Economic and Environmental Value

    Energy Savers [EERE]

    Gregory Wagner About Us Gregory Wagner - COMMUNICATIONS SPECIALIST, WIND AND WATER POWER TECHNOLOGIES OFFICE Gregory Wagner Most Recent Calming the Waters: The Impact of Turbulence on Tidal Energy Systems March 29

    Grid Connected Functionalities Grid Connected Functionalities Lead Performer: National Renewable Energy Laboratory (NREL) Objective The objective of Grid Connected Functionality is to develop planning and establish strategic directions, along with supporting framework documents

  2. NREL Develops Heat Pump Water Heater Simulation Model (Fact Sheet), NREL Highlights, Research & Development, NREL (National Renewable Energy Laboratory)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    simulation model helps researchers evaluate real-world impacts of heat pump water heaters in U.S. homes. Heat pump water heaters (HPWHs) remove heat from the air and use it to heat water, presenting an energy-saving opportunity for homeowners. Researchers at the National Renewable Energy Laboratory (NREL) developed a simulation model to study the inter- actions of HPWHs and space conditioning equipment, related to climate and installa- tion location in the home. This model was created in TRNSYS

  3. Side-by-Side Testing of Water Heating Systems: Results from the 2009-2010 Evaluation

    Broader source: [DOE]

    The performance of seven differing types of residential water heating systems was compared in a side-by-side test configuration over a full year period. The Hot Water System Laboratory (HWS Lab) test facility at the Florida Solar Energy Center (FSEC) in Cocoa, FL was used for the tests.

  4. "Table HC11.8 Water Heating Characteristics by Northeast Census Region, 2005"

    U.S. Energy Information Administration (EIA) Indexed Site

    8 Water Heating Characteristics by Northeast Census Region, 2005" " Million U.S. Housing Units" ,,"Northeast Census Region" ,"U.S. Housing Units (millions)" ,,,"Census Division" ,,"Total Northeast" "Water Heating Characteristics",,,"Middle Atlantic","New England" "Total",111.1,20.6,15.1,5.5 "Number of Water Heaters" "1.",106.3,19.6,14.4,5.2 "2 or

  5. "Table HC13.8 Water Heating Characteristics by South Census Region, 2005"

    U.S. Energy Information Administration (EIA) Indexed Site

    8 Water Heating Characteristics by South Census Region, 2005" " Million U.S. Housing Units" ,,"South Census Region" ,"U.S. Housing Units (millions)" ,,,"Census Division" ,,"Total South" "Water Heating Characteristics",,,"South Atlantic","East South Central","West South Central" "Total",111.1,40.7,21.7,6.9,12.1 "Number of Water Heaters" "1.",106.3,39,21.1,6.6,11.3 "2

  6. "Table HC14.8 Water Heating Characteristics by West Census Region, 2005"

    U.S. Energy Information Administration (EIA) Indexed Site

    8 Water Heating Characteristics by West Census Region, 2005" " Million U.S. Housing Units" ,,"West Census Region" ,"U.S. Housing Units (millions)" ,,,"Census Division" ,,"Total West" "Water Heating Characteristics",,,"Mountain","Pacific" "Total",111.1,24.2,7.6,16.6 "Number of Water Heaters" "1.",106.3,23.2,7.1,16.1 "2 or More",3.7,1,0.4,0.6 "Do Not Use Hot

  7. Solar heating and hot water system installed at St. Louis, Missouri. Final report

    SciTech Connect (OSTI)

    Not Available


    Information is provided on the solar heating and hot water system installed at the William Tao and Associates, Inc., office building in St. Louis, Missouri. The information consists of description, photos, maintenance and construction problems, final drawing, system requirements and manufacturer's component data. The solar system was designed to provide 50% of the hot water requirements and 45% of the space heating needs for a 900 square foot office space and drafting room. The solar facility has 252 square foot of glass tube concentrator collectors and a 1000 gallon steel storage tank buried below a concrete slab floor. Freeze protection is provided by a propylene glycol/water mixture in the collector loop. The collectors are roof mounted on a variable tilt array which is adjusted seasonally and is connected to the solar thermal storage tank by a tube-in-shell heat exchanger. Incoming city water is preheated through the solar energy thermal storage tank.

  8. Building America Case Study: Evaluation of Residential Integrated Space/Water Heat Systems, Illinois and New York (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available


    This multi-unit field demonstration of combined space and water heating (combi) systems was conducted to help document combi system installation and performance issues that needed to be addressed through research. The objective of the project was to put commercialized forced-air tankless combi units into the field through local contractors that were trained by manufacturers and GTI staff under the auspices of utility-implemented Emerging Technology Programs. With support from PARR, NYSERDA and other partners, the project documented system performance and installations in Chicago and New York. Combi systems were found to save nearly 200 therms in cold climates at efficiencies between about 80% and 94%. Combi systems using third-party air handler units specially designed for condensing combi system operation performed better than the packaged integrated combi systems available for the project. Moreover, combi systems tended to perform poorly when the tankless water heaters operating at high turn-down ratios. Field tests for this study exposed installation deficiencies due to contractor unfamiliarity with the products and the complexity of field engineering and system tweaking to achieve high efficiencies. Widespread contractor education must be a key component to market expansion of combi systems. Installed costs for combi systems need to come down about 5% to 10% to satisfy total resource calculations for utility-administered energy efficiency programs. Greater sales volumes and contractor familiarity can drive costs down. More research is needed to determine how well heating systems such as traditional furnace/water heater, combis, and heat pumps compare in similar as-installed scenarios, but under controlled conditions.

  9. Knox County Detention Facility Goes Solar for Heating Water

    Broader source: [DOE]

    Hot water demand soars at the six-building Knox County Detention Facility in Tennessee. It's open 24/7 with 1,036 inmate beds and 4,500 meals served daily—and don't forget the laundry.

  10. Water treatment capacity of forward osmosis systems utilizing power plant waste heat

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Zhou, Xingshi; Gingerich, Daniel B.; Mauter, Meagan S.


    Forward osmosis (FO) has the potential to improve the energy efficiency of membrane-based water treatment by leveraging waste heat from steam electric power generation as the primary driving force for separation. In this study, we develop a comprehensive FO process model, consisting of membrane separation, heat recovery, and draw solute regeneration (DSR) models. We quantitatively characterize three alternative processes for DSR: distillation, steam stripping, and air stripping. We then construct a mathematical model of the distillation process for DSR that incorporates hydrodynamics, mass and heat transport resistances, and reaction kinetics, and we integrate this into a model for the fullmore » FO process. Finally, we utilize this FO process model to derive a first-order approximation of the water production capacity given the rejected heat quantity and quality available at U.S. electric power facilities. We find that the upper bound of FO water treatment capacity using low-grade heat sources at electric power facilities exceeds process water treatment demand for boiler water make-up and flue gas desulfurization wastewater systems.« less

  11. Water treatment capacity of forward osmosis systems utilizing power plant waste heat

    SciTech Connect (OSTI)

    Zhou, Xingshi; Gingerich, Daniel B.; Mauter, Meagan S.


    Forward osmosis (FO) has the potential to improve the energy efficiency of membrane-based water treatment by leveraging waste heat from steam electric power generation as the primary driving force for separation. In this study, we develop a comprehensive FO process model, consisting of membrane separation, heat recovery, and draw solute regeneration (DSR) models. We quantitatively characterize three alternative processes for DSR: distillation, steam stripping, and air stripping. We then construct a mathematical model of the distillation process for DSR that incorporates hydrodynamics, mass and heat transport resistances, and reaction kinetics, and we integrate this into a model for the full FO process. Finally, we utilize this FO process model to derive a first-order approximation of the water production capacity given the rejected heat quantity and quality available at U.S. electric power facilities. We find that the upper bound of FO water treatment capacity using low-grade heat sources at electric power facilities exceeds process water treatment demand for boiler water make-up and flue gas desulfurization wastewater systems.

  12. Market assessment for active solar heating and cooling products. Category B: a survey of decision-makers in the HVAC marketplace. Final report

    SciTech Connect (OSTI)


    A comprehensive evaluation of the market for solar heating and cooling products for new and retrofit markets is reported. The emphasis is on the analysis of solar knowledge among HVAC decision makers and a comprehensive evaluation of their solar attitudes and behavior. The data from each of the following sectors are described and analyzed: residential consumers, organizational and manufacturing buildings, HVAC engineers and architects, builders/developers, and commercial/institutional segments. (MHR)

  13. A comparison of the heat transfer capabilities of two manufacturing methods for high heat flux water-cooled devices

    SciTech Connect (OSTI)

    McKoon, R.H.


    An experimental program was undertaken to compare the heat transfer characteristics of water-cooled copper devices manufactured via conventional drilled passage construction and via a technique whereby molten copper is cast over a network of preformed cooling tubes. Two similar test blocks were constructed; one using the drilled passage technique, the other via casting copper over Monel pipe. Each test block was mounted in a vacuum system and heated uniformly on the top surface using a swept electron beam. From the measured absorbed powers and resultant temperatures, an overall heat transfer coefficient was calculated. The maximum heat transfer coefficient calculated for the case of the drilled passage test block was 2534 Btu/hr/ft/sup 2///sup 0/F. This corresponded to an absorbed power density of 320 w/cm/sup 2/ and resulted in a maximum recorded copper temperature of 346/sup 0/C. Corresponding figures for the cast test block were 363 Btu/hr/ft/sup 2///sup 0/F, 91 w/cm/sup 2/, and 453/sup 0/C.

  14. U.S. Solar Market Trends

    SciTech Connect (OSTI)

    Larry Sherwood


    Grid-connected photovoltaic installations grew by 60% in 2006. California and New Jersey have the largest markets and installations more than doubled in New Jersey, Nevada, Colorado, Connecticut, and many other states with smaller markets. The off-grid growth has been steady, but significantly lower. For the first time in more than a decade, a solar thermal electric plant was installed in 2006. More than 350 MW installed in the 1990's still generates electricity today. Solar water heating and solar space heating installations grew in 2006 after years offlat installation numbers. Hawaii dominates this market, with nearly half of the market. Solar pool heating accounts for the largest number of installations and has grown at an average rate of 10% since 1998. However, installations decreased by 7% in 2006. Installations in California and Florida together are 73% of the pool heating market.

  15. Heating Water with Solar Energy Costs Less at the Phoenix Federal Correctional Institution

    SciTech Connect (OSTI)



    A large solar thermal system installed at the Phoenix Federal Correctional Institution (FCI) in 1998 heats water for the prison and costs less than buying electricity to heat that water. This renewable energy system provides 70% of the facility's annual hot water needs. The Federal Bureau of Prisons did not incur the up-front cost of this system because it was financed through an Energy Savings Performance Contract (ESPC). The ESPC payments are 10% less than the energy savings so that the prison saves an average of $6,700 per year, providing an immediate payback. The solar hot water system produces up to 50,000 gallons of hot water daily, enough to meet the needs of 1,250 inmates and staff who use the kitchen, shower, and laundry facilities. This publication details specifications of the parabolic trough solar system and highlights 5 years of measured performance data.

  16. PV vs. Solar Water Heating- Simple Solar Payback

    Broader source: [DOE]

    Solar energy systems hang their hats on payback. Financial payback is as tangible as money in your bank account, while other types of payback—like environmental externalities—are not usually calculated in dollars. There’s no doubt that photovoltaic (PV) and solar hot water (SHW) systems will pay you back. Maybe not as quickly as you’d like, but all systems will significantly offset their cost over their lifetimes. Here we’ll try to answer: Which system will give the quickest return on investment (ROI)?

  17. Solar space and water heating system at Stanford University Central Food Services Building. Final report

    SciTech Connect (OSTI)

    Not Available


    This active hydronic domestic hot water and space heating system was 840 ft/sup 2/ of single-glazed, liquid, flat plate collectors and 1550 gal heat storage tanks. The following are discussed: energy conservation, design philosophy, operation, acceptance testing, performance data, collector selection, bidding, costs, economics, problems, and recommendations. An operation and maintenance manual and as-built drawings are included in appendices. (MHR)

  18. Geothermal direct heat use: market potential/penetration analysis for Federal Region IX (Arizona, California, Hawaii, Nevada)

    SciTech Connect (OSTI)

    Powell, W.; Tang, K.


    A preliminary study was made of the potential for geothermal direct heat use in Arizona, California, Hawaii, and Nevada (Federal Region IX). The analysis for each state was performed by a different team, located in that state. For each state, the study team was asked to: (1) define the resource, based on the latest available data; (2) assess the potential market growth for geothermal energy; and (3) estimate the market penetration, projected to 2020. Each of the four states of interest in this study is unique in its own way. Rather than impose the same assumptions as to growth rates, capture rates, etc. on all of the study teams, each team was asked to use the most appropriate set of assumptions for its state. The results, therefore, should reflect the currently accepted views within each state. The four state reports comprise the main portion of this document. A brief regional overview section was prepared by the Jet Propulsion Laboratory, following completion of the state reports.

  19. Measure Guideline: Heat Pump Water Heaters in New and Existing Homes

    SciTech Connect (OSTI)

    Shapiro, C.; Puttagunta, S.; Owens, D.


    This Building America Measure Guideline is intended for builders, contractors, homeowners, and policy-makers. This document is intended to explore the issues surrounding heat pump water heaters (HPWHs) to ensure that homeowners and contractors have the tools needed to appropriately and efficiently install HPWHs. Heat pump water heaters (HPWHs) promise to significantly reduce energy consumption for domestic hot water (DHW) over standard electric resistance water heaters (ERWHs). While ERWHs perform with energy factors (EFs) around 0.9, new HPWHs boast EFs upwards of 2.0. High energy factors in HPWHs are achieved by combining a vapor compression system, which extracts heat from the surrounding air at high efficiencies, with electric resistance element(s), which are better suited to meet large hot water demands. Swapping ERWHs with HPWHs could result in roughly 50% reduction in water heating energy consumption for 35.6% of all U.S. households. This Building America Measure Guideline is intended for builders, contractors, homeowners, and policy-makers. While HPWHs promise to significantly reduce energy use for DHW, proper installation, selection, and maintenance of HPWHs is required to ensure high operating efficiency and reliability. This document is intended to explore the issues surrounding HPWHs to ensure that homeowners and contractors have the tools needed to appropriately and efficiently install HPWHs. Section 1 of this guideline provides a brief description of HPWHs and their operation. Section 2 highlights the cost and energy savings of HPWHs as well as the variables that affect HPWH performance, reliability, and efficiency. Section 3 gives guidelines for proper installation and maintenance of HPWHs, selection criteria for locating HPWHs, and highlights of important differences between ERWH and HPWH installations. Throughout this document, CARB has included results from the evaluation of 14 heat pump water heaters (including three recently released HPWH products) installed in existing homes in the northeast region of the United States.

  20. Solar heating, cooling and domestic hot water system installed at Columbia Gas System Service Corp. , Columbus, Ohio. Final report

    SciTech Connect (OSTI)


    The Solar Energy System located at the Columbia Gas Corporation, Columbus, Ohio, has 2978 ft/sup 2/ of Honeywell single axis tracking, concentrating collectors and provides solar energy for space heating, space cooling and domestic hot water. A 1,200,000 Btu/h Bryan water-tube gas boiler provides hot water for space heating. Space cooling is provided by a 100 ton Arkla hot water fired absorption chiller. Domestic hot water heating is provided by a 50 gallon natural gas domestic storage water heater. Extracts are included from the site files, specification references, drawings, installation, operation and maintenance instructions.

  1. ISSUANCE 2015-06-30: Energy Conservation Program for Certain Industrial Equipment: Energy Conservation Standards and Test Procedures for Commercial Heating, Air-Conditioning, and Water-Heating Equipment, Final Rule

    Broader source: [DOE]

    Energy Conservation Program for Certain Industrial Equipment: Energy Conservation Standards and Test Procedures for Commercial Heating, Air-Conditioning, and Water-Heating Equipment, Final Rule

  2. Improved Design Tools for Surface Water and Standing Column Well Heat Pump Systems (DE-EE0002961)

    SciTech Connect (OSTI)

    Spitler, J.D.; Culling, J.R.; Conjeevaram, K.; Ramesh, M.; Selvakumar, M.


    Ground-source heat pump (GSHP) systems are perhaps the most widely used “sustainable” heating and cooling systems, with an estimated 1.7 million installed units with total installed heating capacity on the order of 18 GW. They are widely used in residential, commercial, and institutional buildings. Standing column wells (SCW) are one form of ground heat exchanger that, under the right geological conditions, can provide excellent energy efficiency at a relatively low capital cost. Closed-loop surface water heat pump (SWHP) systems utilize surface water heat exchangers (SWHE) to reject or extract heat from nearby surface water bodies. For building near surface water bodies, these systems also offer a high degree of energy efficiency at a low capital cost. However, there have been few design tools available for properly sizing standing column wells or surface water heat exchangers. Nor have tools for analyzing the energy consumption and supporting economics-based design decisions been available. The main contributions of this project lie in providing new tools that support design and energy analysis. These include a design tool for sizing surface water heat exchangers, a design tool for sizing standing column wells, a new model of surface water heat pump systems implemented in EnergyPlus and a new model of standing column wells implemented in EnergyPlus. These tools will better help engineers design these systems and determine the economic and technical feasibility.

  3. Measure Guideline. Heat Pump Water Heaters in New and Existing Homes

    SciTech Connect (OSTI)

    Shapiro, Carl; Puttagunta, Srikanth; Owens, Douglas


    This Building America Measure Guideline is intended for builders, contractors, homeowners, and policy-makers. This document is intended to explore the issues surrounding heat pump water heaters (HPWHs) to ensure that homeowners and contractors have the tools needed to appropriately and efficiently install HPWHs

  4. Residential Water Heaters Webinar | Department of Energy

    Energy Savers [EERE]

    Engine-Driven Heat Pump for the Residential Sector Introduction Building on previous work on an 11-ton packaged natural gas heat pump, this project will develop hardware and software for engine and system controls for a residential gas heat pump system that will provide space cooling, heating, and hot water. Various electric heat pump systems are used to provide heating and cooling for a wide range of buildings, from commercial fa- cilities to single family homes. The market for heat pumps is

  5. 2014-02-07 Issuance: Certification of Commercial Heating, Ventilation, and Air-conditioning, Water Heating, and Refrigeration Equipment; Notice of Proposed Rulemaking

    Broader source: [DOE]

    This document is a pre-publication Federal Register notice of proposed rulemaking regarding certification of commercial heating, ventilation, and air-conditioning, water-heating, and refrigeration equipment, as issued by the Deputy Assistant Secretary for Energy Efficiency on February 7, 2014.

  6. NREL Tests Integrated Heat Pump Water Heater Performance in Different Climates (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available


    This technical highlight describes NREL tests to capture information about heat pump performance across a wide range of ambient conditions for five heat pump water heaters (HPWH). These water heaters have the potential to significantly reduce water heater energy use relative to traditional electric resistance water heaters. These tests have provided detailed performance data for these appliances, which have been used to evaluate the cost of saved energy as a function of climate. The performance of HPWHs is dependent on ambient air temperature and humidity and the logic controlling the heat pump and the backup resistance heaters. The laboratory tests were designed to measure each unit's performance across a range of air conditions and determine the specific logic controlling the two heat sources, which has a large effect on the comfort of the users and the energy efficiency of the system. Unlike other types of water heaters, HPWHs are both influenced by and have an effect on their surroundings. Since these effects are complex and different for virtually every house and climate region, creating an accurate HPWH model from the data gathered during the laboratory tests was a main goal of the project. Using the results from NREL's laboratory tests, such as the Coefficient of Performance (COP) curves for different air conditions as shown in Figure 1, an existing HPWH model is being modified to produce more accurate whole-house simulations. This will allow the interactions between the HPWH and the home's heating and cooling system to be evaluated in detail, for any climate region. Once these modeling capabilities are in place, a realistic cost-benefit analysis can be performed for a HPWH installation anywhere in the country. An accurate HPWH model will help to quantify the savings associated with installing a HPWH in the place of a standard electric water heater. In most locations, HPWHs are not yet a cost-effective alternative to natural gas water heaters. The detailed system performance maps that were developed by this testing program will be used to: (1) Target regions of the country that would benefit most from this technology; (2) Identify improvements in current systems to maximize homeowner cost savings; and (3) Explore opportunities for development of advanced hot water heating systems.

  7. "Table HC12.8 Water Heating Characteristics by Midwest Census Region, 2005"

    U.S. Energy Information Administration (EIA) Indexed Site

    8 Water Heating Characteristics by Midwest Census Region, 2005" " Million U.S. Housing Units" ,,"Midwest Census Region" ,"U.S. Housing Units (millions)" ,,,"Census Division" ,,"Total Midwest" "Water Heating Characteristics",,,"East North Central","West North Central" "Total",111.1,25.6,17.7,7.9 "Number of Water Heaters" "1.",106.3,24.5,17.1,7.4 "2 or More",3.7,0.9,0.5,0.4

  8. "Table B32. Water-Heating Energy Sources, Floorspace for Non-Mall Buildings, 2003"

    U.S. Energy Information Administration (EIA) Indexed Site

    2. Water-Heating Energy Sources, Floorspace for Non-Mall Buildings, 2003" ,"Total Floorspace (million square feet)" ,"All Buildings*","Buildings with Water Heating","Water-Heating Energy Sources Used (more than one may apply)" ,,,"Elec- tricity","Natural Gas","Fuel Oil","District Heat","Propane" "All Buildings* ...............",64783,56478,27490,28820,1880,3088,1422 "Building

  9. A light water excess heat reaction suggests that cold fusion may be alkali-hydrogen fusion

    SciTech Connect (OSTI)

    Bush, R.T. )


    This paper reports that Mills and Kneizys presented data in support of a light water excess heat reaction obtained with an electrolytic cell highly reminiscent of the Fleischmann-Pons cold fusion cell. The claim of Mills and Kneizys that their excess heat reaction can be explained on the basis of a novel chemistry, which supposedly also explains cold fusion, is rejected in favor of their reaction being, instead, a light water cold fusion reaction. It is the first known light water cold fusion reaction to exhibit excess heat, it may serve as a prototype to expand our understanding of cold fusion. From this new reactions are deduced, including those common to past cold fusion studies. This broader pattern of nuclear reactions is typically seen to involve a fusion of the nuclides of the alkali atoms with the simplest of the alkali-type nuclides, namely, protons, deuterons, and tritons. Thus, the term alkali-hydrogen fusion seems appropriate for this new type of reaction with three subclasses: alkali-hydrogen fusion, alkali-deuterium fusion, and alkali-tritium fusion. A new three-dimensional transmission resonance model (TRM) is sketched. Finally, preliminary experimental evidence in support of the hypothesis of a light water nuclear reaction and alkali-hydrogen fusion is reported. Evidence is presented that appears to strongly implicate the transmission resonance phenomenon of the new TRM.

  10. Prediction of critical heat flux in water-cooled plasma facing components using computational fluid dynamics.

    SciTech Connect (OSTI)

    Bullock, James H.; Youchison, Dennis Lee; Ulrickson, Michael Andrew


    Several commercial computational fluid dynamics (CFD) codes now have the capability to analyze Eulerian two-phase flow using the Rohsenow nucleate boiling model. Analysis of boiling due to one-sided heating in plasma facing components (pfcs) is now receiving attention during the design of water-cooled first wall panels for ITER that may encounter heat fluxes as high as 5 MW/m2. Empirical thermalhydraulic design correlations developed for long fission reactor channels are not reliable when applied to pfcs because fully developed flow conditions seldom exist. Star-CCM+ is one of the commercial CFD codes that can model two-phase flows. Like others, it implements the RPI model for nucleate boiling, but it also seamlessly transitions to a volume-of-fluid model for film boiling. By benchmarking the results of our 3d models against recent experiments on critical heat flux for both smooth rectangular channels and hypervapotrons, we determined the six unique input parameters that accurately characterize the boiling physics for ITER flow conditions under a wide range of absorbed heat flux. We can now exploit this capability to predict the onset of critical heat flux in these components. In addition, the results clearly illustrate the production and transport of vapor and its effect on heat transfer in pfcs from nucleate boiling through transition to film boiling. This article describes the boiling physics implemented in CCM+ and compares the computational results to the benchmark experiments carried out independently in the United States and Russia. Temperature distributions agreed to within 10 C for a wide range of heat fluxes from 3 MW/m2 to 10 MW/m2 and flow velocities from 1 m/s to 10 m/s in these devices. Although the analysis is incapable of capturing the stochastic nature of critical heat flux (i.e., time and location may depend on a local materials defect or turbulence phenomenon), it is highly reliable in determining the heat flux where boiling instabilities begin to dominate. Beyond this threshold, higher heat fluxes lead to the boiling crisis and eventual burnout. This predictive capability is essential in determining the critical heat flux margin for the design of complex 3d components.

  11. Construction and testing of ceramic fabric heat pipe with water working fluid

    SciTech Connect (OSTI)

    Antoniak, Z.I.; Webb, B.J.; Bates, J.M.; Cooper, M.F.


    A prototype ceramic fabric/titanium water heat pipe has been constructed and tested; it transported 25 to 80 W of power at 423 K. Component development and testing is continuing with the aim of providing an improved prototype, with a 38-{mu}m stainless steel linear covered by a biaxially-braided Nextel (trademark of the 3M Co., St. Paul Minnesota) sleeve that is approximately 300-{mu}m thick. This fabric has been tested to 800 K, and its emittance is about 0.5 at that temperature. Advanced versions of the water heat pipe will probably require a coating over the ceramic fabric in order to increase this emittance to the 0.8 to 0.9 range. 2 refs., 3 figs., 1 tab.

  12. Status of not-in-kind refrigeration technologies for household space conditioning, water heating and food refrigeration

    SciTech Connect (OSTI)

    Bansal, Pradeep; Vineyard, Edward Allan; Abdelaziz, Omar


    This paper presents a review of the next generation not-in-kind technologies to replace conventional vapor compression refrigeration technology for household applications. Such technologies are sought to provide energy savings or other environmental benefits for space conditioning, water heating and refrigeration for domestic use. These alternative technologies include: thermoacoustic refrigeration, thermoelectric refrigeration, thermotunneling, magnetic refrigeration, Stirling cycle refrigeration, pulse tube refrigeration, Malone cycle refrigeration, absorption refrigeration, adsorption refrigeration, and compressor driven metal hydride heat pumps. Furthermore, heat pump water heating and integrated heat pump systems are also discussed due to their significant energy saving potential for water heating and space conditioning in households. The paper provides a snapshot of the future R&D needs for each of the technologies along with the associated barriers. Both thermoelectric and magnetic technologies look relatively attractive due to recent developments in the materials and prototypes being manufactured.

  13. Water and Heat Balance Model for Predicting Drainage Below the Plant Root Zone

    Energy Science and Technology Software Center (OSTI)


    UNSAT-H Version 2.0 is a one-dimensional model that simulates the dynamic processes of infiltration, drainage, redistribution, surface evaporation, and the uptake of water from soil by plants. The model was developed for assessing the water dynamics of arid sites used or proposed for near-surface waste disposal. In particular, the model is used for simulating the water balance of cover systems over buried waste and for estimating the recharge rate (i.e., the drainage rate beneath themore » plant root zone when a sizable vadose zone is present). The mathematical base of the model are Richards'' equation for water flow, Ficks'' law for vapor diffusion, and Fouriers law for heat flow. The simulated profile can be homogeneous or layered. The boundary conditions can be controlled as either constant (potential or temperature) or flux conditions to reflect actual conditions at a given site.« less

  14. Expert Meeting Report: Exploring the Disconnect Between Rated and Field Performance of Water Heating Systems

    Energy Savers [EERE]

    Exploring the Disconnect Between Rated and Field Performance of Water Heating Systems M. Hoeschele and E. Weitzel Alliance for Residential Building Innovation (ARBI) May 2013 NOTICE This report was prepared as an account of work sponsored by an agency of the United States government. Neither the United States government nor any agency thereof, nor any of their employees, subcontractors, or affiliated partners makes any warranty, express or implied, or assumes any legal liability or

  15. Measured water heating performance of a vertical-bore water-to-water ground source heat pump (WW-GSHP) for domestic water heating over twelve months under simulated occupancy loads

    SciTech Connect (OSTI)

    Ally, Moonis Raza; Munk, Jeffrey D; Baxter, Van D; Gehl, Anthony C


    This paper presents monthly performance metrics of a 5.275 kW (1.5 ton) WW-GSHP providing 227 L day-1 domestic hot water at 49 C. Daily water use is simulated as stipulated in the Building America Research Benchmark Definition capturing the living habits of the average U.S household. The 94.5m vertical-bore ground loop is shared with a separate GSHP for space conditioning the 251m2 residential home. Data on entering water temperatures, energy extracted from the ground, delivered energy, compressor electricity use, COP, WW-GSHP run times, and the impact of fan and pump energy consumption on efficiency are presented for each month. Factors influencing performance metrics are highlighted.

  16. Performance of a Heat Pump Water Heater in the Hot-Humid Climate, Windermere, Florida (Fact Sheet)

    SciTech Connect (OSTI)

    Metzger, C.; Puttagunta, S.; Williamson, J.


    Over recent years, heat pump water heaters (HPWHs) have become more readily available and more widely adopted in the marketplace. For a 6-month period, the Building America team Consortium for Advanced Residential Buildings monitored the performance of a GE Geospring HPWH in Windermere, Florida. The study found that the HPWH performed 144% more efficiently than a traditional electric resistance water heater, saving approximately 64% on water heating annually. The monitoring showed that the domestic hot water draw was a primary factor affecting the system's operating efficiency.

  17. Technology Solutions Case Study: Performance of a Heat Pump Water Heater in the Hot-Humid Climate, Windermere, Florida

    SciTech Connect (OSTI)


    Over recent years, heat pump water heaters (HPWHs) have become more readily available and more widely adopted in the marketplace. For a 6-month period, the Building America team Consortium for Advanced Residential Buildings monitored the performance of a GE Geospring HPWH in Windermere, Florida. The study found that the HPWH performed 144% more efficiently than a traditional electric resistance water heater, saving approximately 64% on water heating annually. The monitoring showed that the domestic hot water draw was a primary factor affecting the system's operating efficiency.

  18. Impact of Ducting on Heat Pump Water Heater Space Conditioning Energy Use and Comfort

    SciTech Connect (OSTI)

    Widder, Sarah H.; Petersen, Joseph M.; Parker, Graham B.; Baechler, Michael C.


    Increasing penetration of heat pump water heaters (HPWHs) in the residential sector will offer an important opportunity for energy savings, with a theoretical energy savings of up to 63% per water heater and up to 11% of residential energy use (EIA 2009). However, significant barriers must be overcome before this technology will reach widespread adoption in the Pacific Northwest region and nationwide. One significant barrier noted by the Northwest Energy Efficiency Alliance (NEEA) is the possible interaction with the homes’ space conditioning system for units installed in conditioned spaces. Such complex interactions may decrease the magnitude of whole-house savings available from HPWH installed in the conditioned space in cold climates and could lead to comfort concerns (Larson et al. 2011; Kresta 2012). Modeling studies indicate that the installation location of HPWHs can significantly impact their performance and the resultant whole-house energy savings (Larson et al. 2012; Maguire et al. 2013). However, field data are not currently available to validate these results. This field evaluation of two GE GeoSpring HPWHs in the PNNL Lab Homes is designed to measure the performance and impact on the Lab Home HVAC system of a GE GeoSpring HPWH configured with exhaust ducting compared to an unducted GeoSpring HPWH during heating and cooling season periods; and measure the performance and impact on the Lab Home HVAC system of the GeoSpring HPWH with both supply and exhaust air ducting as compared to an unducted GeoSpring HPWH during heating and cooling season periods. Important metrics evaluated in these experiments include water heater energy use, HVAC energy use, whole house energy use, interior temperatures (as a proxy for thermal comfort), and cost impacts. This technical report presents results from the PNNL Lab Homes experiment.

  19. 2014-10-10 Issuance: Energy Conservation Standards for Commercial Water Heating Equipment; Request for Information

    Broader source: [DOE]

    This document is a pre-publication Federal Register request for information regarding energy conservation standards for commercial water heating equipment, as issued by the Deputy Assistant Secretary for Energy Efficiency on October 10, 2014. Though it is not intended or expected, should any discrepancy occur between the document posted here and the document published in the Federal Register, the Federal Register publication controls. This document is being made available through the Internet solely as a means to facilitate the public's access to this document.

  20. Market Potential for Advanced Thermally Activated BCHP in Five National

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Account Sectors, May 2003 | Department of Energy Market Potential for Advanced Thermally Activated BCHP in Five National Account Sectors, May 2003 Market Potential for Advanced Thermally Activated BCHP in Five National Account Sectors, May 2003 Potential distributed generation (DG) and combined heat and power (CHP) applications in the United States cover a broad spectrum of market segments, from nursing homes requiring a few hundred kilowatts (kW) of power and an economical hot water source

  1. Heat Pump Water Heater Technology Assessment Based on Laboratory Research and Energy Simulation Models: Preprint

    SciTech Connect (OSTI)

    Hudon, K.; Sparn, B.; Christensen, D.; Maguire, J.


    This paper explores the laboratory performance of five integrated Heat Pump Water Heaters (HPWHs) across a wide range of operating conditions representative of US climate regions. Laboratory results demonstrate the efficiency of this technology under most of the conditions tested and show that differences in control schemes and design features impact the performance of the individual units. These results were used to understand current model limitations, and then to bracket the energy savings potential for HPWH technology in various US climate regions. Simulation results show that HPWHs are expected to provide significant energy savings in many climate zones when compared to other types of water heaters (up to 64%, including impact on HVAC systems).

  2. Insights into Cold Water Injection Stimulation Effects through Analytical Solutions to Flow and Heat Transport

    SciTech Connect (OSTI)

    M.A. Plummer


    Wells in traditional hydrothermal reservoirs are used to extract heat and to dispose of cooled water. In the first case, high productivity (the ratio of production flow rate to the pressure differential required to produce that rate) to is preferred in order to maximize power generation, while minimizing the parasitic energy loss of pumping. In the second case, high injectivity (the ratio of injection flow rate to the pressure differential required to produce that rate) is preferred, in order to reduce pumping costs. In order to improve productivity or injectivity, cold water is sometimes injected into the reservoir in an attempt to cool and contract the surrounding rock matrix and thereby induce dilation and/or extension of existing fractures or to generate new fractures. Though the increases in permeability associated with these changes are likely localized, by improving connectivity to more extensive high-permeability fractures they can at least temporarily provide substantially improved productivity or injectivity.

  3. Air-to-Water Heat Pumps With Radiant Delivery in Low-Load Homes

    SciTech Connect (OSTI)

    Backman, C.; German, A.; Dakin, B.; Springer, D.


    Space conditioning represents nearly 50% of average residential household energy consumption, highlighting the need to identify alternative cost-effective, energy-efficient cooling and heating strategies. As homes are better built, there is an increasing need for strategies that are particularly well suited for high performance, low load homes. ARBI researchers worked with two test homes in hot-dry climates to evaluate the in-situ performance of air-to-water heat pump (AWHP) systems, an energy efficient space conditioning solution designed to cost-effectively provide comfort in homes with efficient, safe, and durable operation. Two monitoring projects of test houses in hot-dry climates were initiated in 2010 to test this system. Both systems were fully instrumented and have been monitored over one year to capture complete performance data over the cooling and heating seasons. Results are used to quantify energy savings, cost-effectiveness, and system performance using different operating modes and strategies. A calibrated TRNSYS model was developed and used to evaluate performance in various climate regions. This strategy is most effective in tight, insulated homes with high levels of thermal mass (i.e. exposed slab floors).

  4. Air-to-Water Heat Pumps With Radiant Delivery in Low-Load Homes

    SciTech Connect (OSTI)

    Backman, C.; German, A.; Dakin, B.; Springer, D.


    Space conditioning represents nearly 50% of average residential household energy consumption, highlighting the need to identify alternative cost-effective, energy-efficient cooling and heating strategies. As homes are better built, there is an increasing need for strategies that are particularly well suited for high performance, low load homes. ARBI researchers worked with two test homes in hot-dry climates to evaluate the in-situ performance of air-to-water heat pump systems, an energy efficient space conditioning solution designed to cost-effectively provide comfort in homes with efficient, safe, and durable operation. Two monitoring projects of test houses in hot-dry climates were initiated in 2010 to test this system. Both systems were fully instrumented and have been monitored over one year to capture complete performance data over the cooling and heating seasons. Results are used to quantify energy savings, cost-effectiveness, and system performance using different operating modes and strategies. A calibrated TRNSYS model was developed and used to evaluate performance in various climate regions. This strategy is most effective in tight, insulated homes with high levels of thermal mass (i.e. exposed slab floors).

  5. Direct utilization of geothermal energy for space and water heating at Marlin, Texas. Final report

    SciTech Connect (OSTI)

    Conover, M.F.; Green, T.F.; Keeney, R.C.; Ellis, P.F. II; Davis, R.J.; Wallace, R.C.; Blood, F.B.


    The Torbett-Hutchings-Smith Memorial Hospital geothermal heating project, which is one of nineteen direct-use geothermal projects funded principally by DOE, is documented. The five-year project encompassed a broad range of technical, institutional, and economic activities including: resource and environmental assessments; well drilling and completion; system design, construction, and monitoring; economic analyses; public awareness programs; materials testing; and environmental monitoring. Some of the project conclusions are that: (1) the 155/sup 0/F Central Texas geothermal resource can support additional geothermal development; (2) private-sector economic incentives currently exist, especially for profit-making organizations, to develop and use this geothermal resource; (3) potential uses for this geothermal resource include water and space heating, poultry dressing, natural cheese making, fruit and vegetable dehydrating, soft-drink bottling, synthetic-rubber manufacturing, and furniture manufacturing; (4) high maintenance costs arising from the geofluid's scaling and corrosion tendencies can be avoided through proper analysis and design; (5) a production system which uses a variable-frequency drive system to control production rate is an attractive means of conserving parasitic pumping power, controlling production rate to match heating demand, conserving the geothermal resource, and minimizing environmental impacts.

  6. West Village Community. Quality Management Processes and Preliminary Heat Pump Water Heater Performance

    SciTech Connect (OSTI)

    Dakin, B.; Backman, C.; Hoeschele, M.; German, A.


    West Village, a multi-use project underway at the University of California Davis, represents a ground-breaking sustainable community incorporating energy efficiency measures and on-site renewable generation to achieve community-level Zero Net Energy (ZNE) goals. When complete, the project will provide housing for students, faculty, and staff with a vision to minimize the communitys impact on energy use by reducing building energy use, providing on-site generation, and encouraging alternative forms of transportation. This focus of this research is on the 192 student apartments that were completed in 2011 under Phase I of the West Village multi-year project. The numerous aggressive energy efficiency measures implemented result in estimated source energy savings of 37% over the B10 Benchmark. There are two primary objectives of this research. The first is to evaluate performance and efficiency of the central heat pump water heaters as a strategy to provide efficient electric water heating for net-zero all-electric buildings and where natural gas is not available on site. In addition, effectiveness of the quality assurance and quality control processes implemented to ensure proper system commissioning and to meet program participation requirements is evaluated. Recommendations for improvements that could improve successful implementation for large-scale, high performance communities are identified.

  7. West Village Community: Quality Management Processes and Preliminary Heat Pump Water Heater Performance

    SciTech Connect (OSTI)

    Dakin, B.; Backman, C.; Hoeschele, M.; German, A.


    West Village, a multi-use project underway at the University of California Davis, represents a ground-breaking sustainable community incorporating energy efficiency measures and on-site renewable generation to achieve community-level Zero Net Energy (ZNE) goals. The project when complete will provide housing for students, faculty, and staff with a vision to minimize the community's impact on energy use by reducing building energy use, providing on-site generation, and encouraging alternative forms of transportation. This focus of this research is on the 192 student apartments that were completed in 2011 under Phase I of the West Village multi-year project. The numerous aggressive energy efficiency measures implemented result in estimated source energy savings of 37% over the B10 Benchmark. There are two primary objectives of this research. The first is to evaluate performance and efficiency of the central heat pump water heaters as a strategy to provide efficient electric water heating for net-zero all-electric buildings and where natural gas is not available on site. In addition, effectiveness of the quality assurance and quality control processes implemented to ensure proper system commissioning and to meet program participation requirements is evaluated. Recommendations for improvements that could improve successful implementation for large-scale, high performance communities are identified.

  8. Solar Water Heater Roadmap Leads Path to Market Expansion (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available


    Innovative strategy to reduce installed cost of solar water heater systems can rival conventional natural gas water heaters in the marketplace.

  9. "Table HC10.8 Water Heating Characteristics by U.S. Census Region, 2005"

    U.S. Energy Information Administration (EIA) Indexed Site

    8 Water Heating Characteristics by U.S. Census Region, 2005" " Million U.S. Housing Units" ,"Housing Units (millions)","U.S. Census Region" "Water Heating Characteristics",,"Northeast","Midwest","South","West" "Total",111.1,20.6,25.6,40.7,24.2 "Number of Water Heaters" "1.",106.3,19.6,24.5,39,23.2 "2 or More",3.7,0.3,0.9,1.5,1 "Do Not Use Hot

  10. One Market Plaza

    SciTech Connect (OSTI)


    This is a combined heat and power (CHP) project profile on a 1.5 MW CHP system at One Market Plaza in San Francisco, California.

  11. Data, exergy, and energy analysis of a vertical-bore, ground-source heat pump to for domestic water heating under simulated occupancy conditions

    SciTech Connect (OSTI)

    Ally, Moonis Raza; Munk, Jeffrey D.; Baxter, Van D.; Gehl, Anthony C.


    Evidence is provided to support the view that greater than two-thirds of energy required to produce domestic hot water may be extracted from the ground which serves as renewable energy resource. The case refers to a 345 m2 research house located in Oak Ridge, Tennessee, 36.01 N 84.26 W in a mixed-humid climate with HDD of 2218 C-days (3993 F-days) and CDD of 723 C-days (1301 F-days). The house is operated under simulated occupancy conditions in which the hot water use protocol is based on the Building America Research Benchmark Definition (Hendron 2008; Hendron and Engebrecht 2010) which captures the water consumption lifestyles of the average family in the United States. The 5.275 (1.5-ton) water-to-water ground source heat pump (WW-GSHP) shared the same vertical bore with a 7.56 KW water-to-air ground source heat pump for space conditioning the same house. Energy and exergy analysis of data collected continuously over a twelve month period provide performance metrics and sources of inherent systemic inefficiencies. Data and analyses are vital to better understand how WW-GSHPs may be further improved to enable the ground to be used as a renewable energy resource.

  12. Data, exergy, and energy analysis of a vertical-bore, ground-source heat pump to for domestic water heating under simulated occupancy conditions

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Ally, Moonis Raza; Munk, Jeffrey D.; Baxter, Van D.; Gehl, Anthony C.


    Evidence is provided to support the view that greater than two-thirds of energy required to produce domestic hot water may be extracted from the ground which serves as renewable energy resource. The case refers to a 345 m2 research house located in Oak Ridge, Tennessee, 36.01 N 84.26 W in a mixed-humid climate with HDD of 2218 C-days (3993 F-days) and CDD of 723 C-days (1301 F-days). The house is operated under simulated occupancy conditions in which the hot water use protocol is based on the Building America Research Benchmark Definition (Hendron 2008; Hendron and Engebrecht 2010) which captures themore » water consumption lifestyles of the average family in the United States. The 5.275 (1.5-ton) water-to-water ground source heat pump (WW-GSHP) shared the same vertical bore with a 7.56 KW water-to-air ground source heat pump for space conditioning the same house. Energy and exergy analysis of data collected continuously over a twelve month period provide performance metrics and sources of inherent systemic inefficiencies. Data and analyses are vital to better understand how WW-GSHPs may be further improved to enable the ground to be used as a renewable energy resource.« less

  13. Performance of a drain-back solar heating and hot water system with auxiliary heat pump. Final report

    SciTech Connect (OSTI)

    Karaki, S.


    The principal objective of the project was to test and evaluate the BNL collectors in a space heating system. When the BNL collectors delaminated under stagnation conditions, they were replaced with the Chamberlain collectors which were previously used on solar house III, and tests were continued to evaluate performance of a drain-back system. Results leading to the following conclusions are discussed. (1) The Chamberlain collectors have deteriorated in performance compared to previous seasons. Where daily efficiency of 41% were attained in 1978 to 1979 and 1979 to 1980, efficiency was 37%. System efficiency of 29% compares to 30% in prior years. (2) Solar contribution to DHW heating is low, and is probably the result of the artificially imposed load profile and the low recovery rate of the double-wall heat exchanger. (3) System efficiency can be improved by reducing thermal losses from storage.

  14. Assessment of Heating Fuels and Electricity Markets During the Winters of 2013-2014 and 2014-2015 Now Available

    Broader source: [DOE]

    Cold weather that blanketed much of the Eastern United States in 2013-2014 and 2014-2015 exhibited unique characteristics that prompted different — but related — challenges across heating fuels and...

  15. Screening analysis for EPACT-covered commercial HVAC and water-heating equipment

    SciTech Connect (OSTI)

    S Somasundaram; PR Armstrong; DB Belzer; SC Gaines; DL Hadley; S Katipumula; DL Smith; DW Winiarski


    EPCA requirements state that if the American Society of Heating, Refrigerating and Air-Conditioning Engineers, Inc. (ASHRAE) amends efficiency levels prescribed in Standard 90.1-1989, then DOE must establish an amended uniform national manufacturing standard at the minimum level specified in amended Standard 90.1. However, DOE can establish higher efficiency levels if it can show through clear and convincing evidence that a higher efficiency level, that is technologically feasible and economically justified, would produce significant additional energy savings. On October 29, 1999, ASHRAE approved the amended Standard 90.1, which increases the minimum efficiency levels for some of the commercial heating, cooling, and water-heating equipment covered by EPCA 92. DOE asked Pacific Northwest National Laboratory (PNNL) to conduct a screening analysis to determine the energy-savings potential of the efficiency levels listed in Standard 90.1-1999. The analysis estimates the annual national energy consumption and the potential for energy savings that would result if the EPACT-covered products were required to meet these efficiency levels. The analysis also estimates additional energy-savings potential for the EPACT-covered products if they were to exceed the efficiency levels prescribed in Standard 90-1-1999. In addition, a simple life-cycle cost (LCC) analysis was performed for some alternative efficiency levels. This paper will describe the methodology, data assumptions, and results of the analysis. The magnitude of HVAC and SWH loads imposed on equipment depends on the building's physical and operational characteristics and prevailing climatic conditions. To address this variation in energy use, coil loads for 7 representative building types at 11 climate locations were estimated based on a whole-building simulation.

  16. Solar space- and water-heating system at Stanford University. Final report

    SciTech Connect (OSTI)

    Not Available


    Application of an active hydronic domestic hot water and space heating solar system for the Central Food Services Building is discussed. The closed-loop drain-back system is described as offering dependability of gravity drain-back freeze protection, low maintenance, minimal costs, and simplicity. The system features an 840 square-foot collector and storage capacity of 1550 gallons. The acceptance testing and the predicted system performance data are briefly described. Solar performance calculations were performed using a computer design program (FCHART). Bidding, costs, and economics of the system are reviewed. Problems are discussed and solutions and recommendations given. An operation and maintenance manual is given in Appendix A, and Appendix B presents As-built Drawings. (MCW)

  17. Pressure drop and heat transfer characteristics of boiling water in sub-hundred micron channel

    SciTech Connect (OSTI)

    Bhide, R.R.; Singh, S.G.; Sridharan, Arunkumar; Duttagupta, S.P.; Agrawal, Amit [Department of Mechanical Engineering, Indian Institute of Technology Bombay, Powai, Mumbai 400 076 (India)


    The current work focuses on the pressure drop, heat transfer and stability in two phase flow in microchannels with hydraulic diameter of less than one hundred microns. Experiments were conducted in smooth microchannels of hydraulic diameter of 45, 65 {mu}m, and a rough microchannel of hydraulic diameter of 70 {mu}m, with deionised water as the working fluid. The local saturation pressure and temperature vary substantially over the length of the channel. In order to correctly predict the local saturation temperature and subsequently the heat transfer characteristics, numerical techniques have been used in conjunction with the conventional two phase pressure drop models. The Lockhart-Martinelli (liquid-laminar, vapour-laminar) model is found to predict the two phase pressure drop data within 20%. The instability in two phase flow is quantified; it is found that microchannels of smaller hydraulic diameter have lesser instabilities as compared to their larger counterparts. The experiments also suggest that surface characteristics strongly affect flow stability in the two phase flow regime. The effect of hydraulic diameter and surface characteristics on the flow characteristics and stability in two phase flow is seldom reported, and is of considerable practical relevance. (author)

  18. Screening Analysis for EPACT-Covered Commercial HVAC and Water-Heating Equipment

    SciTech Connect (OSTI)

    Somasundaram, Sriram; Armstrong, Peter R.; Belzer, David B.; Gaines, Suzanne C.; Hadley, Donald L.; Katipumula, S.; Smith, David L.; Winiarski, David W.


    The Energy Policy and Conservation Act (EPCA) as amended by the Energy Policy Act of 1992 (EPACT) establishes that the U.S. Department of Energy (DOE) regulate efficiency levels of certain categories of commercial heating, cooling, and water-heating equip-ment. EPACT establishes the initial minimum efficiency levels for products falling under these categories, based on ASHRAE/IES Standard 90.1-1989 requirements. EPCA states that, if ASHRAE amends Standard 90.1-1989 efficiency levels, then DOE must establish an amended uniform national manufacturing standard at the minimum level specified in the amended Standard 90.1 and that it can establish higher efficiency levels if they would result in significant additional energy savings. Standard 90.1-1999 increases minimum efficiency levels for some of the equipment categories covered by EPCA 92. DOE conducted a screening analysis to determine the energy-savings potential for EPACT-covered products meet and exceeding these levels. This paper describes the methodology, data assumptions, and results of the analysis.

  19. Measured Performance and Analysis of Ground Source Heat Pumps for Space Conditioning and for Water Heating in a Low-Energy Test House Operated under Simulated Occupancy Conditions

    SciTech Connect (OSTI)

    Ally, Moonis Raza [ORNL] [ORNL; Munk, Jeffrey D [ORNL] [ORNL; Baxter, Van D [ORNL] [ORNL; Gehl, Anthony C [ORNL] [ORNL


    In this paper we present measured performance and efficiency metrics of Ground Source Heat Pumps (GSHPs) for space conditioning and for water heating connected to a horizontal ground heat exchanger (GHX) loop. The units were installed in a 345m2 (3700ft2) high-efficiency test house built with structural insulated panels (SIPs), operated under simulated occupancy conditions, and located in Oak Ridge, Tennessee (USA) in US Climate Zone 4 . The paper describes distinctive features of the building envelope, ground loop, and equipment, and provides detailed monthly performance of the GSHP system. Space conditioning needs of the house were completely satisfied by a nominal 2-ton (7.0 kW) water-to-air GSHP (WA-GSHP) unit with almost no auxiliary heat usage. Recommendations for further improvement through engineering design changes are identified. The comprehensive set of data and analyses demonstrate the feasibility and practicality of GSHPs in residential applications and their potential to help achieve source energy and greenhouse gas emission reduction targets set under the IECC 2012 Standard.

  20. Cedarville School District Retrofit of Heating and Cooling Systems with Geothermal Heat Pumpsand Ground Source Water Loops

    Broader source: [DOE]

    Project objectives: Improve the indoor air quality and lower the cost of cooling and heating the buildings that make up the campus of Cedarville High School and Middle School.; Provide jobs; and reduce requirements of funds for the capital budget of the School District; and thus give relief to taxpayers in this rural region during a period of economic recession.

  1. Faradaic efficiencies less than 100% during electrolysis of water can account for reports of excess heat in `cold fusion` cells

    SciTech Connect (OSTI)

    Jones, J.E.; Hansen, L.D.; Jones, S.E.; Shelton, D.S.; Thorne, J.M.


    The purpose of this study is to evaluate claims of excess heat generation during water electrolysis. Several cells were constructed and operated similarly to low-current-density cells described in the literature. All produced excess heat as defined and calculated in the literature reports, but the production of excess heat could be readily terminated by the introduction of various barriers to the migration of hydrogen and oxygen. Remarkably, published reports of excess heat fail to disprove the presence of decreased faradaic efficiency (e.g., current that oxidizes H{sub 2} or reduces O{sub 2}) or systematic calorimetric errors. Illustrative examples of both problems are given. Thus, failure to rule out prosaic explanations probably invalidates all the currently available reports of excess heat in both light water-Ni/Pt and heavy water-Pd/Pt cells. There is no compelling evidence that excess heat is of a nuclear origin in such electrolytic cells. 20 refs., 6 figs., 1 tab.

  2. Pressure drop, heat transfer, critical heat flux, and flow stability of two-phase flow boiling of water and ethylene glycol/water mixtures - final report for project "Efficent cooling in engines with nucleate boiling."

    SciTech Connect (OSTI)

    Yu, W.; France, D. M.; Routbort, J. L.


    Because of its order-of-magnitude higher heat transfer rates, there is interest in using controllable two-phase nucleate boiling instead of conventional single-phase forced convection in vehicular cooling systems to remove ever increasing heat loads and to eliminate potential hot spots in engines. However, the fundamental understanding of flow boiling mechanisms of a 50/50 ethylene glycol/water mixture under engineering application conditions is still limited. In addition, it is impractical to precisely maintain the volume concentration ratio of the ethylene glycol/water mixture coolant at 50/50. Therefore, any investigation into engine coolant characteristics should include a range of volume concentration ratios around the nominal 50/50 mark. In this study, the forced convective boiling heat transfer of distilled water and ethylene glycol/water mixtures with volume concentration ratios of 40/60, 50/50, and 60/40 in a 2.98-mm-inner-diameter circular tube has been investigated in both the horizontal flow and the vertical flow. The two-phase pressure drop, the forced convective boiling heat transfer coefficient, and the critical heat flux of the test fluids were determined experimentally over a range of the mass flux, the vapor mass quality, and the inlet subcooling through a new boiling data reduction procedure that allowed the analytical calculation of the fluid boiling temperatures along the experimental test section by applying the ideal mixture assumption and the equilibrium assumption along with Raoult's law. Based on the experimental data, predictive methods for the two-phase pressure drop, the forced convective boiling heat transfer coefficient, and the critical heat flux under engine application conditions were developed. The results summarized in this final project report provide the necessary information for designing and implementing nucleate-boiling vehicular cooling systems.

  3. U.S. Solar Market Trends

    SciTech Connect (OSTI)

    Larry Sherwood


    Grid-connected photovoltaic installations grew by 40% in 2009 compared with installations in 2008. California and New Jersey have the largest markets. Growth occurred in the residential and utility markets, but non-residential customer-sited installations did not change compared with the installations in 2008. Two small solar thermal electric plants were connected to the grid in 2009 with a combined capacity of 7 MW. The future prospects for solar thermal electric plants look bright, although developers are not expected to complete any new large plants until at least 2011. Solar water heating and solar space heating annual installations grew by 40% in 2008 compared with 2007. Hawaii, California, Puerto Rico, and Florida dominate this market. Solar pool heating annual installation capacity fell by 1% in 2008 following a dramatic decline of 15% in solar pool heating capacity in 2007 compared with 2006. Florida and California are the largest markets for solar pool heating. The economic decline in the real estate markets in Florida and California likely led to the decrease in pool installations and thus the dramatic decline in capacity installed of solar pool systems in 2007.

  4. Evaluation and demonstration of decentralized space and water heating versus centralized services for new and rehabilitated multifamily buildings. Final report

    SciTech Connect (OSTI)

    Belkus, P.; Tuluca, A.


    The general objective of this research was aimed at developing sufficient technical and economic know-how to convince the building and design communities of the appropriateness and energy advantages of decentralized space and water heating for multifamily buildings. Two main goals were established to guide this research. First, the research sought to determine the cost-benefit advantages of decentralized space and water heating versus centralized systems for multifamily applications based on innovative gas piping and appliance technologies. The second goal was to ensure that this information is made available to the design community.

  5. "Table HC3.8 Water Heating Characteristics by Owner-Occupied Housing Unit, 2005"

    U.S. Energy Information Administration (EIA) Indexed Site

    8 Water Heating Characteristics by Owner-Occupied Housing Unit, 2005" " Million U.S. Housing Units" ,," Owner-Occupied Housing Units (millions)","Type of Owner-Occupied Housing Unit" ,"U.S. Housing Units (millions" ,,,"Single-Family Units",,"Apartments in Buildings With--" "Water Heating Characteristics",,,"Detached","Attached","2 to 4 Units","5 or More Units","Mobile

  6. "Table HC4.8 Water Heating Characteristics by Renter-Occupied Housing Unit, 2005"

    U.S. Energy Information Administration (EIA) Indexed Site

    8 Water Heating Characteristics by Renter-Occupied Housing Unit, 2005" " Million U.S. Housing Units" ,," Renter-Occupied Housing Units (millions)","Type of Renter-Occupied Housing Unit" ,"U.S. Housing Units (millions" ,,,"Single-Family Units",,"Apartments in Buildings With--" "Water Heating Characteristics",,,"Detached","Attached","2 to 4 Units","5 or More Units","Mobile

  7. Energy Smart Guide to Campus Cost Savings: Today's Trends in Project Finance, Clean Fuel Fleets, Combined Heat& Power, Emissions Markets

    SciTech Connect (OSTI)

    Not Available


    The Energy Smart Guide to Campus Cost Savings covers today's trends in project finance, combined heat& power, clean fuel fleets and emissions trading. The guide is directed at campus facilities and business managers and contains general guidance, contact information and case studies from colleges and universities across the country.

  8. Boise geothermal district heating system

    SciTech Connect (OSTI)

    Hanson, P.J.


    This document describes the Boise geothermal district heating project from preliminary feasibility studies completed in 1979 to a fully operational system by 1983. The report includes information about the two local governments that participated in the project - the City of Boise, Idaho and the Boise Warm Springs Water District. It also discusses the federal funding sources; the financial studies; the feasibility studies conducted; the general system planning and design; design of detailed system components; the legal issues involved in production; geological analysis of the resource area; distribution and disposal; the program to market system services; and the methods of retrofitting buildings to use geothermal hot water for space heating. Technically this report describes the Boise City district heating system based on 170/sup 0/F water, a 4000 gpm production system, a 41,000 foot pipeline system, and system economies. Comparable data are also provided for the Boise Warm Springs Water District. 62 figs., 31 tabs.

  9. Radiant heating and cooling, displacement ventilation with heat recovery and storm water cooling: An environmentally responsible HVAC system

    SciTech Connect (OSTI)

    Carpenter, S.C.; Kokko, J.P.


    This paper describes the design, operation, and performance of an HVAC system installed as part of a project to demonstrate energy efficiency and environmental responsibility in commercial buildings. The systems installed in the 2180 m{sup 2} office building provide superior air quality and thermal comfort while requiring only half the electrical energy of conventional systems primarily because of the hydronic heating and cooling system. Gas use for the building is higher than expected because of longer operating hours and poor performance of the boiler/absorption chiller.

  10. Market Analyses | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Combined Heat & Power Deployment » Market Analyses Market Analyses Need information on the market potential for combined heat and power (CHP) in the U.S.? These assessments and analyses cover a wide range of markets including commercial and institutional buildings and facilities, district energy, and industrial sites. The market potential for CHP at federal sites and in selected states/regions is also examined. Commercial CHP and Bioenergy Systems for Landfills and Wastewater Treatment

  11. Solar heating and hot water system installed at the Senior Citizen Center, Huntsville, Alabama. [Includes engineering drawings

    SciTech Connect (OSTI)

    Not Available


    Information is provided on the solar energy system installed at the Huntsville Senior Citizen Center. The solar space heating and hot water facility and the project involved in its construction are described in considerable detail and detailed drawings of the complete system and discussions of the planning, the hardware, recommendations, and other pertinent information are included. The facility was designed to provide 85 percent of the hot water and 85 percent of the space heating requirements. Two important factors concerning this project for commercial demonstration are the successful use of silicon oil as a heat transfer fluid and the architecturally aesthetic impact of a large solar energy system as a visual centerpoint. There is no overheat or freeze protection due to the characteristics of the silicon oil and the design of the system. Construction proceeded on schedule with no cost overruns. It is designed to be relatively free of scheduled maintenance, and has experienced practically no problems.

  12. Building America Technology Solutions for New and Existing Homes: Multifamily Central Heat Pump Water Heaters (Fact Sheet)

    Broader source: [DOE]

    To evaluate the performance of central heat pump water heaters for multifamily applications, the Alliance for Residential Building Innovation team monitored the performance of a 10.5 ton central HPWH installed on a student apartment building at the West Village Zero Net Energy Community in Davis, California, for 16 months.

  13. Using Solar Hot Water to Address Piping Heat Losses in Multifamily...

    Office of Scientific and Technical Information (OSTI)

    Subject: 32 ENERGY CONSERVATION, CONSUMPTION, AND UTILIZATION residential; Residential Buildings; ARBI; Building America; TRNSYS; multifamily; domestic hot water; solar water ...

  14. "Table HC15.8 Water Heating Characteristics by Four Most Populated States, 2005"

    U.S. Energy Information Administration (EIA) Indexed Site

    8 Water Heating Characteristics by Four Most Populated States, 2005" " Million U.S. Housing Units" ,"Housing Units (millions)","Four Most Populated States" "Water Heating Characteristics",,"New York","Florida","Texas","California" "Total",111.1,7.1,7,8,12.1 "Number of Water Heaters" "1.",106.3,6.5,6.9,7.4,11.7 "2 or More",3.7,"Q","Q",0.5,0.4 "Do

  15. U.S. Solar Market Trends

    SciTech Connect (OSTI)

    Larry Sherwood


    U.S. solar installations by technology are detailed for 1998???¢????????2005. The growth and state distribution of installations are different for the three primary solar sectors: ???¢???????¢ photovoltaics, ???¢???????¢ solar water heating and space heating, and ???¢???????¢ solar pool heating. Photovoltaic installations have grown steadily. Since 2001, grid-connected installations grew at an average rate of 52%. California has 79% of the installations, with Arizona, New Jersey, New York, Illinois, Massachusetts, and Oregon accounting for most of the remaining installations. The offgrid growth has been steady, but significantly lower. Solar water heating and solar space heating installations have shown little growth since 1997. Hawaii dominates, with 41% of the market. Other states with a large number of installations include Puerto Rico, California, Florida, and Arizona. Solar pool heating accounts for the largest number of installations and has grown at an average rate of 13% since 1997. Installations in California and Florida are 75% of the pool heating market.

  16. Max Tech Electric Heat Pump Water Heater with Lower GWP Halogenated...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Image credit: Oak Ridge National Laboratory. Information flow schematic for an integrated heat ... options, cycle configurations, and system designs to determine the best path ...

  17. Using Solar Hot Water to Address Piping Heat Losses in Multifamily...

    Office of Scientific and Technical Information (OSTI)

    Subject: residential; Residential Buildings; ARBI; Building America; TRNSYS; multifamily; domestic hot water; solar water heater; recirculation Word Cloud More Like This Full Text ...

  18. Purification of water from cooling towers and other heat exchange systems

    DOE Patents [OSTI]

    Sullivan; Enid J. , Carlson; Bryan J. , Wingo; Robert M. , Robison; Thomas W.


    The amount of silica in cooling tower water is reduced by passing cooling tower water through a column of silica gel.

  19. Residential Marketing Toolkit

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    & Events Expand News & Events Skip navigation links Residential Residential Lighting Energy Star Appliances Consumer Electronics Heat Pump Water Heaters Electric Storage Water...

  20. Savannah River reactor process water heat exchanger tube structural integrity margin Task Number 92-005-1

    SciTech Connect (OSTI)

    Mertz, G.E.; Barnes, D.M.; Sindelar, R.L.


    Twelve process water heat exchangers are designed to remove heat generated in the reactor tank. Each heat exchanger has approximately 9000, 1/2 inch diameter {times} 0.049 inches thick tubes. Minimum structural tubing requirements and the leak rate through postulated tubing defects are developed in this report A comparison of the structural requirements and the defect size calculated to produce leak rates of 0.5 lbs./day demonstrate adequate structural margins against gross tube rupture. Commercial nuclear experience with pressurized water reactor (PWR) steam generator plugging criteria are used for guidance in performing this analysis. It is important to note that the SRS reactors are low energy systems with normal operating pressures of 203 psig at 130{degree}F while the PWR is a high energy system with operating pressures near 2200 psig at 600{degree}F. Clearly the PVM steam generator has loadings which are more severe than the SRS heat exchangers. Consistent with the Regulatory Guide 1.121 criteria both wastage (wall thinning) and cracking are addressed. Structural limits on wall thinning and crack size are developed to preclude gross rupture. ASME Section XI criteria, with the factors of safety recommended by Regulatory Guide 1.121 are used to develop the allowable crack size criteria. Normal operating conditions (pressure, dead weight, and hydraulic drag) are considered with seismic and water hammer accident conditions. Both the wall thinning and crack size criteria are developed for the end-of-evaluation period. Allowances for corrosion, wear, or crack growth have not been included in this analysis Structurally, the tubing is over designed and can tolerate large defects with adequate margins against gross rupture. The structural margins of heat exchanger tubing are evident by contrasting the tubing`s structural capacity, per the ASME Code, with its operating conditions/configuration.

  1. Savannah River reactor process water heat exchanger tube structural integrity margin Task Number 92-005-1

    SciTech Connect (OSTI)

    Mertz, G.E.; Barnes, D.M.; Sindelar, R.L.


    Twelve process water heat exchangers are designed to remove heat generated in the reactor tank. Each heat exchanger has approximately 9000, 1/2 inch diameter {times} 0.049 inches thick tubes. Minimum structural tubing requirements and the leak rate through postulated tubing defects are developed in this report A comparison of the structural requirements and the defect size calculated to produce leak rates of 0.5 lbs./day demonstrate adequate structural margins against gross tube rupture. Commercial nuclear experience with pressurized water reactor (PWR) steam generator plugging criteria are used for guidance in performing this analysis. It is important to note that the SRS reactors are low energy systems with normal operating pressures of 203 psig at 130{degree}F while the PWR is a high energy system with operating pressures near 2200 psig at 600{degree}F. Clearly the PVM steam generator has loadings which are more severe than the SRS heat exchangers. Consistent with the Regulatory Guide 1.121 criteria both wastage (wall thinning) and cracking are addressed. Structural limits on wall thinning and crack size are developed to preclude gross rupture. ASME Section XI criteria, with the factors of safety recommended by Regulatory Guide 1.121 are used to develop the allowable crack size criteria. Normal operating conditions (pressure, dead weight, and hydraulic drag) are considered with seismic and water hammer accident conditions. Both the wall thinning and crack size criteria are developed for the end-of-evaluation period. Allowances for corrosion, wear, or crack growth have not been included in this analysis Structurally, the tubing is over designed and can tolerate large defects with adequate margins against gross rupture. The structural margins of heat exchanger tubing are evident by contrasting the tubing's structural capacity, per the ASME Code, with its operating conditions/configuration.

  2. Economic analysis of wind-powered refrigeration cooling/water-heating systems in food processing. Final report

    SciTech Connect (OSTI)

    Garling, W.S.; Harper, M.R.; Merchant-Geuder, L.; Welch, M.


    Potential applications of wind energy include not only large central turbines that can be utilized by utilities, but also dispersed systems for farms and other applications. The US Departments of Energy (DOE) and Agriculture (USDA) currently are establishing the feasibility of wind energy use in applications where the energy can be used as available, or stored in a simple form. These applications include production of hot water for rural sanitation, heating and cooling of rural structures and products, drying agricultural products, and irrigation. This study, funded by USDA, analyzed the economic feasibility of wind power in refrigeration cooling and water heating systems in food processing plants. Types of plants included were meat and poultry, dairy, fruit and vegetable, and aquaculture.

  3. Effect of Sodium Carboxymethyl Celluloses on Water-catalyzed Self-degradation of 200-degree C-heated Alkali-Activated Cement

    SciTech Connect (OSTI)

    Sugama T.; Pyatina, T.


    We investigated the usefulness of sodium carboxymethyl celluloses (CMC) in promoting self-degradation of 200°C-heated sodium silicate-activated slag/Class C fly ash cementitious material after contact with water. CMC emitted two major volatile compounds, CO2 and acetic acid, creating a porous structure in cement. CMC also reacted with NaOH from sodium silicate to form three water-insensitive solid reaction products, disodium glycolate salt, sodium glucosidic salt, and sodium bicarbonate. Other water-sensitive solid reaction products, such as sodium polysilicate and sodium carbonate, were derived from hydrolysates of sodium silicate. Dissolution of these products upon contact with water generated heat that promoted cement’s self-degradation. Thus, CMC of high molecular weight rendered two important features to the water-catalyzed self-degradation of heated cement: One was the high heat energy generated in exothermic reactions in cement; the other was the introduction of extensive porosity into cement.

  4. 8. Innovative Technologies: Two-Phase Heat Transfer in Water-Based Nanofluids for Nuclear Applications Final Report

    SciTech Connect (OSTI)

    Buongiorno, Jacopo; Hu, Lin-wen


    Abstract Nanofluids are colloidal dispersions of nanoparticles in water. Many studies have reported very significant enhancement (up to 200%) of the Critical Heat Flux (CHF) in pool boiling of nanofluids (You et al. 2003, Vassallo et al. 2004, Bang and Chang 2005, Kim et al. 2006, Kim et al. 2007). These observations have generated considerable interest in nanofluids as potential coolants for more compact and efficient thermal management systems. Potential Light Water Reactor applications include the primary coolant, safety systems and severe accident management strategies, as reported in other papers (Buongiorno et al. 2008 and 2009). However, the situation of interest in reactor applications is often flow boiling, for which no nanofluid data have been reported so far. In this project we investigated the potential of nanofluids to enhance CHF in flow boiling. Subcooled flow boiling heat transfer and CHF experiments were performed with low concentrations of alumina, zinc oxide, and diamond nanoparticles in water (? 0.1 % by volume) at atmospheric pressure. It was found that for comparable test conditions the values of the nanofluid and water heat transfer coefficient (HTC) are similar (within ?20%). The HTC increased with mass flux and heat flux for water and nanofluids alike, as expected in flow boiling. The CHF tests were conducted at 0.1 MPa and at three different mass fluxes (1500, 2000, 2500 kg/m2s) under subcooled conditions. The maximum CHF enhancement was 53%, 53% and 38% for alumina, zinc oxide and diamond, respectively, always obtained at the highest mass flux. A post-mortem analysis of the boiling surface reveals that its morphology is altered by deposition of the particles during nanofluids boiling. A confocal-microscopy-based examination of the test section revealed that nanoparticles deposition not only changes the number of micro-cavities on the surface, but also the surface wettability. A simple model was used to estimate the ensuing nucleation site density changes, but no definitive correlation between the nucleation site density and the heat transfer coefficient data could be found. Wettability of the surface was substantially increased for heater coupons boiled in alumina and zinc oxide nanofluids, and such wettability increase seems to correlate reasonably well with the observed marked CHF enhancement for the respective nanofluids. Interpretation of the experimental data was conducted in light of the governing surface parameters (surface area, contact angle, roughness, thermal conductivity) and existing models. It was found that no single parameter could explain the observed HTC or CHF phenomena.

  5. Water Heating: Office of Building Technology, State and Community Programs (BTS) Technology Fact Sheet

    SciTech Connect (OSTI)


    Fact sheet for homeowners and contractors on how to supply hot water in the home while saving energy.

  6. Home Heating | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Heating Home Heating Energy Saver 101 Infographic: Home Heating Energy Saver 101 Infographic: Home Heating Everything you need to know about home heating, including how heating systems work, the different types on the market and proper maintenance. Read more Thermostats Thermostats Save money on heating by automatically setting back your thermostat when you are asleep or away. Read more Wood and Pellet Heating Wood and Pellet Heating Wood and pellets are renewable fuel sources, and modern wood

  7. Heat Transfer in GE Jet Engines | GE Global Research

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    & Cool » Water Heating » Solar Water Heaters » Heat Transfer Fluids for Solar Water Heating Systems Heat Transfer Fluids for Solar Water Heating Systems Illustration of a solar water heater. Illustration of a solar water heater. Heat-transfer fluids carry heat through solar collectors and a heat exchanger to the heat storage tanks in solar water heating systems. When selecting a heat-transfer fluid, you and your solar heating contractor should consider the following criteria: Coefficient

  8. Buildings Energy Data Book: 5.3 Heating, Cooling, and Ventilation Equipment

    Buildings Energy Data Book [EERE]

    6 2008 Unitary Air-Conditioner/Heat Pump Manufacturer Market Shares (Percent of Products Produced) Company Market Share (%) Total Units Shipped: (1) UTC/Carrier 27% Goodman (Amana) 14% American Standard (Trane) 14% York 12% Nordyne 12% Rheem 9% Lennox 9% Others 3% Total 100% Note(s): Source(s): 5,833,354 1) Does not include water-source or ground-source heat pumps.

  9. A Highly Efficient Six-Stroke Internal Combustion Engine Cycle with Water Injection for In-Cylinder Exhaust Heat Recovery

    SciTech Connect (OSTI)

    Conklin, Jim; Szybist, James P


    A concept is presented here that adds two additional strokes to the four-stroke Otto or Diesel cycle that has the potential to increase fuel efficiency of the basic cycle. The engine cycle can be thought of as a 4 stroke Otto or Diesel cycle followed by a 2-stroke heat recovery steam cycle. Early exhaust valve closing during the exhaust stroke coupled with water injection are employed to add an additional power stroke at the end of the conventional four-stroke Otto or Diesel cycle. An ideal thermodynamics model of the exhaust gas compression, water injection at top center, and expansion was used to investigate this modification that effectively recovers waste heat from both the engine coolant and combustion exhaust gas. Thus, this concept recovers energy from two waste heat sources of current engine designs and converts heat normally discarded to useable power and work. This concept has the potential of a substantial increase in fuel efficiency over existing conventional internal combustion engines, and under appropriate injected water conditions, increase the fuel efficiency without incurring a decrease in power density. By changing the exhaust valve closing angle during the exhaust stroke, the ideal amount of exhaust can be recompressed for the amount of water injected, thereby minimizing the work input and maximizing the mean effective pressure of the steam expansion stroke (MEPsteam). The value of this exhaust valve closing for maximum MEPsteam depends on the limiting conditions of either one bar or the dew point temperature of the expansion gas/moisture mixture when the exhaust valve opens to discard the spent gas mixture in the sixth stroke. The range of MEPsteam calculated for the geometry of a conventional gasoline spark-ignited internal combustion engine and for plausible water injection parameters is from 0.75 to 2.5 bars. Typical combustion mean effective pressures (MEPcombustion) of naturally aspirated gasoline engines are up to 10 bar, thus this concept has the potential to significantly increase the engine efficiency and fuel economy while not resulting in a decrease in power density.

  10. Solar heating, cooling, and domestic hot water system installed at Kaw Valley State Bank and Trust Company, Topeka, Kansas. Final report

    SciTech Connect (OSTI)


    The building has approximately 5600 square feet of conditioned space. Solar energy is used for space heating, space cooling, and preheating domestic hot water (DHW). The solar energy system has an array of evacuated tube-type collectors with an area of 1068 square feet. A 50/50 solution of ethylene glycol and water is the transfer medium that delivers solar energy to a tube-in-shell heat exchanger that in turn delivers solar-heated water to a 1100 gallon pressurized hot water storage tank. When solar energy is insufficient to satisfy the space heating and/or cooling demand, a natural gas-fired boiler provides auxiliary energy to the fan coil loops and/or the absorption chillers. Extracts from the site files, specification references, drawings, and installation, operation and maintenance instructions are included.

  11. Retrofit Integrated Space & Water Heating: Field Assessment, Minneapolis, Minnesota (Fact Sheet), Building America Case Study: Technology Solutions for New and Existing Homes, Building Technologies Office (BTO)

    Energy Savers [EERE]

    Retrofit Integrated Space and Water Heating: Field Assessment Minneapolis, Minnesota PROJECT INFORMATION Project Name: Retrofit Integrated Space and Water Heating: Field Assessment Location: Minneapolis, MN Partners: Center for Energy and Environment, Sustainable Resources Center, University of Minnesota, NorthernSTAR Building America Partnership Building Component: HVAC Application: Retrofit; single family Year Tested: 2012 Climate

  12. UNSAT-H Version 3.0: Unsaturated Soil Water and Heat Flow Model Theory, User Manual, and Examples

    SciTech Connect (OSTI)

    MJ Fayer


    The UNSAT-H model was developed at Pacific Northwest National Laboratory (PNNL) to assess the water dynamics of arid sites and, in particular, estimate recharge fluxes for scenarios pertinent to waste disposal facilities. During the last 4 years, the UNSAT-H model received support from the Immobilized Waste Program (IWP) of the Hanford Site's River Protection Project. This program is designing and assessing the performance of on-site disposal facilities to receive radioactive wastes that are currently stored in single- and double-shell tanks at the Hanford Site (LMHC 1999). The IWP is interested in estimates of recharge rates for current conditions and long-term scenarios involving the vadose zone disposal of tank wastes. Simulation modeling with UNSAT-H is one of the methods being used to provide those estimates (e.g., Rockhold et al. 1995; Fayer et al. 1999). To achieve the above goals for assessing water dynamics and estimating recharge rates, the UNSAT-H model addresses soil water infiltration, redistribution, evaporation, plant transpiration, deep drainage, and soil heat flow as one-dimensional processes. The UNSAT-H model simulates liquid water flow using Richards' equation (Richards 1931), water vapor diffusion using Fick's law, and sensible heat flow using the Fourier equation. This report documents UNSAT-H .Version 3.0. The report includes the bases for the conceptual model and its numerical implementation, benchmark test cases, example simulations involving layered soils and plants, and the code manual. Version 3.0 is an, enhanced-capability update of UNSAT-H Version 2.0 (Fayer and Jones 1990). New features include hysteresis, an iterative solution of head and temperature, an energy balance check, the modified Picard solution technique, additional hydraulic functions, multiple-year simulation capability, and general enhancements.

  13. Total Space Heat-

    Gasoline and Diesel Fuel Update (EIA)

    Commercial Buildings Energy Consumption Survey: Energy End-Use Consumption Tables Total Space Heat- ing Cool- ing Venti- lation Water Heat- ing Light- ing Cook- ing Refrig- eration...

  14. Total Space Heat-

    Gasoline and Diesel Fuel Update (EIA)

    Revised: December, 2008 Total Space Heat- ing Cool- ing Venti- lation Water Heat- ing Light- ing Cook- ing Refrig- eration Office Equip- ment Com- puters Other All Buildings...

  15. Total Space Heat-

    Gasoline and Diesel Fuel Update (EIA)

    Released: September, 2008 Total Space Heat- ing Cool- ing Venti- lation Water Heat- ing Light- ing Cook- ing Refrig- eration Office Equip- ment Com- puters Other All Buildings*...

  16. Optimization of biological recycling of plant nutrients in livestock waste by utilizing waste heat from cooling water

    SciTech Connect (OSTI)

    Maddox, J.J.; Behrends, L.L.; Burch, D.W.; Kingsley, J.B.; Waddell, E.L. Jr.


    Results are presented from a 5-year study to develop aquatic methods which beneficially use condenser cooling water from electric generating power plants. A method is proposed which uses a system for aquatic farming. Livestock waste is used to fertilize planktonic algae production and filter-feeding fish are used to biologically harvest the algae, condenser cooling water (simulated) is used to add waste heat to the system, and emergent aquatic plants are used in a flow through series as a bio-filter to improve the water quality and produce an acceptable discharge. Two modes of operation were tested; one uses untreated swine manure as the source of aquatic fertilizer and the other uses anaerobic digester waste as a means of pretreating the manure to produce an organic fertilizer. A set of operating conditions (temperature, retention time, fish stocking rate, fertilizer rates, land and water requirements, suggested fish and plant species, and facility design) were developed from these results. The integrated system allows continual use of power plant condenser cooling water from plants in the southeastern United States.

  17. High Efficiency Integrated Space Conditioning, Water Heating and Air Distribution System for HUD-Code Manufactured Housing

    SciTech Connect (OSTI)

    Henry DeLima; Joe Akin; Joseph Pietsch


    Recognizing the need for new space conditioning and water heating systems for manufactured housing, DeLima Associates assembled a team to develop a space conditioning system that would enhance comfort conditions while also reducing energy usage at the systems level. The product, Comboflair® was defined as a result of a needs analysis of project sponsors and industry stakeholders. An integrated system would be developed that would combine a packaged airconditioning system with a small-duct, high-velocity air distribution system. In its basic configuration, the source for space heating would be a gas water heater. The complete system would be installed at the manufactured home factory and would require no site installation work at the homesite as is now required with conventional split-system air conditioners. Several prototypes were fabricated and tested before a field test unit was completed in October 2005. The Comboflair® system, complete with ductwork, was installed in a 1,984 square feet, double-wide manufactured home built by Palm Harbor Homes in Austin, TX. After the home was transported and installed at a Palm Harbor dealer lot in Austin, TX, a data acquisition system was installed for remote data collection. Over 60 parameters were continuously monitored and measurements were transmitted to a remote site every 15 minutes for performance analysis. The Comboflair® system was field tested from February 2006 until April 2007. The cooling system performed in accordance with the design specifications. The heating system initially could not provide the needed capacity at peak heating conditions until the water heater was replaced with a higher capacity standard water heater. All system comfort goals were then met. As a result of field testing, we have identified improvements to be made to specific components for incorporation into production models. The Comboflair® system will be manufactured by Unico, Inc. at their new production facility in St. Louis, MO. The product will be initially launched in the hot-humid climates of the southern U.S.

  18. 2009 Fuel Cell Market Report

    SciTech Connect (OSTI)

    Vincent, Bill; Gangi, Jennifer; Curtin, Sandra; Delmont, Elizabeth


    Fuel cells are electrochemical devices that combine hydrogen and oxygen to produce electricity, water, and heat. Unlike batteries, fuel cells continuously generate electricity, as long as a source of fuel is supplied. Moreover, fuel cells do not burn fuel, making the process quiet, pollution-free and two to three times more efficient than combustion. Fuel cell systems can be a truly zero-emission source of electricity, if the hydrogen is produced from non-polluting sources. Global concerns about climate change, energy security, and air pollution are driving demand for fuel cell technology. More than 630 companies and laboratories in the United States are investing $1 billion a year in fuel cells or fuel cell component technologies. This report provides an overview of trends in the fuel cell industry and markets, including product shipments, market development, and corporate performance. It also provides snapshots of select fuel cell companies, including general.

  19. State Heating Oil & Propane Program. Final report 1997/98 heating season

    SciTech Connect (OSTI)

    Hunton, G.


    The following is a summary report of the New Hampshire Governor`s Office of Energy and Community Services (ECS) participation in the State Heating Oil and Propane Program (SHOPP) for the 1997/98 heating season. SHOPP is a cooperative effort, linking energy offices in East Coast and Midwest states, with the Department of Energy (DOE), Energy Information Administration (EIA) for the purpose of collecting retail price data for heating oil and propane. The program is funded by the participating state with a matching grant from DOE. SHOPP was initiated in response to congressional inquires into supply difficulties and price spikes of heating oil and propane associated with the winter of 1989/90. This is important to New Hampshire because heating oil controls over 55% of the residential heating market statewide. Propane controls 10% of the heating market statewide and is widely used for water heating and cooking in areas of the state where natural gas is not available. Lower installation cost, convenience, lower operating costs compared to electricity, and its perception as a clean heating fuel have all worked to increase the popularity of propane in New Hampshire and should continue to do so in the future. Any disruption in supply of these heating fuels to New Hampshire could cause prices to skyrocket and leave many residents in the cold.

  20. U.S. Solar Market Trends

    SciTech Connect (OSTI)

    Larry Sherwood


    2010 marked the emergence of the utility sector photovoltaic market. Utility sector photovoltaic installations quadrupled over 2009 installations. The share of utility sector installations of all U.S. grid-connected PV installations grew from virtually none in 2006 to 15 percent in 2009 and 32 percent in 2010. In addition, 2010 saw installation of a 75 MWAC concentrating solar power plant, the largest installed in the U.S. since 1991. In 2010, annual distributed grid-connected PV installations in the United States grew by 62 percent, to 606 MWDC. Photovoltaic arrays were installed at more than 50,000 sites in 2010, a 45 percent increase over the number of installations in 2009. Solar water heating installations increased by 6 percent in 2010, compared with 2009. Solar water heating has shown only two years of higher growth in the last 10 years. Solar pool heating installations increased by 13 percent in 2010, the largest growth in five years.

  1. Air-To-Water Heat Pumps with Radiant Delivery in Low Load Homes: Tucson, Arizona and Chico, California (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available


    Space conditioning represents nearly 50% of average residential household energy consumption, highlighting the need to identify alternative cost-effective, energy-efficient cooling and heating strategies. As homes are better built, there is an increasing need for strategies that are particularly well suited for high performance, low load homes. ARBI researchers worked with two test homes in hot-dry climates to evaluate the in-situ performance of air-to-water heat pump (AWHP) systems, an energy efficient space conditioning solution designed to cost-effectively provide comfort in homes with efficient, safe, and durable operation. Two monitoring projects of test houses in hot-dry climates were initiated in 2010 to test this system. Both systems were fully instrumented and have been monitored over one year to capture complete performance data over the cooling and heating seasons. Results are used to quantify energy savings, cost-effectiveness, and system performance using different operating modes and strategies. A calibrated TRNSYS model was developed and used to evaluate performance in various climate regions. This strategy is most effective in tight, insulated homes with high levels of thermal mass (i.e. exposed slab floors).

  2. Northeastern Summer Electricity Market Alert

    Reports and Publications (EIA)


    The National Weather Service declared an excessive-heat warning for much of the Mid-Atlantic and northeastern United States, including major electric markets covering Philadelphia, Boston, Washington, D.C., and New York City. This report highlights the wholesale electricity market activity occurring in response to the higher-than-normal electricity demand caused by the heat wave.

  3. Break-Even Cost for Residential Solar Water Heating in the United States: Key Drivers and Sensitivities

    SciTech Connect (OSTI)

    Cassard, H.; Denholm, P.; Ong, S.


    This paper examines the break-even cost for residential rooftop solar water heating (SWH) technology, defined as the point where the cost of the energy saved with a SWH system equals the cost of a conventional heating fuel purchased from the grid (either electricity or natural gas). We examine the break-even cost for the largest 1,000 electric and natural gas utilities serving residential customers in the United States as of 2008. Currently, the break-even cost of SWH in the United States varies by more than a factor of five for both electricity and natural gas, despite a much smaller variation in the amount of energy saved by the systems (a factor of approximately one and a half). The break-even price for natural gas is lower than that for electricity due to a lower fuel cost. We also consider the relationship between SWH price and solar fraction and examine the key drivers behind break-even costs. Overall, the key drivers of the break-even cost of SWH are a combination of fuel price, local incentives, and technical factors including the solar resource location, system size, and hot water draw.

  4. EECBG Success Story: Knox County Detention Facility Goes Solar for Heating Water

    Broader source: [DOE]

    Hot water demand soars at the six-building Knox County Detention Facility in Tennessee. It's open 24/7 with 1,036 inmate beds and 4,500 meals served daily—and don't forget the laundry. Learn more.

  5. Ductless Heat Pumps

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    & Events Expand News & Events Skip navigation links Residential Residential Lighting Energy Star Appliances Consumer Electronics Heat Pump Water Heaters Electric Storage Water...

  6. Geothermal Heat Pump Manufacturing Activities

    Gasoline and Diesel Fuel Update (EIA)

    3 Number of companies expecting to introduce new geothermal heat pump products in 2010 ARI-320 Water-Source Heat Pumps 10 ARI-325 Ground Water-Source Heat Pumps 13 ARI-330 Ground Source Closed-Loop Heat Pumps 11 ARI-870 Direct Geoexhange Heat Pumps 2 Other Non-ARI Rated 4 Non-Geothermal Heat Pump System Components - ARI-320 = Water-Source Heat Pumps. ARI-325 = Ground Water-Source Heat Pumps. ARI-330 = Ground Source Closed-Loop Heat Pumps. ARI-870 = Direct Geoexchange Heat Pumps. - = No data

  7. Bayonet heat exchangers in heat-assisted Stirling heat pump

    SciTech Connect (OSTI)

    Yagyu, S.; Fukuyama, Y.; Morikawa, T.; Isshiki, N.; Satoh, I.; Corey, J.; Fellows, C.


    The Multi-Temperature Heat Supply System is a research project creating a city energy system with lower environmental load. This system consists of a gas-fueled internal combustion engine and a heat-assisted Stirling heat pump utilizing shaft power and thermal power in a combination of several cylinders. The heat pump is mainly driven by engine shaft power and is partially assisted by thermal power from engine exhaust heat source. Since this heat pump is operated by proportioning the two energy sources to match the characteristics of the driving engine, the system is expected to produce cooling and heating water at high COP. This paper describes heat exchanger development in the project to develop a heat-assisted Stirling heat pump. The heat pump employs the Bayonet type heat exchangers (BHX Type I) for supplying cold and hot water and (BHX Type II) for absorbing exhaust heat from the driving engine. The heat exchanger design concepts are presented and their heat transfer and flow loss characteristics in oscillating gas flow are investigated. The main concern in the BHX Type I is an improvement of gas side heat transfer and the spirally finned tubes were applied to gas side of the heat exchanger. For the BHX Type II, internal heat transfer characteristics are the main concern. Shell-and-tube type heat exchangers are widely used in Stirling machines. However, since brazing is applied to the many tubes for their manufacturing processes, it is very difficult to change flow passages to optimize heat transfer and loss characteristics once they have been made. The challenge was to enhance heat transfer on the gas side to make a highly efficient heat exchanger with fewer parts. It is shown that the Bayonet type heat exchanger can have good performance comparable to conventional heat exchangers.

  8. The Stress Corrosion Crack Growth Rate of Alloy 600 Heat Affected Zones Exposed to High Purity Water

    SciTech Connect (OSTI)

    George A. Young; Nathan Lewis


    Grain boundary chromium carbides improve the resistance of nickel based alloys to primary water stress corrosion cracking (PWSCC). However, in weld heat affected zones (HAZ's), thermal cycles from fusion welding can solutionize beneficial grain boundary carbides, produce locally high residual stresses and strains, and promote PWSCC. The present research investigates the crack growth rate of an A600 HAZ as a function of test temperature. The A600 HAZ was fabricated by building up a gas-tungsten-arc-weld deposit of EN82H filler metal onto a mill-annealed A600 plate. Fracture mechanics based, stress corrosion crack growth rate testing was performed in high purity water between 600 F and 680 F at an initial stress intensity factor of 40 ksi {radical}in and at a constant electrochemical potential. The HAZ samples exhibited significant SCC, entirely within the HAZ at all temperatures tested. While the HAZ samples showed the same temperature dependence for SCC as the base material (HAZ: 29.8 {+-} 11.2{sub 95%} kcal/mol vs A600 Base: 35.3 {+-} 2.58{sub 95%} kcal/mol), the crack growth rates were {approx} 30X faster than the A600 base material tested at the same conditions. The increased crack growth rates of the HAZ is attributed to fewer intergranular chromium rich carbides and to increased plastic strain in the HAZ as compared to the unaffected base material.

  9. Building America Case study: Advanced Controls Improve Performance of Combination Space and Water Heating Systems, Minneapolis, Minnesota (Fact Sheet), Technology Solutions for New and Existing Homes, Energy Efficiency & Renewable Energy (EERE)

    Energy Savers [EERE]

    Controls Improve Performance of Combination Space- and Water-Heating Systems Minneapolis, Minnesota PROJECT INFORMATION Combined Space and Water Heating: Next Steps to Improved Performance Location: Minneapolis, MN Partners: University of Minnesota and The Energy Conservatory Center for Energy and Environment, NorthernSTAR Building America Partnership Building Component: Space conditioning and water heating Application: New and retrofit; single-family Year Tested: 2011-2014 Applicable

  10. Coal Markets

    U.S. Energy Information Administration (EIA) Indexed Site

    Coal Markets | Archive Coal Markets Weekly production Dollars per short ton Dollars per mmbtu Average weekly coal commodity spot prices dollars per short ton Week ending Week ago ...

  11. Marketing Resources

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Expand Utility Resources News & Events Expand News & Events Skip navigation links Marketing Resources Marketing Portal Reports, Publications, and Research Utility Toolkit...

  12. Pioneering Heat Pump Project

    Broader source: [DOE]

    Project objectives: To install and monitor an innovative WaterFurnace geothermal system that is technologically advanced and evolving; To generate hot water heating from a heat pump that uses non-ozone depleting refrigerant CO2. To demonstrate the energy efficiency of this system ground source heat pump system.

  13. Performance of a Heat Pump Water Heater in the Hot-Humid Climate, Windermere, Florida (Fact Sheet), Building America Case Study: Technology Solutions for New and Existing Homes, Building Technologies Office (BTO)

    Energy Savers [EERE]

    Performance of a Heat Pump Water Heater in the Hot-Humid Climate Windermere, Florida Over recent years, heat pump water heaters (HPWHs) have become more read- ily available and more widely adopted in the marketplace. A key feature of an HPWH unit is that it is a hybrid system. When conditions are favorable, the unit will operate in heat pump mode (using a vapor compression system that extracts heat from the surrounding air) to effciently provide domestic hot water (DHW). Homeowners need not

  14. Microsoft PowerPoint - mather_twpice_heating_newyork.ppt

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Manus Clear-Sky Heating Rates (Kday) Shortwave Longwave Net Ice Water Content + Liquid Water Content Radiative Heating Radiative heating profiles for the period January 26 -...

  15. Building America January 2015 Webinar: Multifamily Central Heat...

    Energy Savers [EERE]

    Davis Energy Group | DATE Multifamily Central Heat Pump Water Heating Elizabeth Weitzel ... 3 Davis Energy Group | DATE Why Heat Pump Water Heaters? * More than 40% of US ...

  16. Geothermal Heat Pump Manufacturing Activities - Energy Information...

    Gasoline and Diesel Fuel Update (EIA)

    ARI-320, Water-Source Heat Pumps (WSHP). These systems are installed in commercial buildings, where a central chiller or boiler supplies chilled or heated water, respectively, to ...

  17. GEOTHERMAL DISTRICT HEATING Dr. John W. Lund, PE Emeritus Director

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to a group of buildings, providing: *Space heating and cooling *Domestic hot water heating *Industrial process heat Could be a hybrid system augmented by: *Heat Pump to boost ...

  18. ,"Total District Heat Consumption (trillion Btu)",,,,,"District...

    U.S. Energy Information Administration (EIA) Indexed Site

    Heat Consumption (trillion Btu)",,,,,"District Heat Energy Intensity (thousand Btusquare foot)" ,"Total ","Space Heating","Water Heating","Cook- ing","Other","Total ","Space...

  19. List of Heat recovery Incentives | Open Energy Information

    Open Energy Info (EERE)

    Heat Solar Thermal Electric Solar Thermal Process Heat Solar Water Heat Energy Storage Nuclear Wind Heat recovery Fuel Cells using Renewable Fuels No Agricultural Energy Efficiency...

  20. 2009 Fuel Cell Market Report, November 2010

    SciTech Connect (OSTI)

    Not Available


    Fuel cells are electrochemical devices that combine hydrogen and oxygen to produce electricity, water, and heat. Unlike batteries, fuel cells continuously generate electricity, as long as a source of fuel is supplied. Moreover, fuel cells do not burn fuel, making the process quiet, pollution-free and two to three times more efficient than combustion. Fuel cell systems can be a truly zero-emission source of electricity, if the hydrogen is produced from non-polluting sources. Global concerns about climate change, energy security, and air pollution are driving demand for fuel cell technology. More than 630 companies and laboratories in the United States are investing $1 billion a year in fuel cells or fuel cell component technologies. This report provides an overview of trends in the fuel cell industry and markets, including product shipments, market development, and corporate performance. It also provides snapshots of select fuel cell companies, including general.

  1. Total Space Heat-

    Gasoline and Diesel Fuel Update (EIA)

    Survey: Energy End-Use Consumption Tables Total Space Heat- ing Cool- ing Venti- lation Water Heat- ing Light- ing Cook- ing Refrig- eration Office Equip- ment Com- puters Other...

  2. Technology Solutions Case Study: Air-To-Water Heat Pumps with Radiant Delivery in Low Load Homes, Tucson, Arizona and Chico, California

    SciTech Connect (OSTI)


    Space conditioning represents nearly 50% of average residential household energy consumption, highlighting the need to identify alternative cost-effective, energy-efficient cooling and heating strategies. As homes are better built, there is an increasing need for strategies that are particularly well suited for high performance, low load homes. ARBI researchers worked with two test homes in hot-dry climates to evaluate the in-situ performance of air-to-water heat pump (AWHP) systems, an energy efficient space conditioning solution designed to cost-effectively provide comfort in homes with efficient, safe, and durable operation. Both systems were fully instrumented and have been monitored over one year to capture complete performance data over the cooling and heating seasons. Results are used to quantify energy savings, cost-effectiveness, and system performance using different operating modes and strategies. This strategy is most effective in tight, insulated homes with high levels of thermal mass (i.e. exposed slab floors).

  3. HUD (Housing and Urban Development) Intermediate Minimum Property Standards Supplement 4930. 2 (1989 edition). Solar heating and domestic hot water systems

    SciTech Connect (OSTI)

    Not Available


    The Minimum Property Standards for Housing 4910.1 were developed to provide a sound technical basis for housing under numerous programs of the Department of Housing and Urban Development (HUD). These Intermediate Minimum Property Standards for Solar Heating and Domestic Hot Water Systems are intended to provide a companion technical basis for the planning and design of solar heating and domestic hot water systems. These standards have been prepared as a supplement to the Minimum Property Standards (MPS) and deal only with aspects of planning and design that are different from conventional housing by reason of the solar systems under consideration. The document contains requirements and standards applicable to one- and two-family dwellings, multifamily housing, and nursing homes and intermediate care facilities references made in the text to the MPS refer to the same section in the Minimum Property Standards for Housing 4910.1.

  4. Market Transformation

    SciTech Connect (OSTI)

    Not Available


    Summarizes the goals and activities of the DOE Solar Energy Technologies Program efforts within its market transformation subprogram.

  5. Estimating Costs and Efficiency of Storage, Demand, and Heat...

    Energy Savers [EERE]

    Costs and Efficiency of Storage, Demand, and Heat Pump Water Heaters Estimating Costs and Efficiency of Storage, Demand, and Heat Pump Water Heaters A water heater's energy ...

  6. Estimating Costs and Efficiency of Storage, Demand, and Heat...

    Energy Savers [EERE]

    Estimating Costs and Efficiency of Storage, Demand, and Heat Pump Water Heaters Estimating Costs and Efficiency of Storage, Demand, and Heat Pump Water Heaters A water heater's ...

  7. Estimating Costs and Efficiency of Storage, Demand, and Heat...

    Office of Environmental Management (EM)

    Estimating Costs and Efficiency of Storage, Demand, and Heat Pump Water Heaters Estimating Costs and Efficiency of Storage, Demand, and Heat Pump Water Heaters A water heater's...

  8. Combined Heat and Power

    Energy Savers [EERE]

    ... Energy and Water from Waste for the Food and Beverage ... Reciprocating Internal Combustion 223 Engine System for ... System for Combined Heat and Power 225 - Low-NOx ...

  9. Total Space Heat-

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    12 1 18 (*) 2 1 Q 6 Buildings without Cooling ... 30 1 (*) 4 (*) 14 (*) 4 (*) 1 6 Water-Heating Energy Source Electricity ... 402 21 57 42...

  10. Panel 3, PEM Electrolysis Technology R&D and Near-Term Market...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industrial Markets Power Plants Energy Markets capability Power Plants Heat Treating Semiconductors Laboratories Government Fueling Backup Power Renewable Energy Storage 2 Energy ...

  11. Experimental studies on heat transfer and friction factor characteristics of forced circulation solar water heater system fitted with helical twisted tapes

    SciTech Connect (OSTI)

    Jaisankar, S.; Radhakrishnan, T.K.; Sheeba, K.N.


    Experimental investigation of heat transfer, friction factor and thermal performance of twisted tape solar water heater with various twist ratios has been conducted and the results are compared with plain tube collector for the same operating conditions with Reynolds number varied from 3000 to 23,000. Experimental data from plain tube collector is validated with the fundamental equations and found that the discrepancy is less than {+-}5.35% and {+-}8.80% for Nusselt number and friction factor, respectively. Correlations have been developed for Nusselt number and friction factor with various twist ratios (Y = 3, 4, 5, 6) and are compared with the experimental values. Results conclude that, heat transfer and pressure drop are higher in twisted tape collector compared to the plain one. Among the various twist ratios, the minimum twist ratio 3 is found to enhance the heat transfer and pressure drop due to swirl generation. As the twist ratio increases, the swirl generation decreases and minimizes the heat transfer and friction factor. (author)

  12. Heat pipe array heat exchanger

    DOE Patents [OSTI]

    Reimann, Robert C.


    A heat pipe arrangement for exchanging heat between two different temperature fluids. The heat pipe arrangement is in a ounterflow relationship to increase the efficiency of the coupling of the heat from a heat source to a heat sink.

  13. Optimization of biological recycling of plant nutrients in livestock waste by utilizing waste heat from cooling water. Final report May 75-Sep 81

    SciTech Connect (OSTI)

    Maddox, J.J.; Behrends, L.L.; Burch, D.W.; Kingsley, J.B.; Waddell, E.L. Jr


    The report summarizes a 5-year study of the beneficial uses of waste heat from condenser cooling water from steam-electric generating plants. The major effort addressed the recovery of plant nutrients in swine manure by aquatic farming of selected fish and Chinese waterchestnuts. Another effort included biogas production from swine manure in an anaerobic digester and the use of the digester waste to fertilize the aquatic farming system. Optimum recovery of plant nutrients resulted from operation of an integrated fish and waterchestnut system. Flowing water systems were 30-50% more productive than static systems. Annual fish yields of 5000-7000 lb/acre are projected for a properly stocked system over a 150-180 day growing period. Similarly, waterchestnut yields of nearly 17.8 tons/acre and dry hay yields of 6.7 tons/acre from sand-bed filters would be expected when fed wastewater from the fish system. The quality of the water leaving the sand beds would meet tertiary wastewater treatment standards during the growing season. An estimated 2000-head swine facility with a $400,000 investment would annually produce a 20% rate of return, save 360,000 bbl of oil through waste heat utilization, and produce biogas equivalent to 3000 bbl of oil.

  14. Market Transformation

    SciTech Connect (OSTI)


    This Fuel Cell Technologies Program fact sheet outlines current status and challenges in the market transformation of hydrogen and fuel cell technologies.

  15. Market Acceleration

    SciTech Connect (OSTI)

    Solar Energy Technologies Program


    The fact sheet summarizes the goals and activities of the DOE Solar Energy Technologies Program efforts within its market acceleration subprogram.

  16. Energy Markets

    U.S. Energy Information Administration (EIA) Indexed Site

    will show a lower growth trajectory Source: EIA, International Energy Outlook 2013 carbon dioxide emissions billion metric tons 6 CSIS | Energy Markets Outlook November 16,...

  17. Market Transformation

    Fuel Cell Technologies Publication and Product Library (EERE)

    This Fuel Cell Technologies Program fact sheet outlines current status and challenges in the market transformation of hydrogen and fuel cell technologies.

  18. Initial Business Case Analysis of Two Integrated Heat Pump HVAC Systems for Near-Zero-Energy Homes -- Update to Include Analyses of an Economizer Option and Alternative Winter Water Heating Control Option

    SciTech Connect (OSTI)

    Baxter, Van D


    The long range strategic goal of the Department of Energy's Building Technologies (DOE/BT) Program is to create, by 2020, technologies and design approaches that enable the construction of net-zero energy homes at low incremental cost (DOE/BT 2005). A net zero energy home (NZEH) is a residential building with greatly reduced needs for energy through efficiency gains, with the balance of energy needs supplied by renewable technologies. While initially focused on new construction, these technologies and design approaches are intended to have application to buildings constructed before 2020 as well resulting in substantial reduction in energy use for all building types and ages. DOE/BT's Emerging Technologies (ET) team is working to support this strategic goal by identifying and developing advanced heating, ventilating, air-conditioning, and water heating (HVAC/WH) technology options applicable to NZEHs. Although the energy efficiency of heating, ventilating, and air-conditioning (HVAC) equipment has increased substantially in recent years, new approaches are needed to continue this trend. Dramatic efficiency improvements are necessary to enable progress toward the NZEH goals, and will require a radical rethinking of opportunities to improve system performance. The large reductions in HVAC energy consumption necessary to support the NZEH goals require a systems-oriented analysis approach that characterizes each element of energy consumption, identifies alternatives, and determines the most cost-effective combination of options. In particular, HVAC equipment must be developed that addresses the range of special needs of NZEH applications in the areas of reduced HVAC and water heating energy use, humidity control, ventilation, uniform comfort, and ease of zoning. In FY05 ORNL conducted an initial Stage 1 (Applied Research) scoping assessment of HVAC/WH systems options for future NZEHs to help DOE/BT identify and prioritize alternative approaches for further development. Eleven system concepts with central air distribution ducting and nine multi-zone systems were selected and their annual and peak demand performance estimated for five locations: Atlanta (mixed-humid), Houston (hot-humid), Phoenix (hot-dry), San Francisco (marine), and Chicago (cold). Performance was estimated by simulating the systems using the TRNSYS simulation engine (Solar Energy Laboratory et al. 2006) in two 1800-ft{sup 2} houses--a Building America (BA) benchmark house and a prototype NZEH taken from BEopt results at the take-off (or crossover) point (i.e., a house incorporating those design features such that further progress towards ZEH is through the addition of photovoltaic power sources, as determined by current BEopt analyses conducted by NREL). Results were summarized in a project report, HVAC Equipment Design options for Near-Zero-Energy Homes--A Stage 2 Scoping Assessment, ORNL/TM-2005/194 (Baxter 2005). The 2005 study report describes the HVAC options considered, the ranking criteria used, and the system rankings by priority. In 2006, the two top-ranked options from the 2005 study, air-source and ground-source versions of an integrated heat pump (IHP) system, were subjected to an initial business case study. The IHPs were subjected to a more rigorous hourly-based assessment of their performance potential compared to a baseline suite of equipment of legally minimum efficiency that provided the same heating, cooling, water heating, demand dehumidification, and ventilation services as the IHPs. Results were summarized in a project report, Initial Business Case Analysis of Two Integrated Heat Pump HVAC Systems for Near-Zero-Energy Homes, ORNL/TM-2006/130 (Baxter 2006). The present report is an update to that document. Its primary purpose is to summarize results of an analysis of the potential of adding an outdoor air economizer operating mode to the IHPs to take advantage of free cooling (using outdoor air to cool the house) whenever possible. In addition it provides some additional detail for an alternative winter water heating/space heating (WH/SH) control strategy briefly described in the original report and corrects some minor errors.

  19. Pacific Northwest National Laboratory Technology Marketing Summaries...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Technologies Solar Thermal Startup America Find ... approach to converting solar energy, water, and CO2 into small ... power demand for heating hot water to non-peak power ...

  20. 2014-12-22 Issuance: Alternative Efficiency Determination Methods, Basic Model Definition, and Compliance for Commercial HVAC, Refrigeration, and Water Heating Equipment; Final Rule

    Broader source: [DOE]

    This document is a pre-publication Federal Register final rule regarding alternative efficiency determination methods, basic model definition, and compliance for commercial HVAC, refrigeration, and water heating equipment , as issued by the Deputy Assistant Secretary for Energy Efficiency on December 22, 2014. Though it is not intended or expected, should any discrepancy occur between the document posted here and the document published in the Federal Register, the Federal Register publication controls. This document is being made available through the Internet solely as a means to facilitate the public's access to this document.

  1. Housing standards: change to HUD 4930. 2 Intermediate Minimum Property Standard (IMPS) supplement for solar heating and domestic hot water systems

    SciTech Connect (OSTI)

    Not Available


    This rule is made to provide an updating, clarification, and improvement of requirements contained in HUD Handbook 4930.2, Intermediate Minimum Property Standards (IMPS) Supplement concerning solar heating and domestic hot water systems. Changes pertain to fire protection, penetration, roof covering, conditions of use, thermal stability, rain resistance, ultraviolet stability, and compatibility with transfer medium. Additional changes cover applicable standards, labeling, flash point, chemical and physical commpatibility, flame spread classification, lightening protection, and parts of a solar energy system. Altogether, there are over 50 changes, some of which apply to tables and worksheets. Footnotes are included.

  2. Water Infrastructure Security

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Water Heating Products and Services Water Heating Products and Services Choosing an efficient water heater will help you save money and Energy. | Photo Credit Energy Department Choosing an efficient water heater will help you save money and Energy. | Photo Credit Energy Department Use the following links to get product information and locate professional services for water heating. Product Information Solar Pool Heating Systems Florida Solar Energy Center Listing of solar pool heating systems

  3. Marketing and Market Transformation | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Market Transformation Marketing and Market Transformation Presents how going green will grow your business, as well as how programs can overcome appraisal challenges. PDF icon Marketing and Market Transformation Presentation More Documents & Publications Marketing and Market Transformation Working with the Real Estate Sector Trends in Real Estate and Energy Efficiency

  4. Revisions included in HUD Intermediate Minimum Property Standards Supplement 4930. 2, 1977 edition: solar heating and domestic hot-water systems

    SciTech Connect (OSTI)

    Not Available


    This addendum to a 1977 HUD publication contains revisions and additions to the existing intermediate minimum property standards supplment for solar heating and cooling systems. Building design revisions cover fire protection, penetrations, and roof coverings. Changes to guidelines for materials, such as those for thermal and ultraviolet stability and moisture resistance, are detailed. Flash points of toxic and combustive fluids, chemical and physical compatibility, and flame spread and resistance of insulation materials are also explained. Construction standards were revised for hail loads; waterproofing insulated exterior storage containers, pipes, and ducts; and for passive systems. Standards also were revised for power-operated protection, dust and dirt prevention, and chimney and vent heights. Radiation temperature, draft control, and thermal energy storage and loss standards were deleted. Other standards for insulation values for thermal devices, lighting protection, and sealing and testing air distribution systems were added. Appended materials contain revisions to calculation procedures for determining the thermal performance of active, solar space heating, and domestic hot water systems. A revised materials list for properties of typical cover materials, absorptive coatings, thermal storage unit containers, and heat-transfer liquids is provided. Revisions to acceptable engineering practice standards are also included.

  5. State of Washington Clean Energy Opportunity: Technical Market Potential

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    for CHP, August 2010 | Department of Energy of Washington Clean Energy Opportunity: Technical Market Potential for CHP, August 2010 State of Washington Clean Energy Opportunity: Technical Market Potential for CHP, August 2010 The State of Washington has significant clean energy technical market potential including clean heat and power (CHP)/cogeneration, waste heat recovery for power and heat, and district energy. This brief white paper by the Northwest Clean Energy Application Center (NW

  6. Transition Helmholtz free energy, entropy, and heat capacity of free-standing smectic films in water: A mean-field treatment

    SciTech Connect (OSTI)

    Śliwa, Izabela; Zakharov, A. V.


    Using the extended McMillan's mean field approach with anisotropic forces a study of both the structural and thermodynamic properties of free-standing smectic film (FSSF) in water on heating to the isotropic temperature is carried out numerically. By solving the self-consistent nonlinear equations for the order parameters, we obtained that the smectic-A-isotropic (AI) transition occurs through the series of layer-thinning transitions causing the films to thin in the stepwise manner as the temperature is increased above the bulk smectic-A-isotropic temperature T{sub AI}(bulk). With enhanced pair interactions in the bounding layers, the smectic-isotropic transition corresponds to smectic melting of the central layers. The effects of surface “enhanced” pair interactions in the bounding layers and of film thickness on the orientational and translational order parameters, the Helmholtz free energy and entropy, as well as the temperature dependence of the heat capacity of FSSFs, have also been investigated. Reasonable agreement between the theoretically predicted and the experimentally obtained – by means of optical microscopy and ellipsometry techniques – data of the temperature when the thin decylcyanobiphenyl smectic film immersing in water ruptures has been obtained.

  7. 2008 Fuel Cell Technologies Market Report

    SciTech Connect (OSTI)

    Vincent, B.


    Fuel cells are electrochemical devices that combine hydrogen and oxygen to produce electricity, water, and heat. Unlike batteries, fuel cells continuously generate electricity, as long as a source of fuel is supplied. Moreover, fuel cells do not burn fuel, making the process quiet, pollution-free and two to three times more efficient than combustion. Fuel cell systems can be a truly zero-emission source of electricity, if the hydrogen is produced from non-polluting sources. Global concerns about climate change, energy security, and air pollution are driving demand for fuel cell technology. More than 630 companies and laboratories in the United States are investing $1 billion a year in fuel cells or fuel cell component technologies. This report provides an overview of trends in the fuel cell industry and markets, including product shipments, market development, and corporate performance. It also provides snapshots of select fuel cell companies, including general business strategy and market focus, as well as, financial information for select publicly-traded companies.

  8. 2008 Fuel Cell Technologies Market Report

    SciTech Connect (OSTI)



    Fuel cells are electrochemical devices that combine hydrogen and oxygen to produce electricity, water, and heat. Unlike batteries, fuel cells continuously generate electricity, as long as a source of fuel is supplied. Moreover, fuel cells do not burn fuel, making the process quiet, pollution-free and two to three times more efficient than combustion. Fuel cell systems can be a truly zero-emission source of electricity, if the hydrogen is produced from non-polluting sources. Global concerns about climate change, energy security, and air pollution are driving demand for fuel cell technology. More than 630 companies and laboratories in the United States are investing $1 billion a year in fuel cells or fuel cell component technologies. This report provides an overview of trends in the fuel cell industry and markets, including product shipments, market development, and corporate performance. It also provides snapshots of select fuel cell companies, including general business strategy and market focus, as well as, financial information for select publicly-traded companies.

  9. Potential Applications for Nuclear Energy besides Electricity Generation: AREVA Global Perspective of HTR Potential Market

    SciTech Connect (OSTI)

    Soutworth, Finis; Gauthier, Jean-Claude; Lecomte, Michel; Carre, Franck


    Energy supply is increasingly showing up as a major issue for electricity supply, transportation, settlement, and process heat industrial supply including hydrogen production. Nuclear power is part of the solution. For electricity supply, as exemplified in Finland and France, the EPR brings an immediate answer; HTR could bring another solution in some specific cases. For other supply, mostly heat, the HTR brings a solution inaccessible to conventional nuclear power plants for very high or even high temperature. As fossil fuels costs increase and efforts to avoid generation of Greenhouse gases are implemented, a market for nuclear generated process heat will develop. Following active developments in the 80's, HTR have been put on the back burner up to 5 years ago. Light water reactors are widely dominating the nuclear production field today. However, interest in the HTR technology was renewed in the past few years. Several commercial projects are actively promoted, most of them aiming at electricity production. ANTARES is today AREVA's response to the cogeneration market. It distinguishes itself from other concepts with its indirect cycle design powering a combined cycle power plant. Several reasons support this design choice, one of the most important of which is the design flexibility to adapt readily to combined heat and power applications. From the start, AREVA made the choice of such flexibility with the belief that the HTR market is not so much in competition with LWR in the sole electricity market but in the specific added value market of cogeneration and process heat. In view of the volatility of the costs of fossil fuels, AREVA's choice brings to the large industrial heat applications the fuel cost predictability of nuclear fuel with the efficiency of a high temperature heat source free of greenhouse gases emissions. The ANTARES module produces 600 MWth which can be split into the required process heat, the remaining power drives an adapted prorated electric plant. Depending on the process heat temperature and power needs, up to 80 % of the nuclear heat is converted into useful power. An important feature of the design is the standardization of the heat source, as independent as possible of the process heat application. This should expedite licensing. The essential conditions for success include: 1. Timely adapted licensing process and regulations, codes and standards for such application and design; 2. An industry oriented R and D program to meet the technological challenges making the best use of the international collaboration. Gen IV could be the vector; 3. Identification of an end user (or a consortium of) willing to fund a FOAK. (authors)


    SciTech Connect (OSTI)

    Chad Bowers; Michael Petersen; Stefan Elbel; Pega Hrnjak


    Although heat pump water heaters are today widely accepted in Japan, where energy costs are high and government incentives for their use exist, acceptance of such a product in the U.S. has been slow. This trend is slowly changing with the introduction of heat pump water heaters into the residential market, but remains in the commercial sector. Barriers to heat pump water heater acceptance in the commercial market have historically been performance, reliability and first/operating costs. The use of carbon dioxide (R744) as the refrigerant in such a system can improve performance for relatively small increase in initial cost and make this technology more appealing. What makes R744 an excellent candidate for use in heat pump water heaters is not only the wide range of ambient temperatures within which it can operate, but also the excellent ability to match water to refrigerant temperatures on the high side, resulting in very high exit water temperatures of up to 82?ºC, as required by sanitary codes in the U.S. (Food Code, 2005), in a single pass, temperatures that are much more difficult to reach with other refrigerants. This can be especially attractive in applications where this water is used for the purpose of sanitation. While reliability has also been of concern historically, dramatic improvements have been made over the last several years through research done in the automotive industry and commercialization of R744 technology in residential water heating mainly in Japan. This paper presents the performance results from the development of an R744 commercial heat pump water heater of approximately 35 kW and a comparison to a baseline R134a unit of the same capacity and footprint. In addition, recommendations are made for further improvements of the R744 system which could result in possible energy savings of up to 20 %.

  11. Incorporate Minimum Efficiency Requirements for Heating and Cooling...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FEMP-designated and ENERGY STAR-qualified heating, ventilating, and air conditioning (HVAC) and water heating products into tables that mirror American Society of Heating, ...

  12. Cedarville School District Retrofit of Heating and Cooling Systems...

    Energy Savers [EERE]

    Cedarville School District Retrofit of Heating and Cooling Systems with Geothermal Heat Pumpsand Ground Source Water Loops Cedarville School District Retrofit of Heating and...

  13. Recover Heat from Boiler Blowdown, Energy Tips: STEAM, Steam...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    0 Recover Heat from Boiler Blowdown Heat can be recovered from boiler blowdown by using a heat exchanger to preheat boiler makeup water. Any boiler with continuous blowdown ...

  14. State of Washington Clean Energy Opportunity: Technical Market...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    New Release -- U.S. DOE Analysis: Combined Heat and Power (CHP) Technical Potential in the United States Opportunities for CHP at Wastewater Treatment Facilities: Market Analysis ...

  15. Air-To-Water Heat Pumps with Radiant Delivery in Low Load Homes, Tucson, Arizona and Chico, California (Fact Sheet), Building America Case Study: Technology Solutions for New and Existing Homes, Building Technologies Office (BTO)

    Energy Savers [EERE]

    Air-to-Water Heat Pumps With Radiant Delivery in Low Load Homes Tucson, Arizona and Chico, California PROJECT INFORMATION Project Name: Field testing of air-to-water heat pump Location: Tucson, AZ and Chico, CA Partners: La Mirada Homes Chico Green Builders Daikin ARBI Building Component: HVAC, domestic hot water Application: New, single family Year Tested: 2011-2012 Applicable Climate Zones: Hot-dry, cold PERFORMANCE DATA Cost

  16. Active Solar Heating | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Heat & Cool » Home Heating Systems » Active Solar Heating Active Solar Heating This North Carolina home gets most of its space heating from the passive solar design, but the solar thermal system supplies both domestic hot water and a secondary radiant floor heating system. | Photo courtesy of Jim Schmid Photography, NREL This North Carolina home gets most of its space heating from the passive solar design, but the solar thermal system supplies both domestic hot water and a secondary

  17. Active Solar Heating | Department of Energy

    Energy Savers [EERE]

    Home Heating Systems » Active Solar Heating Active Solar Heating This North Carolina home gets most of its space heating from the passive solar design, but the solar thermal system supplies both domestic hot water and a secondary radiant floor heating system. | Photo courtesy of Jim Schmid Photography, NREL This North Carolina home gets most of its space heating from the passive solar design, but the solar thermal system supplies both domestic hot water and a secondary radiant floor heating

  18. Heat pipe device and heat pipe fabricating process

    SciTech Connect (OSTI)

    Busch, C.H.


    An energy saving liquid to liquid heat exchanger for a dishwasher or like device discharging hot waste water comprising a hot water tank for holding the waste water from the dishwasher and having inlet and outlet pipes, a cold water tank for holding the fresh water going to a water heater and having inlet and outlet pipes, the cold water tank disposed on top of the hot water tank, a bundle of heat pipes containing low boiling refrigerant disposed inside of the two tanks so as to extract heat from the hot water tank and give it up to the cold water tank, whereby the temperature of the fresh water leaving the heat exchanger is higher than its entering temperature.

  19. Market Studies

    Broader source: [DOE]

    This page contains links to lighting market characterization studies published by the U.S. Department of Energy, plus information on current studies under way. These studies are intended to present...

  20. Energy Markets

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Markets November 16, 2015 0 2 4 6 8 10 1990 1994 1998 2002 2006 2010 2014 biofuels geothermal solar wind waste hydroelectric wood 0 2 4 6 8 10 1990 1994 1998 2002 2006 2010...

  1. Energy Markets

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Markets October 22, 2015 0 2 4 6 8 10 1990 1994 1998 2002 2006 2010 2014 biofuels geothermal solar wind waste hydroelectric wood 0 2 4 6 8 10 1990 1994 1998 2002 2006 2010...

  2. Energy Markets

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Markets October 29, 2015 0 2 4 6 8 10 1990 1994 1998 2002 2006 2010 2014 biofuels geothermal solar wind waste hydroelectric wood 0 2 4 6 8 10 1990 1994 1998 2002 2006 2010...

  3. Total Space Heating Water Heating Cook-

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    (million gallons) Fuel Oil Energy Intensity (gallonssquare foot) Energy-Related Space Functions (more than one may apply) Commercial Food Preparation.... 860 720 87 Q 41...

  4. Total Space Heating Water Heating Cook-

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Activity Education ... 342 322 11 Q Q 0.18 0.17 0.01 Q (*) Food Sales ... Q Q Q Q Q Q Q Q Q Q Food Service...

  5. Heat rejection system

    DOE Patents [OSTI]

    Smith, Gregory C.; Tokarz, Richard D.; Parry, Jr., Harvey L.; Braun, Daniel J.


    A cooling system for rejecting waste heat consists of a cooling tower incorporating a plurality of coolant tubes provided with cooling fins and each having a plurality of cooling channels therein, means for directing a heat exchange fluid from the power plant through less than the total number of cooling channels to cool the heat exchange fluid under normal ambient temperature conditions, means for directing water through the remaining cooling channels whenever the ambient temperature rises above the temperature at which dry cooling of the heat exchange fluid is sufficient and means for cooling the water.

  6. Field Testing of Pre-Production Prototype Residential Heat Pump...

    Energy Savers [EERE]

    Field Testing of Pre-Production Prototype Residential Heat Pump Water Heaters Field Testing of Pre-Production Prototype Residential Heat Pump Water Heaters Provides and overview of ...

  7. Geothermal District Heating Economics

    Energy Science and Technology Software Center (OSTI)


    GEOCITY is a large-scale simulation model which combines both engineering and economic submodels to systematically calculate the cost of geothermal district heating systems for space heating, hot-water heating, and process heating based upon hydrothermal geothermal resources. The GEOCITY program simulates the entire production, distribution, and waste disposal process for geothermal district heating systems, but does not include the cost of radiators, convectors, or other in-house heating systems. GEOCITY calculates the cost of district heating basedmore » on the climate, population, and heat demand of the district; characteristics of the geothermal resource and distance from the distribution center; well-drilling costs; design of the distribution system; tax rates; and financial conditions.« less

  8. System-Level Heat Transfer Analysis, Thermal- Mechanical Cyclic Stress Analysis, and Environmental Fatigue Modeling of a Two-Loop Pressurized Water Reactor. A Preliminary Study

    SciTech Connect (OSTI)

    Mohanty, Subhasish; Soppet, William; Majumdar, Saurin; Natesan, Ken


    This report provides an update on an assessment of environmentally assisted fatigue for light water reactor components under extended service conditions. This report is a deliverable in April 2015 under the work package for environmentally assisted fatigue under DOE's Light Water Reactor Sustainability program. In this report, updates are discussed related to a system level preliminary finite element model of a two-loop pressurized water reactor (PWR). Based on this model, system-level heat transfer analysis and subsequent thermal-mechanical stress analysis were performed for typical design-basis thermal-mechanical fatigue cycles. The in-air fatigue lives of components, such as the hot and cold legs, were estimated on the basis of stress analysis results, ASME in-air fatigue life estimation criteria, and fatigue design curves. Furthermore, environmental correction factors and associated PWR environment fatigue lives for the hot and cold legs were estimated by using estimated stress and strain histories and the approach described in NUREG-6909. The discussed models and results are very preliminary. Further advancement of the discussed model is required for more accurate life prediction of reactor components. This report only presents the work related to finite element modelling activities. However, in between multiple tensile and fatigue tests were conducted. The related experimental results will be presented in the year-end report.

  9. Water Cooling | Open Energy Information

    Open Energy Info (EERE)

    Water Cooling Jump to: navigation, search Dictionary.png Water Cooling: Water cooling is commonly defined as a method of using water as a heat conduction to remove heat from an...

  10. Geothermal Heat Pumps are Scoring High Marks

    SciTech Connect (OSTI)


    Geothermal Energy Program Office of Geothermal and Wind Technologies Geothermal Heat Pumps are Scoring High Marks Geothermal heat pumps, one of the clean energy technology stars Geothermal heat pumps (GHPs) are one of the most cost-effective heating, cooling, and water heating systems available for both residential and commercial buildings. GHPs extract heat from the ground during the heating season and discharge waste heat to the ground during the cooling season. The U.S. Environmental Protecti

  11. Geothermal Heat Pump Benchmarking Report

    SciTech Connect (OSTI)


    A benchmarking study was conducted on behalf of the Department of Energy to determine the critical factors in successful utility geothermal heat pump programs. A Successful program is one that has achieved significant market penetration. Successfully marketing geothermal heat pumps has presented some major challenges to the utility industry. However, select utilities have developed programs that generate significant GHP sales. This benchmarking study concludes that there are three factors critical to the success of utility GHP marking programs: (1) Top management marketing commitment; (2) An understanding of the fundamentals of marketing and business development; and (3) An aggressive competitive posture. To generate significant GHP sales, competitive market forces must by used. However, because utilities have functioned only in a regulated arena, these companies and their leaders are unschooled in competitive business practices. Therefore, a lack of experience coupled with an intrinsically non-competitive culture yields an industry environment that impedes the generation of significant GHP sales in many, but not all, utilities.

  12. Tritium generation and large excess heat evolution by electrolysis in light and heavy water-potassium carbonate solutions with nickel electrodes

    SciTech Connect (OSTI)

    Notoya, Reiko; Noya, Yohichi; Ohnishi, Toshiyuki


    The generation of tritium was quantitatively measured in an electrolytic cell with a nickel cathode and a platinum anode in potassium carbonate-light and heavy water solutions. Simultaneously, the evolution of a large amount of excess heat (70 to 170{degrees} for the input power) was observed during electrolysis of these solutions. The tritium generation by electrolysis provides some of the most conclusive evidence for so-called cold fusion, along with the calcium generation described in a previous paper. On the basis of the current experiments and the knowledge of the knetics of a hydrogen evolution reaction in an alkaline solution, the nuclear reactions taking place are worth mentioning. 11 refs., 1 fig., 2 tabs.

  13. Value impact analysis of Generic Issue 143, Availability of Heating, Ventilation, Air Conditioning (HVAC) and Chilled Water Systems

    SciTech Connect (OSTI)

    Daling, P.M.; Marler, J.E.; Vo, T.V.; Phan, H.; Friley, J.R.


    This study evaluates the values (benefits) and impacts (costs) associated with potential resolutions to Generic Issue 143, ``Availability of HVAC and Chilled Water Systems.`` The study identifies vulnerabilities related to failures of HVAC, chilled water, and room cooling systems; develops estimates of room heatup rates and safety-related equipment vulnerabilities following losses of HVAC/room cooler systems; develops estimates of the core damage frequencies and public risks associated with failures of these systems; develops three proposed resolution strategies to this generic issue; and performs a value/impact analysis of the proposed resolutions. Existing probabilistic risk assessments for four representative plants, including one plant from each vendor, form the basis for the core damage frequency and public risk calculations. Both internal and external events were considered. It was concluded that all three proposed resolution strategies exceed the $1,000/person-rem cost-effectiveness ratio. Additional evaluations were performed to develop ``generic`` insights on potential design-related and configuration-related vulnerabilities and potential high-frequency ({approximately}1E-04/RY) accident sequences that involve failures of HVAC/room cooling functions. It was concluded that, although high-frequency accident sequences may exist at some plants, these high-frequency sequences are plant-specific in nature or have been resolved through hardware and/or operational changes. The plant-specific Individual Plant Examinations are an effective vehicle for identification and resolution of these plant-specific anomalies and hardware configurations.

  14. Geothermal Heat Pump Manufacturing Activities

    Gasoline and Diesel Fuel Update (EIA)

    4 Average heating efficiency for geothermal heat pump shipments, 2008 and 2009 (average coefficient of performance) ARI-320 ARI-325/330 ARI-870 Other Non-ARI Rated 2008 4.4 4.0 4.2 3.6 2009 3.9 4.1 4.3 3.8 ARI-320 = Water-Source Heat Pumps. ARI-325 = Ground Water-Source Heat Pumps. ARI-330 = Ground Source Closed-Loop Heat Pumps. ARI-870 = Direct Geoexchange Heat Pumps. Year Model Type Notes: One ton of capacity is equal to 12,000 Btus per hour. Efficiency is expressed as btus of output per

  15. Future Heating | Open Energy Information

    Open Energy Info (EERE)

    London, England, United Kingdom Sector: Solar Product: Designs and installs solar passive water heating systems. Coordinates: 51.506325, -0.127144 Show Map Loading map......

  16. Webinar: ENERGY STAR Hot Water Systems for High Performance Homes...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2011 providing informationprovide information about how to achieve energy savings from solar water heating, electric dedicated heat pump water heating, and gas tankless systems. ...

  17. Heat Distribution Systems | Department of Energy

    Energy Savers [EERE]

    Home Heating Systems » Heat Distribution Systems Heat Distribution Systems Radiators are used in steam and hot water heating. | Photo courtesy of ©iStockphoto/Jot Radiators are used in steam and hot water heating. | Photo courtesy of ©iStockphoto/Jot Heat is distributed through your home in a variety of ways. Forced-air systems use ducts that can also be used for central air conditioning and heat pump systems. Radiant heating systems also have unique heat distribution systems. That leaves

  18. Heat Distribution Systems | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    & Cool » Home Heating Systems » Heat Distribution Systems Heat Distribution Systems Radiators are used in steam and hot water heating. | Photo courtesy of ©iStockphoto/Jot Radiators are used in steam and hot water heating. | Photo courtesy of ©iStockphoto/Jot Heat is distributed through your home in a variety of ways. Forced-air systems use ducts that can also be used for central air conditioning and heat pump systems. Radiant heating systems also have unique heat distribution systems.

  19. Opportunities for CHP at Wastewater Treatment Facilities: Market Analysis and Lessons from the Field, U.S. EPA, October 2011

    Office of Energy Efficiency and Renewable Energy (EERE)

    Opportunities for Combined Heat and Power at Wastewater Treatment Facilities: Market Analysis and Lessons from the Field

  20. Petroleum Marketing Annual Archives

    U.S. Energy Information Administration (EIA) Indexed Site

    Petrolem Reports Petroleum Marketing Annual Archives The Petroleum Marketing Annual was discontinued in 2010. Choose the year from the archive Petroleum Marketing Annual you wish...

  1. Energy Imbalance Market Update

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    in CAISO Market Jim Price, Senior Advisor, Market Development & Analysis California ISO CAISO Public Market minimizes bid costs, while accounting for multiple transmission...

  2. 2009 Fuel Cell Market Report

    Fuel Cell Technologies Publication and Product Library (EERE)

    Fuel cells are electrochemical devices that combine hydrogen and oxygen to produce electricity, water, and heat. Unlike batteries, fuel cells continuously generate electricity, as long as a source of

  3. New configurations of a heat recovery absorption heat pump integrated with a natural gas boiler for boiler efficiency improvement

    SciTech Connect (OSTI)

    Qu, Ming; Abdelaziz, Omar; Yin, Hongxi


    Conventional natural gas-fired boilers exhaust flue gas direct to the atmosphere at 150 200 C, which, at such temperatures, contains large amount of energy and results in relatively low thermal efficiency ranging from 70% to 80%. Although condensing boilers for recovering the heat in the flue gas have been developed over the past 40 years, their present market share is still less than 25%. The major reason for this relatively slow acceptance is the limited improvement in the thermal efficiency of condensing boilers. In the condensing boiler, the temperature of the hot water return at the range of 50 60 C, which is used to cool the flue gas, is very close to the dew point of the water vapor in the flue gas. Therefore, the latent heat, the majority of the waste heat in the flue gas, which is contained in the water vapor, cannot be recovered. This paper presents a new approach to improve boiler thermal efficiency by integrating absorption heat pumps with natural gas boilers for waste heat recovery (HRAHP). Three configurations of HRAHPs are introduced and discussed. The three configurations are modeled in detail to illustrate the significant thermal efficiency improvement they attain. Further, for conceptual proof and validation, an existing hot water-driven absorption chiller is operated as a heat pump at operating conditions similar to one of the devised configurations. An overall system performance and economic analysis are provided for decision-making and as evidence of the potential benefits. These three configurations of HRAHP provide a pathway to achieving realistic high-efficiency natural gas boilers for applications with process fluid return temperatures higher than or close to the dew point of the water vapor in the flue gas.

  4. Wastewater heat recovery apparatus

    DOE Patents [OSTI]

    Kronberg, James W.


    A heat recovery system with a heat exchanger and a mixing valve. A drain trap includes a heat exchanger with an inner coiled tube, baffle plate, wastewater inlet, wastewater outlet, cold water inlet, and preheated water outlet. Wastewater enters the drain trap through the wastewater inlet, is slowed and spread by the baffle plate, and passes downward to the wastewater outlet. Cold water enters the inner tube through the cold water inlet and flows generally upward, taking on heat from the wastewater. This preheated water is fed to the mixing valve, which includes a flexible yoke to which are attached an adjustable steel rod, two stationary zinc rods, and a pivoting arm. The free end of the arm forms a pad which rests against a valve seat. The rods and pivoting arm expand or contract as the temperature of the incoming preheated water changes. The zinc rods expand more than the steel rod, flexing the yoke and rotating the pivoting arm. The pad moves towards the valve seat as the temperature of the preheated water rises, and away as the temperature falls, admitting a variable amount of hot water to maintain a nearly constant average process water temperature.

  5. Wastewater heat recovery apparatus

    DOE Patents [OSTI]

    Kronberg, J.W.


    A heat recovery system is described with a heat exchanger and a mixing valve. A drain trap includes a heat exchanger with an inner coiled tube, baffle plate, wastewater inlet, wastewater outlet, cold water inlet, and preheated water outlet. Wastewater enters the drain trap through the wastewater inlet, is slowed and spread by the baffle plate, and passes downward to the wastewater outlet. Cold water enters the inner tube through the cold water inlet and flows generally upward, taking on heat from the wastewater. This preheated water is fed to the mixing valve, which includes a flexible yoke to which are attached an adjustable steel rod, two stationary zinc rods, and a pivoting arm. The free end of the arm forms a pad which rests against a valve seat. The rods and pivoting arm expand or contract as the temperature of the incoming preheated water changes. The zinc rods expand more than the steel rod, flexing the yoke and rotating the pivoting arm. The pad moves towards the valve seat as the temperature of the preheated water rises, and away as the temperature falls, admitting a variable amount of hot water to maintain a nearly constant average process water temperature. 6 figs.

  6. Selecting a New Water Heater | Department of Energy

    Broader source: (indexed) [DOE]

    or demand-type water heaters heat water directly without the use of a storage tank Heat pump water heaters move heat from one place to another instead of generating heat...

  7. Technology Solutions Case Study: Foundation Heat Exchanger, Oak Ridge, Tennessee

    SciTech Connect (OSTI)


    The foundation heat exchanger, developed by Oak Ridge National Laboratory, is a new concept for a cost-effective horizontal ground heat exchanger that can be connected to water-to-water or water-to-air heat pump systems for space conditioning as well as domestic water heating.

  8. Fast reactor power plant design having heat pipe heat exchanger

    DOE Patents [OSTI]

    Huebotter, P.R.; McLennan, G.A.


    The invention relates to a pool-type fission reactor power plant design having a reactor vessel containing a primary coolant (such as liquid sodium), and a steam expansion device powered by a pressurized water/steam coolant system. Heat pipe means are disposed between the primary and water coolants to complete the heat transfer therebetween. The heat pipes are vertically oriented, penetrating the reactor deck and being directly submerged in the primary coolant. A U-tube or line passes through each heat pipe, extended over most of the length of the heat pipe and having its walls spaced from but closely proximate to and generally facing the surrounding walls of the heat pipe. The water/steam coolant loop includes each U-tube and the steam expansion device. A heat transfer medium (such as mercury) fills each of the heat pipes. The thermal energy from the primary coolant is transferred to the water coolant by isothermal evaporation-condensation of the heat transfer medium between the heat pipe and U-tube walls, the heat transfer medium moving within the heat pipe primarily transversely between these walls.

  9. Fast reactor power plant design having heat pipe heat exchanger

    DOE Patents [OSTI]

    Huebotter, Paul R.; McLennan, George A.


    The invention relates to a pool-type fission reactor power plant design having a reactor vessel containing a primary coolant (such as liquid sodium), and a steam expansion device powered by a pressurized water/steam coolant system. Heat pipe means are disposed between the primary and water coolants to complete the heat transfer therebetween. The heat pipes are vertically oriented, penetrating the reactor deck and being directly submerged in the primary coolant. A U-tube or line passes through each heat pipe, extended over most of the length of the heat pipe and having its walls spaced from but closely proximate to and generally facing the surrounding walls of the heat pipe. The water/steam coolant loop includes each U-tube and the steam expansion device. A heat transfer medium (such as mercury) fills each of the heat pipes. The thermal energy from the primary coolant is transferred to the water coolant by isothermal evaporation-condensation of the heat transfer medium between the heat pipe and U-tube walls, the heat transfer medium moving within the heat pipe primarily transversely between these walls.

  10. Marketing and Market Transformation | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Marketing and Market Transformation Presents how going green will grow your business, as ... Working with the Real Estate Sector Trends in Real Estate and Energy Efficiency

  11. Combined Heat and Power Webinar | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Combined Heat and Power Webinar PDF icon 06092010CHP.pdf More Documents & Publications CHP: Connecting the Gap between Markets and Utility Interconnection and Tariff Practices, ...

  12. Electric Storage Water Heaters

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    & Events Expand News & Events Skip navigation links Residential Residential Lighting Energy Star Appliances Consumer Electronics Heat Pump Water Heaters Electric Storage Water...

  13. Market Transformation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering ...

  14. Energy 101: Geothermal Heat Pumps

    ScienceCinema (OSTI)



    An energy-efficient heating and cooling alternative, the geothermal heat pump system moves heat from the ground to a building (or from a building to the ground) through a series of flexible pipe "loops" containing water. This edition of Energy 101 explores the benefits Geothermal and the science behind how it all comes together.

  15. Preliminary business plan: Plzen district heating system upgrade

    SciTech Connect (OSTI)


    The district heating system of the City of Plzen, Czech Republic, needs to have physical upgrades to replace aging equipment and to comply with upcoming environmental regulations. Also, its ownership and management are being changed as a result of privatization. As majority owner, the City has the primary goal of ensuring that the heating needs of its customers are met as reliably and cost-effectively as possible. This preliminary business plan is part of the detailed analysis (5 reports in all) done to assist the City in deciding the issues. Preparation included investigation of ownership, management, and technology alternatives; estimation of market value of assets and investment requirements; and forecasting of future cash flow. The district heating system consists of the Central Plzen cogeneration plant, two interconnected heating plants [one supplying both hot water and steam], three satellite heating plants, and cooperative agreements with three industrial facilities generating steam and hot water. Most of the plants are coal-fired, with some peaking units fired by fuel oil.

  16. Geothermal Heat Pump Manufacturing Activities

    Gasoline and Diesel Fuel Update (EIA)

    3 Average cooling efficiency for geothermal heat pump shipments, 2008 and 2009 (average energy efficiency ratio) ARI-320 ARI-325/330 ARI-870 Other Non-ARI Rated 2008 13.1 19.5 17.5 13.5 2009 14.6 20.4 18.2 14.3 ARI-320 = Water-Source Heat Pumps. ARI-325 = Ground Water-Source Heat Pumps. ARI-330 = Ground Source Closed-Loop Heat Pumps. ARI-870 = Direct Geoexchange Heat Pumps. Year Model Type Notes: One ton of capacity is equal to 12,000 Btus per hour. Efficiency is expressed as btus of output per

  17. Early Markets: Fuel Cells for Backup Power

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Backup Power Overview Fuel cells convert the chemical energy in hydrogen to electricity with only water and heat as byproducts and are commercially available today for certain ...

  18. Heating System Basics | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    System Basics Heating System Basics August 16, 2013 - 2:32pm Addthis A variety of heating technologies are available today. You can learn more about what heating systems and heat pumps are commonly used today and how they work below. To learn how to use these technologies in your own home, see the Home Heating Systems section on Energy Saver. Furnaces and Boilers Furnaces heat air and distribute the heated air through a building using ducts. Boilers heat water, providing either hot water or

  19. DOE Releases 2013 Fuel Cell Technologies Market Report | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Releases 2013 Fuel Cell Technologies Market Report DOE Releases 2013 Fuel Cell Technologies Market Report November 12, 2014 - 11:13am Addthis The Energy Department today released the 2013 Fuel Cell Technologies Market Report, detailing trends in the U.S. fuel cell and hydrogen technologies market. The report highlights continued growth in fuel cell commercial deployments, including material handling equipment such as forklifts as well as combined heat and power systems and back-up and

  20. California CHP Market Assessment, July 2009 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    California CHP Market Assessment, July 2009 California CHP Market Assessment, July 2009 Presentation by ICF International to the Integrated Energy Policy Report Committee at the California Energy Commission's July 2009 Combined Heat and Power Workshop. PDF icon 2009-07-15_ICF_CHP_Market_Assessment.pdf More Documents & Publications CHP Assessment, California Energy Commission, October 2009 2008 CHP Baseline Assessment and Action Plan for the California Market CHP: Connecting the Gap between