National Library of Energy BETA

Sample records for washington seattle wa

  1. DOE Zero Energy Ready Home: Montlake Modern - Seattle, Washington...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Montlake Modern - Seattle, Washington DOE Zero Energy Ready Home: Montlake Modern - Seattle, Washington Case study of a DOE Zero Energy Ready Home in Seattle, WA, that scored HERS ...

  2. Category:Seattle, WA | Open Energy Information

    Open Energy Info (EERE)

    Seattle, WA Jump to: navigation, search Go Back to PV Economics By Location Media in category "Seattle, WA" The following 16 files are in this category, out of 16 total....

  3. Seattle, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Institutions in Seattle, Washington ARCH Venture Partners (Washington) Northwest National Marine Renewable Energy Center Washington Technology Center Registered Networking...

  4. Seattle, Washington: Solar in Action (Brochure), Solar America Cities,

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Efficiency & Renewable Energy (EERE) | Department of Energy Seattle, Washington: Solar in Action (Brochure), Solar America Cities, Energy Efficiency & Renewable Energy (EERE) Seattle, Washington: Solar in Action (Brochure), Solar America Cities, Energy Efficiency & Renewable Energy (EERE) This brochure provides an overview of the challenges and successes of Seattle, WA, a 2008 Solar America City awardee, on the path toward becoming a solar-powered community.

  5. Seattle, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Network Puget Sound Clean Air Agency Puget Sound Clean Cities Coalition Washington Clean Technology Alliance Registered Policy Organizations in Seattle, Washington Northwest SEED...

  6. Climate Action Champions: Seattle, WA | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Seattle, WA Climate Action Champions: Seattle, WA The City of Seattle has long been at the leading edge of environmental innovation. Seattle has been recycling for over 25 years and today has one of the highest recycling and composting rates nationwide. In 2005, Seattle City Light became the first electric utility in the nation to be carbon neutral. Recently, Seattle was recognized as the “most sustainable city in the nation” by STAR communities with a 5-STAR rating and the highest

  7. Seattle, Washington: Solar in Action (Brochure), Solar America...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Seattle, Washington: Solar in Action (Brochure), Solar America Cities, Energy Efficiency & Renewable Energy (EERE) Seattle, Washington: Solar in Action (Brochure), Solar America ...

  8. Seattle, Washington: Solar in Action (Brochure), Solar America...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Seattle, Washington Includes case studies on: * "Solar Works in Seattle" Workshops * Interconnection Training for Utility Staff * "Community Solar" Financing Program Implementation ...

  9. City of Seattle, Washington (Utility Company) | Open Energy Informatio...

    Open Energy Info (EERE)

    Light) Jump to: navigation, search Name: Seattle City of Place: Washington Phone Number: (206) 684-3000 Website: www.seattle.govlight Twitter: @SEACityLight Facebook: https:...

  10. Seattle, Washington: Solar in Action (Brochure)

    SciTech Connect (OSTI)

    Not Available


    This brochure provides an overview of the challenges and successes of Seattle, WA, a 2008 Solar America City awardee, on the path toward becoming a solar-powered community. Accomplishments, case studies, key lessons learned, and local resource information are given.

  11. Spotlight on Seattle, Washington: Community Partnerships Work to Extend

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Program Reach | Department of Energy Seattle, Washington: Community Partnerships Work to Extend Program Reach Spotlight on Seattle, Washington: Community Partnerships Work to Extend Program Reach Spotlight on Seattle, Washington: Community Partnerships Work to Extend Program Reach, as posted on the U.S. Department of Energy's Better Buildings Neighborhood Program website. PDF icon Spotlight on Seattle, Washington More Documents & Publications Seattle Summary of Reported Data Better

  12. DOE Zero Energy Ready Home Case Study: Dwell Development, Seattle, WA,

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Systems Home | Department of Energy Dwell Development, Seattle, WA, Systems Home DOE Zero Energy Ready Home Case Study: Dwell Development, Seattle, WA, Systems Home Case study of a DOE Zero Energy Ready Home in Seattle, WA, that scored HERS 34 without PV. This 2,000-square-foot system home has R-45 double-stud walls, an unvented flat roof with 2 inches of spray foam plus 18 inches blown cellulose, R-42 XPS under slab, triple-pane windows, and a ductless mini-split heat pump. PDF icon Dwell

  13. EA-1741: Seattle Steam Company Combined Heat and Power at Post Street in Downtown Seattle, Washington

    Broader source: [DOE]

    This EA evaluates the environmental impacts of a proposal to provide an American Recovery Act and Reinvestment Act of 2009 financial assistance grant to Seattle Steam Company to facilitate the installation of a combined heat and power plant in downtown Seattle, Washington. NOTE: This Project has been cancelled.

  14. DOE Zero Energy Ready Home Case Study: TC Legend, Seattle, WA, Custom Home

    Broader source: [DOE]

    Case study of a DOE Zero Energy Ready Home in Seattle, WA, that scored HERS 37 without PV, HERS -1 with PV. This 1,915-square-foot custom home has SIP walls and roof, R-20 XPS under the slab, triple-pane windows, an air to water heat pump for radiant heat, and balanced ventilation with timer-controlled fans to bring in and exhaust air.

  15. Clean Cities: Western Washington Clean Cities coalition

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Studies where her studies focused on policies to stimulate the growth of renewable energy. 1904 Third Ave, Ste 105 Seattle, WA 98101 Western Washington Success Stories Watch...

  16. Seattle Biodiesel aka Seattle BioFuels | Open Energy Information

    Open Energy Info (EERE)

    Seattle Biodiesel aka Seattle BioFuels Jump to: navigation, search Name: Seattle Biodiesel (aka Seattle BioFuels) Place: Seattle, Washington Sector: Renewable Energy Product:...

  17. File:06-WA-b - Washington Construction Storm Water Permit.pdf...

    Open Energy Info (EERE)

    6-WA-b - Washington Construction Storm Water Permit.pdf Jump to: navigation, search File File history File usage Metadata File:06-WA-b - Washington Construction Storm Water...

  18. Washington: Community Power Works is Building a More Efficient Seattle

    Office of Energy Efficiency and Renewable Energy (EERE)

    The City of Seattle and several community organizations are working to improve energy efficiency and reduce carbon emissions.

  19. Seattle, Washington A White House Climate Action Champions Case...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... City of Seattle recognizes its own energy impact and the importance of leading by example. ... of their lowest performers. 6 ResourcesLearning More 1. Contacts Authors Sandra Mallory, ...

  20. DOE Zero Energy Ready Home Case Study: Montlake Modern - Seattle, Washington

    SciTech Connect (OSTI)



    This case study describes a DOE Zero Energy Ready Home in Seattle, WA, that scored HERS 42 without PV and a -1 with PV. This 3,192 ft2 custom home has 6-inch SIP walls, a 12-inch SIP roof, an R-28 ICF-insulated foundation slab edge with R-20 rigid foam under the slab; an air-to-water heat pump plus radiant floor heat; 100% LED lighting; filtered-fan-powered fresh air intake; triple-pane windows, 9.7 kWh PV for electric car charging station.

  1. EERE Success Story—Washington: Seattle Rises Above with Alternative Fuels

    Broader source: [DOE]

    From the airport's baggage carriers to the taxis, Seattle's efforts to reduce petroleum in transportation will improve their local energy and environmental security, as well as help tourists realize the benefits of alternative fuels.

  2. Potential social, institutional, and environmental impacts of selected energy-conservation measures in two Washington communities. [Seattle and Yakima

    SciTech Connect (OSTI)

    Edelson, E.; Olsen, M.


    The likely environmental, social, and institutional impacts of selected energy-conservation measures in two communities in Washington state are reported. The five conservation measures investigated in this study were: (1) retrofitting existing buildings; (2) district heating and Integrated Community Energy Systems (ICES); (3) small automobiles and vehicle redesign; (4) land-use and housing modifications; and (5) electric-utility rate reform. Twenty potential impact areas were selected for analysis. These areas were divided into five categories of environmental impacts, economic impacts, community impacts, personal impacts, and overall quality of life in the community. The research was conducted in Seattle and Yakima, Washington. In each location, about two dozen public officials and business, labor, and community leaders were interviewed. Their diverse views are summarized. The Seattle respondents saw energy conservation as a highly desirable policy with a number of temporary, transitional problems arising as energy-conservation measures were implemented. Yakima respondents, in contrast, did not expect to encounter many serious energy problems in the foreseeable future and consequently viewed energy conservation as a relatively minor community concern. Moreover, they anticipated that many conservation measures, if implemented by the government, would encounter either apathy or resistance in their community. Two broad generalizations can bedrawn from these interviews: (1) energy conservation will basically be beneficial for the natural environment and our society; and (2) if energy conservation does become a dominant thrust in our society, it could stimulate and reinforce a much broader process of fundamental social change. (LCL)

  3. Seattle Data Dashboard | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data Dashboard Seattle Data Dashboard The data dashboard for Seattle, Washington, a partner in the Better Buildings Neighborhood Program. File Seattle Data Dashboard More Documents & Publications Cincinnati Data Dashboard Austin Energy Data Dashboard Massachusetts -- SEP Data Dashboard

  4. University of Washington | Open Energy Information

    Open Energy Info (EERE)

    Washington Jump to: navigation, search Name: University of Washington Place: Seattle, Washington Product: Public research university with campuses in Seattle, Tacoma, and Bothell....

  5. DOE Zero Energy Ready Home Case Study: Dwell Development, Seattle, Washington

    SciTech Connect (OSTI)



    This Challenge Home is one of 42 homes in a micro-community of ultra-modern, energy-efficient homes built by Dwell Development on an urban gray-field site in South Seattle. Every home will achieve a 5-Star Built Green rating from the regional master builders association and meet the criteria of the Northwest ENERGY STAR program, which is more strict than the national ENERGY STAR criteria. Also, the home won a 2013 Housing Innovation Award in the "systems builder" category.

  6. Final Site Specific Decommissioning Inspection Report #2 for the University of Washington Research and Test Reactor, Seattle, Washington

    SciTech Connect (OSTI)

    S.J. Roberts


    During the period of August through November 2006, ORISE performed a comprehensive IV at the University of Washington Research and Test Reactor Facility. The objective of the ORISE IV was to validate the licensee’s final status survey processes and data, and to assure the requirements of the DP and FSSP were met.

  7. Climate Leadership Conference (Seattle, WA)

    Broader source: [DOE]

    Sustainability leaders from the private, public, academic, and non-profit communities meet to explore market transformation, carbon management, and building climate resilience on an annual basis.

  8. Orchestrating Market Success: Seattle Market Introduction Workshop Video

    Broader source: [DOE]

    View the video from Jim Brodrick's opening presentation at the July 2011 DOE SSL Market Introduction Workshop in Seattle, Washington.

  9. Seattle Structure Named WAN Sustainable Building of 2013

    Broader source: [DOE]

    World Architecture News (WAN) recently named the Bullit Center in Seattle, Washington, as the WAN Sustainable Building of the Year.

  10. Washington Biodiesel | Open Energy Information

    Open Energy Info (EERE)

    Logo: Washington Biodiesel Name: Washington Biodiesel Address: 3401 Fremont Avenue N. Place: Seattle, Washington Zip: 98103 Region: Pacific Northwest Area Sector: Biofuels...


    Broader source: [DOE]

    Seattle, Washington, is a diverse, environmentally aware city with a variety of languages, cultures, and income levels. Leveraging relationships with public, private, and nonprofit partners, the...

  12. Fermilab Today | University of Washington Profile

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Washington August 27, 2009 NAME: University of Washington HOME TOWN: Seattle, Washington MASCOT: Husky SCHOOL COLORS: Purple and gold PARTICLE PHYSICS COLLABORATIONS: DZero and...

  13. Washington Technology Center | Open Energy Information

    Open Energy Info (EERE)

    Logo: Washington Technology Center Name: Washington Technology Center Address: 300 Fluke Hall Place: Seattle, Washington Zip: 98195 Region: Pacific Northwest Area Website:...

  14. Text-Alternative Version: Seattle Market Introduction Workshop Video

    Broader source: [DOE]

    Following is a text version of Jim Brodrick's welcome presentation video from the July 2011 DOE SSL Market Introduction Workshop in Seattle, Washington.

  15. Seattle Summary of Reported Data | Department of Energy

    Energy Savers [EERE]

    Washington. PDF icon Seattle Summary of Reported Data More Documents & Publications Virginia -- SEP Summary of Reported Data NYSERDA Summary of Reported Data University Park...

  16. DOE Zero Energy Ready Home Case Study: Dwell Development, Seattle...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Case study of a DOE Zero Energy Ready Home in Seattle, WA, that scored HERS 34 without PV. This 2,000-square-foot system home has R-45 double-stud walls, an unvented flat roof with ...

  17. EIS-0492: Oregon LNG Export Project (Warrenton, OR) and Washington Expansion Project (between Sumas and Woodland, WA)

    Broader source: [DOE]

    The Federal Energy Regulatory Commission (FERC) is preparing, with DOE as a cooperating agency, an EIS to analyze the potential environmental impacts of proposals (1) to add liquefaction and export capability to a proposed liquefied natural gas (LNG) import terminal in Warrenton, Oregon, and add 39 miles of new pipeline in Columbia County, Oregon, and Cowlitz County, Washington, to interconnect with the Northwest Pipeline, and (2) to expand the capacity of the Northwest Pipeline by adding 140 miles of 36-inch diameter pipeline in 10 segments and increasing compression at five existing compressor stations. These proposals are connected actions and will be evaluated in the same EIS. DOE, Office of Fossil Energy, has an obligation under Section 3 of the Natural Gas Act to authorize the import and export of natural gas, including LNG, unless it finds that the import or export is not consistent with the public interest.

  18. Washington State University | Open Energy Information

    Open Energy Info (EERE)

    University Jump to: navigation, search Name: Washington State University Place: Spokane, WA Website: www.washingtonstateuniversity. References: Washington State University1...

  19. Washington

    Office of Environmental Management (EM)

    Washington , DC 20585 April 15, 2013 Mr. David Martin, Chair Oak Ridge Site Specific Advisory Board P.O. Box 2001 Oak Ridge, Tennessee 37831 Dear Mr. Martin: Thank you for your February 27, 2013 , letter recognizing the Department of Energy's (DOE) considerable success in disposing of transuranic waste (TRU) and your interest in expansion of the Waste Isolation Pilot Plant (WIPP) mission. We are proud of having safely and effectively disposed of more than 85,000 cubic meters of TRU at WIPP since

  20. RAPID/Roadmap/5-WA-a | Open Energy Information

    Open Energy Info (EERE)

    Geothermal Hydropower Solar Tools Contribute Contact Us Drilling and Well Development (5-WA-a) In Washington geothermal drilling and well development are regulated by the...

  1. RAPID/Roadmap/14-WA-c | Open Energy Information

    Open Energy Info (EERE)

    Geothermal Hydropower Solar Tools Contribute Contact Us Underground Injection Control Permit (14-WA-c) The Safe Drinking Water Act requires Washington to implement...

  2. RAPID/Roadmap/18-WA-b | Open Energy Information

    Open Energy Info (EERE)

    Transmission Geothermal Hydropower Solar Tools Contribute Contact Us Dangerous Solid Waste Permit (18-WA-b) The Washington State Department of Ecology (WSDE) oversees the...

  3. RAPID/Roadmap/12-WA-b | Open Energy Information

    Open Energy Info (EERE)

    Geothermal Hydropower Solar Tools Contribute Contact Us State Trust Lands Habitat Conservation Plan Compliance (12-WA-b) The State of Washington has a Habitat Conservation Plan...

  4. RAPID/Roadmap/19-WA-d | Open Energy Information

    Open Energy Info (EERE)

    BETA About Bulk Transmission Geothermal Hydropower Solar Tools Contribute Contact Us Water Conservancy Board Transfer or Change of Water Right (19-WA-d) In 1997, the Washington...

  5. RAPID/Roadmap/19-WA-c | Open Energy Information

    Open Energy Info (EERE)

    Geothermal Hydropower Solar Tools Contribute Contact Us Transfer or Change of Water Right (19-WA-c) Much of Washington's public waters have been accounted for through...

  6. RAPID/Roadmap/19-WA-b | Open Energy Information

    Open Energy Info (EERE)

    About Bulk Transmission Geothermal Hydropower Solar Tools Contribute Contact Us New Water Right Permit Process (19-WA-b) Washington uses a prior appropriation system for the...

  7. City of Port Angeles, Washington (Utility Company) | Open Energy...

    Open Energy Info (EERE)

    Port Angeles, Washington (Utility Company) Jump to: navigation, search Name: Port Angeles City of Place: Washington Phone Number: 360-457-0411 Website:

  8. EIS-0492: Oregon LNG Export Project (Warrenton, OR) and Washington...

    Energy Savers [EERE]

    2: Oregon LNG Export Project (Warrenton, OR) and Washington Expansion Project (between Sumas and Woodland, WA) EIS-0492: Oregon LNG Export Project (Warrenton, OR) and Washington ...

  9. Microsoft Word - Final Rainfall in Washington newsletter_2010...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    England and Southern Scotland The eastern coasts of large islands like Australia and Madagascar Areas in the northwestern United States near the Great Lakes Seattle, Washington,...

  10. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  11. Cheney, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Cheney, Washington: Energy Resources (Redirected from Cheney, WA) Jump to: navigation, search Equivalent URI DBpedia Coordinates 47.4873895, -117.5757622 Show Map Loading...

  12. Olympia, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Olympia, Washington: Energy Resources (Redirected from Olympia, WA) Jump to: navigation, search Equivalent URI DBpedia Coordinates 47.0378741, -122.9006951 Show Map Loading...

  13. Kirkland, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Kirkland, Washington: Energy Resources (Redirected from Kirkland, WA) Jump to: navigation, search Equivalent URI DBpedia Coordinates 47.6814875, -122.2087353 Show Map Loading...

  14. Spotlight on Seattle, Washington: Community Partnerships Work...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Simultaneously, CPW is set to achieve significant energy, climate, and economic development goals with its 40 partners-setting the city up for program sustainability. Leverage ...

  15. Spotlight on Seattle, Washington: Community Partnerships Work...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Making the Program Work for Contractors Better Buildings - Spotlight on Portland, Oregon; Financing and Incetntives: Use Incentives to Get Attention and Encourage Deep Savings

  16. RAPID/Roadmap/6-WA-a | Open Energy Information

    Open Energy Info (EERE)

    in the Washington Administrative Code. 6-WA-a - Oversize-Overweight Load Permit.pdf Error creating thumbnail: Page number not in range. Error creating thumbnail: Page number...

  17. RAPID/Roadmap/3-WA-b | Open Energy Information

    Open Energy Info (EERE)

    the Washington State Department of Natural Resources. 3-WA-b - Land Access Overview.pdf Error creating thumbnail: Page number not in range. Error creating thumbnail: Page number...

  18. Hanford, WA Selected as Plutonium Production Facility | National...

    National Nuclear Security Administration (NNSA)

    Production Facility Hanford, WA Groves selects Hanford, Washington, as site for full-scale plutonium production and separation facilities. Three reactors--B, D, and F--are built....

  19. DOE ZERH Case Study: Dwell Development, Reclaimed Modern, Seattle, WA

    SciTech Connect (OSTI)



    Case study of a DOE 2015 Housing Innovation Award winning custom home in the cold climate that got a HERS 30 without PV, with 2x8 24” on center walls with blown fiberglass and 4” polysio rigid foam; basement with 2” XPS interior, 4” under slab, 4” exterior of foundation wall; vented attic with R-100 blown cellulose; wo air-to-air heat pumps SEER 14.1; HSPF 9.6; heat pump water heater.

  20. ERSUG Meeting: January 12 - 13, 1995 (Richland, WA)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ERSUG Meeting: January 12 - 13, 1995 (Richland, WA) Dates January 12th & 13th, 1995 Location Pacific Northwest Laboratory Richland, Washington Presentations Summary of ERSUG Meeting January 12 - 13, 1995, Richland, Washington The latest Energy Research Supercomputer Users Group (ERSUG) meeting was held at Pacific Northwest Laboratory in Richland, Washington, on January 12 - 13, 1995. Some of the talks are summarized below. The View from Washington (Tom Kitchens) Tom Kitchens presented the

  1. HERO Seattle Mariners

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    HERO Seattle Mariners vs. St. Louis Cardinals Sunday, June 26, 2016 1:10 pm game time $65/person Payments over $250 must be cashier's check or cash $65/person includes bus ride, game ticket, snacks on the bus and pizza on the way home! Send payment to Linda Meigs (376-5785) @ A3-01 Enjoy Sunday afternoon at Safeco Field, cheering on your favorite team!


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Linda Hoffman, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA...

  3. ,"Washington Natural Gas Underground Storage Net Withdrawals...

    U.S. Energy Information Administration (EIA) Indexed Site

    ,,"(202) 586-8800",,,"1012015 11:00:57 AM" "Back to Contents","Data 1: Washington Natural Gas Underground Storage Net Withdrawals (MMcf)" "Sourcekey","N5070WA2"...

  4. Washington - Compare - U.S. Energy Information Administration (EIA)

    U.S. Energy Information Administration (EIA) Indexed Site

    Washington Washington

  5. Washington - Rankings - U.S. Energy Information Administration (EIA)

    U.S. Energy Information Administration (EIA) Indexed Site

    Washington Washington

  6. Washington - Search - U.S. Energy Information Administration (EIA)

    U.S. Energy Information Administration (EIA) Indexed Site

    Washington Washington

  7. Solar Works in Seattle: Domestic Hot Water

    Broader source: [DOE]

    Seattle's residential solar hot water workshop. Content also covers general solar resource assessment, siting, and financial incentives.

  8. Best Practices Case Study: Devoted Builders, LLC, Mediterrtanean Villas, Pasco,WA

    SciTech Connect (OSTI)


    Devoted Builders of Kennewick, WA worked with Building America's BIRA team to achieve the 50% Federal tax credit level energy savings on 81 homes at its Mediterranean Villas community in eastern Washington.

  9. Workplace Charging Challenge Partner: Eastern Washington University |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Washington University Workplace Charging Challenge Partner: Eastern Washington University Workplace Charging Challenge Partner: Eastern Washington University Joined the Challenge: August 2015 Headquarters: Cheney, WA Charging Locations: N/A Domestic Employees: 1,989 In 2007 Eastern Washington University accepted the challenge to reduce campus emissions by becoming signatory to the American Colleges and University President's Climate Commitment (ACUPCC). Installing

  10. Franklin PUD, Pasco WA

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    have been replaced by Hans Berg (State of Washington, Wid Ritchie (Idaho Falls) and Shawn Collins (The Energy Project). A few participants reported new LIEE activities, due at...

  11. Indian Community Development Block Grant Program Workshop - Seattle...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Indian Community Development Block Grant Program Workshop - Seattle Indian Community Development Block Grant Program Workshop - Seattle May 18, 2016 9:00AM to 3:00PM PDT Seattle, ...

  12. Alternative Fuels Data Center: Seattle's Waste Haulers are Going Green

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Seattle's Waste Haulers are Going Green to someone by E-mail Share Alternative Fuels Data Center: Seattle's Waste Haulers are Going Green on Facebook Tweet about Alternative Fuels Data Center: Seattle's Waste Haulers are Going Green on Twitter Bookmark Alternative Fuels Data Center: Seattle's Waste Haulers are Going Green on Google Bookmark Alternative Fuels Data Center: Seattle's Waste Haulers are Going Green on Delicious Rank Alternative Fuels Data Center: Seattle's Waste Haulers are Going

  13. City of Richland, Washington (Utility Company) | Open Energy...

    Open Energy Info (EERE)

    Name: City of Richland Place: Washington Phone Number: (509) 942-7421 Website: Outage Hotline: After Hours and Weekends: (509) 943-4428...

  14. DOE Zero Energy Ready Home: Montlake Modern- Seattle, Washington

    Broader source: [DOE]

    This DOE Zero Energy Ready Home features structural insulated panel walls and roof, an air-to-water heat pump plus radiant floor heat; 100% LED lighting; filtered-fan-powered fresh air intake; triple-pane windows, and 9.7 kWh PV for electric car charging station.

  15. City of Seattle, Washington (Utility Company) | Open Energy Informatio...

    Open Energy Info (EERE)

    27,512 519,210 39,402 4,885 105,963 220 3 50 3 55,758 999,805 391,180 2008-12 15,946 266,607 350,675 24,130 441,877 39,392 4,551 95,303 219 3 56 3 44,630 803,843 390,289 2008-11...

  16. Seattle, Washington, Summary of Reported Data From July 1, 2010...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... These partners help overcome language barriers that have prevented participation i n energy efficiency programs thanks to their expertise in 15 languages, including Spanish, ...

  17. City of Seattle, Washington (Utility Company) | Open Energy Informatio...

    Open Energy Info (EERE)

    ) OTH SALES (MWH) OTH CONS TOT REV (THOUSAND ) TOT SALES (MWH) TOT CONS 2009-03 23,601 373,913 353,104 24,986 456,778 39,325 4,440 92,495 220 3 47 3 53,030 923,233 392,652...

  18. Washington: Seattle Rises Above with Alternative Fuels | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    on fuel due to the cost differential between compresses natural gas (CNG) and gasoline. ... who was a veteran started a taxi company with a 100% alternative fuel fleet-CNG For Hire. ...

  19. Alternative Fuels Data Center: Seattle Bakery Delivers With Biodiesel

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Trucks Seattle Bakery Delivers With Biodiesel Trucks to someone by E-mail Share Alternative Fuels Data Center: Seattle Bakery Delivers With Biodiesel Trucks on Facebook Tweet about Alternative Fuels Data Center: Seattle Bakery Delivers With Biodiesel Trucks on Twitter Bookmark Alternative Fuels Data Center: Seattle Bakery Delivers With Biodiesel Trucks on Google Bookmark Alternative Fuels Data Center: Seattle Bakery Delivers With Biodiesel Trucks on Delicious Rank Alternative Fuels Data

  20. Alternative Fuels Data Center: Seattle Rideshare Fleet Adds EVs, Enjoys

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Success Seattle Rideshare Fleet Adds EVs, Enjoys Success to someone by E-mail Share Alternative Fuels Data Center: Seattle Rideshare Fleet Adds EVs, Enjoys Success on Facebook Tweet about Alternative Fuels Data Center: Seattle Rideshare Fleet Adds EVs, Enjoys Success on Twitter Bookmark Alternative Fuels Data Center: Seattle Rideshare Fleet Adds EVs, Enjoys Success on Google Bookmark Alternative Fuels Data Center: Seattle Rideshare Fleet Adds EVs, Enjoys Success on Delicious Rank Alternative

  1. Microsoft Word - HABAdv#224_Proposed COnsent Decree&TPA Modifications...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Seattle, WA 98101 Ins Triay Assistant Secretary for Environmental Management EM-1Forestal Building U.S. Department of Energy 1000 Independence Avenue Washington, D.C. 20585...

  2. Community Solar Public Opinion Research Results (Seattle)

    Broader source: [DOE]

    500 Seattle City Light customers were polled to determine interest in a community solar program, how people would participate and at what price levels. This is a presentation of the results.

  3. Seattle City Light- Vending Machine Rebate Program

    Broader source: [DOE]

    Seattle City Light offers qualifying customers $80 rebates for the purchase of VendingMiser Energy Efficient Vending Machines. VendingMiser reduces the energy consumption of cold drink vending...

  4. Seattle City Light- New Construction Incentive Program

    Broader source: [DOE]

    Seattle City Light (SCL) works with the design teams of their commercial and industrial customers to create high performance buildings with low long-term operating costs. The utility provides...

  5. DOE Zero Energy Ready Home Case Study: Dwell Development, Reclaimed...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Seattle, WA, Systems Home DOE Zero Energy Ready Home: Montlake Modern - Seattle, Washington DOE Zero Energy Ready Home Case Study: Palo Duro Homes, Via del Cielo, Santa Fe, NM

  6. New Whole-House Solutions Case Study: Quadrant Homes, Kent, WA

    Energy Savers [EERE]

    Quadrant Homes, a Weyerhaeuser real estate company and Seattle-area builder, offers buyers of its "custom" production homes over 300 house plans and 10,000 feature options to choose from. With technical assistance from DOE's Building America program in 2007, Quadrant developed a package of energy-efficiency measures designed to save home owners 50% over the state energy code at the time. Savings were modeled by the Washington State University (WSU) Extension Energy Office (a member of

  7. Manager Helps Washington County Develop Energy Efficiency Projects |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Manager Helps Washington County Develop Energy Efficiency Projects Manager Helps Washington County Develop Energy Efficiency Projects August 11, 2010 - 1:01pm Addthis An Energy Department grant funded Autumn Salamack's new job as resource conservation manager for Kitsap County, Washington, and the energy efficient windows framed behind her. | Photo courtesy of Kitsap County, WA | An Energy Department grant funded Autumn Salamack's new job as resource conservation manager


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    STAT 12293GG STATE OF WASHINGTON DEPARTMENT OF ECOLOGY 3100 Port of Benton Blvd * Richland, WA 99354 * (509) 372-7950 711 for Washington Relay Service * Persons with a speech disability can call 877-833-6341 April 20, 2015 15-NWP-076 APR 2 1 2015 Ms. Stacy Charboneau, Man er Mr. Ijevin Smith, Manager Richland Operations Office L'ieie of River Protection United States Department of Energy United States Department of Energy PO Box 550, MSIN: A7-50 PO Box 450, MSIN: H6-60 Richland, Washington 99352

  9. General Resources - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Help 314 1st Ave W Seattle, WA 98119 (800) 255-9752 Washington State Department of Labor and Industries P. O. Box 44000 Olympia, WA 98504-4000 (800) 547-8367 toll free (360)...

  10. DOE Zero Energy Ready Home Case Study: TC Legend, Seattle, WA...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and roof, R-20 XPS under the slab, triple-pane windows, an air to water heat pump for radiant heat, and balanced ventilation with timer-controlled fans to bring in and exhaust air. ...

  11. BayWa Group | Open Energy Information

    Open Energy Info (EERE)

    BayWa Group Jump to: navigation, search Name: BayWa Group Place: Munich, Germany Zip: 81925 Sector: Services, Solar Product: Germany-based company with international operations...

  12. Metropolitan Washington

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Metropolitan Washington Council of Governments A White House Climate Action Champions Case Study INDEX Executive Summary...............................2 Climate Action Champion.....................2 Project Spotlight.................................3-5 Co-benefits.............................................5 Challenges and Lessons Learned.........5 Resources and Contacts........................7 2 Executive Summary The Metropolitan Washington Council of Governments (COG) is an independent,

  13. Advance Patent Waiver W(A)2011-006 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    WA05022DOWCHEMICALCOMPANYWaiverofdomesticandForeig.pdf WA04033CARGILLWaiverofPatentRightstoCARGILLDOWNL.pdf WA00022CARGILLDOWPOLYMERSLLCWaiverofDomest...

  14. Seattle HomeWise: Weatherization | Department of Energy

    Broader source: (indexed) [DOE]

    Program Type Grant Program Rebate Amount Varies Summary The City of Seattle offers free weatherization services to residents who meet income qualifications. Services are...

  15. Seattle City Light- Commercial Energy Efficiency Rebate Programs

    Broader source: [DOE]

    Seattle City Light offers a variety of rebates to commercial and industrial customers through the Energy Smart Services Program. Energy Smart Services are available to commercial businesses,...

  16. Seattle City Light- Built Smart Program for Builders and Architects

    Broader source: [DOE]

    Seattle City Light provides incentives for builders, developers, and architects who construct energy efficient multi-family buildings. The program is designed to encourage the construction of...

  17. Seattle City Light- Residential Energy Efficiency Rebate Program

    Broader source: [DOE]

    Seattle City Light provides rebates to its customers for energy audits and purchasing and installing energy saving clothes washers, refrigerators, heat pump water heaters, ductless heat pumps,...

  18. Snohomish County, Washington: Energy Resources | Open Energy...

    Open Energy Info (EERE)

    Echo Lake, Washington Edmonds, Washington Esperance, Washington Everett, Washington Gold Bar, Washington Granite Falls, Washington Index, Washington John Sam Lake, Washington...


    Office of Legacy Management (LM)

    WASHINGTON. DC. tzr.~Dfak nuf, Ama fall- II* 8. Atoalc l%mqy Camlealnn . . . . ,L:,. ' ,. 8ta loui Are0 offlaa " . . : ' ; ,.' ~. ._ ; . . ..!"C.. ,:. . . ..~.;~..?n:,.;,, ,_ ," .L,: ' ..: ' I I. P.O. Box 36 ,, ,,,,: ,.,.:... . . Brorarw Btotlrn . St. Louis, $105cnlr1 =- %A. WO. LB - FCA Fbn. A. Dfcklooa, V?,ao huralb$

  20. Walla Walla County, Washington: Energy Resources | Open Energy...

    Open Energy Info (EERE)

    Burbank, Washington College Place, Washington Dixie, Washington Garrett, Washington Prescott, Washington Touchet, Washington Waitsburg, Washington Walla Walla East, Washington...

  1. Skagit County, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    View, Washington Big Lake, Washington Burlington, Washington Clear Lake, Washington Concrete, Washington Conway, Washington Edison, Washington Hamilton, Washington La Conner,...

  2. Whatcom County, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Bellingham, Washington Birch Bay, Washington Blaine, Washington Custer, Washington Deming, Washington Everson, Washington Ferndale, Washington Geneva, Washington Glacier,...

  3. Clark County, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Washington Meadow Glade, Washington Mill Plain, Washington Minnehaha, Washington Mount Vista, Washington Orchards, Washington Ridgefield, Washington Salmon Creek, Washington...

  4. Thurston County, Washington: Energy Resources | Open Energy Informatio...

    Open Energy Info (EERE)

    Washington Olympia, Washington Rainier, Washington Rochester, Washington Tanglewilde-Thompson Place, Washington Tenino, Washington Tumwater, Washington Yelm, Washington Retrieved...

  5. Pacific County, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Bay Center, Washington Chinook, Washington Ilwaco, Washington Lebam, Washington Long Beach, Washington Naselle, Washington Ocean Park, Washington Raymond, Washington...

  6. Department Washington,

    Office of Legacy Management (LM)

    Washington, of Energy DC 20545 Mr. Roy J. Villella, Jr. Assistant Secretary Diebold, Incorporated 818 Mulberry Road, S.E. F. 0. Box 8230 Canton, Ohio 44711-8230 Dear Mr..Villella: Enclosed is your copy of the signed consent form for the survey of those portions of the Diebold property used by the former owner, Herring Hall and Marvin Safe Company, to machine uranium rod for the Manhattan Engineer District. I have directed our contractor, Oak Ridge National Laboratory (ORNL), to coordinate the

  7. Clallam County, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Blyn, Washington Carlsborg, Washington Forks, Washington Neah Bay, Washington Port Angeles East, Washington Port Angeles, Washington River Road, Washington Sequim,...

  8. DOE Tour of Zero: The Net Zero in Seattle by TC Legend Homes...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Net Zero in Seattle by TC Legend Homes DOE Tour of Zero: The Net Zero in Seattle by TC Legend Homes Addthis 1 of 15 Northwest builder TC Legend Homes has built a certified U.S. DOE...

  9. Advance Patent Waiver W(A)2002-023 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2-023 Advance Patent Waiver W(A)2002-023 PDF icon Advance Patent Waiver W(A)2002-023 More Documents & Publications Advance Patent Waiver W(A)2006-028 WA05056IBMWATSONRESEARCH...

  10. Washington: Washington's Clean Energy Resources and Economy

    SciTech Connect (OSTI)


    This document highlights the Office of Energy Efficiency and Renewable Energy's investments and impacts in the state of Washington.

  11. DOE Commercial Building Energy Asset Rating Program Focus Groups with Primary Stakeholders in Seattle-- Final Report

    Broader source: [DOE]

    Collection, assessment, and analysis of Seattle stakeholder input and opinions regarding the commercial building energy asset rating program.


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    STATE OF WASHINGTON August 29, 2012 The Honorable Stephen Chu, Secretary United States Department of Energy 1000 Independence Avenue Washington, DC 20585 Dear Secretary Chu: As you...

  13. WA_00_022_CARGILL_DOW_POLYMERS_LLC_Waiver_of_Domestic_and_Fo...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    22CARGILLDOWPOLYMERSLLCWaiverofDomesticandFo.pdf WA00022CARGILLDOWPOLYMERSLLCWaiverofDomesticandFo.pdf PDF icon WA00022CARGILLDOWPOLYMERSLLCWaiverofDom...

  14. WA_98_001_REYNOLDS_METALS_COMPANY_Waiver_of_Domestic_and_For...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8001REYNOLDSMETALSCOMPANYWaiverofDomesticandFor.pdf WA98001REYNOLDSMETALSCOMPANYWaiverofDomesticandFor.pdf PDF icon WA98001REYNOLDSMETALSCOMPANYWaiverofD...

  15. WA_02_035_BP_SOLAR_INTERNATIONAL_Waiver_of_Domestic_and_Fore...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    INTERNATIONALWaiverofDomesticandFore.pdf More Documents & Publications WA06016BPSOLARINTERNATIONALWaiverofPatentRightsUnd.pdf WA02034BPSOLARINTERNATIONALLLCW...

  16. WA_03_010_SHELL_SOLAR_INDUSTRIES_Waiver_of_Domestic_and_Fore...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    INDUSTRIESWaiverofDomesticandFore.pdf More Documents & Publications WA02039SHELLSOLARSYSTEMSWaiverofPatentRightsUnder.pdf WA05059SHELLSOLARINDUSTRIESLPWaive...

  17. Jefferson County, Washington: Energy Resources | Open Energy...

    Open Energy Info (EERE)

    C. Places in Jefferson County, Washington Brinnon, Washington Marrowstone, Washington Port Hadlock-Irondale, Washington Port Ludlow, Washington Port Townsend, Washington...

  18. Geothermal Technologies Program - Washington

    SciTech Connect (OSTI)


    This fact sheets provides a summary of geothermal potential, issues, and current development in Washington State.

  19. Kitsap County, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Island, Washington Bangor Trident Base, Washington Bremerton, Washington East Port Orchard, Washington Erlands Point-Kitsap Lake, Washington Indianola, Washington...

  20. Grays Harbor County, Washington: Energy Resources | Open Energy...

    Open Energy Info (EERE)

    in Grays Harbor County, Washington Aberdeen Gardens, Washington Aberdeen, Washington Brady, Washington Central Park, Washington Chehalis Village, Washington Cohassett Beach,...

  1. Builders Challenge High Performance Builder Spotlight - Martha Rose Construction, Inc., Seattle, Washington

    SciTech Connect (OSTI)


    Building America/Builders Challenge fact sheet on Martha Rose Construction, an energy-efficient home builder in marine climate using the German Passiv Haus design, improved insulation, and solar photovoltaics.

  2. Reference Buildings by Climate Zone and Representative City: 4C Seattle, Washington

    Broader source: [DOE]

    In addition to the ZIP file for each building type, you can directly view the "scorecard" spreadsheet that summarizes the inputs and results for each location. This Microsoft Excel spreadsheet is also included in the ZIP file. For version 1.4, only the IDF file is included.

  3. DOE Zero Energy Ready Home Case Study: TC Legend Homes, Seattle, Washington

    SciTech Connect (OSTI)



    This house incorporates slab-on-grade, EPS roof, and radiant heating with an air-to-water heat pump that also preheats domestic hot water. Without counting in the solar panels, the home earns a home energy rating system (HERS) score of 37, with projected utility bills of about $740 a year. With the 6.4-kW photovoltaic power system installed on the roof, the home’s HERS scores drops to -1 and utility bills for the all-electric home drop to zero. This home was awarded a 2013 Housing Innovation Award in the affordable builder category.

  4. Urban Wood-Based Bio-Energy Systems in Seattle

    SciTech Connect (OSTI)

    Stan Gent, Seattle Steam Company


    Seattle Steam Company provides thermal energy service (steam) to the majority of buildings and facilities in downtown Seattle, including major hospitals (Swedish and Virginia Mason) and The Northwest (Level I) Regional Trauma Center. Seattle Steam has been heating downtown businesses for 117 years, with an average length of service to its customers of 40 years. In 2008 and 2009 Seattle Steam developed a biomass-fueled renewable energy (bio-energy) system to replace one of its gas-fired boilers that will reduce greenhouse gases, pollutants and the amount of waste sent to landfills. This work in this sub-project included several distinct tasks associated with the biomass project development as follows: a. Engineering and Architecture: Engineering focused on development of system control strategies, development of manuals for start up and commissioning. b. Training: The project developer will train its current operating staff to operate equipment and facilities. c. Flue Gas Clean-Up Equipment Concept Design: The concept development of acid gas emissions control system strategies associated with the supply wood to the project. d. Fuel Supply Management Plan: Development of plans and specifications for the supply of wood. It will include potential fuel sampling analysis and development of contracts for delivery and management of fuel suppliers and handlers. e. Integrated Fuel Management System Development: Seattle Steam requires a biomass Fuel Management System to track and manage the delivery, testing, processing and invoicing of delivered fuel. This application will be web-based and accessed from a password-protected URL, restricting data access and privileges by user-level.

  5. Washington/Transmission | Open Energy Information

    Open Energy Info (EERE)

    Avista, Pacificorp, Puget Sound Energy, Tacoma Public Utilities, Bonneville Power Administration, Columbia Grid, Northern Tier Transmission Group, and Seattle City...

  6. RAPID/Roadmap/19-WA-e | Open Energy Information

    Open Energy Info (EERE)

    Permitting Information Desktop Toolkit BETA About Bulk Transmission Geothermal Hydropower Solar Tools Contribute Contact Us Water Well Notice of Intent for New Well (19-WA-e) A...

  7. RAPID/Roadmap/11-WA-b | Open Energy Information

    Open Energy Info (EERE)

    Permitting Information Desktop Toolkit BETA About Bulk Transmission Geothermal Hydropower Solar Tools Contribute Contact Us Human Remains Process (11-WA-b) This flowchart...

  8. RAPID/Roadmap/14-WA-b | Open Energy Information

    Open Energy Info (EERE)

    RAPIDRoadmap14-WA-b < RAPID | Roadmap Jump to: navigation, search RAPID Regulatory and Permitting Information Desktop Toolkit BETA About Bulk Transmission Geothermal...

  9. RAPID/Roadmap/15-WA-a | Open Energy Information

    Open Energy Info (EERE)

    BETA About Bulk Transmission Geothermal Hydropower Solar Tools Contribute Contact Us Air Quality Permit - Notice of Construction Permit (15-WA-a) This flowchart illustrates...

  10. RAPID/Roadmap/15-WA-b | Open Energy Information

    Open Energy Info (EERE)

    BETA About Bulk Transmission Geothermal Hydropower Solar Tools Contribute Contact Us Air Quality Permit - Operating Permit (15-WA-b) This flowchart illustrates the process for...

  11. file://L:\\public\boards\hab\advice\

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dick French, Manager Office of River Protection 2440 Stevens Center Richland, WA 99352 Subject: TPA Agency Processes for Responding to HAB Consensus Advice Dear Messrs.

  12. file://L:\\public\boards\hab\advice\

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Harry Boston, Manager Office of River Protection 2440 Stevens Center Richland, WA 99352 Chuck Findley, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Subject: FY2001 Performance Measures Dear Messrs. Klein, Boston, Findley, and

  13. file://L:\\public\boards\hab\advice\advice36.htm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Washington, DC 20585 Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Mary Riveland, Director Washington Department of Ecology PO Box 47600 Olympia, WA 98504-7600 John Wagoner, Manager Department of Energy, Richland Operations PO Box 550 Richland, WA 99352 December 8, 1995 RE: Review of FY96 BEMR, MYPP and Site Level Assumptions (HAB Advice #36) Dear Messrs. Grumbly, Clarke and Wagoner, and Ms. Riveland: The FY96 BEMR, MYPP

  14. DOE - Office of Legacy Management -- Hanford Engineer Works - WA 01

    Office of Legacy Management (LM)

    Hanford Engineer Works - WA 01 FUSRAP Considered Sites Site: Hanford Engineer Works (WA.01 ) Designated Name: Alternate Name: Location: Evaluation Year: Site Operations: Site Disposition: Radioactive Materials Handled: Primary Radioactive Materials Handled: Radiological Survey(s): Site Status: Also see Documents Related to Hanford Engineer Works

  15. Grant County, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Banks Lake South, Washington Cascade Valley, Washington Coulee City, Washington Coulee Dam, Washington Desert Aire, Washington Electric City, Washington Ephrata, Washington...

  16. WA_06_016_BP_SOLAR_INTERNATIONAL_Waiver_of_Patent_Rights_Und...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    06016BPSOLARINTERNATIONALWaiverofPatentRightsUnd.pdf WA06016BPSOLARINTERNATIONALWaiverofPatentRightsUnd.pdf PDF icon WA06016BPSOLARINTERNATIONALWaiverofP...

  17. WA_04_033_CARGILL_Waiver_of_Patent_Rights_to_CARGILL_DOWN_L.pdf...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    33CARGILLWaiverofPatentRightstoCARGILLDOWNL.pdf WA04033CARGILLWaiverofPatentRightstoCARGILLDOWNL.pdf PDF icon WA04033CARGILLWaiverofPatentRightstoCARGI...

  18. WA_02_034_BP_SOLAR_INTERNATIONAL_LLC_Waiver_of_Domestic_and_...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    verofDomesticand.pdf More Documents & Publications WA02035BPSOLARINTERNATIONALWaiverofDomesticandFore.pdf WA06016BPSOLARINTERNATIONALWaiverofPatentRightsUnd...

  19. Washington, DC.20585

    Office of Legacy Management (LM)

    Department of ,En&gy Washington, DC.20585 , ' . The Honorable Thomas, Murphy : ,, 414 Grant.Street Pittsburgh, Pennsylvania 15219 Dear Rayor Murphy:. Secretary of Energy ...

  20. BayWa Sunways JV | Open Energy Information

    Open Energy Info (EERE)

    JV that specialises in developing, planning and realizing medium-sized to large photovoltaic systems and solar plants. References: BayWa & Sunways JV1 This article is a stub....

  1. RAPID/Roadmap/19-WA-a | Open Energy Information

    Open Energy Info (EERE)

    BETA About Bulk Transmission Geothermal Hydropower Solar Tools Contribute Contact Us Water Access and Water Rights Overview (19-WA-a) Pursuant to RCW 78.60.060, developers that...

  2. Best Practices Case Study: Quadrant Homes - Kentlake Highlands, Kent, WA

    SciTech Connect (OSTI)



    Case study of Quadrant Homes, a Seattle area builder who, despite the recession, sold three homes a day in the first half of 2009, by letting buyers choose from 300 floor plans and 10,000 options, including an energy efficiency package designed with help from DOEs Building America that cut energy use by 50% over a code-built home.

  3. Itron (Washington) | Open Energy Information

    Open Energy Info (EERE)

    Washington) Jump to: navigation, search Name: Itron Address: 601 Officers Row Place: Vancouver, Washington Zip: 98661 Region: Pacific Northwest Area Sector: Efficiency Product:...

  4. George Washington Carver Recognition Day

    Broader source: [DOE]

    In commemoration of George Washington Carver’s life and work, Congress declared January 5 as George Washington Carver Recognition Day.

  5. Nuclear Physics Laboratory, University of Washington annual report

    SciTech Connect (OSTI)


    The Nuclear Physics Laboratory at the University of Washington in Seattle pursues a broad program of nuclear physics. These activities are conducted locally and at remote sites. The current programs include in-house research using the local tandem Van de Graaff and superconducting linac accelerators and non-accelerator research in solar neutrino physics at the Sudbury Neutrino Observatory in Canada and at SAGE in Russia, and gravitation as well as user-mode research at large accelerators and reactor facilities around the world. Summaries of the individual research projects are included. Areas of research covered are: fundamental symmetries, weak interactions and nuclear astrophysics; neutrino physics; nucleus-nucleus reactions; ultra-relativistic heavy ions; and atomic and molecular clusters.

  6. Carolina, Tennessee, and Washington.

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    March 2016 The U.S. Department of Energy is responsible for one of the largest nuclear cleanup efforts in the world, managing the legacy of five decades of nuclear weapons production. At its peak, this national weapons complex consisted of 16 major facilities, including vast reservations of land in the States of Idaho, Nevada, South Carolina, Tennessee, and Washington. Nowhere in the DOE Complex is cleanup more challenging than at the Hanford Site in southeastern Washington. Hanford made more

  7. Carolina, Tennessee, and Washington.

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    April 2016 The U.S. Department of Energy is responsible for one of the largest nuclear cleanup efforts in the world, managing the legacy of five decades of nuclear weapons production. At its peak, this national weapons complex consisted of 16 major facilities, including vast reservations of land in the States of Idaho, Nevada, South Carolina, Tennessee, and Washington. Nowhere in the DOE Complex is cleanup more challenging than at the Hanford Site in southeastern Washington. Hanford made more

  8. Washington Closure Hanford - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contracting Washington Closure Hanford Contracting ORP Contracts and Procurements RL Contracts and Procurements CH2M HILL Plateau Remediation Company Mission Support Alliance Washington Closure Hanford HPM Corporation (HPMC) Wastren Advantage, Inc. Bechtel National, Inc. Washington River Protection Solutions Washington Closure Hanford Email Email Page | Print Print Page |Text Increase Font Size Decrease Font Size Washington Closure Hanford (WCH) logo A prime contractor for environmental

  9. Seattle City Light- Multi-Family Residential Energy Efficiency Rebate Program

    Broader source: [DOE]

    Seattle City Light provides incentives for multi-family housing properties with 5 or more units to increase their energy efficiency. Rebates are offered for common area lighting and weatherization...

  10. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  11. EA-1741: Draft Environmental Assessment

    Broader source: [DOE]

    Seattle Steam Company Combined Heat and Power at Post Street in Downtown Seattle, Washington (June 2010)

  12. WA_1994_003_GOLDEN_PHOTOCON_INC_Waiver_of_Domestic_and_Forei.pdf |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy WA_1994_003_GOLDEN_PHOTOCON_INC_Waiver_of_Domestic_and_Forei.pdf WA_1994_003_GOLDEN_PHOTOCON_INC_Waiver_of_Domestic_and_Forei.pdf PDF icon WA_1994_003_GOLDEN_PHOTOCON_INC_Waiver_of_Domestic_and_Forei.pdf More Documents & Publications WA_1995_030_GOLDEN_PHOTON_INC_Waiver_of_Domestic_and_Foreign.pdf WA_1993_033_GOLDEN_PHOTON_INC_Waiver_of_Domestic_and_Foreign.pdf WA_03_010_SHELL_SOLAR_INDUSTRIES_Waiver_of_Domestic_and_Fore.pdf

  13. file://L:\\public\boards\hab\advice\advice67.htm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 John Wagoner, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Subject: TWRS Vadose Zone Characterization Dear Messrs. Clarke, Fitzsimmons and Wagoner: Background In February 1996, new data were disclosed that contamination in the form

  14. Sumas, WA Liquefied Natural Gas Imports (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    (Million Cubic Feet) Sumas, WA Liquefied Natural Gas Imports (Million Cubic Feet) Year Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec 2014 5 2015 4 4 2 1 2016 1 2 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release Date: 5/31/2016 Referring Pages: U.S. Liquefied Natural Gas Imports by Point of Entry Sumas, WA LNG Imports from All Countries

  15. Microsoft Word - WA Parish_MAP_Final.docx

    Energy Savers [EERE]

    W.A. Parish Post-Combustion CO 2 Capture and Sequestration Project U. S. Department of Energy National Energy Technology Laboratory June 2013 INTRODUCTION: The United States (U.S.) Department of Energy (DOE) issued a final environmental impact statement (EIS; DOE/EIS-0473) for the W.A. Parish Post-Combustion CO 2 Capture and Sequestration Project (Parish PCCS Project) in March 2013. DOE announced its decision to provide $167 million in cost-shared funding to NRG Energy, Inc. (NRG) for the


    SciTech Connect (OSTI)



    Washington is called the 'Evergreen State' and it evokes images like this of lush forests, lakes and mountains. However, such images apply primarily to the half of the state west of the Cascade Mountains, where we are today. Eastern Washington state is quite a different matter and I want to draw your attention to a portion of Eastern Washington that is the focus ofmy presentation to you this morning. This image was taken on a part of the Department of Energy's Hanford Site, a 586-square mile government reservation, the second largest DOE facility in the nation . Here you can see where I am talking about, roughly 220 miles southeast of Seattle and about the same distance northeast of Portland.

  17. Washington: Washington's Clean Energy Resources and Economy (Brochure)

    SciTech Connect (OSTI)

    Not Available


    This document highlights the Office of Energy Efficiency and Renewable Energy's investments and impacts in the state of Washington.

  18. Mechanism of somatic hypermutation at the WA motif by human DNA...

    Office of Scientific and Technical Information (OSTI)

    at the WA motif by human DNA polymerase eta Citation Details In-Document Search Title: Mechanism of somatic hypermutation at the WA motif by human DNA polymerase eta Authors: ...

  19. The George Washington University | Open Energy Information

    Open Energy Info (EERE)

    Washington University Jump to: navigation, search Name: The George Washington University Place: Washington, District of Columbia Zip: 20052 Website: Coordinates:...

  20. Klickitat County, Washington: Energy Resources | Open Energy...

    Open Energy Info (EERE)

    Zone Subtype B. Energy Generation Facilities in Klickitat County, Washington Roosevelt Biogas 1 Biomass Facility Places in Klickitat County, Washington Bickleton, Washington...

  1. Good Energies (Washington DC) | Open Energy Information

    Open Energy Info (EERE)

    Good Energies (Washington DC) Name: Good Energies (Washington DC) Address: 1250 24th St., NW, Suite 250 Place: Washington, District of Columbia Zip: 20037 Product: Global investor...

  2. LiveWall Operational Evaluation: Seattle Law Enforcement Pilot

    SciTech Connect (OSTI)

    Barr, Jonathan L.; Burtner, Edwin R.; Stein, Steven L.


    The LiveWall concept envisioned as an outgrowth of the Precision Information Environment (PIE) project allows communications between separate groups using interactive video, audio, and a shared desktop environment; this allows everyone to participate and collaborate in real time, regardless of location. The LiveWall concept provides a virtual window to other locations, where all parties can interact and collaboratively work with each other. This functionality is intended to improve multi-site coordination amongst emergency operations centers (EOC), field operations sites and across organizations and jurisdictions to accommodate communications during routine and emergency events. For the initial LiveWall operational evaluation PNNL partnered with the Seattle Police Department (SPD). This partnership allowed for the creation of an excellent LiveWall test bed specific to law enforcement. This partnership made it possible to test the LiveWall concept with scenarios involving the many facets of the law enforcement work done by SPD. PNNL and SPD agreed that integrating the systems into operations for a real event would be the best test of the technology and give SPD staff greater visibility into the functionality and benefits offered by the LiveWall concept.

  3. file://L:\\public\boards\hab\advice\

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Riveland, Director The Washington Department of Ecology PO Box 47600 Olympia, WA 98504-7600 Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 August 11, 1995 Dear Ms. Riveland and Mr. Clarke: RE: Stewardship and Stockpile Scoping Hearings Enclosed is the Hanford Advisory Board's request toUSDOE to extend the public comment period on the stewardship and stockpile scoping hearings. We also urge the Washington State Department

  4. EIS-0397: Lyle Falls Fish Passage Project, WA

    Broader source: [DOE]

    This EIS analyzes BPA's decision to modify funding to the existing Lyle Falls Fishway on the lower Klickitat River in Klickitat County, WA. The proposed project would help BPA meet its off-site mitigation responsibilities for anadromous fish affected by the development of the Federal Columbia River Power System and increase overall fish production in the Columbia Basin.

  5. EA-1949: Admiralty Inlet Pilot Tidal Project, Puget Sound, WA

    Broader source: [DOE]

    This EA analyzes the potential environmental effects of a proposal by the Public Utility District No. 1 of Snohomish County, Washington to construct and operate the Admiralty Inlet Tidal Project. The proposed 680-kilowatt project would be located on the east side of Admiralty Inlet in Puget Sound, Washington, about 1 kilometer west of Whidbey Island, entirely within Island County, Washington. The Federal Energy Regulatory Commission (FERC) is the lead agency. The DOE NEPA process for this project has been canceled.

  6. EIS-0325: Schultz-Hanford Area Transmission Line Project, WA

    Broader source: [DOE]

    BPA proposes to construct a new 500-kilovolt (kV) transmission line in central Washington. This project would increase transmission system capacity north of Hanford.

  7. RAPID/Roadmap/11-WA-c | Open Energy Information

    Open Energy Info (EERE)

    sites and artifacts, and traditional areas or items of religious, ceremonial and social uses to affected tribes. Washington defines an "Archaeological resource" as any...

  8. RAPID/Roadmap/6-WA-d | Open Energy Information

    Open Energy Info (EERE)

    of a Hydraulic Project Approval Permit issued by the Washington State Department of Fish and Wildlife. State waters include all marine waters and fresh waters of the state,...

  9. Washington Closure Hanford: Cleanup Progress Along Hanford's...

    Broader source: (indexed) [DOE]

    Sax, President, Washington Closure Hanford. Washington Closure Hanford: Cleanup Progress Along Hanford's River Corridor More Documents & Publications 2014 Congressional Nuclear...

  10. WA_01_018_IBM_Waiver_of_Governement_US_and_Foreign_Patent_Ri.pdf |

    Energy Savers [EERE]

    Department of Energy 1_018_IBM_Waiver_of_Governement_US_and_Foreign_Patent_Ri.pdf WA_01_018_IBM_Waiver_of_Governement_US_and_Foreign_Patent_Ri.pdf PDF icon WA_01_018_IBM_Waiver_of_Governement_US_and_Foreign_Patent_Ri.pdf More Documents & Publications WA_04_053_IBM_CORP_Waiver_of_the_Government_U.S._and_Foreign.pdf WA_00_015_COMPAQ_FEDERAL_LLC_Waiver_Domestic_and_Foreign_Pat.pdf Advance Patent Waiver W(A)2002-023

  11. WA_04_047_CATERPILLAR_INC_Waiver_of_Patent_Rights_to_Inventi.pdf |

    Energy Savers [EERE]

    Department of Energy 47_CATERPILLAR_INC_Waiver_of_Patent_Rights_to_Inventi.pdf WA_04_047_CATERPILLAR_INC_Waiver_of_Patent_Rights_to_Inventi.pdf PDF icon WA_04_047_CATERPILLAR_INC_Waiver_of_Patent_Rights_to_Inventi.pdf More Documents & Publications WA_04_046_CATERPILLAR_INC_Waiver_of_Patent_Rights_to_Inventi.pdf WA_04_071_CATERPILLAR_INC_Waiver_of_Patent_Rights_to_Inventi.pdf Advance Patent Waiver W(A)2005-052

  12. WA_04_069__EATON_CORPORATION_Waiver_of_Domestic_and_Foreign_.pdf |

    Energy Savers [EERE]

    Department of Energy 69__EATON_CORPORATION_Waiver_of_Domestic_and_Foreign_.pdf WA_04_069__EATON_CORPORATION_Waiver_of_Domestic_and_Foreign_.pdf PDF icon WA_04_069__EATON_CORPORATION_Waiver_of_Domestic_and_Foreign_.pdf More Documents & Publications WA_04_059_EATON_CORPORATION_Waiver_of_Patent_Rights_Under_a_.pdf WA_02_048_EATON_CORPORATION_Waviver_of_Patent_Rights_Under_A.pdf WA_04_074_EATON_CORPORATION_Waiver_of_Domestic_and_Foreign_I.pdf

  13. Cascade Apartments - Deep Energy Multifamily Retrofit , Kent, Washington (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available


    In December of 2009-10, King County Housing Authority (KCHA) implemented energy retrofit improvements in the Cascade multifamily community, located in Kent, Washington (marine climate.)This research effort involved significant coordination from stakeholders KCHA, WA State Department of Commerce, utility Puget Sound Energy, and Cascade tenants. This report focuses on the following three primary BA research questions : 1. What are the modeled energy savings using DOE low income weatherization approved TREAT software? 2. How did the modeled energy savings compare with measured energy savings from aggregate utility billing analysis? 3. What is the Savings to Investment Ratio (SIR) of the retrofit package after considering utility window incentives and KCHA capitol improvement funding.

  14. EcoCAR 3: Year 1 Finals in Seattle | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    EcoCAR 3: Year 1 Finals in Seattle EcoCAR 3: Year 1 Finals in Seattle Addthis 1 of 11 As part of the EcoCAR 3 Advanced Vehicle Technology Competition, university teams from throughout North America will redesign a 2016 Chevrolet Camaro to reduce its environmental impact while maintaining its "muscle car" performance. Image: Courtesy of EcoCAR 3 2 of 11 As part of EcoCAR 3, university teams will receive a set of keys to a brand new Chevrolet Camaro from General Motors to re-engineer

  15. ,"Washington Natural Gas Underground Storage Volume (MMcf)"

    U.S. Energy Information Administration (EIA) Indexed Site

    Underground Storage Volume (MMcf)" ,"Click worksheet name or tab at bottom for data" ...dnavnghistn5030wa2m.htm" ,"Source:","Energy Information Administration" ,"For Help, ...

  16. Hanford Site, Richland, Washington

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    144 December 2014 Page 1 Activity Specific Categorical Exclusion for U.S. Army Training Exercises and Simulations at the Hanford Site, Richland, Washington 1.0 BACKGROUND Title 10, Part 1021 of the Code of Federal Regulations (10 CFR 1021), "National Environmental Policy Act Implementing Procedures," establishes procedures that the U.S. Department of Energy (DOE) uses to comply with section 102(2) of the National Environmental Policy Act (NEPA) of 1969 [42 U.S.C. 4332(2)] and the

  17. Recent developments: Washington focus

    SciTech Connect (OSTI)


    Congress reconvened on January 23, but most of Washington`s January new involves the Administration. DOE sent two letters to USEC customers, awarded a contract for the independent financial review of the enrichment program, and released a plan for demonstrating AVLIS by 1992. A General Accounting Office (GAO) report investigating the impact of imports of Soviet EUP into the US was made public. Both Congress and the administration are reportedly considering a full-scope US-Soviet Agreement for Nuclear Cooperation. Finally, published reports indicate Congress may consider ending the customs user fee which levies a charge of 0.17% on the value of all imported goods. The fee is felt to violate the General Agreement on Tariffs and Trade (GATT) and is not based on recovering actual Customs costs for processing a good. The fee brings the Treasury over $700 million per year, but the business community plans to lobby hard for its outright elimination or a change in authority to collect the fee based on actual costs.

  18. Washington: Integrated Transportation Programs & Coordinated...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Integrated Transportation Programs & Coordinated Regional Planning Washington: Integrated Transportation Programs & Coordinated Regional Planning November 6, 2013 - 5:42pm Addthis ...

  19. ,"Washington Natural Gas Underground Storage Capacity (MMcf)"

    U.S. Energy Information Administration (EIA) Indexed Site

    Capacity (MMcf)" ,"Click worksheet name or tab at bottom for data" ,"Worksheet Name","Description","# Of Series","Frequency","Latest Data for" ,"Data 1","Washington Natural Gas Underground Storage Capacity (MMcf)",1,"Monthly","2/2016" ,"Release Date:","4/29/2016" ,"Next Release Date:","5/31/2016" ,"Excel File Name:","n5290wa2m.xls"


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    islanding Paper presented at the 36th IEEE Photovoltaic Specialists Conference, Seattle, WA (2011)...


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    islanding Paper presented at the 36th IEEE Photovoltaic Specialists Conference, Seattle, WA (2011)

  2. RAPID/Roadmap/12-WA-a | Open Energy Information

    Open Energy Info (EERE)

    take wildlife from the wild without permission from the Washington State Department of Fish and Wildlife (WDFW). The WDFW issues Live Wildlife Taking Permits under WAC 232-12-064....

  3. Spokane County, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    in Spokane County, Washington Avista Corp City of Cheney, Washington (Utility Company) Modern Electric Water Company Places in Spokane County, Washington Airway Heights, Washington...

  4. WSDE Report: Wastewater Discharge Permits in Washington State...

    Open Energy Info (EERE)

    Wastewater Discharge Permits in Washington State Author Washington State Department of Ecology Organization Washington State Department of Ecology Published Washington State...

  5. WA_97_027_GENERAL_ATOMICS__CORPORATION_Waiver_of_Domestic_an.pdf |

    Energy Savers [EERE]

    Department of Energy 97_027_GENERAL_ATOMICS__CORPORATION_Waiver_of_Domestic_an.pdf WA_97_027_GENERAL_ATOMICS__CORPORATION_Waiver_of_Domestic_an.pdf PDF icon WA_97_027_GENERAL_ATOMICS__CORPORATION_Waiver_of_Domestic_an.pdf More Documents & Publications WA_99_014_UNITED_SOLAR_SYSTEMS_CORP_Waiver_of_Domestic_and_F.pdf Class Patent Waiver W(C)2004-001 WA_97_006_MOTOROLA_MANUFACTURING_SYSTEMS_Waiver_of_Patent_Ri

  6. DOE Zero Energy Ready Home Case Study: TC Legend Homes, Bellingham, WA |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Bellingham, WA DOE Zero Energy Ready Home Case Study: TC Legend Homes, Bellingham, WA DOE Zero Energy Ready Home Case Study: TC Legend Homes, Bellingham, WA Case study of a DOE Zero Energy Ready home in Bellingham, WA, that achieves HERS 43 without PV or HERS 13 with 3.2 kW of PV. The 1,055-ft2 two-story production home has 6-in. SIP walls, a 10-in. SIP roof, and ICF foundation walls with R-20 high-density rigid EPS foam under the slab. A single ductless heat pump heats

  7. Washington: Community Power Works is Building a More Efficient...

    Broader source: (indexed) [DOE]

    the awe-inspiring Puget Sound, Seattle has a legacy of environmental stewardship and a culture of innovation. Combined with thoughtful leadership on climate change, these are the...

  8. Washington: Community Power Works is Building a More Efficient...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Working with Craft3, a community development financial institution, Seattle households are able to finance their efficiency improvements at low interest rates with repayments via ...

  9. Washington Coastal Zone Management Regulatory Handbook | Open...

    Open Energy Info (EERE)

    to library PermittingRegulatory Guidance - GuideHandbook: Washington Coastal Zone Management Regulatory HandbookPermittingRegulatory GuidanceGuideHandbook Author Washington...

  10. Washington Electric Coop, Inc | Open Energy Information

    Open Energy Info (EERE)

    search Name: Washington Electric Coop, Inc Place: Ohio Website: Facebook: https:www.facebook.comWashingtonElectricCoop Outage Hotline: 740-373-2141...

  11. Washington TRU Solutions Inc | Open Energy Information

    Open Energy Info (EERE)

    Washington TRU Solutions Inc Jump to: navigation, search Name: Washington TRU Solutions, Inc. Place: Carlsbad, New Mexico Zip: 88220 Product: New Mexico-based managing and...

  12. Voluntary Protection Program Onsite Review, Washington Closure...

    Office of Environmental Management (EM)

    Washington Closure Hanford VPP Report - March 2009 Voluntary Protection Program Onsite Review, Washington Closure Hanford VPP Report - March 2009 March 2009 Evaluation to determine...


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    " "'- STATE OF WASHINGTON DEPARTMENT OF ECOLOGY p.o. Box 47600 .Olympja, Washington 98504-7600 (360) 4076000 .TOD Only (Hearing Impaired) (360) 407-6006 ,'""""" .w.--.- ...

  14. Washington Environmental Permit Handbook - 401 Water Quality...

    Open Energy Info (EERE)

    Regulatory GuidanceGuideHandbook Author Washington State Department of Ecology Published Washington State Department of Ecology, 2014 DOI Not Provided Check for DOI...

  15. Preliminary Notice of Violation, Washington Group International...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Group International - EA-2003-07 Preliminary Notice of Violation, Washington Group International - EA-2003-07 October 23, 2003 Issued to Washington Group International related to ...

  16. Washington/Incentives | Open Energy Information

    Open Energy Info (EERE)

    - Residential Energy Efficiency Rebate Programs (Washington) Utility Rebate Program Yes Biodiesel and Alcohol Fuel Blend Sales Tax Exemption (Washington) Sales Tax Incentive No...

  17. Leadership through Effective Communication (FLD 142), Washington...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Leadership through Effective Communication (FLD 142), Washington DC Leadership through Effective Communication (FLD 142), Washington DC April 25, 2016 8:00AM EDT to April 27, 2016 ...

  18. Harold Washington Social Security Administration (SSA) Center...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Harold Washington Social Security Administration (SSA) Center Water Conservation and Green Energy Harold Washington Social Security Administration (SSA) Center Water Conservation ...

  19. Voluntary Protection Program Onsite Review, Washington River...

    Energy Savers [EERE]

    Washington River Protection Solutions, LLC, Hanford - Feb 2014 Voluntary Protection Program Onsite Review, Washington River Protection Solutions, LLC, Hanford - Feb 2014 February...

  20. EA-1096: Washington Wildlife Mitigation Projects (Programmatic), Washington

    Broader source: [DOE]

    This EA evaluates the environmental impacts of the proposal for the U.S. Department of Energy Bonneville Power Administration to fund the portion of the Washington Wildlife Mitigation Agreement...

  1. Washington: Putting More Solar on More Rooftops in Washington...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    with a ribbon cutting at the Auto-Spa car wash. Mercer Island celebrates the 500th Solarize installation in the state of Washington with a ribbon cutting at the Auto-Spa car wash. ...


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7, 2001 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Harry Boston, Manager U.S. Department of Energy, Office of River Protection 2440 Stevens Richland, WA 99352 Chuck Findley, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Re: Community Relations Plan Dear Messrs. Klein,

  3. file://L:\\public\boards\hab\advice\advice75.htm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1997 Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 John Wagoner, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Subject: ERDF Expansion Dear Messrs. Clarke, Fitzsimmons and Wagoner: The U.S. Environmental Protection Agency, the Washington State Department of Ecology, and the U.S.

  4. Washington Gas- Residential Rebate Program

    Broader source: [DOE]

    Washington Gas as a part of the Maryland EmPOWER program offers incentives to its residential customer for making energy efficiency improvements. Rebates are available for qualifying water heaters,...

  5. Washington City Power- Net Metering

    Broader source: [DOE]

    Washington City adopted a net-metering program, including interconnection procedures, in January 2008, and updated the policy in December 2014.* Net metering is available to any customer of...

  6. Washington Gas- Commercial Rebate Program

    Broader source: [DOE]

    Washington Gas as a part of the Maryland EmPOWER program offers incentives to its commercial customer for making energy efficiency improvements. Rebates are available for qualifying water heaters,...

  7. Washington Post editor David E.

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Department of Energy Washington Auto Show Spotlight: How Fuel Cell Electric Vehicles Work Washington Auto Show Spotlight: How Fuel Cell Electric Vehicles Work January 27, 2015 - 12:57pm Addthis The Hyundai Tucson FCEV is currently available for lease in Southern California for less than $500 per month, including free hydrogen fuel. Hydrogen for FCEVs can be produced from a variety of resources all providing emission reductions. Hydrogen derived from natural gas reduces emissions by half and

  8. file://L:\\public\boards\hab\advice\advice04.htm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Mary Riveland, Director Department of Ecology State of Washington PO Box 47600 Olympia, WA 98504-7600 September 22, 1994 Dear Messrs. Wagoner and Clarke, and Ms. Riveland: On behalf of the Hanford Advisory Board, I am forwarding to you the following statement of concerns, which was adopted by the Board at the September 8 & 9 meeting: The cleanup of contaminated sites and

  9. Washington River Protection Solutions - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contracting Washington River Protection Solutions Contracting ORP Contracts and Procurements RL Contracts and Procurements CH2M HILL Plateau Remediation Company Mission Support Alliance Washington Closure Hanford HPM Corporation (HPMC) Wastren Advantage, Inc. Bechtel National, Inc. Washington River Protection Solutions Washington River Protection Solutions Email Email Page | Print Print Page |Text Increase Font Size Decrease Font Size Washington River Protection Solutions, LLC logo The operation

  10. Advance Patent Waiver W(A)2006-028 | Department of Energy

    Energy Savers [EERE]

    6-028 Advance Patent Waiver W(A)2006-028 This document waives certain patent rights the Department of Energy (DOE) has to inventions conceived or first actually reduced to practice by COLONY PROJECT under agreement SUBC-B555909, as the DOE has determined that granting such a waiver best serves the interests of the United States and the general public. PDF icon Advance Patent Waiver W(A)2006-028 More Documents & Publications Advance Patent Waiver W(A)2005-048 2011_INCITE_Fact_Sheets.pdf

  11. Advance Patent Waiver W(A)2012-021 | Department of Energy

    Energy Savers [EERE]

    2-021 Advance Patent Waiver W(A)2012-021 This document waives certain patent rights the Department of Energy (DOE) has to inventions conceived or first actually reduced to practice by USEC, INC. under agreement DE-NE0000488, as the DOE has determined that granting such a waiver best serves the interests of the United States and the general public. PDF icon Advance Patent Waiver W(A)2012-021 More Documents & Publications WA_1993_042_UNITED_TECHNOLOGIES_CORPORATION_Waiver_of_the_Go.pdf

  12. DOE Zero Energy Ready Home Case Study: Clifton View Homes, Coupeville, WA,

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Systems Home | Department of Energy Coupeville, WA, Systems Home DOE Zero Energy Ready Home Case Study: Clifton View Homes, Coupeville, WA, Systems Home Case study of a DOE Zero Energy Ready Home on Whidbey Island, WA, that scored HERS 45 without PV. This 2,908-square-foot custom/system home has a SIP roof and walls, R-20 rigid foam under slab, triple-pane windows, ground source heat pump for radiant floor heat, and a unique balanced ventilation system using separate exhaust fans to bring

  13. Fisher & Paykel Appliances: ENERGY STAR Referral (WA42T26GW1) | Department

    Energy Savers [EERE]

    of Energy Fisher & Paykel Appliances: ENERGY STAR Referral (WA42T26GW1) Fisher & Paykel Appliances: ENERGY STAR Referral (WA42T26GW1) June 12, 2013 DOE referred the matter of Fisher & Paykel Appliances residential clothes washer, model WA42T26GW1, to the U.S. Environmental Protection Agency, brand manager for the ENERGY STAR Program, for appropriate action after DOE testing showed that the model does not meet the ENERGY STAR specification. PDF icon Fisher & Paykel Appliances:

  14. EIS-0189: Tank Waste Remediation System (TWRS), Richland, WA (Programmatic)

    Broader source: [DOE]

    This environmental impact statement evaluates the Department of Energy (DOE)'s, in cooperation with the Washington State Department of Ecology (Ecology), decisions on how to properly manage and dispose of Hanford Site tank waste and encapsulated cesium and strontium to reduce existing and potential future risk to the public, Site workers, and the environment. The waste includes radioactive, hazardous, and mixed waste currently stored in 177 underground storage tanks, approximately 60 other smaller active and inactive miscellaneous underground storage tanks (MUSTs), and additional Site waste likely to be added to the tank waste, which is part of the tank farm system. In addition, DOE proposes to manage and dispose of approximately 1,930 cesium and strontium capsules that are by-products of tank waste. The tank waste and capsules are located in the 200 Areas of the Hanford Site near Richland, Washington.

  15. Washington Lease Purchase Case Study | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Washington Lease Purchase Case Study Washington Lease Purchase Case Study Washington's Centralia School District pulled together several sources of funding to make 1.3 million in ...

  16. Washington State Department of Natural Resources | Open Energy...

    Open Energy Info (EERE)

    Natural Resources Jump to: navigation, search Logo: Washington State Department of Natural Resources Name: Washington State Department of Natural Resources Address: 1111 Washington...

  17. Washington State Department of Ecology | Open Energy Information

    Open Energy Info (EERE)

    Ecology Jump to: navigation, search Logo: Washington State Department of Ecology Name: Washington State Department of Ecology Place: Lacey, Washington Zip: 98503 References:...

  18. Gig Harbor, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Washington. It falls under Washington's 6th congressional district.12 Registered Energy Companies in Gig Harbor, Washington Inventure Chemical Technology Structural...

  19. Washington -- SEP Summary of Reported Data | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Summary of Reported Data Washington -- SEP Summary of Reported Data Summary of data reported by Better Buildings Neighborhood Program partner Washington -- SEP. PDF icon Washington ...

  20. Washington State Species of Concern Lists | Open Energy Information

    Open Energy Info (EERE)

    Web Site: Washington State Species of Concern Lists Author Washington Department of Fish & Wildlife Published State of Washington, Date Not Provided DOI Not Provided Check for...

  1. PROJECT PROFILE: George Washington University

    Broader source: [DOE]

    The GW Solar Institute at the George Washington University is developing multimedia solar energy training materials that can be used to train a spectrum of diverse audiences. The resulting solar knowledge library serves as an invaluable resource for other STEP awardees who are directly engaging and training communities as diverse as real estate agents, financiers, and state regulators and policymakers.

  2. Advance Patent Waiver W(A)2010-006 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Advance Patent Waiver W(A)2010-006 This document waives certain patent rights the Department of Energy (DOE) has to inventions conceived or first actually reduced to practice by ...

  3. DOE Zero Energy Ready Home Case Study: TC Legend Homes, Bellingham, WA

    Broader source: [DOE]

    Case study of a DOE Zero Energy Ready home in Bellingham, WA, that achieves HERS 43 without PV or HERS 13 with 3.2 kW of PV.

  4. Hatton, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Map This article is a stub. You can help OpenEI by expanding it. Hatton is a town in Adams County, Washington. It falls under Washington's 5th congressional district.12...

  5. Lind, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Hide Map This article is a stub. You can help OpenEI by expanding it. Lind is a town in Adams County, Washington. It falls under Washington's 5th congressional district.12...

  6. Othello, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Map This article is a stub. You can help OpenEI by expanding it. Othello is a city in Adams County, Washington. It falls under Washington's 4th congressional district.12...

  7. Richland, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Hide Map This article is a stub. You can help OpenEI by expanding it. Richland is a city in Benton County, Washington. It falls under Washington's 4th congressional...

  8. Washington Elec Member Corp | Open Energy Information

    Open Energy Info (EERE)

    Washington Elec Member Corp Jump to: navigation, search Name: Washington Elec Member Corp Place: Georgia Phone Number: 478-552-2577; 1-800-552-2577 Website:

  9. An Economic Engine for Washington State

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search) An Economic Engine for Washington State When Washington State leaders share their visions for a vibrant future, certain priorities rise to the top: jobs, education, and an...

  10. Issaquah, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Map This article is a stub. You can help OpenEI by expanding it. Issaquah is a city in King County, Washington. It falls under Washington's 8th congressional district.12...

  11. Duvall, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Map This article is a stub. You can help OpenEI by expanding it. Duvall is a city in King County, Washington. It falls under Washington's 8th congressional district.12...

  12. Carnation, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Map This article is a stub. You can help OpenEI by expanding it. Carnation is a city in King County, Washington. It falls under Washington's 8th congressional district.12...

  13. Burien, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Map This article is a stub. You can help OpenEI by expanding it. Burien is a city in King County, Washington. It falls under Washington's 7th congressional district and...

  14. Algona, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Map This article is a stub. You can help OpenEI by expanding it. Algona is a city in King County, Washington. It falls under Washington's 9th congressional district.12...

  15. Redmond, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Map This article is a stub. You can help OpenEI by expanding it. Redmond is a city in King County, Washington. It falls under Washington's 1st congressional district and...

  16. Pacific, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Map This article is a stub. You can help OpenEI by expanding it. Pacific is a city in King County and Pierce County, Washington. It falls under Washington's 9th congressional...

  17. Auburn, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Map This article is a stub. You can help OpenEI by expanding it. Auburn is a city in King County and Pierce County, Washington. It falls under Washington's 8th congressional...

  18. Enumclaw, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Map This article is a stub. You can help OpenEI by expanding it. Enumclaw is a city in King County, Washington. It falls under Washington's 8th congressional district.12...

  19. Renton, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Map This article is a stub. You can help OpenEI by expanding it. Renton is a city in King County, Washington. It falls under Washington's 7th congressional district and...

  20. Medina, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Map This article is a stub. You can help OpenEI by expanding it. Medina is a city in King County, Washington. It falls under Washington's 8th congressional district.12...

  1. Newcastle, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Map This article is a stub. You can help OpenEI by expanding it. Newcastle is a city in King County, Washington. It falls under Washington's 8th congressional district.12...

  2. Shoreline, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Map This article is a stub. You can help OpenEI by expanding it. Shoreline is a city in King County, Washington. It falls under Washington's 1st congressional district and...

  3. Kenmore, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Map This article is a stub. You can help OpenEI by expanding it. Kenmore is a city in King County, Washington. It falls under Washington's 1st congressional district.12...

  4. Woodinville, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    This article is a stub. You can help OpenEI by expanding it. Woodinville is a city in King County, Washington. It falls under Washington's 1st congressional district.12...

  5. Snoqualmie, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    This article is a stub. You can help OpenEI by expanding it. Snoqualmie is a city in King County, Washington. It falls under Washington's 8th congressional district.12...

  6. Bellevue, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Map This article is a stub. You can help OpenEI by expanding it. Bellevue is a city in King County, Washington. It falls under Washington's 8th congressional district.12...

  7. Sammamish, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Map This article is a stub. You can help OpenEI by expanding it. Sammamish is a city in King County, Washington. It falls under Washington's 8th congressional district.12...

  8. Covington, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Map This article is a stub. You can help OpenEI by expanding it. Covington is a city in King County, Washington. It falls under Washington's 8th congressional district.12...

  9. Milton, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Map This article is a stub. You can help OpenEI by expanding it. Milton is a city in King County and Pierce County, Washington. It falls under Washington's 9th congressional...

  10. Tukwila, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Map This article is a stub. You can help OpenEI by expanding it. Tukwila is a city in King County, Washington. It falls under Washington's 7th congressional district and...

  11. Bothell, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Map This article is a stub. You can help OpenEI by expanding it. Bothell is a city in King County and Snohomish County, Washington. It falls under Washington's 1st congressional...

  12. Skykomish, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Map This article is a stub. You can help OpenEI by expanding it. Skykomish is a town in King County, Washington. It falls under Washington's 2nd congressional district.12...

  13. Kent, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Hide Map This article is a stub. You can help OpenEI by expanding it. Kent is a city in King County, Washington. It falls under Washington's 8th congressional district and...

  14. Washington DC | OpenEI Community

    Open Energy Info (EERE)

    DC Home Linked Open Data Workshop in Washington, D.C. Description: A group organizing the LOD workshop in Washington, D.C. in fall 2012 A follow-up event to the successful LOD...

  15. Advance Patent Waiver W(A)2008-006 | Department of Energy

    Energy Savers [EERE]

    8-006 Advance Patent Waiver W(A)2008-006 This document waives certain patent rights the Department of Energy (DOE) has to inventions conceived or first actually reduced to practice by CATERPILLAR, INC under agreement DE-FC26-00AL67017, as the DOE has determined that granting such a waiver best serves the interests of the United States and the general public. PDF icon Advance Patent Waiver W(A)2008-006 More Documents & Publications

  16. Advance Patent Waiver W(A)2010-037 | Department of Energy

    Energy Savers [EERE]

    7 Advance Patent Waiver W(A)2010-037 This document waives certain patent rights the Department of Energy (DOE) has to inventions conceived or first actually reduced to practice by ALCATEL-LUCENT USA INC. under agreement DE-EE0002895, as the DOE has determined that granting such a waiver best serves the interests of the United States and the general public. PDF icon Advance Patent Waiver W(A)2010-037 More Documents & Publications A

  17. Advance Patent Waiver W(A)2010-038 | Department of Energy

    Energy Savers [EERE]

    8 Advance Patent Waiver W(A)2010-038 This document waives certain patent rights the Department of Energy (DOE) has to inventions conceived or first actually reduced to practice by ALCATEL-LUCENT USA INC. under agreement DE-EE0002887, as the DOE has determined that granting such a waiver best serves the interests of the United States and the general public. PDF icon Advance Patent Waiver W(A)2010-038 More Documents & Publications A

  18. Washington, D.C. - Local Information | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Department of Energy Washington School District Makes the Grade in Energy Efficiency Washington School District Makes the Grade in Energy Efficiency September 2, 2015 - 10:01am Addthis As part of the Better Buildings Challenge, Camas School District in Washington not only surpassed its energy efficiency goals, but did so five years early. | Photo courtesy of Camas School District. As part of the Better Buildings Challenge, Camas School District in Washington not only surpassed its energy

  19. EIS-0456: Cushman Hydroelectric Project, Tacoma, Washington

    Broader source: [DOE]

    This EIS is for the design and construction of certain components of the Cushman Hydroelectric Project in Mason County, Washington.

  20. Washington -- SEP Data Dashboard | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data Dashboard Washington -- SEP Data Dashboard The data dashboard for Washington -- SEP, a partner in the Better Buildings Neighborhood Program. File Washington -- SEP Data Dashboard More Documents & Publications Santa Barbara County, California Data Dashboard Kansas City Data Dashboard Massachusetts -- SEP Data Dashboard

  1. Building America Case Study: Habitat for Humanity, The Woods at Golden Given, Tacoma, Washington (Fact Sheet), Whole-House Solutions for New Homes, Energy Efficiency & Renewable Energy (EERE)

    Energy Savers [EERE]

    Testing Ductless Heat Pumps in High-Performance Affordable Housing The Woods at Golden Given Tacoma, Washington PROJECT INFORMATION Construction: New home Type: Single-family, affordable Partners: Tacoma Public Utilities, Habitat for Humanity of Tacoma/ Pierce County, WA, Building America Partnership for Improved Residential Construction, Size: 1,133-1,391 ft 2 (monitored), 950-2500 ft 2 (all homes) Date Completed: 2013-2015 Climate Zone: Marine PRELIMINARY

  2. Final Report

    Office of Scientific and Technical Information (OSTI)

    Internal magnetic field, temperature, and density measurements on magnetized HED plasmas using Pulsed Polarimetry DOE Grant ER55034, UW grant # 61-9515 - High Energy Density, Office of Fusion Science Roger J Smith (PI) Dept. Aeronautics and Astronautics, University of Washington, Seattle, Wa 98195, 206 543 6323 (AA grants administrator) June 11, 2014 Report submitted to: Formerly Dr. Francis Thio Program Manager, DOE Office of Fusion Energy Sciences Nominal Grant Period:

  3. Microsoft Word - RM1_Tidal Turbine_UW Tidal Resource-Abstract.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reference Model #1 - Tidal Energy: Resource Dr. Brian Polagye Northwest National Marine Renewable Energy Center University of Washington, Seattle, WA Introduction Reference Model #1 is a tidal turbine operating in a narrow, tidal channel. The site is a generalized version of Tacoma Narrows, Puget Sound, Washington. The resource is a mixed, mainly semidiurnal tidal regime with two ebbs and floods each day of unequal strength (i.e., a diurnal inequality in which a strong ebb/flood exchange is

  4. Reference Model #1 - Tidal Energy: Resource Dr. Brian Polagye

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reference Model #1 - Tidal Energy: Resource Dr. Brian Polagye Northwest National Marine Renewable Energy Center University of Washington, Seattle, WA 1 Introduction Reference Model #1 is a tidal turbine operating in a narrow, tidal channel. The site is a generalized version of Tacoma Narrows, Puget Sound, Washington. The resource is a mixed, mainly semidiurnal tidal regime with two ebbs and floods each day of unequal strength (i.e., a diurnal inequality in which a strong ebb/flood exchange is

  5. Workplace Charging Challenge Partner: Washington Area New Automobile...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Washington Area New Automobile Dealers Association Workplace Charging Challenge Partner: Washington Area New Automobile Dealers Association Workplace Charging Challenge Partner: ...

  6. Washington State Department of Transportation | Open Energy Informatio...

    Open Energy Info (EERE)

    Transportation Jump to: navigation, search Logo: Washington State Department of Transportation Name: Washington State Department of Transportation Abbreviation: WDOT Place:...

  7. Washington's 7th congressional district: Energy Resources | Open...

    Open Energy Info (EERE)

    7th congressional district ARCH Venture Partners (Washington) Northwest National Marine Renewable Energy Center Washington Technology Center Registered Networking...

  8. Newseum Washington, D.C.

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    , 2016 Newseum Washington, D.C. Shaping the future of the marine and hydrokinetic energy industry EXECUTIVE SUMMIT ON MARINE AND HYDROKINETIC RESEARCH AND DEVELOPMENT LETTER FROM THE DIRECTOR Dear Industry Executive, I would like to take this opportunity to personally welcome you to the Executive Summit on Marine and Hydrokinetic (MHK) Research and Development presented by the U.S. Department of Energy Wind and Water Power Technologies Office. We are excited to bring together executive members

  9. Workplace Charging Challenge Partner: Washington Area New Automobile

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Dealers Association | Department of Energy Washington Area New Automobile Dealers Association Workplace Charging Challenge Partner: Washington Area New Automobile Dealers Association Workplace Charging Challenge Partner: Washington Area New Automobile Dealers Association Joined the Challenge: February 2015 Headquarters: Washington, DC Charging Location: Washington, DC Domestic Employees: 18 Washington Area New Automobile Dealers Association (WANADA) serves as the representative organization

  10. file://L:\\public\boards\hab\advice\advice06.htm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1, 1994 John Wagoner, Manager Department of Energy, Richland Operations Office PO Box 550 (A7-50) Richland, WA 99352 Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Mary Riveland, Director Department of Ecology State of Washington PO Box 47600 Olympia, WA 98504-7600 Dear Messrs. Wagoner and Clarke and Ms. Riveland: On behalf of the Hanford Advisory Board, I am pleased to forward to you the advice the Board adopted at its

  11. file://L:\\public\boards\hab\advice\

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7, 2000 Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Subject: 618-10 and 618-11 Burial Grounds Dear Messrs. Clarke, Fitzsimmons, and Klein: The Hanford Advisory Board (HAB) has an acute concern with regard to the

  12. file://L:\\public\boards\hab\advice\advice91.htm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2, 1999 Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 James Hall, Acting Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Subject: Plutonium Finishing Plant Dear Messrs. Clarke, Fitzsimmons and Hall: The Plutonium Finishing Plant (PFP) contains 17.8 metric tons of plutonium bearing

  13. file://L:\\public\boards\hab\advice\advice93.htm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 James Hall, Acting Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Subject: Tri-Party Agreement Milestones and Public Involvement Dear Messrs. Clarke, Fitzsimmons and Hall: The safe treatment and disposal of Hanford's tank waste remains a top priority of the Hanford Advisory Board (HAB). This advice recommends both

  14. file://L:\\public\boards\hab\advice\

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 James Hall, Acting Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Subject: U.S. Department of Energy Fiscal Year 2001 Budget Dear Messrs. Clarke, Fitzsimmons and Hall: The Hanford Advisory Board (HAB) has completed its review of the


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 John Iani, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Re: 100/300 Area Change Package Dear Messrs. Klein, Iani, and Fitzsimmons The Hanford Advisory Board applauds the Tri-Party agencies for reaching agreement on a proposed

  16. Microsoft Word - HABAdv #170 Hanford Buried Waste.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    70 Subject: Hanford Buried Waste Adopted: March 4, 2005 Page 1 March 4, 2005 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Roy Schepens, Manager U.S. Department of Energy, Office of River Protection P.O. Box 450 (H6-60) Richland, WA 99352 Ron Kreizenbeck, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Jay Manning, Director Washington State Department of Ecology P.O. Box 47600

  17. HABAdv#1671.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 Subject: U Plant Closure Plan Adopted: September 10, 2004 Page 1 September 10, 2004 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Linda Hoffman, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Ron Kreizeneeck, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Subject: U Plant Closure Plan Dear Mssrs. Klein, Kreizeneeck, and Ms.

  18. Habadv#165 RCBRA.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 Subject: River Corridor Baseline Risk Assessment (RCBRA) Adopted: September 10, 2004 Page 1 September 10, 2004 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Ron Kreizeneeck, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Linda Hoffman, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Subject: Risk Assessment Work Plan for the 100 Area

  19. Habadv-119.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 Subject: B Reactor Engineering Evaluation and Cost Analysis Adopted: June 8, 2001 Page 1 June 8, 2001 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Chuck Findley, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Re: B Reactor Engineering Evaluation and Cost Analysis Dear

  20. Washington,

    Energy Savers [EERE]

    DC 20585 December 20, 2005 MEMORANDUM FOR THE ADMINISTRATOR, NATIONAL NUCLEAR SECURITY ADMINISTRATION CHIEF FINANCIAL OFFICER DIRECTOR, OFFICE OF MANAGEMENT FROM: William S. Maharay Deputy Inspector General for Audit Services Office of Inspector General SUBJECT: Audit Report on "Federal Managers' Financial Integrity Act" Audit Report No.: OAS-L-06-04 We reviewed selected aspects of the Department.of Energy's (Department) implementation of the Federal Managers' Financial Integrity Act

  1. Washington

    Broader source: (indexed) [DOE]

    comparable assessment of results. As part of the review process, the Contractor Supply Chain Council (CSCC) was tasked to survey and catalog all cost savings methods and measures...

  2. City of Centralia, Washington (Utility Company) | Open Energy...

    Open Energy Info (EERE)

    Company) Jump to: navigation, search Name: City of Centralia Address: 500 N Pearl Street Place: Centralia, WA Zip: 98531 Phone Number: 360-330-7657 Website:...

  3. City of Ellensburg, Washington (Utility Company) | Open Energy...

    Open Energy Info (EERE)

    Company) Jump to: navigation, search Name: City of Ellensburg Address: 501 North Anderson Street Place: Ellensburg, WA Zip: 98926 Phone Number: (509) 962-7204 Website:...

  4. Port Townsend, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    (Redirected from Port Townsend, WA) Jump to: navigation, search Equivalent URI DBpedia Coordinates 48.1170387, -122.7604472 Show Map Loading map... "minzoom":false,"mappingser...

  5. DOE - Office of Legacy Management -- University of Washington...

    Office of Legacy Management (LM)

    for residual radioactive contamination considered remote - Operating under active NRC license WA.0-01-1 Radioactive Materials Handled: Yes Primary Radioactive Materials...

  6. Washington Nuclear Profile - Power Plants

    U.S. Energy Information Administration (EIA) Indexed Site

    Washington nuclear power plants, summer capacity and net generation, 2010" "Plant name/total reactors","Summer capacity (mw)","Net generation (thousand mwh)","Share of State nuclear net generation (percent)","Owner" "Columbia Generating Station Unit 2","1,097","9,241",100.0,"Energy Northwest" "1 Plant 1 Reactor","1,097","9,241",100.0

  7. Sherwood, Washington, Disposal Site Fact Sheet

    Office of Legacy Management (LM)

    Sherwood, Washington, Disposal Site This fact sheet provides information about the Sherwood, Washington, Disposal Site. This site is managed by the U.S. Department of Energy Office of Legacy Management under Title II of the Uranium Mill Tailings Radiation Control Act of 1978. Location of the Sherwood, Washington, Disposal Site Site Description and History The Sherwood disposal site is a former uranium-ore processing site operated by Western Nuclear, Inc. The site is in Stevens County near the

  8. Federal Utility Partnership Working Group Meeting: Washington...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Federal Utility Partnership Working Group Meeting: Washington Update PDF icon fupwgspring12unruh.pdf More Documents & Publications Federal Utility Partnership Working Group ...

  9. Washington Gas- Commercial Efficiency Rebate Program

    Broader source: [DOE]

    Washington Gas offers rebates to commercial customers for the purchase and installation of energy efficient equipment. Rebates for available for water heating, space heating, boilers, and for...

  10. SSL Demonstration: Parking Garage Lighting, Washington, DC

    SciTech Connect (OSTI)


    GATEWAY program report brief summarizing an SSL parking garage demonstration at the Dept. of Labor headquarters parking garage in Washington, DC.

  11. BLM Washington Office | Open Energy Information

    Open Energy Info (EERE)

    www.blm.govwosteninfodire References: BLM Washington Office1 Cite error: tags exist, but no tag was found Retrieved from "http:en.openei.orgw...

  12. ,"Washington Natural Gas LNG Storage Withdrawals (MMcf)"

    U.S. Energy Information Administration (EIA) Indexed Site

    Of Series","Frequency","Latest Data for" ,"Data 1","Washington Natural Gas LNG Storage Withdrawals (MMcf)",1,"Annual",2014 ,"Release Date:","9302015" ,"Next Release...

  13. ,"Washington Natural Gas LNG Storage Additions (MMcf)"

    U.S. Energy Information Administration (EIA) Indexed Site

    Of Series","Frequency","Latest Data for" ,"Data 1","Washington Natural Gas LNG Storage Additions (MMcf)",1,"Annual",2014 ,"Release Date:","9302015" ,"Next Release...

  14. Washington, Maine: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Washington, Maine: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 44.2736858, -69.3672657 Show Map Loading map... "minzoom":false,"mappingserv...

  15. Marchetti New CEO of Washington TRU Solutions

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Release Marchetti New CEO of Washington TRU Solutions CARLSBAD, N.M., July 31, 2003 - Stephen Marchetti, Executive Vice President of Operations for the Energy and Environment unit...

  16. Tacoma, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    9th congressional district.12 Energy Generation Facilities in Tacoma, Washington Simpson Tacoma Biomass Facility References US Census Bureau Incorporated place and minor...

  17. Washington County, Tennessee: Energy Resources | Open Energy...

    Open Energy Info (EERE)

    4 Climate Zone Subtype A. Places in Washington County, Tennessee Fall Branch, Tennessee Gray, Tennessee Johnson City, Tennessee Jonesborough, Tennessee Midway, Tennessee Oak Grove,...

  18. Washington Working Natural Gas Underground Storage Capacity ...

    Gasoline and Diesel Fuel Update (EIA)

    Working Natural Gas Underground Storage Capacity (Million Cubic Feet) Washington Working Natural Gas Underground Storage Capacity (Million Cubic Feet) Year Jan Feb Mar Apr May Jun...

  19. Ferndale, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Ferndale, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 48.8464991, -122.5910056 Show Map Loading map... "minzoom":false,"mapping...

  20. Rochester, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Rochester, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 46.8217664, -123.0962516 Show Map Loading map... "minzoom":false,"mappin...

  1. Lacey, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Lacey, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 47.0342629, -122.8231915 Show Map Loading map... "minzoom":false,"mappingser...

  2. Ritzville, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Ritzville, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 47.1273723, -118.3799751 Show Map Loading map... "minzoom":false,"mappin...

  3. Washtucna, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Washtucna, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 46.7565354, -118.3105282 Show Map Loading map... "minzoom":false,"mappin...

  4. Aberdeen, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Aberdeen, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 46.9753708, -123.8157218 Show Map Loading map... "minzoom":false,"mapping...

  5. Ahtanum, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Ahtanum, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 46.5595702, -120.6220123 Show Map Loading map... "minzoom":false,"mappings...

  6. Acme, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Acme, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 48.7170574, -122.2051584 Show Map Loading map... "minzoom":false,"mappingserv...

  7. ,"Washington Natural Gas Underground Storage Withdrawals (MMcf...

    U.S. Energy Information Administration (EIA) Indexed Site

    Name","Description"," Of Series","Frequency","Latest Data for" ,"Data 1","Washington Natural Gas Underground Storage Withdrawals (MMcf)",1,"Annual",2014 ,"Release...

  8. ,"Washington Natural Gas Vehicle Fuel Consumption (MMcf)"

    U.S. Energy Information Administration (EIA) Indexed Site

    Name","Description"," Of Series","Frequency","Latest Data for" ,"Data 1","Washington Natural Gas Vehicle Fuel Consumption (MMcf)",1,"Annual",2014 ,"Release Date:","930...

  9. Washington Parish, Louisiana: Energy Resources | Open Energy...

    Open Energy Info (EERE)

    Washington Parish, Louisiana: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 30.6163073, -92.057063 Show Map Loading map......

  10. Spokane, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Spokane, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 47.6587802, -117.4260466 Show Map Loading map... "minzoom":false,"mappings...

  11. Vancouver, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Vancouver, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 45.6387281, -122.6614861 Show Map Loading map... "minzoom":false,"mappin...

  12. Rainier, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Rainier, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 46.888155, -122.6884595 Show Map Loading map... "minzoom":false,"mappingse...

  13. ,"Washington Natural Gas Input Supplemental Fuels (MMcf)"

    U.S. Energy Information Administration (EIA) Indexed Site

    Name","Description"," Of Series","Frequency","Latest Data for" ,"Data 1","Washington Natural Gas Input Supplemental Fuels (MMcf)",1,"Annual",2014 ,"Release Date:","09...

  14. Bucoda, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Bucoda, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 46.7989899, -122.8698523 Show Map Loading map... "minzoom":false,"mappingse...

  15. Kirkland, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Kirkland, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 47.6814875, -122.2087353 Show Map Loading map... "minzoom":false,"mapping...

  16. Tenino, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Tenino, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 46.8567662, -122.8529094 Show Map Loading map... "minzoom":false,"mappingse...

  17. Olympia, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Olympia, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 47.0378741, -122.9006951 Show Map Loading map... "minzoom":false,"mappings...

  18. ,"Washington Natural Gas Underground Storage Capacity (MMcf)...

    U.S. Energy Information Administration (EIA) Indexed Site

    Name","Description"," Of Series","Frequency","Latest Data for" ,"Data 1","Washington Natural Gas Underground Storage Capacity (MMcf)",1,"Annual",2014 ,"Release...

  19. Spokane, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Washington Avista Corp References US Census Bureau Incorporated place and minor civil division population dataset (All States, all geography) US Census Bureau...

  20. Bonneville Power Administration, Oregon Energy Northwest, Washington...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Bonneville Power Administration, Oregon Energy Northwest, Washington; Wholesale Electric Primary Credit Analyst: David N Bodek, New York (1) 212-438-7969; david.bodek@standardandpo...

  1. Washington Environmental Permit Handbook - Dangerous Waste Treatment...

    Open Energy Info (EERE)

    Dangerous Waste Treatment Storage Disposal Facility New Permit Jump to: navigation, search OpenEI Reference LibraryAdd to library Web Site: Washington Environmental Permit Handbook...

  2. Washington Environmental Permit Handbook - Underground Injection...

    Open Energy Info (EERE)

    Underground Injection Control Registration webpage Jump to: navigation, search OpenEI Reference LibraryAdd to library Web Site: Washington Environmental Permit Handbook -...

  3. Washington/Wind Resources | Open Energy Information

    Open Energy Info (EERE)

    Guidebook >> Washington Wind Resources WindTurbine-icon.png Small Wind Guidebook * Introduction * First, How Can I Make My Home More Energy Efficient? * Is Wind Energy Practical...

  4. Washington Energy Facility Site Evalutation Council - Siting...

    Open Energy Info (EERE)

    Reference LibraryAdd to library Web Site: Washington Energy Facility Site Evalutation Council - Siting and Review Process Abstract Overview of the siting and review process for...

  5. Washington Energy Facility Site Evalutation Council - Generalized...

    Open Energy Info (EERE)

    Reference LibraryAdd to library Chart: Washington Energy Facility Site Evalutation Council - Generalized Siting ProcessInfo GraphicMapChart Abstract Flowchart showing the...

  6. Washington Environmental Permit Handbook - NPDES General Permit...

    Open Energy Info (EERE)

    search OpenEI Reference LibraryAdd to library PermittingRegulatory Guidance - GuideHandbook: Washington Environmental Permit Handbook - NPDES General Permit...

  7. Washington Environmental Permit Handbook - NPDES Individual Permit...

    Open Energy Info (EERE)

    search OpenEI Reference LibraryAdd to library PermittingRegulatory Guidance - GuideHandbook: Washington Environmental Permit Handbook - NPDES Individual Permit...

  8. Washington Environmental Permit Handbook - NPDES Construction...

    Open Energy Info (EERE)

    search OpenEI Reference LibraryAdd to library PermittingRegulatory Guidance - GuideHandbook: Washington Environmental Permit Handbook - NPDES Construction Stormwater...

  9. Washington Environmental Permit Handbook - Air Operating Permit...

    Open Energy Info (EERE)

    search OpenEI Reference LibraryAdd to library PermittingRegulatory Guidance - GuideHandbook: Washington Environmental Permit Handbook - Air Operating PermitPermitting...

  10. Washington County, Wisconsin: Energy Resources | Open Energy...

    Open Energy Info (EERE)

    Zone Subtype A. Registered Energy Companies in Washington County, Wisconsin A.O. Smith Johnson Controls Optima Batteries Oskosh Tech Laboratories Inc WE Energies Energy...

  11. Everett, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    District Smart Grid Project Utility Companies in Everett, Washington Snohomish County PUD No 1 References US Census Bureau Incorporated place and minor civil division...

  12. USDA Rural Development Washington State Workshop

    Broader source: [DOE]

    The U.S. Department of Agriculture is hosting a Washington Rural Development Workshop. Speakers will cover local and regional broadband initiatives program and broadband success stories,...

  13. Washington: Graphene Nanostructures for Lithium Batteries Recieves...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Graphene Nanostructures for Lithium Batteries Recieves 2012 R&D 100 Award Washington: ... Improving charge time and these other battery characteristics could significantly expand ...

  14. Washington Environmental Permit Handbook - Geothermal Drilling...

    Open Energy Info (EERE)

    PermitLegal Abstract The State of Washington Governor's Office for Regulatory Innovation and Assistance provides a FAQs resource for developers. Published NA Year Signed or...

  15. Sumas, WA Liquefied Natural Gas Imports from Canada (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    from Canada (Million Cubic Feet) Sumas, WA Liquefied Natural Gas Imports from Canada (Million Cubic Feet) Year Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec 2014 5 2015 4 4 2 1 2016 1 2 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release Date: 5/31/2016 Referring Pages: U.S. Liquefied Natural Gas Imports by Point of Entry Sumas, WA Natural Gas Imports by Pipeline from Canada

  16. W.A. Parish Post-Combustion CO{sub 2} Capture and Sequestration Project

    Office of Scientific and Technical Information (OSTI)

    Phase 1 Definition (Technical Report) | SciTech Connect SciTech Connect Search Results Technical Report: W.A. Parish Post-Combustion CO{sub 2} Capture and Sequestration Project Phase 1 Definition Citation Details In-Document Search Title: W.A. Parish Post-Combustion CO{sub 2} Capture and Sequestration Project Phase 1 Definition For a secure and sustainable energy future, the United States (U.S.) must reduce its dependence on imported oil and reduce its emissions of carbon dioxide (CO{sub 2})

  17. Ensemble Properties of Comets in the Sloan Digital Sky Survey...

    Office of Scientific and Technical Information (OSTI)

    Chicago ; Ivezic, Zeljko ; Washington U., Seattle, Astron. Dept. ; Juric, Mario ; Harvard Coll. Observ. ; Becker, Andrew C. ; Washington U., Seattle, Astron. Dept. ; Jones,...

  18. Washington State biomass data book

    SciTech Connect (OSTI)

    Deshaye, J.A.; Kerstetter, J.D.


    This is the first edition of the Washington State Biomass Databook. It assess sources and approximate costs of biomass fuels, presents a view of current users, identifies potential users in the public and private sectors, and lists prices of competing energy resources. The summary describes key from data from the categories listed above. Part 1, Biomass Supply, presents data increasing levels of detail on agricultural residues, biogas, municipal solid waste, and wood waste. Part 2, Current Industrial and Commercial Use, demonstrates how biomass is successfully being used in existing facilities as an alternative fuel source. Part 3, Potential Demand, describes potential energy-intensive public and private sector facilities. Part 4, Prices of Competing Energy Resources, shows current suppliers of electricity and natural gas and compares utility company rates. 49 refs., 43 figs., 72 tabs.

  19. DOE Zero Energy Ready Home Case Study: Clifton View Homes, Whidbey Island, WA

    Broader source: [DOE]

    Case study of a DOE Zero Energy Ready home on Whidbey Island, WA, that scores HERS 37 without PV or HERS -13 with 10 kW PV, enough to power the home and an electric car. The two-story custom home...

  20. Secretary Chu Tours the 2013 Washington Auto Show | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Tours the 2013 Washington Auto Show Secretary Chu Tours the 2013 Washington Auto Show January 31, 2013 - 5:04pm Addthis 1 of 10 While at the Washington Auto Show, Energy Secretary ...

  1. Secretary Chu Webchat with the Washington Post | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Webchat with the Washington Post Secretary Chu Webchat with the Washington Post April 22, 2010 - 12:00am Addthis Washington, DC - Today, on the 40th anniversary of Earth Day, ...

  2. Washington, D.C. Roundtable Summary | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Washington, D.C. Roundtable Summary Washington, D.C. Roundtable Summary Summary of the DOE Office of Indian Energy roundtable held March 30, 2011, in Washington, D.C. PDF icon ...

  3. Building a Greener, More Resilient Future in Washington State | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy Building a Greener, More Resilient Future in Washington State Building a Greener, More Resilient Future in Washington State July 18, 2014 - 1:45pm Addthis Washington State Governor Jay Inslee, UniEnergy Technologies CEO Dr. Z. Gary Yang, and Assistant Secretary Patricia Hoffman (left to right) at the July 8 event in Mukilteo, Washington. Photo courtesy of Office of Washington State Governor Jay Inslee Washington State Governor Jay Inslee, UniEnergy Technologies CEO Dr. Z. Gary

  4. File:EIA-Eastern-OR-WA-gas.pdf | Open Energy Information

    Open Energy Info (EERE)

    pdf) Description Eastern Oregon and Washington By 2001 Gas Reserve Class Sources Energy Information Administration Authors Samuel H. Limerick; Lucy Luo; Gary Long; David F....

  5. EIS-0119: Decommissioning of Eight Surplus Production Reactors at the Harford Site, Richland, WA

    Broader source: [DOE]

    This EIS presents analyses of potential environmental impacts of decommissioning the eight surplus production reactors at the Hanford Site near Richland, Washington.

  6. Washington County, Nebraska: Energy Resources | Open Energy Informatio...

    Open Energy Info (EERE)

    Washington County, Nebraska Arlington, Nebraska Blair, Nebraska Fort Calhoun, Nebraska Herman, Nebraska Kennard, Nebraska Washington, Nebraska Retrieved from "

  7. Type B Accident Investigation At Washington Closure Hanford,...

    Office of Environmental Management (EM)

    Type B Accident Investigation At Washington Closure Hanford, LLC, Employee Fall Injury on ... PDF icon Type B Accident Investigation At Washington Closure Hanford, LLC, Employee Fall ...

  8. Spokane Valley, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    city in Spokane County, Washington.1 Utility Companies in Spokane Valley, Washington Modern Electric Water Company References US Census Bureau Incorporated place and minor...

  9. Washington Gas Energy Services (District of Columbia) | Open...

    Open Energy Info (EERE)

    Washington Gas Energy Services (District of Columbia) Jump to: navigation, search Name: Washington Gas Energy Services Place: District of Columbia References: EIA Form EIA-861...

  10. Garfield County, Washington: Energy Resources | Open Energy Informatio...

    Open Energy Info (EERE)

    Climate Zone Number 5 Climate Zone Subtype B. Places in Garfield County, Washington Pomeroy, Washington Retrieved from "http:en.openei.orgwindex.php?titleGarfieldCounty,W...

  11. July 2015 Groundwater Sampling at the Sherwood, Washington, Disposal...

    Office of Legacy Management (LM)

    Sherwood, Washington, Disposal Site October 2015 LMSSHES00715 This page intentionally left blank U.S. Department of Energy DVP-July 2015, Sherwood, Washington October 2015 RIN ...

  12. Sempra Energy Trading Corp (Washington) | Open Energy Information

    Open Energy Info (EERE)

    Sempra Energy Trading Corp (Washington) Jump to: navigation, search Name: Sempra Energy Trading Corp Place: Washington Phone Number: (877) SEMPRA1 Website: Twitter:...

  13. Washington County, Ohio: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Climate Zone Subtype A. Registered Energy Companies in Washington County, Ohio Michael Bradley Co. Michael Bradley Co.,Inc Solsil Inc Places in Washington County, Ohio Belpre, Ohio...

  14. FY 2008 Washington Savannah River Company, LLC, PER Summary ...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 Washington Savannah River Company, LLC, PER Summary SUMMARY OF FY 2008 WASHINGTON SAVANNAH RIVER COMPANY, LLC, AWARD FEE DETERMINATION Total Available Fee Total Fee Earned % ...

  15. FY 2006 Washington Savannah River Company, LLC, PER Summary ...

    National Nuclear Security Administration (NNSA)

    6 Washington Savannah River Company, LLC, PER Summary SUMMARY OF FY 2006 WASHINGTON SAVANNAH RIVER COMPANY, LLC, AWARD FEE DETERMINATION Total Available Fee Total Fee Earned % ...

  16. Port Washington, New York: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Washington, New York: Energy Resources (Redirected from Port Washington, NY) Jump to: navigation, search Equivalent URI DBpedia Coordinates 40.8256561, -73.6981858 Show Map...

  17. RAPID/Geothermal/Land Access/Washington | Open Energy Information

    Open Energy Info (EERE)

    Basis: Royalty Distribution: ContactsAgencies: Washington State Department of Natural Resources, Washington State Department of Transportation State Land Access Process In...

  18. DOE - Office of Legacy Management -- Carnegie Institute of Washington...

    Office of Legacy Management (LM)

    Carnegie Institute of Washington Dept of Genetics - NY 0-07 FUSRAP Considered Sites Site: Carnegie Institute of Washington (Dept. of Genetics) (NY.0-07 ) Eliminated from...

  19. Washington's 8th congressional district: Energy Resources | Open...

    Open Energy Info (EERE)

    Energy Companies in Washington's 8th congressional district GreenFoot Technologies Prometheus Energy Sunreps Utility Companies in Washington's 8th congressional district Alder...

  20. Washington, D.C. and Indiana: Allison Hybrid Technology Achieves...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Washington, D.C. and Indiana: Allison Hybrid Technology Achieves Commercial Success Washington, D.C. and Indiana: Allison Hybrid Technology Achieves Commercial Success August 21,...

  1. Washington's 3rd congressional district: Energy Resources | Open...

    Open Energy Info (EERE)

    can help OpenEI by expanding it. This page represents a congressional district in Washington. Registered Research Institutions in Washington's 3rd congressional district WSU...

  2. City of Milton, Washington (Utility Company) | Open Energy Information

    Open Energy Info (EERE)

    Milton, Washington (Utility Company) Jump to: navigation, search Name: City of Milton Place: Washington Phone Number: (253) 922-8738 Website: cityofmilton.netpage.php?id1 Outage...

  3. Washington State Energy Facility Site Evaluation Council | Open...

    Open Energy Info (EERE)

    Energy Facility Site Evaluation Council Jump to: navigation, search Name: Washington State Energy Facility Site Evaluation Council Abbreviation: EFSEC Place: Olympia, Washington...

  4. Washington State Environmental Policy Act | Open Energy Information

    Open Energy Info (EERE)

    OpenEI Reference LibraryAdd to library Legal Document- StatuteStatute: Washington State Environmental Policy ActLegal Abstract The Washington State Environmental Policy Act...

  5. ESPC Sucess Story - Harold Washington Social Security Administration...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HAROLD WASHINGTON SOCIAL SECURITY ADMINISTRATION CENTER CHICAGO, ILLINOIS Water Conservation and Green Energy ESPC SUCCESS STORY The Harold Washington Social Security Center in ...

  6. FY 2006 Washington Savannah River Company, LLC, PER Summary ...

    National Nuclear Security Administration (NNSA)

    FY 2006 Washington Savannah River Company, LLC, PER Summary SUMMARY OF FY 2006 WASHINGTON SAVANNAH RIVER COMPANY, LLC, AWARD FEE DETERMINATION Total Available Fee Total Fee Earned ...

  7. FY 2007 Washington Savannah River Company, LLC, PER Summary ...

    National Nuclear Security Administration (NNSA)

    FY 2007 Washington Savannah River Company, LLC, PER Summary SUMMARY OF FY 2007 WASHINGTON SAVANNAH RIVER COMPANY, LLC, AWARD FEE DETERMINATION Total Available Fee Total Fee Earned ...

  8. FY 2008 Washington Savannah River Company, LLC, PER Summary ...

    National Nuclear Security Administration (NNSA)

    FY 2008 Washington Savannah River Company, LLC, PER Summary SUMMARY OF FY 2008 WASHINGTON SAVANNAH RIVER COMPANY, LLC, AWARD FEE DETERMINATION Total Available Fee Total Fee Earned ...

  9. Washington: State Ferries Run Cleaner With Biodiesel | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addthis Related Articles Auto and passenger ferries operated by the Washington State ... SEP Success Story: Washington State Becomes Largest Public Consumer of Biodiesel Auto and ...

  10. Washington's 5th congressional district: Energy Resources | Open...

    Open Energy Info (EERE)

    district Avista Corp City of Cheney, Washington (Utility Company) Retrieved from "http:en.openei.orgwindex.php?titleWashington%27s5thcongressionaldistrict&oldid189780...

  11. Washington's 1st congressional district: Energy Resources | Open...

    Open Energy Info (EERE)

    in Washington's 1st congressional district Snohomish County PUD No 1 Retrieved from "http:en.openei.orgwindex.php?titleWashington%27s1stcongressionaldistrict&oldid189772...

  12. Washington's 2nd congressional district: Energy Resources | Open...

    Open Energy Info (EERE)

    Biofuels LLC Energy Generation Facilities in Washington's 2nd congressional district S.P. Everett Biomass Facility Utility Companies in Washington's 2nd congressional district...

  13. Washington Coastal Zone Management Webpage | Open Energy Information

    Open Energy Info (EERE)

    Webpage Jump to: navigation, search OpenEI Reference LibraryAdd to library Web Site: Washington Coastal Zone Management Webpage Abstract Provides overview of Washington's coastal...

  14. DOE Exercises 5 Year Option on Washington TRU Solutions Contract...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Exercises 5 Year Option on Washington TRU Solutions Contract to Operate WIPP DOE Exercises 5 Year Option on Washington TRU Solutions Contract to Operate WIPP January 18, 2005 - ...

  15. Washington State Department of Fish and Wildlife | Open Energy...

    Open Energy Info (EERE)

    Fish and Wildlife Jump to: navigation, search Logo: Washington State Department of Fish and Wildlife Name: Washington State Department of Fish and Wildlife Abbreviation: WDFW...

  16. Washington State Energy-Efficiency Appliance Rebate Program ...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Oregon State Energy-Efficiency Appliance Rebate Program Helps Low-Income Families Washington: RePower's Energy Dashboard Spurs Change on Bainbridge Island Washington: ...

  17. Washington Department of Natural Resources | Open Energy Information

    Open Energy Info (EERE)

    of Natural Resources is located in Olympia, Washington. About About 600 gas and oil wells have been drilled in Washington, but large-scale commercial production has never...

  18. Washington County, Utah: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Number 3 Climate Zone Subtype B. Registered Energy Companies in Washington County, Utah Verdi Energy Group Places in Washington County, Utah Apple Valley, Utah Enterprise, Utah...

  19. 2016 Washington Auto Show | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Washington Auto Show 2016 Washington Auto Show Addthis 1 of 20 Energy Secretary Ernest Moniz sits in the driver's seat of the all-electric Chevrolet Bolt at the Washington Auto Show. When it debuts on the road later this year, the Bolt will offer drivers about 200 miles of electric range. Image: Simon Edelman, Energy Department Date taken: 2016-01-21 09:45 2 of 20 The 2016 next-generation Chevrolet Volt builds on the success of its previous version, which was the first plug-in hybrid electric

  20. 2013 Washington Auto Show | Department of Energy

    Energy Savers [EERE]

    Washington Auto Show 2013 Washington Auto Show Addthis 1 of 10 While at the Washington Auto Show, Energy Secretary Steven Chu visited Nissan to see the 2013 Leaf. | Photo courtesy of Sarah Gerrity, Energy Department. Date taken: 2013-01-31 13:50 2 of 10 The new Nissan Leaf is being built at the company's Smyrna, Tennessee, Vehicle Assembly Plant -- helping to cut the price of its electric vehicle. | Photo courtesy of Sarah Gerrity, Energy Department. Date taken: 2013-01-31 13:49 3 of 10 Energy

  1. Washington Gas- Residential Energy Efficiency Rebate Program

    Broader source: [DOE]

    Washington Gas provides a number of rebates to residential customers who utilize energy efficient equipment and measures in the home. Rebates are limited to natural gas furnaces and programmable...

  2. From The Washington Post's Federal Diary:

    National Nuclear Security Administration (NNSA)

    The Washington Post's Federal Diary: Merit Pay in a Nuclear Test Project By Stephen Barr ... and Kane said he expects changes will be made to the system during its five-year test run. ...

  3. Washington Gas Energy Services | Open Energy Information

    Open Energy Info (EERE)

    Washington Gas Energy Services Place: Virginia Phone Number: 1-844-427-5945 Website: Outage Hotline: 1-844-427-5945 References: EIA Form EIA-861 Final Data File for...

  4. Washington Electric Coop Inc | Open Energy Information

    Open Energy Info (EERE)

    Territory: Vermont Phone Number: (802) 223-5245 Website: Facebook: https:www.facebook.comWashingtonElectricCoop Outage Hotline: 1-800-932-5245....

  5. Photosynthetic Antenna Research Center | Washington University...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    All Hands 2015 Our sixth annual meeting at Washington University in St. Louis PARC: Harvesting Solar Energy for the Future In this video, we detail the vision and goals of PARC's ...

  6. Charging Up in King County, Washington

    Broader source: [DOE]

    King County, Washington is spearheading a regional effort to develop a network of electric vehicle charging stations. It is also improving its vehicle fleet and made significant improvements to a...

  7. Riverbend, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    a stub. You can help OpenEI by expanding it. Riverbend is a census-designated place in King County, Washington.1 References US Census Bureau 2005 Place to 2006 CBSA...

  8. Vashon, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    is a stub. You can help OpenEI by expanding it. Vashon is a census-designated place in King County, Washington.1 References US Census Bureau 2005 Place to 2006 CBSA...

  9. Mirrormont, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    a stub. You can help OpenEI by expanding it. Mirrormont is a census-designated place in King County, Washington.1 References US Census Bureau 2005 Place to 2006 CBSA...

  10. Tanner, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    is a stub. You can help OpenEI by expanding it. Tanner is a census-designated place in King County, Washington.1 References US Census Bureau 2005 Place to 2006 CBSA...

  11. Hobart, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    is a stub. You can help OpenEI by expanding it. Hobart is a census-designated place in King County, Washington.1 References US Census Bureau 2005 Place to 2006 CBSA...

  12. Eastgate, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    a stub. You can help OpenEI by expanding it. Eastgate is a census-designated place in King County, Washington.1 References US Census Bureau 2005 Place to 2006 CBSA...

  13. Ravensdale, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    a stub. You can help OpenEI by expanding it. Ravensdale is a census-designated place in King County, Washington.1 References US Census Bureau 2005 Place to 2006 CBSA...

  14. Kingsgate, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    a stub. You can help OpenEI by expanding it. Kingsgate is a census-designated place in King County, Washington.1 References US Census Bureau 2005 Place to 2006 CBSA...

  15. Baring, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    is a stub. You can help OpenEI by expanding it. Baring is a census-designated place in King County, Washington.1 References US Census Bureau 2005 Place to 2006 CBSA...

  16. Charging Up in King County, Washington

    ScienceCinema (OSTI)

    Constantine, Dow; Oliver, LeAnn; Inslee, Jay; Sahandy, Sheida; Posthuma, Ron; Morrison, David;


    King County, Washington is spearheading a regional effort to develop a network of electric vehicle charging stations. It is also improving its vehicle fleet and made significant improvements to a low-income senior housing development.

  17. Fort Washington, Pennsylvania: Energy Resources | Open Energy...

    Open Energy Info (EERE)

    You can help OpenEI by expanding it. Fort Washington is a census-designated place in Montgomery County, Pennsylvania.1 References US Census Bureau 2005 Place to 2006 CBSA...

  18. 2015 Washington Auto Show | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5 Washington Auto Show 2015 Washington Auto Show Addthis Moniz Delivers Keynote Remarks 1 of 10 Moniz Delivers Keynote Remarks Secretary Moniz touted the Department's investments in advanced vehicle technologies, infrastructure and manufacturing. Photo by Sarah Gerrity Date taken: 2015-01-22 04:33 Secretary Moniz Announces More than $55M in Fuel-Efficient Vehicle Funding 2 of 10 Secretary Moniz Announces More than $55M in Fuel-Efficient Vehicle Funding The funding opportunities will go towards a


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    WASHINGTON DEPARTMENT OF ECOLOGY p.o. Box 47600 .Olympia, Washington 98504-7600 (360) 407-6000 .TOO Only (Hearing Impaired) (360) 407-6006 May 3, 2004 Todd Martin, Chair Hanford Advisory Board 1933 Jadwin Ave. Suite 135 Richland, W A 99352 Dear Mr. Martin: This letter is in response to your recent Hanford Advisory Board Consensus Advice #156 . requesting re-establishment of a forum to discuss Hanford's science and technology issues. Ecology agrees that the previous Site Technology Coordination

  20. Federal Utility Partnership Working Group Seminar: Washington Update

    Broader source: [DOE]

    Presentation covers the Federal Utility Partnership Working Group Seminar: Washington Update on May 22, 2013.

  1. Washington Success StoryA Performance Contracting Program

    Broader source: [DOE]

    Provides an overview case study of Washington's Performance Contracting Program. Author: Energy Services Coalition

  2. Central Washington University: 2014 Engineering Technologies, Safety & Construction Fair

    Broader source: [DOE]

    Location: 400 E. University Way Ellensburg, WA 98926, SURC BallroomPOC: Heather BainWebsite:

  3. Washington State Department of Archaeology and Historic Preservation...

    Open Energy Info (EERE)

    oversees the procedures for cultural resource discovery. References "DAHP Website" Human Remains Process Contact Contacts.png Guy Tasa 360.586.3534

  4. City of Tacoma, Washington (Utility Company) | Open Energy Information

    Open Energy Info (EERE)

    Jump to: navigation, search Name: Tacoma City of Address: 3628 South 35th Street Place: Tacoma, WA Zip: 98409 Phone Number: (800) 752-6745 Website: www.mytpu.orgtacomapower...

  5. City of Tacoma, Washington (Utility Company) | Open Energy Information

    Open Energy Info (EERE)

    Power) Jump to: navigation, search Name: Tacoma City of Address: 3628 South 35th Street Place: Tacoma, WA Zip: 98409 Phone Number: (800) 752-6745 Website:

  6. Type B Accident Investigation At Washington Closure Hanford, LLC, Employee

    Energy Savers [EERE]

    Fall Injury on July 1, 2009, At The 336 Building, Hanford Site, Washington | Department of Energy At Washington Closure Hanford, LLC, Employee Fall Injury on July 1, 2009, At The 336 Building, Hanford Site, Washington Type B Accident Investigation At Washington Closure Hanford, LLC, Employee Fall Injury on July 1, 2009, At The 336 Building, Hanford Site, Washington July 30, 2009 During D4 project demolition preparation work on the morning of July 1, 2009, in Hanford's 300 Area, a millwright

  7. Buildings Energy Data Book: 7.8 State Building Energy Codes

    Buildings Energy Data Book [EERE]

    3 Building Energy Rating and Disclosure Policies in the United States Commercial Buildings Commercial Buildings Public Buildings Homes Existing Policy Policy Being Considered Rating Requirement Disclosure Requirement Austin, TX Connecticut Arlington County, VA Alaska California Colorado Denver, CO Austin, TX District of Columbia Illinois Hawaii Kansas New York, NY Maine Michigan Montgomery County, MD San Francisco, CA Maryland Minnesota Nevada Seattle, WA Massachusetts Ohio New York Washington

  8. Effects of Localized Energy Extraction in an Idealized, Energetically Complete Numerical Model of an Ocean-Estuary Tidal System

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    localized energy extraction in an idealized, energetically complete numerical model of an ocean-estuary tidal system MHK Instrumentation, Measurement & Computer Modeling Workshop, Broomfield CO, July 10 2012 Mitsuhiro Kawase and Marisa Gedney Northwest National Marine Renewable Energy Center / School of Oceanography University of Washington Seattle WA 98195 United States * Far-field (Estuary-wide) - Changes in the tidal range - Changes in tidal currents  Near-field (Vicinity of the

  9. New Whole-House Solutions Case Study: Schneider Homes, Inc., Burien, WA

    Energy Savers [EERE]

    Schneider Homes worked with the U.S. Department of Energy's Building America program to design 37 energy efficient homes at the Village at Miller Creek, in Burien, Washington. Schneider Homes used analysis from Washington State University's Extension Energy Office, a member of Building America's BIRA team, to determine the most cost-effective measures for significant energy savings. The homes were air sealed according to the EPA thermal bypass checklist. Contractors caulked all mechanical

  10. Washington, D.C. Office | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Office NREL's Washington, D.C. office provides energy analysis and technical program support to the U.S. Department of Energy. View Larger Map National Renewable Energy Laboratory - D.C. Office 901 D Street, SW (also 370 L'Enfant Promenade, adjacent to the Forrestal building) Suite 930 Washington, D.C., 20024 202-488-2200 D.C. Visitor Information See local information to plan your trip. Security Procedures Building security will accept HSPD-12 badges (recognizable by gold chip on front) or valid

  11. EIS-0424: Klickitat Hatchery Complex Program, Washington

    Broader source: [DOE]

    This EIS evaluates the environmental impacts from DOE’s Bonneville Power Administration's proposal to assist with funding the construction, operation, and maintenance of modifications to the Klickitat Hatchery and the Yakama Nation’s Hatchery Complex Program that intend to aid populations of anadromous fish affected by the Federal Columbia River Power System dams. The proposed action could include support for modifications to the existing hatchery, a new hatchery/acclimation facility in Wahkiacus, Washington, and an acclimation facility at McCreedy Creek in Yakima County, Washington.

  12. Gasoline and Diesel Fuel Update

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    CA Contra Costa County, CA Marin County, CA San Francisco County, CA San Mateo County, CA Santa Clara County, CA Seattle Island County, WA King County, WA Snohomish County, WA...

  13. Washington DC Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    school's state, county, city, or district. For more information, please visit the High School Coach page. Washington, DC Region High School Regional Washington, DC Washington, DC...

  14. Washington Island El Coop, Inc | Open Energy Information

    Open Energy Info (EERE)

    Washington Island El Coop, Inc Jump to: navigation, search Name: Washington Island El Coop, Inc Place: Wisconsin Phone Number: 920-847-2541 Website: Outage Hotline:...

  15. Washington State Energy Program, Summary of Reported Data From...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Washington Department of Commerce Washington 2,587,500 1.1 ... 2010 through September 30, 2013. Although some awards were ... build an energy upgrade business community within Kitsap ...

  16. Port Townsend, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Hide Map This article is a stub. You can help OpenEI by expanding it. Port Townsend is a city in Jefferson County, Washington. It falls under Washington's 6th...

  17. DOE, Washington Closure complete recycling project at Hanford

    Broader source: [DOE]

    RICHLAND, Wash. – The U.S. Department of Energy (DOE) recently teamed with contractor Washington Closure Hanford to complete a major recycling effort during cleanup of the Hanford Site in southeastern Washington State.

  18. Potential Federal On-Site Solar Aggregation in Washington, D...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Potential Federal On-Site Solar Aggregation in Washington, D.C., and Maryland Potential Federal On-Site Solar Aggregation in Washington, D.C., and Maryland Presentation describes...

  19. Leasing State Trust Lands in Washington | Open Energy Information

    Open Energy Info (EERE)

    Leasing State Trust Lands in Washington Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- OtherOther: Leasing State Trust Lands in WashingtonLegal...

  20. SeaTac, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Map This article is a stub. You can help OpenEI by expanding it. SeaTac is a city in King County, Washington. It falls under Washington's 7th congressional district and...

  1. Mercer Island, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    This article is a stub. You can help OpenEI by expanding it. Mercer Island is a city in King County, Washington. It falls under Washington's 8th congressional district.12...

  2. Yarrow Point, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    This article is a stub. You can help OpenEI by expanding it. Yarrow Point is a town in King County, Washington. It falls under Washington's 8th congressional district.12...

  3. Des Moines, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    This article is a stub. You can help OpenEI by expanding it. Des Moines is a city in King County, Washington. It falls under Washington's 9th congressional district.12...

  4. Hunts Point, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    This article is a stub. You can help OpenEI by expanding it. Hunts Point is a town in King County, Washington. It falls under Washington's 8th congressional district.12...

  5. Federal Way, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    This article is a stub. You can help OpenEI by expanding it. Federal Way is a city in King County, Washington. It falls under Washington's 9th congressional district.12...

  6. Black Diamond, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    This article is a stub. You can help OpenEI by expanding it. Black Diamond is a city in King County, Washington. It falls under Washington's 8th congressional district.12...

  7. North Bend, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    This article is a stub. You can help OpenEI by expanding it. North Bend is a city in King County, Washington. It falls under Washington's 8th congressional district.12...

  8. Clyde Hill, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    This article is a stub. You can help OpenEI by expanding it. Clyde Hill is a city in King County, Washington. It falls under Washington's 8th congressional district.12...

  9. Lake Forest Park, Washington: Energy Resources | Open Energy...

    Open Energy Info (EERE)

    article is a stub. You can help OpenEI by expanding it. Lake Forest Park is a city in King County, Washington. It falls under Washington's 1st congressional district and...

  10. Maple Valley, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    This article is a stub. You can help OpenEI by expanding it. Maple Valley is a city in King County, Washington. It falls under Washington's 8th congressional district.12...

  11. Normandy Park, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    This article is a stub. You can help OpenEI by expanding it. Normandy Park is a city in King County, Washington. It falls under Washington's 9th congressional district.12...

  12. An Introduction to Washington Water Law | Open Energy Information

    Open Energy Info (EERE)

    Introduction to Washington Water Law Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- OtherOther: An Introduction to Washington Water LawLegal...

  13. George Washington University: School of Business Career Fair Fall 2015

    Broader source: [DOE]

    Location: George Washington University Foggy Bottom campus, School of Business, Duques Hall, 2201 G Street, NW, Washington, DC 20052POC: Recruitment@doe.govWebsite:


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site


  15. Lewis County, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    is 041. It is classified as ASHRAE 169-2006 Climate Zone Number 4 Climate Zone Subtype C. Utility Companies in Lewis County, Washington City of Centralia, Washington (Utility...

  16. EIS-0205: Joint NEPA/SEPA Final Environmental Impact Statement Washington Windplant No. 1, Goldendale, Washington

    Broader source: [DOE]

    The U.S. Department of Energy’s Bonneville Power Administration prepared this statement in order to fulfill its National Environmental Policy Act obligations ahead of signing an agreement with the utilities that would purchase the Windplant’s power from KENETECH. KENETECH Windpower, Inc., proposes to construct and operate Washington Windplant No. 1 in the Columbia Hills area, southeast of Goldendale, in Klickitat County, Washington.

  17. Washington Closure Hanford: Ten Years of River Corridor Cleanup

    Broader source: [DOE]

    This timeline shows contractor Washington Closure Hanford's accomplishments over the past 10 years through its River Corridor Closure Contract.

  18. Washington DOE ZERH Program Requirements | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Washington DOE ZERH Program Requirements Washington DOE ZERH Program Requirements Washington specific program requirements for the U.S. Department of Energy's Zero Energy Ready Home Program. PDF icon ch_washington_requirements8-23-13.pdf More Documents & Publications DOE Challenge Home, California Program Requirements Version Tracking Document for DOE Challenge Homes, National Program Requirements (Rev. 03) DOE Zero Energy Ready Home National Program Requirements (Rev. 04)

  19. Washington State University Wins 2014 Hydrogen Student Design Contest |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Washington State University Wins 2014 Hydrogen Student Design Contest Washington State University Wins 2014 Hydrogen Student Design Contest May 12, 2014 - 12:00pm Addthis Washington State University of Pullman, Washington, has won the Hydrogen Education Foundation's 2014 Hydrogen Student Design Contest. The contest, supported by the U.S. Department of Energy (DOE), is aligned with DOE's efforts to work with the public, academic and energy institutions, to ensure that

  20. November 10, 2004: First hydrogen refueling station opens in Washington,

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DC. | Department of Energy 0, 2004: First hydrogen refueling station opens in Washington, DC. November 10, 2004: First hydrogen refueling station opens in Washington, DC. November 10, 2004: First hydrogen refueling station opens in Washington, DC. November 10, 2004 Secretary Abraham joins representatives of Shell and General Motors in the opening of the nation's first integrated gasoline/hydrogen refueling station in Washington, D.C. The station will be used to refuel General Motors' fuel

  1. Voluntary Protection Program Onsite Review, Washington River Protection

    Energy Savers [EERE]

    Solutions, LLC, Hanford - Feb 2014 | Department of Energy Washington River Protection Solutions, LLC, Hanford - Feb 2014 Voluntary Protection Program Onsite Review, Washington River Protection Solutions, LLC, Hanford - Feb 2014 February 13, 2014 Evaluation to determine whether Washington River Protection Solutions, LLC, Hanford is performing at a level deserving DOE-VPP Star recognition. PDF icon Voluntary Protection Program Onsite Review, Washington River Protection Solutions, LLC, Hanford

  2. DOE Selects Washington River Protection Solutions, LLC for Tank Operations

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Contract at Hanford Site | Department of Energy Washington River Protection Solutions, LLC for Tank Operations Contract at Hanford Site DOE Selects Washington River Protection Solutions, LLC for Tank Operations Contract at Hanford Site May 29, 2008 - 12:51pm Addthis WASHINGTON, DC - The U.S. Department of Energy (DOE) today announced that Washington River Protection Solutions (WRPS), LLC has been selected as the tank operations contractor to store, retrieve and treat Hanford tank waste and

  3. Washington School District Makes the Grade in Energy Efficiency |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Washington School District Makes the Grade in Energy Efficiency Washington School District Makes the Grade in Energy Efficiency September 2, 2015 - 10:01am Addthis As part of the Better Buildings Challenge, Camas School District in Washington not only surpassed its energy efficiency goals, but did so five years early. | Photo courtesy of Camas School District. As part of the Better Buildings Challenge, Camas School District in Washington not only surpassed its energy

  4. Alternative Fuels Data Center: Washington Transportation Data for

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Alternative Fuels and Vehicles Washington Transportation Data for Alternative Fuels and Vehicles to someone by E-mail Share Alternative Fuels Data Center: Washington Transportation Data for Alternative Fuels and Vehicles on Facebook Tweet about Alternative Fuels Data Center: Washington Transportation Data for Alternative Fuels and Vehicles on Twitter Bookmark Alternative Fuels Data Center: Washington Transportation Data for Alternative Fuels and Vehicles on Google Bookmark Alternative Fuels

  5. Washington -- SEP Summary of Reported Data | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Summary of Reported Data Washington -- SEP Summary of Reported Data Summary of data reported by Better Buildings Neighborhood Program partner Washington -- SEP. PDF icon Washington -- SEP Summary of Reported Data More Documents & Publications Bainbridge Island Summary of Reported Data Virginia -- SEP Summary of Reported Data Michigan -- SEP Summary of Reported Data

  6. Deputy Secretary Daniel Poneman's Remarks to the Washington Institute for

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Near East Policy | Department of Energy to the Washington Institute for Near East Policy Deputy Secretary Daniel Poneman's Remarks to the Washington Institute for Near East Policy March 17, 2010 - 1:04pm Addthis U.S. Deputy Secretary of Energy Daniel Poneman Remarks as Prepared for Delivery Washington Institute for Near East Policy Washington, D.C. March 17, 2010 Good afternoon. I would like to thank Rob Satloff and the Washington Institute for inviting me to speak with you today. For 25

  7. Planetary Fuels LLC | Open Energy Information

    Open Energy Info (EERE)

    Fuels LLC Jump to: navigation, search Name: Planetary Fuels, LLC Place: Seattle, Washington Product: Seattle-based start-up dedicated to the production of biodiesel. Coordinates:...

  8. CyVolt Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    Seattle, Washington Zip: 98104 Product: Seattle-based developer fuel cell-powered battery systems for portable, hand-held consumer electronics Coordinates: 47.60356,...

  9. Celerity Energy Partners now EnerNOC | Open Energy Information

    Open Energy Info (EERE)

    Partners (now EnerNOC) Place: Seattle, Washington, DC Product: Seattle-based provider of demand response capacity to electric utilities, power marketers, and electric power users....

  10. EIS-0364: Decommissioning of the Fast Flux Test Facility, Hanford Site, Richland, WA

    Office of Energy Efficiency and Renewable Energy (EERE)

    The U.S. Department of Energy (DOE) announces its intent to prepare an Environmental Impact Statement (EIS), pursuant to the National Environmental Policy Act of 1969 (NEPA), on proposed decommissioning of the Fast Flux Test Facility (FFTF) at the Hanford Site, Richland, Washington.

  11. Washington Renewable Electric Power Industry Statistics

    U.S. Energy Information Administration (EIA) Indexed Site

    Washington Primary Renewable Energy Capacity Source Hydro Conventional Primary Renewable Energy Generation Source Hydro Conventional Capacity (megawatts) Value Percent of State Total Total Net Summer Electricity Capacity 30,478 100.0 Total Net Summer Renewable Capacity 23,884 78.4 Geothermal - - Hydro Conventional 21,181 69.5 Solar 1 * Wind 2,296 7.5 Wood/Wood Waste 368 1.2 MSW/Landfill Gas 39 0.1 Other Biomass - - Generation (thousand megawatthours) Total Electricity Net Generation 103,473

  12. Washington Renewable Electric Power Industry Statistics

    U.S. Energy Information Administration (EIA) Indexed Site

    Washington" "Primary Renewable Energy Capacity Source","Hydro Conventional" "Primary Renewable Energy Generation Source","Hydro Conventional" "Capacity (megawatts)","Value","Percent of State Total" "Total Net Summer Electricity Capacity",30478,100 "Total Net Summer Renewable Capacity",23884,78.4 " Geothermal","-","-" " Hydro Conventional",21181,69.5 "

  13. The Tri-Party Agencies want your input on proposed changes to...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    - 10:00 pm): September 24, 2002 - Yakima, Washington West Coast Yakima Center - Ballroom 607 East Yakima Avenue Yakima, Washington September 26, 2002 - Seattle, Washington...

  14. Federal Utility Partnership Working Group 2011 Meeting: Washington Update |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy 2011 Meeting: Washington Update Federal Utility Partnership Working Group 2011 Meeting: Washington Update Presentation-given at the Fall 2011 Federal Utility Partnership Working Group (FUPWG) meeting-provides an overview of federal government goals and status, Federal Energy Management Program (FEMP) update, and utility energy services contract (UESC) program goals. PDF icon fupwg_fall11_unruh.pdf More Documents & Publications FUPWG Spring 2011 Washington, D.C.,

  15. Institute Recognizes Washington Closure Hanford as International Award

    Energy Savers [EERE]

    Finalist | Department of Energy Institute Recognizes Washington Closure Hanford as International Award Finalist Institute Recognizes Washington Closure Hanford as International Award Finalist December 17, 2015 - 12:05pm Addthis RICHLAND, Wash. - The Project Management Institute (PMI) honored Hanford Site contractor Washington Closure Hanford (WCH) as a finalist for the international Project of the Year Award. WCH and the River Corridor team were recognized for their cleanup progress in this

  16. DOE Cites Washington TRU Solutions for Nuclear Safety Violations |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy TRU Solutions for Nuclear Safety Violations DOE Cites Washington TRU Solutions for Nuclear Safety Violations December 22, 2005 - 4:53pm Addthis WASHINGTON, D.C. -- The Department of Energy (DOE) today notified Washington TRU Solutions (WTS) that it will fine the company $192,500 for violations of the department's nuclear safety requirements. The Preliminary Notice of Violation (PNOV) issued today cites a number of deficiencies that led to a series of low-level plutonium

  17. Secretary Chu's Remarks as Prepared for Delivery at the Washington

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    University Commencement | Department of Energy as Prepared for Delivery at the Washington University Commencement Secretary Chu's Remarks as Prepared for Delivery at the Washington University Commencement May 21, 2010 - 12:00am Addthis Remarks of Secretary Steven Chu- As Prepared for Delivery Washington University Friday, May 21, 2010 Chancellor Mark Wrighton, the Board of Trustees, faculty, family, and friends here today, thank you for letting me share this wonderful day with you. It is a

  18. State of Washington Clean Energy Opportunity: Technical Market Potential

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    for CHP, August 2010 | Department of Energy of Washington Clean Energy Opportunity: Technical Market Potential for CHP, August 2010 State of Washington Clean Energy Opportunity: Technical Market Potential for CHP, August 2010 The State of Washington has significant clean energy technical market potential including clean heat and power (CHP)/cogeneration, waste heat recovery for power and heat, and district energy. This brief white paper by the Northwest Clean Energy Application Center (NW

  19. Bioenergy Technologies Office Judges Washington State University Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Competition | Department of Energy Bioenergy Technologies Office Judges Washington State University Energy Competition Bioenergy Technologies Office Judges Washington State University Energy Competition May 27, 2014 - 9:39am Addthis Washington State University is hosting the Imagine Tomorrow competition to challenge high school students to explore new ways to support the transition to alternative energy sources. The competition, held on May 30-June 1, 2014, asks students to work together in

  20. Greenhouse gas mitigation options for Washington State

    SciTech Connect (OSTI)

    Garcia, N.


    President Clinton, in 1993, established a goal for the United States to return emissions of greenhouse gases to 1990 levels by the year 2000. One effort established to help meet this goal was a three part Environmental Protection Agency state grant program. Washington State completed part one of this program with the release of the 1990 greenhouse gas emissions inventory and 2010 projected inventory. This document completes part two by detailing alternative greenhouse gas mitigation options. In part three of the program EPA, working in partnership with the States, may help fund innovative greenhouse gas reduction strategies. The greenhouse gas control options analyzed in this report have a wide range of greenhouse gas reductions, costs, and implementation requirements. In order to select and implement a prudent mix of control strategies, policy makers need to have some notion of the potential change in climate, the consequences of that change and the uncertainties contained therein. By understanding the risks of climate change, policy makers can better balance the use of scarce public resources for concerns that are immediate and present against those that affect future generations. Therefore, prior to analyzing alternative greenhouse gas control measures, this report briefly describes the phenomenon and uncertainties of global climate change, and then projects the likely consequences for Washington state.

  1. Federal Utility Partnership Working Group 2011 Meeting: Washington...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Federal Utility Partnership Working Group 2011 Meeting: Washington Update Presentation-given at the Fall 2011 Federal Utility Partnership Working Group (FUPWG) meeting-provides an ...

  2. Bureau of Land Management - Washington Office Directories | Open...

    Open Energy Info (EERE)

    navigation, search OpenEI Reference LibraryAdd to library General: Bureau of Land Management - Washington Office Directories Abstract This page links to a directory for state...

  3. Adams County, Washington ASHRAE 169-2006 Climate Zone | Open...

    Open Energy Info (EERE)

    ASHRAE 169-2006 Climate Zone Jump to: navigation, search County Climate Zone Place Adams County, Washington ASHRAE Standard ASHRAE 169-2006 Climate Zone Number Climate Zone...


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    * Briefing Room * Statements & Releases The White House Office of the Press Secretary Communiqu of the Washington Nuclear Security Summit Nuclear terrorism is one of the most ...

  5. DOE Cites Washington Closure Hanford for Safety Violations | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Closure Hanford for Safety Violations DOE Cites Washington Closure Hanford for Safety Violations August 19, 2010 - 12:00am Addthis WASHINGTON, D.C. - The U.S. Department of Energy has issued a Preliminary Notice of Violation (PNOV) to contractor Washington Closure Hanford (WCH) for violations of DOE's worker safety and health program regulations in 2009 at the Hanford Site in southeast Washington State. In a continued effort to maintain the highest level of worker safety at DOE sites,

  6. Washington Priority Habitats and Species on the Web | Open Energy...

    Open Energy Info (EERE)

    Habitats and Species (PHS) in Washington State. PHS is a source of best available science that can inform local planning activities, development projects, conservation...

  7. Washington's 4th congressional district: Energy Resources | Open...

    Open Energy Info (EERE)

    4th congressional district Battelle Memorial Institute, Pacific Northwest Division Smart Grid Demonstration Project Registered Research Institutions in Washington's 4th...

  8. Washington's 9th congressional district: Energy Resources | Open...

    Open Energy Info (EERE)

    Weyerhaeuser Energy Generation Facilities in Washington's 9th congressional district Simpson Tacoma Biomass Facility Retrieved from "http:en.openei.orgwindex.php?titleWashin...

  9. Washington's 6th congressional district: Energy Resources | Open...

    Open Energy Info (EERE)

    Facilities in Washington's 6th congressional district Aberdeen Biomass Facility Simpson Tacoma Biomass Facility Retrieved from "http:en.openei.orgwindex.php?titleWashin...

  10. ,"Washington Natural Gas Vehicle Fuel Price (Dollars per Thousand...

    U.S. Energy Information Administration (EIA) Indexed Site

    Of Series","Frequency","Latest Data for" ,"Data 1","Washington Natural Gas Vehicle Fuel Price (Dollars per Thousand Cubic Feet)",1,"Annual",2012 ,"Release...

  11. ,"Washington Natural Gas Imports Price (Dollars per Thousand...

    U.S. Energy Information Administration (EIA) Indexed Site

    Of Series","Frequency","Latest Data for" ,"Data 1","Washington Natural Gas Imports Price (Dollars per Thousand Cubic Feet)",1,"Annual",2014 ,"Release Date:","9...

  12. Washington DC Reliability Requirements and the Need to Operate...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Washington DC Reliability Requirements and the Need to Operate Mirant's Potomac River Generation Station to Support Local Area Reliability (Oak Ridge National Laboratory 2005) ...

  13. Douglas County, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Douglas County, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 47.7790617, -119.7474606 Show Map Loading map......

  14. Washington County, Indiana: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Washington County, Indiana: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 38.6744747, -86.1751759 Show Map Loading map......

  15. Cowlitz County, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Cowlitz County, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 46.1746472, -122.7746902 Show Map Loading map......

  16. Chelan County, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Chelan County, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 47.9445331, -120.6749068 Show Map Loading map......

  17. Washington County, Florida: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Washington County, Florida: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 30.548737, -85.684578 Show Map Loading map... "minzoom":false,"mapp...

  18. Washington County, Iowa: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Washington County, Iowa: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 41.3477966, -91.7538817 Show Map Loading map... "minzoom":false,"mappi...

  19. Skamania County, Washington: Energy Resources | Open Energy Informatio...

    Open Energy Info (EERE)

    Skamania County, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 45.9428524, -121.8962257 Show Map Loading map......

  20. Washington County, Illinois: Energy Resources | Open Energy Informatio...

    Open Energy Info (EERE)

    Washington County, Illinois: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 38.3988869, -89.3226954 Show Map Loading map......

  1. Island County, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Island County, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 48.19765, -122.579457 Show Map Loading map... "minzoom":false,"mappi...

  2. Washington County, Missouri: Energy Resources | Open Energy Informatio...

    Open Energy Info (EERE)

    Washington County, Missouri: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 37.8907566, -90.8294002 Show Map Loading map......

  3. Mason County, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Mason County, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 47.4251146, -123.1951376 Show Map Loading map... "minzoom":false,"map...

  4. Yakima County, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Yakima County, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 46.543606, -120.7558292 Show Map Loading map... "minzoom":false,"map...

  5. Franklin County, Washington: Energy Resources | Open Energy Informatio...

    Open Energy Info (EERE)

    Franklin County, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 46.4937363, -118.8672379 Show Map Loading map......

  6. Washington County, Kentucky: Energy Resources | Open Energy Informatio...

    Open Energy Info (EERE)

    Washington County, Kentucky: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 37.7516142, -85.1479364 Show Map Loading map......

  7. Okanogan County, Washington: Energy Resources | Open Energy Informatio...

    Open Energy Info (EERE)

    Okanogan County, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 48.5896831, -119.6522139 Show Map Loading map......

  8. Kittitas County, Washington: Energy Resources | Open Energy Informatio...

    Open Energy Info (EERE)

    Kittitas County, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 47.1749548, -120.9319411 Show Map Loading map......

  9. Washington County, Texas: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Washington County, Texas: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 30.2352956, -96.365157 Show Map Loading map... "minzoom":false,"mappi...

  10. Washington County, Alabama: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Washington County, Alabama: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 31.3422346, -88.2461183 Show Map Loading map......

  11. ,"Washington Natural Gas Industrial Price (Dollars per Thousand...

    U.S. Energy Information Administration (EIA) Indexed Site

    ,,"(202) 586-8800",,,"1012015 10:56:55 AM" "Back to Contents","Data 1: Washington Natural Gas Industrial Price (Dollars per Thousand Cubic Feet)"...

  12. Washington Natural Gas Delivered to Commercial Consumers for...

    U.S. Energy Information Administration (EIA) Indexed Site

    Delivered to Commercial Consumers for the Account of Others (Million Cubic Feet) Washington Natural Gas Delivered to Commercial Consumers for the Account of Others (Million Cubic...

  13. Washington County, Colorado: Energy Resources | Open Energy Informatio...

    Open Energy Info (EERE)

    Washington County, Colorado: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 40.063745, -102.989615 Show Map Loading map......

  14. Washington Township, New Jersey: Energy Resources | Open Energy...

    Open Energy Info (EERE)

    Washington Township, New Jersey: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 40.989044, -74.065029 Show Map Loading map......

  15. Whitman County, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Whitman County, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 46.8363403, -117.5887295 Show Map Loading map......

  16. Washington County, Georgia: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Washington County, Georgia: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 32.962702, -82.820974 Show Map Loading map... "minzoom":false,"mapp...

  17. Lincoln County, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Lincoln County, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 47.5320525, -118.4701194 Show Map Loading map......

  18. Washington County, North Carolina: Energy Resources | Open Energy...

    Open Energy Info (EERE)

    Zone Number 3 Climate Zone Subtype A. Places in Washington County, North Carolina Creswell, North Carolina Plymouth, North Carolina Roper, North Carolina Retrieved from "http:...

  19. Washington Notice of Construction Application under New Source...

    Open Energy Info (EERE)

    Notice of Construction Application Organization State of Washington Department of Ecology Published Publisher Not Provided, 12013 DOI Not Provided Check for DOI availability:...

  20. Washington, District of Columbia: Energy Resources | Open Energy...

    Open Energy Info (EERE)

    Perseus LLC (Washington DC) References US Census Bureau Incorporated place and minor civil division population dataset (All States, all geography) Retrieved from "http:...