Powered by Deep Web Technologies
Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Waddington, NY Natural Gas Pipeline Imports From Canada (Million...  

Annual Energy Outlook 2012 (EIA)

data. Release Date: 1302015 Next Release Date: 2272015 Referring Pages: U.S. Natural Gas Pipeline Imports by Point of Entry Waddington, NY Natural Gas Imports by Pipeline from...



Office of Legacy Management (LM)

NY NY 17.8 Prepared by Oak Ridge Associated Universities Prepgred for Office of Operationaf Safety U.S. Department of Energy Ezrt /ur / POST REMEDIAL ACTION SURVEY PROPERTY OF MODERN LANDFILL, INC. FORMER LOOW SITE LEWISTON, NEW YORK J.D. BERGER R a d i o l o g l c a l S t t e A s s e s s r n e n t P r o g r a m M a n p o t a e r E d u c a t l o n , R e s e a r c h , a n d T r a l n i n g D l v i s l o n FINAL REPORT January 1982 POST REIEDIAT ACTION SURVBY PROPERTY OF }TODBRN I.AIIDPILL' INC. rONGB LOOTI SITE LEIIISTOI, NEI{ YORK Prepared for U.S. Department of Eaergy J . D . B e r g e r P r o j e c t S t a f f R.D. Coudra C.F. Rienke P.[. Frane C.F. 9legver [f.0. Eelton L.A. Young Prepered by Radiological Site Aseessuent Progrm Dlanpower Educatioor Researchr and Training Diviaion Oak Ridge Acaociated Univereitiea Oak Ridger Tenneggee 37830 FINAL REPORT January 1982 Thls report ls based on work performed under contract number DB-AC05-760RO0033 wlth


Waddington, New York: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

Waddington, New York: Energy Resources Waddington, New York: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 44.8644999°, -75.2041019° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":44.8644999,"lon":-75.2041019,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


C:\\users\\ziad\\SUMA\\SUMA_doc.doc Page 1 7/2/2004 I. SUMA (SUrface MApping)  

E-Print Network (OSTI)

of dataset color mapping (color plane) order and opacity: Each dataset is colored interactively using SUMA whose order and opacity can be controlled for each surface model. The image below shows surface models with 4 stacked color planes consisting of the surface convexity, drawn ROIs, functional data from AFNI

Baker, Chris I.


City of Sumas, Washington (Utility Company) | Open Energy Information  

Open Energy Info (EERE)

Sumas, Washington (Utility Company) Sumas, Washington (Utility Company) Jump to: navigation, search Name City of Sumas Place Washington Utility Id 18282 Utility Location Yes Ownership M NERC Location WSCC NERC WECC Yes Activity Buying Transmission Yes Activity Distribution Yes References EIA Form EIA-861 Final Data File for 2010 - File1_a[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Utility Rate Schedules Grid-background.png Schedule Five - City Services Commercial Schedule One - Residential Residential Schedule Seven - Commercial Commercial Schedule Seven - Industrial Industrial Schedule Three - Commercial Commercial Schedule Three - Industrial Industrial Average Rates Residential: $0.0683/kWh Commercial: $0.0610/kWh


Motion to Intervene Out of Time of Sumas Energy 2, Inc on Proposed  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

of Sumas Energy 2, Inc on Proposed of Sumas Energy 2, Inc on Proposed Open-Access Requirement International Electric Transmission Facilities and Delegation to the Federal Energy Regulatory Commission. Motion to Intervene Out of Time of Sumas Energy 2, Inc on Proposed Open-Access Requirement International Electric Transmission Facilities and Delegation to the Federal Energy Regulatory Commission. Motion to intervene out ouf time by Sumas Energy 2, Inc on the proposed change in open-access requirement international electric transmission facilities and delegation to the Federal Energy Regulatory Commission. FE Docket No 99-1. Proposed open-access requirement international electric transmission facilities and delegation to the Federal Energy Regulatory Commission. More Documents & Publications


DOE - Office of Legacy Management -- Buffalo NY Site - NY 54  

NLE Websites -- All DOE Office Websites (Extended Search)

Buffalo NY Site - NY 54 Buffalo NY Site - NY 54 FUSRAP Considered Sites Buffalo, NY Alternate Name(s): Bliss & Laughlin Steel Company Niagara Cold Drawn Steel Corporation Ramco Steel Incorporated NY.54-1 NY.54-4 Location: 110 Hopkins Street, Buffalo, New York NY.54-1 Historical Operations: Machined and straightened uranium rods as subcontracted work from National Lead Company, an AEC contractor. NY.54-3 NY.54-4 LTSM012601 Eligibility Determination: Eligible NY.54-4 Radiological Survey(s): Assessment Surveys, Verification Surveys NY.54-6 NY.54-7 NY.54-8 LTSM012601 Site Status: Certified- Certification Basis and Certification Statement BLS000001 LTSM012152 LTSM012584 Long-term Care Requirements: Long-Term Surveillance and Maintenance Requirements for Remediated FUSRAP Sites S07566_FUSRAP


NY Green Bank  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Public Meeting in New York, NY: Energy Infrastructure Finance The conventional clean energy capital markets for large scale infrastructure are deep and robust. These markets...


Category:Syracuse, NY | Open Energy Information  

Open Energy Info (EERE)

Syracuse, NY Syracuse, NY Jump to: navigation, search Go Back to PV Economics By Location Media in category "Syracuse, NY" The following 16 files are in this category, out of 16 total. SVFullServiceRestaurant Syracuse NY Consolidated Edison Co-NY Inc.png SVFullServiceRestauran... 70 KB SVQuickServiceRestaurant Syracuse NY Consolidated Edison Co-NY Inc.png SVQuickServiceRestaura... 70 KB SVHospital Syracuse NY Consolidated Edison Co-NY Inc.png SVHospital Syracuse NY... 66 KB SVLargeHotel Syracuse NY Consolidated Edison Co-NY Inc.png SVLargeHotel Syracuse ... 69 KB SVLargeOffice Syracuse NY Consolidated Edison Co-NY Inc.png SVLargeOffice Syracuse... 68 KB SVMediumOffice Syracuse NY Consolidated Edison Co-NY Inc.png SVMediumOffice Syracus... 67 KB SVMidriseApartment Syracuse NY Consolidated Edison Co-NY Inc.png


Category:Rochester, NY | Open Energy Information  

Open Energy Info (EERE)

Rochester, NY Rochester, NY Jump to: navigation, search Go Back to PV Economics By Location Media in category "Rochester, NY" The following 16 files are in this category, out of 16 total. SVFullServiceRestaurant Rochester NY Consolidated Edison Co-NY Inc.png SVFullServiceRestauran... 70 KB SVQuickServiceRestaurant Rochester NY Consolidated Edison Co-NY Inc.png SVQuickServiceRestaura... 71 KB SVHospital Rochester NY Consolidated Edison Co-NY Inc.png SVHospital Rochester N... 65 KB SVLargeHotel Rochester NY Consolidated Edison Co-NY Inc.png SVLargeHotel Rochester... 69 KB SVLargeOffice Rochester NY Consolidated Edison Co-NY Inc.png SVLargeOffice Rocheste... 67 KB SVMediumOffice Rochester NY Consolidated Edison Co-NY Inc.png SVMediumOffice Rochest... 67 KB SVMidriseApartment Rochester NY Consolidated Edison Co-NY Inc.png


DOE - Office of Legacy Management -- New York, NY, Site - NY 61  

Office of Legacy Management (LM)

York, NY, Site - NY 61 York, NY, Site - NY 61 FUSRAP Considered Sites New York, NY Alternate Name(s): Baker and Williams Warehouses Ralph Ferrara Company Warehouses Ralph Ferrara, Inc. NY.61-2 Location: 513-519, 521-527, and 529-535 West 20th Street, New York, New York NY.61-3 Historical Operations: Received and stored uranium ores and concentrates for MED. NY.61-5 NY.61-6 NY.61-7 Eligibility Determination: Eligible NY.61-1 NY.61-2 Radiological Survey(s): Assessment Surveys, Verification Surveys NY.61-3 NY.61-4 NY.61-8 NY.61-9 NY.61-10 Site Status: Certified - Certification Basis, Federal Register Notice Included NY.61-11 Long-term Care Requirements: Long-Term Surveillance and Maintenance Requirements for Remediated FUSRAP Sites S07566_FUSRAP Also see New York, New York, Site


DOE - Office of Legacy Management -- Niagara Falls Storage Site NY - NY 17  

Office of Legacy Management (LM)

Niagara Falls Storage Site NY - NY Niagara Falls Storage Site NY - NY 17 FUSRAP Considered Sites Niagara Falls Storage Site, NY Alternate Name(s): Lake Ontario Ordnance Works (LOOW) Niagara Falls Storage Site (NFSS) DOE-Niagara Falls Storage Site NY.17-1 NY.17-3 Location: Lewiston, New York NY.17-5 Historical Operations: Stored, shipped, and buried radioactive equipment and waste for MED and AEC containing uranium, radium, and thorium. Contains Interim Waste Containment Structure. NY.17-1 NY.17-2 NY.17-14 Eligibility Determination: Eligible NY.17-4 Radiological Survey(s): Assessment Surveys NY.17-3 NY.17-5 NY.17-6 NY.17-7 NY.17-8 NY.17-9 NY.17-10 NY.17-11 NY.17-12 NY.17-14 Site Status: Cleanup in progress by U.S. Army Corps of Engineers. NY.17-13 NY.17-14 NY.17-15 NY.17-16 USACE Website Long-term Care Requirements: To be determined upon completion.


ACIM-~ NY.49  

Office of Legacy Management (LM)

' ' h:. ,,, ,_" , ACIM-~ NY.49 .,. i MEMORANDUM TO: FILE DATE FE: __~-tt_c~7' e_-_~-~------- --------- "%Kf-- ---- ---i------- Current: ~~~~~~--------__---_______ xf yee, date contacted- IVPE OF OPERATION f- ------------- Research & Development 0 Production scale testing 0 Pilot Scale 0 Bench Scale Process z Theoretical Studies Sample 84 Analysis 0 Production 0 Disposal/Storage a Facility Type 0 Manufacturing 0 University 0 Research Organization 0 Government Sponsored Fat a Other ------------------ c] Prime 0 Other information (i.e., co 0 Subcontractor + fixed fee, unit price, 0 Purchase Order time & material, +x:) G-----------^-------------- . ~~~~-----____~-~----------~ Contract/Purchase Order # ---------------------------------


NY-%-3 P  

Office of Legacy Management (LM)

NY-%-3 NY-%-3 P m F P F ?- P m ?- c m P P CII (I pl F F- 3?r -J-J-. _- /, i ;. / 0 Aerospace Report No. ATR-82 (796344-2 i Aq, is y !i,' Evaluation of the 1943Hto# 1946 ilid Liquid Effluent Discharge From the Linde Air Products Company Ceramics Plant December 198 I Prepared for Office of Operational Safety Assistant Secretary for Environmental Protection, Safety, and Emergency Preparedness U.S. DEPARTMENT OF ENERGY Prepared by Environment and Conservation Directorate Eastern Technical Division THE AEROSPACE CORPORATION Germantown, Maryland Contract No. DE-ACOP-81EV10532 I- ,- A e r o s p a c e R e p o r t N o . A T R - 8 2 ( 7 9 6 3 - 0 4 ) - 2 E V A L U A T IO N O F T H E 1 9 4 3 - T O - 1 9 4 6 L IQ U ID E F F L U E N T D IS C H A R G E F R O M T H E L INDE A IR P R O D U C T S C O M P A N Y C E R A M ICS P L A N T D e c e m b e r 1 9 8 1 P r e p a r e d for O


DOE - Office of Legacy Management -- Guterl Specialty Steel - NY 12  

Office of Legacy Management (LM)

Guterl Specialty Steel - NY 12 Guterl Specialty Steel - NY 12 FUSRAP Considered Sites Guterl Specialty Steel, NY Alternate Name(s): Simonds Saw and Steel Co. Guterl Steel Allegheny Ludlum Steel Corp. NY.12-1 NY.12-2 Location: Ohio Street and Route 95, Lockport, New York NY.12-12 Historical Operations: Performed rolling mill operations on natural uranium and thorium metal. NY.12-6 NY.12-7 Eligibility Determination: NY.12-11 Radiological Survey(s): Assessment Surveys NY.12-1 NY.12-4 NY.12-8 NY.12-9 NY.12-12 Site Status: Cleanup pending by U.S. Army Corps of Engineers. NY.12-10 NY.12-11 USACE Website Long-term Care Requirements: To be determined upon completion. Also see Documents Related to Guterl Specialty Steel, NY NY.12-1 - ORNL Letter; Cottrell to Turi; Radiological Survey of the


DOE - Office of Legacy Management -- Colonie - NY 06  

NLE Websites -- All DOE Office Websites (Extended Search)

Considered Sites > Colonie - NY 06 Considered Sites > Colonie - NY 06 FUSRAP Considered Sites Colonie, NY Alternate Name(s): Colonie Interim Storage Site National Lead Industries NY.06-1 Location: 1130 Central Avenue, Colonie, New York NY.06-1 Historical Operations: Fabricated and processed uranium metal for the AEC, resulting in contamination from thorium and natural, enriched, and depleted uranium. NY.06-1 NY.06-4 NY.06-5 Eligibility Determination: Eligible NY.06-2 NY.06-3 Radiological Survey(s): Assessment Surveys, Verification Surveys NY.06-6 NY.06-7 Site Status: Cleanup in progress by U.S. Army Corps of Engineers. NY.06-8 NY.06-9 NY.06-10 NY.06-11 USACE Website Long-term Care Requirements: To be determined upon completion. Also see Documents Related to Colonie, NY Colonie Site Aerial Photograph


DOE - Office of Legacy Management -- Niagara Falls Vicinity Properties NY -  

Office of Legacy Management (LM)

Niagara Falls Vicinity Properties Niagara Falls Vicinity Properties NY - NY 17 FUSRAP Considered Sites Niagara Falls Vicinity Properties, NY Alternate Name(s): Lake Ontario Ordnance Works (LOOW) Niagara Falls Storage Site (NFSS) DOE-Niagara Falls Storage Site NY.17-1 NY.17-3 Location: Lewiston , New York NY.17-5 Historical Operations: Stored, shipped, and buried radioactive equipment and waste for MED and AEC containing uranium, radium, and thorium. Portions of the former site are privately owned, creating a "site" for the vicinity properties. NY.17-1 NY.17-2 NY.17-14 Eligibility Determination: Eligible NY.17-4 Radiological Survey(s): Assessment Surveys, Verification Surveys NY.17-3 NY.17-5 NY.17-6 NY.17-7 NY.17-8 NY.17-9 NY.17-10 NY.17-11 NY.17-12 NY.17-14 Site Status: Certification Basis, including Federal Register Notice for 23 properties. Cleanup in progress for additional 3 VPs. NY.17-13


NY.O-20- I  

Office of Legacy Management (LM)

; I.-' ; I.-' NY.O-20- I ' 3% 3 MEMORANDUM TO: FILE FKOM: An&x?! w311E? SUHYECT: .Elimination of Pyroferric Co. New Yor SITE ALT NAME: EYE&XCLG f2!Y2~!2Y 621 E. 216th St. CITY: N__ew_ yw-r; STATE: N__V _ok!kEKm. Past: P_rrof_errrLc Go: current: Qwner contacted X yes no; if yes, date co Past owner2 IYE OE C)PEEux!N g Research et Develapment Faci - Production scale testing x M XX - Experimental tests U - Henoh.Scale Process R - Theoretical Studies Gove - Sample % Analysis 0 Production Disposal/Storage "t acted 1 1/10/G iz 17 -&49s300 move !d t li ari ty TYPO "i e+i "! "7 Prime Othe X Subcontractor Furcharje Order r: + fixed time 8: n k, Elr( NY NATE NI?IME: P_YD2fC Inter" Contract/Purchase Order # 33482 with AMF ----- ---- ---


DOE - Office of Legacy Management -- Syracuse University - NY 29  

Office of Legacy Management (LM)

Syracuse University - NY 29 Syracuse University - NY 29 FUSRAP Considered Sites Site: SYRACUSE UNIVERSITY (NY.29) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: None Location: Syracuse , New York NY.29-1 Evaluation Year: 1994 NY.29-2 Site Operations: Activities included work with uranium oxide and the precipitation of thorium iodate from homogeneous solution. NY.29-1 NY.29-3 NY.29-4 Site Disposition: Eliminated - Potential for contamination remote NY.29-2 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Uranium, Thorium NY.29-3 NY.29-4 Radiological Survey(s): None Indicated Site Status: Eliminated from consideration under FUSRAP Also see Documents Related to SYRACUSE UNIVERSITY NY.29-1 - AEC Memorandum; Belmore to Rodden; Request for Uranium


DOE - Office of Legacy Management -- Bethlehem Steel Corporation - NY 02  

Office of Legacy Management (LM)

Bethlehem Steel Corporation - NY 02 Bethlehem Steel Corporation - NY 02 FUSRAP Considered Sites Site: BETHLEHEM STEEL CORPORATION (NY.02 ) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: None Location: Lackawanna , New York NY.02-1 Evaluation Year: 1985 NY.02-2 Site Operations: Conducted high temperature alpha-phase rolling tests on uranium metal in the 1950s. NY.02-3 Site Disposition: Eliminated - Radiation levels below criteria NY.02-5 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Uranium NY.02-3 Radiological Survey(s): Yes NY.02-4 NY.02-5 Site Status: Eliminated from consideration under FUSRAP NY.02-6 Also see Documents Related to BETHLEHEM STEEL CORPORATION NY.02-1 - Bethlehem Steel Corp. Letter; Subject: Completed Access

Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Category:New York, NY | Open Energy Information  

Open Energy Info (EERE)

York, NY York, NY Jump to: navigation, search Go Back to PV Economics By Location Media in category "New York, NY" The following 16 files are in this category, out of 16 total. SVFullServiceRestaurant New York NY Consolidated Edison Co-NY Inc.png SVFullServiceRestauran... 70 KB SVQuickServiceRestaurant New York NY Consolidated Edison Co-NY Inc.png SVQuickServiceRestaura... 71 KB SVHospital New York NY Consolidated Edison Co-NY Inc.png SVHospital New York NY... 64 KB SVLargeHotel New York NY Consolidated Edison Co-NY Inc.png SVLargeHotel New York ... 68 KB SVLargeOffice New York NY Consolidated Edison Co-NY Inc.png SVLargeOffice New York... 67 KB SVMediumOffice New York NY Consolidated Edison Co-NY Inc.png SVMediumOffice New Yor... 67 KB SVMidriseApartment New York NY Consolidated Edison Co-NY Inc.png


Los Alamos technology to be featured on CSI: NY  

NLE Websites -- All DOE Office Websites (Extended Search)

on CSI: NY Los Alamos technology to be featured on CSI: NY The multipurpose "sampler gun" rapidly collects and tracks radiological, chemical, and biological samples in solid,...


Price of Massena, NY Natural Gas Pipeline Exports to Canada ...  

U.S. Energy Information Administration (EIA) Indexed Site

Massena, NY Natural Gas Pipeline Exports to Canada (Dollars per Thousand Cubic Feet) Price of Massena, NY Natural Gas Pipeline Exports to Canada (Dollars per Thousand Cubic Feet)...


DOE - Office of Legacy Management -- Memorial Hospital - NY 0...  

Office of Legacy Management (LM)

Memorial Hospital - NY 0-16 FUSRAP Considered Sites Site: MEMORIAL HOSPITAL (NY.0-16 ) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name:...


U.S. Total Exports  

Gasoline and Diesel Fuel Update (EIA)

Babb, MT Havre, MT Port of Morgan, MT Pittsburg, NH Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Sweetgrass, MT Total to Chile Sabine Pass, LA Total to China Kenai, AK Sabine Pass, LA Total to India Freeport, TX Sabine Pass, LA Total to Japan Cameron, LA Kenai, AK Sabine Pass, LA Total to Mexico Douglas, AZ Nogales, AZ Calexico, CA Ogilby Mesa, CA Otay Mesa, CA Alamo, TX Clint, TX Del Rio, TX Eagle Pass, TX El Paso, TX Hidalgo, TX McAllen, TX Penitas, TX Rio Bravo, TX Roma, TX Total to Portugal Sabine Pass, LA Total to Russia Total to South Korea Freeport, TX Sabine Pass, LA Total to Spain Cameron, LA Sabine Pass, LA Total to United Kingdom Sabine Pass, LA Period: Monthly Annual


U.S. Liquefied Natural Gas Exports to United Kingdom  

Gasoline and Diesel Fuel Update (EIA)

Babb, MT Havre, MT Port of Morgan, MT Pittsburg, NH Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Sweetgrass, MT Total to Chile Sabine Pass, LA Total to China Kenai, AK Sabine Pass, LA Total to India Freeport, TX Sabine Pass, LA Total to Japan Cameron, LA Kenai, AK Sabine Pass, LA Total to Mexico Douglas, AZ Nogales, AZ Calexico, CA Ogilby Mesa, CA Otay Mesa, CA Alamo, TX Clint, TX Del Rio, TX Eagle Pass, TX El Paso, TX Hidalgo, TX McAllen, TX Penitas, TX Rio Bravo, TX Roma, TX Total to Portugal Sabine Pass, LA Total to Russia Total to South Korea Freeport, TX Sabine Pass, LA Total to Spain Cameron, LA Sabine Pass, LA Total to United Kingdom Sabine Pass, LA Period: Monthly Annual


U.S. Natural Gas Exports to China  

Gasoline and Diesel Fuel Update (EIA)

Babb, MT Havre, MT Port of Morgan, MT Pittsburg, NH Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Sweetgrass, MT Total to Chile Sabine Pass, LA Total to China Kenai, AK Sabine Pass, LA Total to India Freeport, TX Sabine Pass, LA Total to Japan Cameron, LA Kenai, AK Sabine Pass, LA Total to Mexico Douglas, AZ Nogales, AZ Calexico, CA Ogilby Mesa, CA Otay Mesa, CA Alamo, TX Clint, TX Del Rio, TX Eagle Pass, TX El Paso, TX Hidalgo, TX McAllen, TX Penitas, TX Rio Bravo, TX Roma, TX Total to Portugal Sabine Pass, LA Total to Russia Total to South Korea Freeport, TX Sabine Pass, LA Total to Spain Cameron, LA Sabine Pass, LA Total to United Kingdom Sabine Pass, LA Period: Monthly Annual


U.S. Liquefied Natural Gas Exports to India  

Gasoline and Diesel Fuel Update (EIA)

Babb, MT Havre, MT Port of Morgan, MT Pittsburg, NH Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Sweetgrass, MT Total to Chile Sabine Pass, LA Total to China Kenai, AK Sabine Pass, LA Total to India Freeport, TX Sabine Pass, LA Total to Japan Cameron, LA Kenai, AK Sabine Pass, LA Total to Mexico Douglas, AZ Nogales, AZ Calexico, CA Ogilby Mesa, CA Otay Mesa, CA Alamo, TX Clint, TX Del Rio, TX Eagle Pass, TX El Paso, TX Hidalgo, TX McAllen, TX Penitas, TX Rio Bravo, TX Roma, TX Total to Portugal Sabine Pass, LA Total to Russia Total to South Korea Freeport, TX Sabine Pass, LA Total to Spain Cameron, LA Sabine Pass, LA Total to United Kingdom Sabine Pass, LA Period: Monthly Annual


U.S. Natural Gas Exports to Russia  

Gasoline and Diesel Fuel Update (EIA)

Babb, MT Havre, MT Port of Morgan, MT Pittsburg, NH Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Sweetgrass, MT Total to Chile Sabine Pass, LA Total to China Kenai, AK Sabine Pass, LA Total to India Freeport, TX Sabine Pass, LA Total to Japan Cameron, LA Kenai, AK Sabine Pass, LA Total to Mexico Douglas, AZ Nogales, AZ Calexico, CA Ogilby Mesa, CA Otay Mesa, CA Alamo, TX Clint, TX Del Rio, TX Eagle Pass, TX El Paso, TX Hidalgo, TX McAllen, TX Penitas, TX Rio Bravo, TX Roma, TX Total to Portugal Sabine Pass, LA Total to Russia Total to South Korea Freeport, TX Sabine Pass, LA Total to Spain Cameron, LA Sabine Pass, LA Total to United Kingdom Sabine Pass, LA Period: Monthly Annual


U.S. Natural Gas Exports to Portugal  

Gasoline and Diesel Fuel Update (EIA)

Babb, MT Havre, MT Port of Morgan, MT Pittsburg, NH Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Sweetgrass, MT Total to Chile Sabine Pass, LA Total to China Kenai, AK Sabine Pass, LA Total to India Freeport, TX Sabine Pass, LA Total to Japan Cameron, LA Kenai, AK Sabine Pass, LA Total to Mexico Douglas, AZ Nogales, AZ Calexico, CA Ogilby Mesa, CA Otay Mesa, CA Alamo, TX Clint, TX Del Rio, TX Eagle Pass, TX El Paso, TX Hidalgo, TX McAllen, TX Penitas, TX Rio Bravo, TX Roma, TX Total to Portugal Sabine Pass, LA Total to Russia Total to South Korea Freeport, TX Sabine Pass, LA Total to Spain Cameron, LA Sabine Pass, LA Total to United Kingdom Sabine Pass, LA Period: Monthly Annual


U.S. Natural Gas Exports to Mexico  

Gasoline and Diesel Fuel Update (EIA)

Babb, MT Havre, MT Port of Morgan, MT Pittsburg, NH Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Sweetgrass, MT Total to Chile Sabine Pass, LA Total to China Kenai, AK Sabine Pass, LA Total to India Freeport, TX Sabine Pass, LA Total to Japan Cameron, LA Kenai, AK Sabine Pass, LA Total to Mexico Douglas, AZ Nogales, AZ Calexico, CA Ogilby Mesa, CA Otay Mesa, CA Alamo, TX Clint, TX Del Rio, TX Eagle Pass, TX El Paso, TX Hidalgo, TX McAllen, TX Penitas, TX Rio Bravo, TX Roma, TX Total to Portugal Sabine Pass, LA Total to Russia Total to South Korea Freeport, TX Sabine Pass, LA Total to Spain Cameron, LA Sabine Pass, LA Total to United Kingdom Sabine Pass, LA Period: Monthly Annual


U.S. Liquefied Natural Gas Exports to Japan  

Gasoline and Diesel Fuel Update (EIA)

Babb, MT Havre, MT Port of Morgan, MT Pittsburg, NH Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Sweetgrass, MT Total to Chile Sabine Pass, LA Total to China Kenai, AK Sabine Pass, LA Total to India Freeport, TX Sabine Pass, LA Total to Japan Cameron, LA Kenai, AK Sabine Pass, LA Total to Mexico Douglas, AZ Nogales, AZ Calexico, CA Ogilby Mesa, CA Otay Mesa, CA Alamo, TX Clint, TX Del Rio, TX Eagle Pass, TX El Paso, TX Hidalgo, TX McAllen, TX Penitas, TX Rio Bravo, TX Roma, TX Total to Portugal Sabine Pass, LA Total to Russia Total to South Korea Freeport, TX Sabine Pass, LA Total to Spain Cameron, LA Sabine Pass, LA Total to United Kingdom Sabine Pass, LA Period: Monthly Annual


U.S. Natural Gas Exports to Russia  

Gasoline and Diesel Fuel Update (EIA)

Babb, MT Havre, MT Port of Morgan, MT Pittsburg, NH Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Sweetgrass, MT Total to Chile Sabine Pass, LA Total to China Kenai, AK Sabine Pass, LA Total to India Freeport, TX Sabine Pass, LA Total to Japan Cameron, LA Kenai, AK Sabine Pass, LA Total to Mexico Douglas, AZ Nogales, AZ Calexico, CA Ogilby Mesa, CA Otay Mesa, CA Alamo, TX Clint, TX Del Rio, TX Eagle Pass, TX El Paso, TX Hidalgo, TX McAllen, TX Penitas, TX Rio Bravo, TX Roma, TX Total to Portugal Sabine Pass, LA Total to Russia Total to South Korea Freeport, TX Sabine Pass, LA Total to Spain Cameron, LA Sabine Pass, LA Total to United Kingdom Sabine Pass, LA Period: Monthly Annual


DOE - Office of Legacy Management -- Hooker Chemical Co - NY 05  

Office of Legacy Management (LM)

Hooker Chemical Co - NY 05 Hooker Chemical Co - NY 05 FUSRAP Considered Sites Site: Hooker Chemical Co. (NY.05) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: Occidental Chemical Corporation Hooker Electrochemical Corporation NY.05-1 NY.05-2 Location: Niagara Falls , New York NY.05-3 Evaluation Year: 1985 NY.05-1 NY.05-2 Site Operations: Design, engineering, construction, equipping and operation of a plant for the manufacture of Product 45 (xylene hexachloride); MFL (Miller's fluorolubricant); P-45Cl; and recovered P-45Cl2 from residues produced in the manufacture of P-45Cl; used hydrochloric acid (a byproduct of the P-45 Program) in the chemical processing of uranium-bearing slag as a precursor to recovery. NY.05-2 NY.05-4 Site Disposition: Eliminated - Radiation levels below criteria NY.05-1


DOE - Office of Legacy Management -- New York University - NY 50  

Office of Legacy Management (LM)

University - NY 50 University - NY 50 FUSRAP Considered Sites Site: NEW YORK UNIVERSITY (NY.50) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: None Location: New York , New York NY.50-1 Evaluation Year: 1987 NY.50-1 Site Operations: Activities were related to equipment development. Counters and a small quantity of uranium oxide were provided by the AEC for work under contract AT(30-1)-1256. NY.50-2 NY.50-3 NY.50-4 NY.50-1 Site Disposition: Eliminated - Potential for contamination considered remote - Limited quantity of radioactive material used at this site NY.50-1 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Uranium NY.50-2 Radiological Survey(s): None Indicated Site Status: Eliminated from consideration under FUSRAP


DOE - Office of Legacy Management -- Gleason Works - NY 55  

Office of Legacy Management (LM)

Gleason Works - NY 55 Gleason Works - NY 55 FUSRAP Considered Sites Site: GLEASON WORKS (NY.55 ) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: None Location: Rochester , New York NY.55-1 Evaluation Year: 1994 NY.55-2 Site Operations: Metal fabrication operations - Rolled uranium metal. NY.55-1 Site Disposition: Eliminated - Potential for contamination considered remote NY.55-2 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Uranium NY.55-1 Radiological Survey(s): Health and Safety Monitoring NY.55-1 NY.55-3 Site Status: Eliminated from consideration under FUSRAP Also see Documents Related to GLEASON WORKS NY.55-1 - NLO Report; Klein to Quigley; Trip Report to the Gleason Works, Rochester, New York on October 30 Thru November 10, 1961; December


Northeast - NY NJ CT PA Area | Open Energy Information  

Open Energy Info (EERE)

Northeast - NY NJ CT PA Area Northeast - NY NJ CT PA Area (Redirected from New York Area - NY NJ CT PA) Jump to: navigation, search Contents 1 Clean Energy Clusters in the Northeast - NY NJ CT PA Area 1.1 Products and Services in the Northeast - NY NJ CT PA Area 1.2 Research and Development Institutions in the Northeast - NY NJ CT PA Area 1.3 Networking Organizations in the Northeast - NY NJ CT PA Area 1.4 Investors and Financial Organizations in the Northeast - NY NJ CT PA Area 1.5 Policy Organizations in the Northeast - NY NJ CT PA Area Clean Energy Clusters in the Northeast - NY NJ CT PA Area Products and Services in the Northeast - NY NJ CT PA Area Loading map... {"format":"googlemaps3","type":"ROADMAP","types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"limit":500,"offset":0,"link":"all","sort":[""],"order":[],"headers":"show","mainlabel":"","intro":"","outro":"","searchlabel":"\u2026


DOE - Office of Legacy Management -- Electromet Corporation - NY 04  

Office of Legacy Management (LM)

Electromet Corporation - NY 04 Electromet Corporation - NY 04 FUSRAP Considered Sites Site: Electromet Corporation (NY.04 ) Eliminated from consideration under FUSRAP - Referred to US EPA and New York State Designated Name: Not Designated Alternate Name: None Location: 4625 Royal Avenue , Niagara Falls , New York NY.04-1 Evaluation Year: 1985 NY.04-2 NY.04-3 Site Operations: Cast zirconium sponge into ingots in the 1950s. NY.04-4 Site Disposition: Eliminated - No Authority NY.04-2 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Uranium, Zirconium NY.04-4 Radiological Survey(s): Yes NY.04-6 Site Status: Eliminated from consideration under FUSRAP - Referred to US EPA and New York State NY.04-2 Also see Documents Related to Electromet Corporation


DOE - Office of Legacy Management -- Rensslaer Polytechnic Institute - NY  

Office of Legacy Management (LM)

Rensslaer Polytechnic Institute - Rensslaer Polytechnic Institute - NY 18 FUSRAP Considered Sites Site: RENSSLAER POLYTECHNIC INSTITUTE (NY.18 ) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: None Location: Troy , New York NY.18-1 Evaluation Year: 1987 NY.18-1 Site Operations: Research activities involving small quantities of radioactive materials in a controlled environment - under AEC license. NY.18-1 Site Disposition: Eliminated - Potential for residual contamination considered remote NY.18-1 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Not Specified NY.18-1 Radiological Survey(s): None Indicated Site Status: Eliminated from consideration under FUSRAP Also see Documents Related to RENSSLAER POLYTECHNIC INSTITUTE


DOE - Office of Legacy Management -- Seneca Army Depot - NY 11  

NLE Websites -- All DOE Office Websites (Extended Search)

Seneca Army Depot - NY 11 Seneca Army Depot - NY 11 FUSRAP Considered Sites Site: SENECA ARMY DEPOT (NY.11 ) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: None Location: Romulus , New York Evaluation Year: 1985 NY.11-2 NY.11-3 Site Operations: Eleven bunkers were used to store approximately 2,000 drums of pitchblende ore in the early 1940's. The bunkers were returned to munitions storage service after removal of the ore drums. NY.11-4 Site Disposition: Eliminated - Referred to The Department of the Army NY.11-2 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Pitchblende Ore NY.11-3 Radiological Survey(s): Yes NY.11-5 Site Status: Eliminated from consideration under FUSRAP NY.11-2 Also see Documents Related to SENECA ARMY DEPOT

Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


DOE - Office of Legacy Management -- Radiation Applications Inc - NY 57  

NLE Websites -- All DOE Office Websites (Extended Search)

Radiation Applications Inc - NY 57 Radiation Applications Inc - NY 57 FUSRAP Considered Sites Site: RADIATION APPLICATIONS, INC. ( NY.57 ) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: RAI NY.57-1 Location: 370 Lexington Avenue , New York , New York NY.57-3 Evaluation Year: 1991 NY.57-4 Site Operations: Developed foam separation techniques and proposed investigations to remove cesium and strontium from fission product waste solutions. No indication that a substantial quantity of radioactive material was involved. NY.57-3 NY.57-5 Site Disposition: Eliminated - Potential for contamination considered remote NY.57-4 Radioactive Materials Handled: None Indicated NY.57-1 Primary Radioactive Materials Handled: None Indicated Radiological Survey(s): None Indicated


DOE - Office of Legacy Management -- Love Canal - NY 24  

Office of Legacy Management (LM)

Love Canal - NY 24 Love Canal - NY 24 FUSRAP Considered Sites Site: LOVE CANAL (NY.24 ) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: None NY.24-1 Location: Region running from Old Military Road from the 16-acre rectangular piece of land in the southeast corner of Niagara Falls into the Township of Lewiston , Niagara Falls , New York NY.24-3 Evaluation Year: 1987 NY.24-1 Site Operations: Chemical storage and disposal. NY.24-1 NY.24-3 Site Disposition: Eliminated - No residual radioactive material found NY.24-1 Radioactive Materials Handled: None Indicated Primary Radioactive Materials Handled: None Indicated Radiological Survey(s): Yes NY.24-5 Site Status: Eliminated from consideration under FUSRAP Also see Documents Related to LOVE CANAL


DOE - Office of Legacy Management -- Markite Co - NY 49  

Office of Legacy Management (LM)

Markite Co - NY 49 Markite Co - NY 49 FUSRAP Considered Sites Site: MARKITE CO. (NY.49 ) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: None Location: 155 Waverly Place , New York , New York NY.49-1 Evaluation Year: 1987 NY.49-2 Site Operations: Conducted experiments with very small amounts of uranium and thorium. NY.49-2 Site Disposition: Eliminated - Handled limited amounts of radioactive materials - Potential for contamination remote NY.49-2 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Uranium, Thorium NY.49-2 NY.49-3 Radiological Survey(s): None Indicated Site Status: Eliminated from consideration under FUSRAP Also see Documents Related to MARKITE CO. NY.49-1 - AEC Memorandum; Morgan to Youngs; Accountability at


Northeast - NY NJ CT PA Area | Open Energy Information  

Open Energy Info (EERE)

Northeast - NY NJ CT PA Area Northeast - NY NJ CT PA Area Jump to: navigation, search Contents 1 Clean Energy Clusters in the Northeast - NY NJ CT PA Area 1.1 Products and Services in the Northeast - NY NJ CT PA Area 1.2 Research and Development Institutions in the Northeast - NY NJ CT PA Area 1.3 Networking Organizations in the Northeast - NY NJ CT PA Area 1.4 Investors and Financial Organizations in the Northeast - NY NJ CT PA Area 1.5 Policy Organizations in the Northeast - NY NJ CT PA Area Clean Energy Clusters in the Northeast - NY NJ CT PA Area Products and Services in the Northeast - NY NJ CT PA Area Loading map... {"format":"googlemaps3","type":"ROADMAP","types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"limit":500,"offset":0,"link":"all","sort":[""],"order":[],"headers":"show","mainlabel":"","intro":"","outro":"","searchlabel":"\u2026


DOE - Office of Legacy Management -- National Carbon Co - NY 48  

Office of Legacy Management (LM)

Carbon Co - NY 48 Carbon Co - NY 48 FUSRAP Considered Sites Site: NATIONAL CARBON CO (NY.48) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: None Location: New York , New York NY.48-1 Evaluation Year: 1987 NY.48-2 Site Operations: Produced graphite for the MED/AEC. NY.48-1 NY.48-2 NY.48-3 Site Disposition: Eliminated - Potential for residual radioactive contamination considered remote - No indication that radioactive material was used on the site NY.48-2 Radioactive Materials Handled: No Primary Radioactive Materials Handled: None Radiological Survey(s): None Indicated Site Status: Eliminated from consideration under FUSRAP Also see Documents Related to NATIONAL CARBON CO NY.48-1 - AEC Letter; Crenshaw to National Carbon Company (Attn.:


DOE - Office of Legacy Management -- Buflovak Co - NY 56  

Office of Legacy Management (LM)

Buflovak Co - NY 56 Buflovak Co - NY 56 FUSRAP Considered Sites Site: Buflovak Co. (NY.56 ) Eliminated from further consideration under FUSRAP Designated Name: Not Designated Alternate Name: None Location: 1543 Fillmore Ave. , Buffalo , New York NY.56-1 Evaluation Year: 1991 NY.56-2 Site Operations: Research and testing with uranium raffinate. NY.56-1 Site Disposition: Eliminated - Possibility for contamination considered remote due to scope of tests conducted and indication of cleanup operations after tests NY.56-1 NY.56-2 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Uranium Raffinate NY.56-1 Radiological Survey(s): None Indicated Site Status: Eliminated from further consideration under FUSRAP Also see Documents Related to Buflovak Co.


DOE - Office of Legacy Management -- Sylvania Corning Plant - NY 19  

Office of Legacy Management (LM)

Plant - NY 19 Plant - NY 19 FUSRAP Considered Sites Sylvania-Corning, NY Alternate Name(s): Sylvania Electric Products, Inc. Sylvania Corp. NY.19-1 NY.19-4 Location: Cantiaque Road, Hicksville, Long Island, New York NY.19-5 Historical Operations: Pilot-scale production of powdered metal uranium slugs for AEC's Hanford reactor. NY.19-4 Eligibility Determination: Eligible Radiological Survey(s): Assessment Survey NY.19-3 Site Status: Cleanup in progress by U.S. Army Corps of Engineers. USACE Website Long-term Care Requirements: To be determined upon completion. Also see Documents Related to Sylvania-Corning, NY Historical documents may contain links which are no longer valid or to outside sources. LM can not attest to the accuracy of information provided by these links. Please see the Leaving LM Website page for more details.


DOE - Office of Legacy Management -- Staten Island Warehouse - NY 22  

Office of Legacy Management (LM)

Staten Island Warehouse - NY 22 Staten Island Warehouse - NY 22 FUSRAP Considered Sites Staten Island Warehouse, NY Alternate Name(s): Archer-Daniels Midland Company NY.22-3 Location: 2393 Richmond Terrace, Port Richmond, New York NY.22-2 Historical Operations: Stored pitchblende (high-grade uranium ore), which was purchased by the MED for the first atomic bomb. NY.22-3 Eligibility Determination: Eligible Radiological Survey(s): Assessment Survey NY.22-5 Site Status: Referred by DOE, evaluation in progess by U.S. Army Corps of Engineers. USACE Website Long-term Care Requirements: To be determined upon completion. Also see Documents Related to Staten Island Warehouse, NY NY.22-1 - MED Trip Report Summary; Authors: Ruhoff (Corps of Engineers) and Geddes (Stone & Webster); Subject: Trip to New York;


DOE - Office of Legacy Management -- American Railway Express Office - NY  

Office of Legacy Management (LM)

Railway Express Office - Railway Express Office - NY 0-03 FUSRAP Considered Sites Site: American Railway Express Office (NY.0-03 ) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: None Location: American Railway Express (Downtown) , New York , New York NY.0-03-1 Evaluation Year: 1987 NY.0-03-1 Site Operations: None - Involved with a fire during transport of uranium scrap. NY.0-03-2 Site Disposition: Eliminated - Potential for contamination remote NY.0-03-1 NY.0-03-2 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Uranium scrap NY.0-03-2 Radiological Survey(s): None Indicated Site Status: Eliminated from consideration under FUSRAP NY.0-03-1 Also see Documents Related to American Railway Express Office


DOE - Office of Legacy Management -- Ledoux and Co - NY 37  

NLE Websites -- All DOE Office Websites (Extended Search)

Ledoux and Co - NY 37 Ledoux and Co - NY 37 FUSRAP Considered Sites Site: LEDOUX AND CO. (NY.37 ) Eliminated from further consideration under FUSRAP Designated Name: Not Designated Alternate Name: None Location: 155 Avenue of the Americas , New York , New York NY.37-1 Evaluation Year: 1987 NY.37-1 Site Operations: Prime contractor to AEC, African Metals. LeDoux handled radioactive materials under this contract at other locations; records indicate that radioactive materials were not sent to the New York office. NY.37-1 Site Disposition: Eliminated - Potential for contamination considered remote - Radioactive materials were not handled NY.37-2 NY.37-3 Radioactive Materials Handled: No NY.37-2 Primary Radioactive Materials Handled: None Radiological Survey(s): None Indicated


DOE - Office of Legacy Management -- Polytechnic Institute of Brooklyn - NY  

Office of Legacy Management (LM)

Polytechnic Institute of Brooklyn - Polytechnic Institute of Brooklyn - NY 0-19 FUSRAP Considered Sites Site: NY.0-19 (POLYTECHNIC INSTITUTE OF BROOKLYN) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: None Location: New York , New York NY.0-19-1 Evaluation Year: 1987 NY.0-19-1 Site Operations: Research and development involving only small quantities of radiological material in a controlled environment. NY.0-19-1 Site Disposition: Eliminated - Potential for contamination remote NY.0-19-1 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Not specified NY.0-19-1 Radiological Survey(s): None Indicated Site Status: Eliminated from consideration under FUSRAP Also see Documents Related to NY.0-19 NY.0-19-1 - Aerospace Letter; Young to Wallo; Subject: Elimination


US MidAtl NY Site Consumption  

Gasoline and Diesel Fuel Update (EIA)

MidAtl NY MidAtl NY Site Consumption million Btu $0 $500 $1,000 $1,500 $2,000 $2,500 $3,000 US MidAtl NY Expenditures dollars ALL ENERGY average per household (excl. transportation) 0 2,000 4,000 6,000 8,000 10,000 12,000 US MidAtl NY Site Consumption kilowatthours $0 $250 $500 $750 $1,000 $1,250 $1,500 US MidAtl NY Expenditures dollars ELECTRICITY ONLY average per household * New York households consume an average of 103 million Btu per year, 15% more than the U.S. average. * Electricity consumption in New York homes is much lower than the U.S. average, because many households use other fuels for major energy end uses like space heating, water heating, and cooking. Electricity costs are closer to the national average due to higher than average electricity prices in the state.


US MidAtl NY Site Consumption  

U.S. Energy Information Administration (EIA) Indexed Site

MidAtl NY MidAtl NY Site Consumption million Btu $0 $500 $1,000 $1,500 $2,000 $2,500 $3,000 US MidAtl NY Expenditures dollars ALL ENERGY average per household (excl. transportation) 0 2,000 4,000 6,000 8,000 10,000 12,000 US MidAtl NY Site Consumption kilowatthours $0 $250 $500 $750 $1,000 $1,250 $1,500 US MidAtl NY Expenditures dollars ELECTRICITY ONLY average per household * New York households consume an average of 103 million Btu per year, 15% more than the U.S. average. * Electricity consumption in New York homes is much lower than the U.S. average, because many households use other fuels for major energy end uses like space heating, water heating, and cooking. Electricity costs are closer to the national average due to higher than average electricity prices in the state.


DOE - Office of Legacy Management -- Sacandaga - NY 51  

Office of Legacy Management (LM)

York NY.51-1 Evaluation Year: 1992 NY.51-2 Site Operations: Plant operated by General Electric during period spanning 1947 to 1951. Facilities housed studies involving radar,...


Geothermal energy and district heating in Ny-lesund, Svalbard .  

E-Print Network (OSTI)

??This thesis presents the possibilities for using shallow geothermal energy for heating purposes in Ny-lesund. The current energy supply in Ny-lesund is a diesel generator, (more)

Iversen, Julianne



DOE - Office of Legacy Management -- ACF Industries Inc - NY...  

Office of Legacy Management (LM)

Evaluation Year: 1987 NY.13-1 Site Operations: Procured, produced, and delivered mechanical and cryogenic weapons components. No radioactive materials used at the site. NY.13-2...


DOE - Office of Legacy Management -- Linde Air Products Division - NY 08  

NLE Websites -- All DOE Office Websites (Extended Search)

Division - NY 08 Division - NY 08 FUSRAP Considered Sites Linde Air Products Division - Towanda, NY Alternate Name(s): Praxair Linde Aire Products Div. of Union Carbide Corp. Linde Ceramics Plant Uranium Refinery, Linde Site NY.08-4 Location: East Park Drive and Woodward, Tonawanda, New York NY.08-5 Historical Operations: Processed uranium compounds for MED and AEC. Includes Towanda Landfill as a VP. NY.08-1 NY.08-2 Eligibility Determination: Eligible NY.08-9 Radiological Survey(s): Assessment Surveys NY.08-3 NY.08-5 NY.08-6 NY.08-7 Site Status: Cleanup in progress by U.S. Army Corps of Engineers. NY.08-8 USACE Website Long-term Care Requirements: To be determined upon completion. Also see Linde FUSRAP Site Documents Related to Linde Air Products Division - Towanda, NY



Office of Legacy Management (LM)

AFRICAN .METALS~ C~RPO~~XON AFRICAN .METALS~ C~RPO~~XON 41 BROAD STREET . i. ,,J iI: : LE OCT 2 2 1945 NlZWYORK4,N.Y. :October 5, 1945. Af-2-a L.: I.__: '../ . ._ The Area Engineer, U.S. Engineer Office, P.O. BOX 42, Station F., New York 16, N.Y. Gentlemen: Contract W-7405 eng-4. Reference is made to your letter EIDM A-33 MS of August 27th, 1945. Contract W-7405 eng-4 called for the delivery of 100 T of M-31, the M308 content of which was sold to you, whereas we reserved all rights to the R-l contained therein. We hereby certify that the liability of the Gouvernment in connection with the M308 contained--has .3*,., been completely fulfilled, and that the R-l%ontained has been returned to us in accordance with separate contract entered into between this Corporation and the Eldorado


DOE - Office of Legacy Management -- Naval Supply Depot AEC Warehouse - NY  

Office of Legacy Management (LM)

Supply Depot AEC Warehouse - Supply Depot AEC Warehouse - NY 36 FUSRAP Considered Sites Site: NAVAL SUPPLY DEPOT, AEC WAREHOUSE (NY.36) Eliminated from further consideration under FUSRAP - Referred to DOD Designated Name: Not Designated Alternate Name: None Location: Building 546 , Scotia , New York NY.36-1 Evaluation Year: 1987 NY.36-1 Site Operations: This facility served as a storage and transshipment point for feed materials between the Hanford and commercial metal fabricators in the northeastern states. NY.36-1 NY.36-2 NY.36-3 Site Disposition: Eliminated - Referred to DOD NY.36-1 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Uranium, Thorium Metals NY.36-1 NY.36-2 NY.36-3 Radiological Survey(s): None Indicated Site Status: Eliminated from further consideration under FUSRAP - Referred to DOD NY.36-1


Northern Westchester Energy Action Consortium (NY) | Open Energy  

Open Energy Info (EERE)

Energy Action Consortium (NY) Energy Action Consortium (NY) Jump to: navigation, search Logo: Northern Westchester Energy Action Consortium (NY) Name Northern Westchester Energy Action Consortium (NY) Address PO Box 681 Place Somers, New York Zip 10589 Region Northeast - NY NJ CT PA Area Year founded 2009 Website http://www.nweac.org Coordinates 41.3278772°, -73.6948234° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":41.3278772,"lon":-73.6948234,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Property:EIA/861/IsoNy | Open Energy Information  

Open Energy Info (EERE)

IsoNy IsoNy Jump to: navigation, search Property Name ISO_NY Property Type Boolean Description Indicates that the organization conducts operations in the NY ISO region [1] References ↑ "EIA Form EIA-861 Final Data File for 2010 - 861 Webfile Layout for 2010.doc" Pages using the property "EIA/861/IsoNy" Showing 25 pages using this property. (previous 25) (next 25) A AES Eastern Energy LP + true + AP Holdings LLC + true + Agway Energy Services, LLC + true + B Bath Electric Gas & Water Sys + true + Bluerock Energy, Inc. + true + C Central Hudson Gas & Elec Corp + true + City of Salamanca, New York (Utility Company) + true + City of Sherrill, New York (Utility Company) + true + City of Watertown, New York (Utility Company) + true +


DOE - Office of Legacy Management -- Ithaca Gun Co Inc - NY 53  

Office of Legacy Management (LM)

Ithaca Gun Co Inc - NY 53 FUSRAP Considered Sites Site: ITHACA GUN CO., INC. (NY.53 ) Eliminated from further consideration under FUSRAP Designated Name: Not Designated Alternate...


Price of Champlain, NY Natural Gas LNG Imports from Canada (Dollars...  

Gasoline and Diesel Fuel Update (EIA)

Champlain, NY Natural Gas LNG Imports from Canada (Dollars per Thousand Cubic Feet) Price of Champlain, NY Natural Gas LNG Imports from Canada (Dollars per Thousand Cubic Feet)...


DOE - Office of Legacy Management -- Tonawanda North Units 1 and 2 - NY 10  

NLE Websites -- All DOE Office Websites (Extended Search)

Tonawanda North Units 1 and 2 - NY Tonawanda North Units 1 and 2 - NY 10 FUSRAP Considered Sites Tonawanda North, NY, Units 1 and 2 Alternate Name(s): Ashland #1 and Ashland #2 Haist Property Seaway Area D Rattlesnake Creek NY.10-1 Location: State Highway 266, east of Interstate Highway 190, Tonawanda, NY NY.10-4 Historical Operations: Served as a repository for refined uranium and vanadium residues containing thorium and radium, generated by Linde Air Products. NY.10-4 NY.10-5 NY.10-6 NY.10-7 NY.10-9 Eligibility Determination: Eligible NY.10-1 NY.10-2 NY.10-3 Radiological Survey(s): Assessment Survey NY.10-4 Site Status: Certified - Certification Basis, Declaration of Completion Included NY.10-11 NY.10-13 NY.10-14 Long-term Care Requirements: Long-Term Surveillance and Maintenance Requirements for Remediated FUSRAP Sites S07566_FUSRAP


DOE - Office of Legacy Management -- Radium Chemical Co Inc - NY 60  

NLE Websites -- All DOE Office Websites (Extended Search)

Radium Chemical Co Inc - NY 60 Radium Chemical Co Inc - NY 60 FUSRAP Considered Sites Site: RADIUM CHEMICAL CO., INC (NY.60 ) Eliminated from further consideration under FUSRAP Designated Name: Not Designated Alternate Name: None Location: New York , New York NY.60-1 Evaluation Year: 1987 NY.60-1 Site Operations: Commercial Producer of Radium. NY.60-1 Site Disposition: Eliminated - Commercial site - EPA cleanup project NY.60-1 Radioactive Materials Handled: Yes NY.60-1 Primary Radioactive Materials Handled: Radium NY.60-1 Radiological Survey(s): None Indicated Site Status: Eliminated from further consideration under FUSRAP Also see Documents Related to RADIUM CHEMICAL CO., INC NY.60-1 - Memorandum; A. Wallo to the File; Subject: FUSRAP review and elimination of the Radium Chemical Co. site in New York, NY; November


DOE - Office of Legacy Management -- Simmons Machine and Tool Inc - NY 35  

NLE Websites -- All DOE Office Websites (Extended Search)

Simmons Machine and Tool Inc - NY Simmons Machine and Tool Inc - NY 35 FUSRAP Considered Sites Site: SIMMONS MACHINE AND TOOL, INC (NY.35) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: None Location: 1000 North Broadway , Albany , New York NY.35-1 Evaluation Year: 1987 NY.35-2 Site Operations: Tested equipment and machined uranium to test the equipment (one time event). NY.35-1 NY.35-2 Site Disposition: Eliminated - Potential for contamination considered remote due to limited scope and duration of activity performed at the site NY.35-2 NY.35-3 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Uranium NY.35-1 NY.35-2 Radiological Survey(s): None Indicated Site Status: Eliminated from consideration under FUSRAP


DOE - Office of Legacy Management -- Utica Street Warehouse - NY 0-23  

Office of Legacy Management (LM)

Street Warehouse - NY 0-23 Street Warehouse - NY 0-23 FUSRAP Considered Sites Site: UTICA STREET WAREHOUSE (NY.0-23) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: None Location: 240 West Utica Street , Buffalo , New York NY.0-23-2 Evaluation Year: 1987 NY.0-23-1 Site Operations: Stored and rebarrelled uranium process residues from operations at Linde. NY.0-23-3 Site Disposition: Eliminated - Original building demolished. Current land use - Parking facility. Potential for residual radioactive contamination considered remote. NY.0-23-1 Radioactive Materials Handled: Yes NY.0-23-1 Primary Radioactive Materials Handled: Natural Uranium Process Residues NY.0-23-1 Radiological Survey(s): None Indicated NY.0-23-1 Site Status: Eliminated from consideration under FUSRAP NY.0-23-1


DOE - Office of Legacy Management -- Eastman Kodak Laboratory - NY 0-09  

Office of Legacy Management (LM)

Eastman Kodak Laboratory - NY 0-09 Eastman Kodak Laboratory - NY 0-09 FUSRAP Considered Sites Site: Eastman Kodak Laboratory (NY.0-09 ) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: Eastman Kodak Rochester Lab NY.0-09-1 Location: Rochester , New York NY.0-09-1 Evaluation Year: 1987 NY.0-09-1 NY.0-09-2 Site Operations: Research and development with natural uranium solutions in 1943. NY.0-09-1 Site Disposition: Eliminated - Potential for contamination remote NY.0-09-2 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Uranium NY.0-09-1 Radiological Survey(s): None Indicated Site Status: Eliminated from consideration under FUSRAP Also see Documents Related to Eastman Kodak Laboratory NY.0-09-1 - Memorandum/Checklist; Wallo to the File; Subject:



E-Print Network (OSTI)

related services including programs in: · Fire Protection, Emergency Services, Emergency Management o Fire Protection Systems and Equipment o University Fire Marshal o Emergency Management o Events Management oANNUAL FIRE SAFETY REPORT 2013 Ithaca, NY Campus http

Chen, Tsuhan



E-Print Network (OSTI)

: · Fire Protection, Emergency Services, Emergency Management o Fire Protection Systems and Equipment oANNUAL FIRE SAFETY REPORT 2012 Ithaca, NY Campus http Annual Fire Safety Report 2012 Page 2 From the Department of Environmental Health and Safety (EH

Chen, Tsuhan


Massena, NY Natural Gas Pipeline Imports From Canada (Million...  

Gasoline and Diesel Fuel Update (EIA)

data. Release Date: 1302015 Next Release Date: 2272015 Referring Pages: U.S. Natural Gas Pipeline Imports by Point of Entry Massena, NY Natural Gas Imports by Pipeline from...


Champlain, NY Natural Gas Pipeline Imports From Canada (Million...  

Annual Energy Outlook 2012 (EIA)

data. Release Date: 1302015 Next Release Date: 2272015 Referring Pages: U.S. Natural Gas Pipeline Imports by Point of Entry Champlain, NY Natural Gas Imports by Pipeline from...


DOE - Office of Legacy Management -- Allegheny-Ludlum Steel Corp - NY 0-02  

Office of Legacy Management (LM)

Allegheny-Ludlum Steel Corp - NY Allegheny-Ludlum Steel Corp - NY 0-02 FUSRAP Considered Sites Site: ALLEGHENY-LUDLUM STEEL CORP. (NY.0-02 ) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: Al-Tech Specialty Steel NY.0-02-1 Location: Watervliet and Dunkirk , New York NY.0-02-1 Evaluation Year: 1985 NY.0-02-2 Site Operations: Processed uranium metal for the AEC in the early 1950s; rolled uranium billets into rods. NY.0-02-3 Site Disposition: Eliminated - Potential for contamination remote - Confirmed by radiological survey NY.0-02-3 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Uranium Metal NY.0-02-3 Radiological Survey(s): Yes NY.0-02-4 Site Status: Eliminated from consideration under FUSRAP Also see


DOE - Office of Legacy Management -- Lucius Pitkin - NY 0-15  

Office of Legacy Management (LM)

Lucius Pitkin - NY 0-15 Lucius Pitkin - NY 0-15 FUSRAP Considered Sites Site: Lucius Pitkin (NY.0-15 ) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: None Location: 47 Fulton Street , New York , New York NY.0-15-1 Evaluation Year: 1987 NY.0-15-1 Site Operations: No MED or AED work done at this site. Contractor supervised activities at Middlesex Sampling Plant in Middlesex, NJ such as assaying, sampling and weighing of ore. NY.0-15-1 NY.0-15-2 Site Disposition: Eliminated - No radioactive material handled at this site NY.0-15-1 Radioactive Materials Handled: No Primary Radioactive Materials Handled: None NY.0-15-1 NY.0-15-2 Radiological Survey(s): No Site Status: Eliminated from consideration under FUSRAP Also see


DOE - Office of Legacy Management -- American Machine and Foundry Co - NY  

NLE Websites -- All DOE Office Websites (Extended Search)

Machine and Foundry Co - Machine and Foundry Co - NY 26 FUSRAP Considered Sites Site: American Machine and Foundry Co ( NY.26 ) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: Lutheran Medical Center NY.26-1 Location: Second Avenue and 56th Street , Brooklyn , New York NY.26-2 Evaluation Year: 1992 NY.26-1 Site Operations: 1951 - 1954 conducted metal fabrication operation on uranium and thorium metals. NY.26-3 NY.26-4 Site Disposition: Eliminated - Potential for contamination considered remote based on results of radiological monitoring and sampling and extensive renovation of the site NY.26-1 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Uranium and Thorium metal NY.26-1 Radiological Survey(s): Yes NY.26-5


DOE - Office of Legacy Management -- Union Mines Development Corp - NY 0-22  

Office of Legacy Management (LM)

Mines Development Corp - NY Mines Development Corp - NY 0-22 FUSRAP Considered Sites Site: UNION MINES DEVELOPMENT CORP. (NY.0-22) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: Union Carbide NY.0-22-1 Location: New York , New York NY.0-22-1 Evaluation Year: 1987 NY.0-22-1 Site Operations: The company owned uranium mines or reserves located in the western U.S. NY.0-22-1 Site Disposition: Eliminated - No reason to believe radioactive material was used at this site NY.0-22-1 Radioactive Materials Handled: None Indicated Primary Radioactive Materials Handled: None Indicated NY.0-22-1 Radiological Survey(s): None Indicated Site Status: Eliminated from consideration under FUSRAP Also see Documents Related to UNION MINES DEVELOPMENT CORP.


DOE - Office of Legacy Management -- Fordham University - NY 0-12  

Office of Legacy Management (LM)

Fordham University - NY 0-12 Fordham University - NY 0-12 FUSRAP Considered Sites Site: Fordham University (NY.0-12 ) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: None Location: New York , New York NY.0-12-1 Evaluation Year: 1987 NY.0-12-1 Site Operations: Research and development involving small quantities of radioactive material in a controlled environment NY.0-12-1 Site Disposition: Eliminated - Potential for contamination remote NY.0-12-1 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Not Specified NY.0-12-1 Radiological Survey(s): None Indicated Site Status: Eliminated from consideration under FUSRAP Also see Documents Related to Fordham University NY.0-12-1 - Aerospace Letter; Young to Wallo; Subject: Elimination


DOE - Office of Legacy Management -- Floyd Bennett Field - NY 0-11  

Office of Legacy Management (LM)

Floyd Bennett Field - NY 0-11 Floyd Bennett Field - NY 0-11 FUSRAP Considered Sites Site: Floyd Bennett Field (NY.0-11 ) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: Naval Air Station NY.0-11-1 Location: Buildings 67 and 69 , Brooklyn , New York NY.0-11-1 Evaluation Year: 1987 NY.0-11-1 Site Operations: The Air station was considered by the AEC but was not used. NY.0-11-1 Site Disposition: Eliminated - No involvement with MED/AEC operations NY.0-11-1 Radioactive Materials Handled: No Primary Radioactive Materials Handled: None Radiological Survey(s): No Site Status: Eliminated from consideration under FUSRAP Also see Documents Related to Floyd Bennett Field NY.0-11-1 - Memorandum/Checklist; Wallo to the File; Subject: Elimination of Floyd Bennett Field; December 7, 1987


DOE - Office of Legacy Management -- Wolff-Alport and Co - NY 30  

Office of Legacy Management (LM)

Wolff-Alport and Co - NY 30 Wolff-Alport and Co - NY 30 FUSRAP Considered Sites Site: Wolff-Alport and Co (NY.30) Eliminated from consideration under FUSRAP - Referred to US EPA Region II and New York City Department of Health Designated Name: Not Designated Alternate Name: None Location: 1127 Irving Avenue , Brooklyn , New York NY.30-1 Evaluation Year: 1987 NY.30-1 Site Operations: Commercial operation -- sold thorium residues to the AEC, which in turn shipped the residues to Maywood for storage. NY.30-2 Site Disposition: Eliminated - No Authority NY.30-1 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Thorium NY.30-2 Radiological Survey(s): No Site Status: Eliminated from consideration under FUSRAP - Referred to US EPA Region II and New York City Department of Health NY.30-1


DOE - Office of Legacy Management -- Frederick Flader Inc - NY 0-13  

NLE Websites -- All DOE Office Websites (Extended Search)

Frederick Flader Inc - NY 0-13 Frederick Flader Inc - NY 0-13 FUSRAP Considered Sites Site: Frederick Flader, Inc. (NY.0-13 ) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: Frederick Flader Division of Eaton Manufacturing Co. NY.0-13-1 Location: 583 Division Street , N. Tonawanda , New York NY.0-13-1 Evaluation Year: 1987 NY.0-13-1 Site Operations: Provided consulting services and supported development of auxiliary equipment related to nuclear power NY.0-13-1 Site Disposition: Eliminated NY.0-13-1 Radioactive Materials Handled: None Indicated Primary Radioactive Materials Handled: None Indicated NY.0-13-1 Radiological Survey(s): No Site Status: Eliminated from consideration under FUSRAP Also see Documents Related to Frederick Flader, Inc.

Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


U.S. LNG Imports from Canada  

Gasoline and Diesel Fuel Update (EIA)

Warroad, MN Babb, MT Havre, MT Port of Morgan, MT Sherwood, ND Pittsburg, NH Buffalo, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Sweetgrass, MT Total to Chile Sabine Pass, LA Total to China Kenai, AK Sabine Pass, LA Total to India Freeport, TX Sabine Pass, LA Total to Japan Cameron, LA Freeport, TX Kenai, AK Port Nikiski, AK Sabine Pass, LA Total to Mexico Douglas, AZ Nogales, AZ Calexico, CA Ogilby Mesa, CA Otay Mesa, CA San Diego, CA Alamo, TX Clint, TX Del Rio, TX Eagle Pass, TX El Paso, TX Hidalgo, TX McAllen, TX Penitas, TX Rio Bravo, TX Roma, TX Total to Portugal Sabine Pass, LA Total to Russia Kenai, AK Total to South Korea Freeport, TX Sabine Pass, LA Total to Spain Cameron, LA Sabine Pass, LA Total to United Kingdom Freeport, TX Sabine Pass, LA LNG Exports from Cameron, LA LNG Exports from Kenai, AK LNG Exports from Freeport, TX LNG Exports from Nogales, AZ LNG Exports from Otay Mesa, CA LNG Exports from Sabine Pass, LA LNG Exports from Sweetgrass, MT Period: Monthly Annual


U.S. Liquefied Natural Gas Exports to India  

Gasoline and Diesel Fuel Update (EIA)

Warroad, MN Babb, MT Havre, MT Port of Morgan, MT Sherwood, ND Pittsburg, NH Buffalo, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Sweetgrass, MT Total to Chile Sabine Pass, LA Total to China Kenai, AK Sabine Pass, LA Total to India Freeport, TX Sabine Pass, LA Total to Japan Cameron, LA Freeport, TX Kenai, AK Port Nikiski, AK Sabine Pass, LA Total to Mexico Douglas, AZ Nogales, AZ Calexico, CA Ogilby Mesa, CA Otay Mesa, CA San Diego, CA Alamo, TX Clint, TX Del Rio, TX Eagle Pass, TX El Paso, TX Hidalgo, TX McAllen, TX Penitas, TX Rio Bravo, TX Roma, TX Total to Portugal Sabine Pass, LA Total to Russia Kenai, AK Total to South Korea Freeport, TX Sabine Pass, LA Total to Spain Cameron, LA Sabine Pass, LA Total to United Kingdom Freeport, TX Sabine Pass, LA LNG Exports from Cameron, LA LNG Exports from Kenai, AK LNG Exports from Freeport, TX LNG Exports from Nogales, AZ LNG Exports from Otay Mesa, CA LNG Exports from Sabine Pass, LA LNG Exports from Sweetgrass, MT Period: Monthly Annual


U.S. LNG Imports from Other Countries  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual


U.S. LNG Imports from Egypt  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual


U.S. LNG Imports from Malaysia  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual


U.S. LNG Imports from Peru  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual


U.S. Liquefied Natural Gas Exports to Japan  

Gasoline and Diesel Fuel Update (EIA)

Warroad, MN Babb, MT Havre, MT Port of Morgan, MT Sherwood, ND Pittsburg, NH Buffalo, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Sweetgrass, MT Total to Chile Sabine Pass, LA Total to China Kenai, AK Sabine Pass, LA Total to India Freeport, TX Sabine Pass, LA Total to Japan Cameron, LA Freeport, TX Kenai, AK Port Nikiski, AK Sabine Pass, LA Total to Mexico Douglas, AZ Nogales, AZ Calexico, CA Ogilby Mesa, CA Otay Mesa, CA San Diego, CA Alamo, TX Clint, TX Del Rio, TX Eagle Pass, TX El Paso, TX Hidalgo, TX McAllen, TX Penitas, TX Rio Bravo, TX Roma, TX Total to Portugal Sabine Pass, LA Total to Russia Kenai, AK Total to South Korea Freeport, TX Sabine Pass, LA Total to Spain Cameron, LA Sabine Pass, LA Total to United Kingdom Freeport, TX Sabine Pass, LA LNG Exports from Cameron, LA LNG Exports from Kenai, AK LNG Exports from Freeport, TX LNG Exports from Nogales, AZ LNG Exports from Otay Mesa, CA LNG Exports from Sabine Pass, LA LNG Exports from Sweetgrass, MT Period: Monthly Annual


U.S. LNG Imports from Trinidad/Tobago  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual


U.S. LNG Imports from Algeria  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual


U.S. Natural Gas Exports to Mexico  

Gasoline and Diesel Fuel Update (EIA)

Warroad, MN Babb, MT Havre, MT Port of Morgan, MT Sherwood, ND Pittsburg, NH Buffalo, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Sweetgrass, MT Total to Chile Sabine Pass, LA Total to China Kenai, AK Sabine Pass, LA Total to India Freeport, TX Sabine Pass, LA Total to Japan Cameron, LA Freeport, TX Kenai, AK Port Nikiski, AK Sabine Pass, LA Total to Mexico Douglas, AZ Nogales, AZ Calexico, CA Ogilby Mesa, CA Otay Mesa, CA San Diego, CA Alamo, TX Clint, TX Del Rio, TX Eagle Pass, TX El Paso, TX Hidalgo, TX McAllen, TX Penitas, TX Rio Bravo, TX Roma, TX Total to Portugal Sabine Pass, LA Total to Russia Kenai, AK Total to South Korea Freeport, TX Sabine Pass, LA Total to Spain Cameron, LA Sabine Pass, LA Total to United Kingdom Freeport, TX Sabine Pass, LA LNG Exports from Cameron, LA LNG Exports from Kenai, AK LNG Exports from Freeport, TX LNG Exports from Nogales, AZ LNG Exports from Otay Mesa, CA LNG Exports from Sabine Pass, LA LNG Exports from Sweetgrass, MT Period: Monthly Annual


U.S. LNG Imports from Nigeria  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual


U.S. LNG Imports from Qatar  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual


U.S. LNG Imports from Yemen  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual


U.S. Total Exports  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual


U.S. LNG Imports from Indonesia  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual


U.S. Natural Gas Exports to Russia  

Gasoline and Diesel Fuel Update (EIA)

Warroad, MN Babb, MT Havre, MT Port of Morgan, MT Sherwood, ND Pittsburg, NH Buffalo, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Sweetgrass, MT Total to Chile Sabine Pass, LA Total to China Kenai, AK Sabine Pass, LA Total to India Freeport, TX Sabine Pass, LA Total to Japan Cameron, LA Freeport, TX Kenai, AK Port Nikiski, AK Sabine Pass, LA Total to Mexico Douglas, AZ Nogales, AZ Calexico, CA Ogilby Mesa, CA Otay Mesa, CA San Diego, CA Alamo, TX Clint, TX Del Rio, TX Eagle Pass, TX El Paso, TX Hidalgo, TX McAllen, TX Penitas, TX Rio Bravo, TX Roma, TX Total to Portugal Sabine Pass, LA Total to Russia Kenai, AK Total to South Korea Freeport, TX Sabine Pass, LA Total to Spain Cameron, LA Sabine Pass, LA Total to United Kingdom Freeport, TX Sabine Pass, LA LNG Exports from Cameron, LA LNG Exports from Kenai, AK LNG Exports from Freeport, TX LNG Exports from Nogales, AZ LNG Exports from Otay Mesa, CA LNG Exports from Sabine Pass, LA LNG Exports from Sweetgrass, MT Period: Monthly Annual


U.S. Natural Gas Exports to Portugal  

Gasoline and Diesel Fuel Update (EIA)

Warroad, MN Babb, MT Havre, MT Port of Morgan, MT Sherwood, ND Pittsburg, NH Buffalo, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Sweetgrass, MT Total to Chile Sabine Pass, LA Total to China Kenai, AK Sabine Pass, LA Total to India Freeport, TX Sabine Pass, LA Total to Japan Cameron, LA Freeport, TX Kenai, AK Port Nikiski, AK Sabine Pass, LA Total to Mexico Douglas, AZ Nogales, AZ Calexico, CA Ogilby Mesa, CA Otay Mesa, CA San Diego, CA Alamo, TX Clint, TX Del Rio, TX Eagle Pass, TX El Paso, TX Hidalgo, TX McAllen, TX Penitas, TX Rio Bravo, TX Roma, TX Total to Portugal Sabine Pass, LA Total to Russia Kenai, AK Total to South Korea Freeport, TX Sabine Pass, LA Total to Spain Cameron, LA Sabine Pass, LA Total to United Kingdom Freeport, TX Sabine Pass, LA LNG Exports from Cameron, LA LNG Exports from Kenai, AK LNG Exports from Freeport, TX LNG Exports from Nogales, AZ LNG Exports from Otay Mesa, CA LNG Exports from Sabine Pass, LA LNG Exports from Sweetgrass, MT Period: Monthly Annual


U.S. LNG Imports from Canada  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual


U.S. LNG Imports from Norway  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual


U.S. LNG Imports from Equatorial Guinea  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual

Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


U.S. LNG Imports from Australia  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual


U.S. LNG Imports from United Arab Emirates  

Gasoline and Diesel Fuel Update (EIA)

Noyes, MN Warroad, MN Babb, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Galvan Ranch, TX LNG Imports from Algeria LNG Imports from Australia LNG Imports from Brunei LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Elba Island, GA Freeport, TX Gulf LNG, MS LNG Imports from Equatorial Guinea LNG Imports from Indonesia LNG Imports from Malaysia LNG Imports from Nigeria Cove Point, MD LNG Imports from Norway Cove Point, MD Freeport, TX Sabine Pass, LA LNG Imports from Oman LNG Imports from Peru Cameron, LA Freeport, TX LNG Imports from Qatar Elba Island, GA Golden Pass, TX Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Sabine Pass, LA LNG Imports from United Arab Emirates LNG Imports from Yemen Everett, MA Freeport, TX Sabine Pass, LA LNG Imports from Other Countries Period: Monthly Annual


U.S. Liquefied Natural Gas Exports to Spain  

Gasoline and Diesel Fuel Update (EIA)

Warroad, MN Babb, MT Havre, MT Port of Morgan, MT Sherwood, ND Pittsburg, NH Buffalo, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Sweetgrass, MT Total to Chile Sabine Pass, LA Total to China Kenai, AK Sabine Pass, LA Total to India Freeport, TX Sabine Pass, LA Total to Japan Cameron, LA Freeport, TX Kenai, AK Port Nikiski, AK Sabine Pass, LA Total to Mexico Douglas, AZ Nogales, AZ Calexico, CA Ogilby Mesa, CA Otay Mesa, CA San Diego, CA Alamo, TX Clint, TX Del Rio, TX Eagle Pass, TX El Paso, TX Hidalgo, TX McAllen, TX Penitas, TX Rio Bravo, TX Roma, TX Total to Portugal Sabine Pass, LA Total to Russia Kenai, AK Total to South Korea Freeport, TX Sabine Pass, LA Total to Spain Cameron, LA Sabine Pass, LA Total to United Kingdom Freeport, TX Sabine Pass, LA LNG Exports from Cameron, LA LNG Exports from Kenai, AK LNG Exports from Freeport, TX LNG Exports from Nogales, AZ LNG Exports from Otay Mesa, CA LNG Exports from Sabine Pass, LA LNG Exports from Sweetgrass, MT Period: Monthly Annual


U.S. Liquefied Natural Gas Exports to United Kingdom  

Gasoline and Diesel Fuel Update (EIA)

Warroad, MN Babb, MT Havre, MT Port of Morgan, MT Sherwood, ND Pittsburg, NH Buffalo, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Sweetgrass, MT Total to Chile Sabine Pass, LA Total to China Kenai, AK Sabine Pass, LA Total to India Freeport, TX Sabine Pass, LA Total to Japan Cameron, LA Freeport, TX Kenai, AK Port Nikiski, AK Sabine Pass, LA Total to Mexico Douglas, AZ Nogales, AZ Calexico, CA Ogilby Mesa, CA Otay Mesa, CA San Diego, CA Alamo, TX Clint, TX Del Rio, TX Eagle Pass, TX El Paso, TX Hidalgo, TX McAllen, TX Penitas, TX Rio Bravo, TX Roma, TX Total to Portugal Sabine Pass, LA Total to Russia Kenai, AK Total to South Korea Freeport, TX Sabine Pass, LA Total to Spain Cameron, LA Sabine Pass, LA Total to United Kingdom Freeport, TX Sabine Pass, LA LNG Exports from Cameron, LA LNG Exports from Kenai, AK LNG Exports from Freeport, TX LNG Exports from Nogales, AZ LNG Exports from Otay Mesa, CA LNG Exports from Sabine Pass, LA LNG Exports from Sweetgrass, MT Period: Monthly Annual


U.S. Natural Gas Exports to Chile  

Gasoline and Diesel Fuel Update (EIA)

Warroad, MN Babb, MT Havre, MT Port of Morgan, MT Sherwood, ND Pittsburg, NH Buffalo, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Sweetgrass, MT Total to Chile Sabine Pass, LA Total to China Kenai, AK Sabine Pass, LA Total to India Freeport, TX Sabine Pass, LA Total to Japan Cameron, LA Freeport, TX Kenai, AK Port Nikiski, AK Sabine Pass, LA Total to Mexico Douglas, AZ Nogales, AZ Calexico, CA Ogilby Mesa, CA Otay Mesa, CA San Diego, CA Alamo, TX Clint, TX Del Rio, TX Eagle Pass, TX El Paso, TX Hidalgo, TX McAllen, TX Penitas, TX Rio Bravo, TX Roma, TX Total to Portugal Sabine Pass, LA Total to Russia Kenai, AK Total to South Korea Freeport, TX Sabine Pass, LA Total to Spain Cameron, LA Sabine Pass, LA Total to United Kingdom Freeport, TX Sabine Pass, LA LNG Exports from Cameron, LA LNG Exports from Kenai, AK LNG Exports from Freeport, TX LNG Exports from Nogales, AZ LNG Exports from Otay Mesa, CA LNG Exports from Sabine Pass, LA LNG Exports from Sweetgrass, MT Period: Monthly Annual


U.S. Liquefied Natural Gas Exports To Brazil  

Gasoline and Diesel Fuel Update (EIA)

Warroad, MN Babb, MT Havre, MT Port of Morgan, MT Sherwood, ND Pittsburg, NH Buffalo, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Sweetgrass, MT Total to Chile Sabine Pass, LA Total to China Kenai, AK Sabine Pass, LA Total to India Freeport, TX Sabine Pass, LA Total to Japan Cameron, LA Freeport, TX Kenai, AK Port Nikiski, AK Sabine Pass, LA Total to Mexico Douglas, AZ Nogales, AZ Calexico, CA Ogilby Mesa, CA Otay Mesa, CA San Diego, CA Alamo, TX Clint, TX Del Rio, TX Eagle Pass, TX El Paso, TX Hidalgo, TX McAllen, TX Penitas, TX Rio Bravo, TX Roma, TX Total to Portugal Sabine Pass, LA Total to Russia Kenai, AK Total to South Korea Freeport, TX Sabine Pass, LA Total to Spain Cameron, LA Sabine Pass, LA Total to United Kingdom Freeport, TX Sabine Pass, LA LNG Exports from Cameron, LA LNG Exports from Kenai, AK LNG Exports from Freeport, TX LNG Exports from Nogales, AZ LNG Exports from Otay Mesa, CA LNG Exports from Sabine Pass, LA LNG Exports from Sweetgrass, MT Period: Monthly Annual



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Town of Brookhaven STATE: NY Town of Brookhaven STATE: NY PROJECT EECBG (S) - Brookhaven (NY): Henrietta Acampora Recreation Center TITLE: Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number cm Number DE-FOA-0000013 DE-EE0000688 GFO-0000688-002 Based on my review of the information concerning tbe proposed action, as NEPA Compliance Officer (autborized under DOE Order 4St.tA), I have made the following determination: CX, EA, EIS APPENDIX AND NUMBER: Description: 85.1 Actions to conserve energy. demonstrate potential energy conservation, and promote energy-efficiency that do not increase the indoor concentrations of potentially harmful substances. These actions may involve financial and technical assistance to individuals (such as builders, owners, consultants, designers), organizations (such as utilities), and state


Consolidated Edison Co-NY Inc | Open Energy Information  

Open Energy Info (EERE)

NY Inc NY Inc Jump to: navigation, search Name Consolidated Edison Co-NY Inc Place New York, New York Service Territory New York Website www.coned.com Green Button Reference Page www.whitehouse.gov/sites/ Green Button Committed Yes Utility Id 4226 Utility Location Yes Ownership I NERC Location NPCC NERC NPCC Yes Activity Transmission Yes Activity Buying Transmission Yes Activity Distribution Yes Activity Wholesale Marketing Yes Alt Fuel Vehicle Yes Alt Fuel Vehicle2 Yes References EIA Form EIA-861 Final Data File for 2010 - File1_a[1] Energy Information Administration Form 826[2] SGIC[3] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Consolidated Edison Company of New York, Inc. Smart Grid Demonstration


DOE - Office of Legacy Management -- Wilson Warehouse - NY 64  

Office of Legacy Management (LM)

Wilson Warehouse - NY 64 Wilson Warehouse - NY 64 FUSRAP Considered Sites Site: Wilson Warehouse (NY.64) Designated Name: Alternate Name: Location: Evaluation Year: Site Operations: Site Disposition: Radioactive Materials Handled: Primary Radioactive Materials Handled: Radiological Survey(s): Site Status: This site is one of a group of 77 FUSRAP considered sites for which few, if any records are available in their respective site files to provide an historical account of past operations and their relationship, if any, with MED/AEC operations. Reviews of contact lists, accountable station lists, health and safety records and other documentation of the period do not provide sufficient information to warrant further search of historical records for information on these sites. These site files remain "open" to


DOE - Office of Legacy Management -- Pfohl Brothers Landfill - NY 66  

Office of Legacy Management (LM)

Pfohl Brothers Landfill - NY 66 Pfohl Brothers Landfill - NY 66 FUSRAP Considered Sites Site: Pfohl Brothers Landfill (NY.66 ) Designated Name: Alternate Name: Location: Evaluation Year: Site Operations: Site Disposition: Radioactive Materials Handled: Primary Radioactive Materials Handled: Radiological Survey(s): Site Status: Also see Five-Year Review Report Pfohl Brothers Landfill Superfund Site Erie County Town of Cheektowaga, New York EPA REGION 2 Congressional District(s): 30 Erie Cheektowaga NPL LISTING HISTORY Documents Related to Pfohl Brothers Landfill Historical documents may contain links which are no longer valid or to outside sources. LM can not attest to the accuracy of information provided by these links. Please see the Leaving LM Website page for more details.


Consolidated Edison Co-NY Inc | Open Energy Information  

Open Energy Info (EERE)

Consolidated Edison Co-NY Inc Consolidated Edison Co-NY Inc (Redirected from ConEdison) Jump to: navigation, search Name Consolidated Edison Co-NY Inc Place New York, New York Service Territory New York Website www.coned.com Green Button Landing Page www.coned.com/customercen Green Button Reference Page www.whitehouse.gov/blog/2 Green Button Implemented Yes Utility Id 4226 Utility Location Yes Ownership I NERC Location NPCC NERC NPCC Yes Activity Transmission Yes Activity Buying Transmission Yes Activity Distribution Yes Activity Wholesale Marketing Yes Alt Fuel Vehicle Yes Alt Fuel Vehicle2 Yes References EIA Form EIA-861 Final Data File for 2010 - File1_a[1] Energy Information Administration Form 826[2] SGIC[3] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now!


Business Council of Westchester County (NY) | Open Energy Information  

Open Energy Info (EERE)

of Westchester County (NY) of Westchester County (NY) Jump to: navigation, search Name Business Council of Westchester County (NY) Address 108 Corporate Park Drive, Suite 101 Place White Plains, New York Zip 10604 Sector Services Product Green Power Marketer Website http://www.westchesterny.org/ Coordinates 41.0200884°, -73.7206631° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":41.0200884,"lon":-73.7206631,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


DOE - Office of Legacy Management -- Linde Air Products Div - Buffalo - NY  

Office of Legacy Management (LM)

Linde Air Products Div - Buffalo - Linde Air Products Div - Buffalo - NY 65 FUSRAP Considered Sites Site: LINDE AIR PRODUCTS DIV. BUFFALO (NY.65 ) Eliminated from further consideration under FUSRAP Designated Name: Not Designated Alternate Name: Linde Chandler Street Plant NY.65-1 Location: Buffalo , New York NY.65-1 Evaluation Year: 1987 NY.65-1 Site Operations: Developed and produced non-radioactive material for the Oak Ridge Gaseous Diffusion Plant under contract with the AEC. NY.65-2 Site Disposition: Eliminated - No indication that radioactive materials were used at the site NY.65-3 Radioactive Materials Handled: No NY.65-1 Primary Radioactive Materials Handled: None Radiological Survey(s): None Indicated Site Status: Eliminated from further consideration under FUSRAP


DOE - Office of Legacy Management -- Long Island College of Medicine - NY  

Office of Legacy Management (LM)

Long Island College of Medicine - Long Island College of Medicine - NY 0-14 FUSRAP Considered Sites Site: Long Island College of Medicine (NY.0-14 ) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: None Location: New York , New York NY.0-14-1 Evaluation Year: 1987 NY.0-14-1 Site Operations: Performed research utilizing small quantities of radioactive materials in a controlled environment. NY.0-14-1 Site Disposition: Eliminated - Potential for contamination remote NY.0-14-1 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Not Specified NY.0-14-1 Radiological Survey(s): None Indicated NY.0-14-1 Site Status: Eliminated from consideration under FUSRAP Also see Documents Related to Long Island College of Medicine


DOE - Office of Legacy Management -- Colorado Fuel and Iron - NY 0-08  

Office of Legacy Management (LM)

Fuel and Iron - NY 0-08 Fuel and Iron - NY 0-08 FUSRAP Considered Sites Site: Colorado Fuel and Iron (NY.0-08 ) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: None Location: Watervliet , New York NY.0-08-1 Evaluation Year: 1987 NY.0-08-1 Site Operations: Site was a contractor to DuPont. Exact nature of operations is not clear. No records to indicate that radioactive materials were handled at the site. NY.0-08-1 Site Disposition: Eliminated NY.0-08-1 Radioactive Materials Handled: None Indicated Primary Radioactive Materials Handled: None Indicated Radiological Survey(s): None Indicated Site Status: Eliminated from consideration under FUSRAP Also see Documents Related to Colorado Fuel and Iron NY.0-08-1 - DOE Memorandum/Checklist; S.Jones to the File; Subject:


Interoperability of Demand Response Resources Demonstration in NY  

SciTech Connect

The Interoperability of Demand Response Resources Demonstration in NY (Interoperability Project) was awarded to Con Edison in 2009. The objective of the project was to develop and demonstrate methodologies to enhance the ability of customer sited Demand Response resources to integrate more effectively with electric delivery companies and regional transmission organizations.

Wellington, Andre



203 Day Hall Ithaca, NY 14853-2602  

E-Print Network (OSTI)

203 Day Hall Ithaca, NY 14853-2602 Page 1 of 2 WILLIAM D. FORD FEDERAL DIRECT LOAN APPLICATION Form F4 BEFORE YOU BEGIN The Direct Loan Program makes federal loan funds available to students directly is not an additional loan source; it replaced the Federal Stafford and SLS Loan programs at Cornell. APPLICATION

Keinan, Alon


Assessment of Summer RBOB Supply for NY & CT  

Gasoline and Diesel Fuel Update (EIA)

Update of Summer Reformulated Gasoline Supply Update of Summer Reformulated Gasoline Supply Assessment for New York and Connecticut May 5, 2004 In October 2003, EIA published a review of the status of the methyl tertiary butyl ether (MTBE) ban transition in New York (NY) and Connecticut (CT) 1 that noted significant uncertainties in gasoline supply for those States for the summer of 2004. To obtain updated information, EIA spoke to major suppliers to the two States over the past several months as the petroleum industry began the switch from winter- to summer-grade gasoline. As discussed on our earlier report, the NY and CT bans on MTBE mainly affect reformulated gasoline (RFG), which in recent years has been provided by domestic refineries on the East Coast (PADD 1) and imports. Our recent findings indicate that


BuildSmart NY Innovators Summit Offers Sneak Peek at Better Buildings...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

prisons, mental health hospitals, office buildings, and facilities that house its trains, buses, and equipment. The New York Power Authority's BuildSmart NY program is...


CUT FLOWER VARIETY TRIALS, ITHACA, NY, 2005 H. C. Wien, Department of Horticulture, Cornell University  

E-Print Network (OSTI)

CUT FLOWER VARIETY TRIALS, ITHACA, NY, 2005 H. C. Wien, Department of Horticulture, Cornell is somewhat transparent to infrared radiation, but prevents transmission of visible light, and thus

Pawlowski, Wojtek

Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


E-Print Network 3.0 - area ny hovedflyplass Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Costs and Benefits of Summary: . Conclusions and Areas for Improvement 12;Environmental Energy Technologies Division Energy Analysis... AZ: 15% by 2025 NY: 24% by 2013 CO: 10%...


Renewable Energy Network of Entrepreneurs in Western New York RENEW NY |  

Open Energy Info (EERE)

Network of Entrepreneurs in Western New York RENEW NY Network of Entrepreneurs in Western New York RENEW NY Jump to: navigation, search Name Renewable Energy Network of Entrepreneurs in Western New York (RENEW NY) Place Rochester, New York Zip 14623 Sector Renewable Energy Product US-based incubator fund, Renewable Energy Network of Entrepreneurs in Western New York, helps early stage renewable energy companies to start and grow in Western New York. References Renewable Energy Network of Entrepreneurs in Western New York (RENEW NY)[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Renewable Energy Network of Entrepreneurs in Western New York (RENEW NY) is a company located in Rochester, New York . References ↑ "Renewable Energy Network of Entrepreneurs in Western New York


CUT FLOWER VARIETY TRIALS, ITHACA, NY, 2004 H. C. Wien, Department of Horticulture, Cornell University  

E-Print Network (OSTI)

CUT FLOWER VARIETY TRIALS, ITHACA, NY, 2004 H. C. Wien, Department of Horticulture, Cornell light and thus discourages weed growth underneath. In the rest of the field not covered by the high

Pawlowski, Wojtek


Integrys Energy Services of N.Y., Inc. | Open Energy Information  

Open Energy Info (EERE)

Services of N.Y., Inc. Services of N.Y., Inc. (Redirected from Integrys) Jump to: navigation, search Name Integrys Energy Services of N.Y., Inc. Place New York Utility Id 21258 Utility Location Yes Ownership R ISO NY Yes Activity Retail Marketing Yes References EIA Form EIA-861 Final Data File for 2010 - File1_a[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Utility Rate Schedules Grid-background.png No rate schedules available. Average Rates Residential: $0.0625/kWh Commercial: $0.0809/kWh Industrial: $0.0631/kWh References ↑ "EIA Form EIA-861 Final Data File for 2010 - File1_a" Retrieved from "http://en.openei.org/w/index.php?title=Integrys_Energy_Services_of_N.Y.,_Inc.&oldid=410875


Contributors Marsha Berger, Courant Institute, New York University, New York, NY, USA  

E-Print Network (OSTI)

Contributors Marsha Berger, Courant Institute, New York University, New York, NY, USA Gyan Bhanot, Piscataway, NJ, USA Erik G. Boman, Discrete Algorithms and Mathematics Department, Sandia National Laboratories, Albuquerque, NM, USA Doruk Bozdag, Department of Biomedical Informatics, The Ohio State

Li, Xiaolin "Andy"


Sediment chemistries and chironomid deformities in the Buffalo River (NY)  

SciTech Connect

The authors examined the surficial sediment chemistry (heavy metals) and the frequency of chironomid (Diptera) larvae mouthpart deformities from multiple PONAR grabs samples at each of 20 sites along the Buffalo River (NY) area of concern (AOC). Because of the potential for patchy invertebrate distribution and high variance in sediment chemistry, repeated spatial and temporal sampling is important to obtain a better integrated picture of contamination in rivers. The findings suggest that the Buffalo River has one of the highest percentages of deformed chironomids in AOC`s of the Great Lakes basin. One river site that was traditionally thought to be a chemical hot spot was less contaminated than another downstream section. At another site, sediment concentrations for V., Mn and AS appeared to be strongly associated with the proximity of combined sewer overflows from a region which is primarily residential. Interestingly, a demonstration project of the US Army Corps of Engineers, during which three types of dredges were used to carefully remove upper sediments from two different short reaches along the river, seemed to have no significant impact on proximate sediment chemistries or biota.

Stewart, K.M.; Diggins, T.P. [State Univ. of New York, Buffalo, NY (United States). Dept. of Biological Science



Built waterfront through edge, connection, and exchange : reclaiming a waterfront for Greenpoint, a project in Brooklyn, N.Y.  

E-Print Network (OSTI)

??Currently the waterfront of Brooklyn N.Y. between the Gowanus Canal of Redhook and the Newton Creek of Greenpoint is predominantly lined with various types of (more)

Ziesemann, Rodney P. (Rodney Paul), 1967-



The distribution of depleted uranium contamination in Colonie, NY, USA  

Science Journals Connector (OSTI)

Uranium oxide particles were dispersed into the environment from a factory in Colonie (NY, USA) by prevailing winds during the 1960s and '70s. Uranium concentrations and isotope ratios from bulk soil samples have been accurately measured using inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) without the need for analyte separation chemistry. The natural range of uranium concentrations in the Colonie soils has been estimated as 0.72.1?gg?1, with a weighted geometric mean of 1.05?gg?1; the contaminated soil samples comprise uranium up to 50040?gg?1. A plot of 236U/238U against 235U/238U isotope ratios describes a mixing line between natural uranium and depleted uranium (DU) in bulk soil samples; scatter from this line can be accounted for by heterogeneity in the DU particulate. The end-member of DU compositions aggregated in these bulk samples comprises (2.050.06)נ10?3 235U/238U, (3.20.1)נ10?5 236U/238U, and (7.10.3)נ10?6 234U/238U. The analytical method is sensitive to as little as 50ngg?1 DU mixed with the natural uranium occurring in these soils. The contamination footprint has been mapped northward from site, and at least one third of the uranium in a soil sample from the surface 5cm, collected 5.1km NNW of the site, is DU. The distribution of contamination within the surface soil horizon follows a trend of exponential decrease with depth, which can be approximated by a simple diffusion model. Bioturbation by earthworms can account for dispersal of contaminant from the soil surface, in the form of primary uranium oxide particulates, and uranyl species that are adsorbed to organic matter. Considering this distribution, the total mass of uranium contamination emitted from the factory is estimated to be c. 4.8tonnes.

N.S. Lloyd; S.R.N. Chenery; R.R. Parrish



Submit Your Ideas for the NY Energy Data Jam | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Submit Your Ideas for the NY Energy Data Jam Submit Your Ideas for the NY Energy Data Jam Submit Your Ideas for the NY Energy Data Jam June 19, 2013 - 11:03am Q&A What idea would you present at the Data Jam? Join the Conversation Addthis Applications powered by open energy data were on display at the Energy Datapalooza in June 2012. | Photo by Sarah Gerrity, Energy Department. Applications powered by open energy data were on display at the Energy Datapalooza in June 2012. | Photo by Sarah Gerrity, Energy Department. Alex Cohen Alex Cohen Senior Digital Information Strategist How can I participate? Even if you cannot attend in person, we still want you to participate. Help us by starting the conversation. Email us at newmedia@hq.doe.gov and tell us your idea. Tweet questions to @ENERGY with the hashtag #EnergyJam.


New York Battery and Energy Storage Technology Consortium NY BEST | Open  

Open Energy Info (EERE)

Storage Technology Consortium NY BEST Storage Technology Consortium NY BEST Jump to: navigation, search Name New York Battery and Energy Storage Technology Consortium (NY-BEST) Place Albany, New York Zip 12203 Product Albany-based project of NYSERDA promoting battery and energy storage in New York. Coordinates 42.707237°, -89.436378° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":42.707237,"lon":-89.436378,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


DOE - Office of Legacy Management -- Pier 38 - NY 0-18  

Office of Legacy Management (LM)

Pier 38 - NY 0-18 Pier 38 - NY 0-18 FUSRAP Considered Sites Site: Pier 38 (NY.0-18 ) Designated Name: Alternate Name: Location: Evaluation Year: Site Operations: Site Disposition: Radioactive Materials Handled: Primary Radioactive Materials Handled: Radiological Survey(s): Site Status: This site is one of a group of 77 FUSRAP considered sites for which few, if any records are available in their respective site files to provide an historical account of past operations and their relationship, if any, with MED/AEC operations. Reviews of contact lists, accountable station lists, health and safety records and other documentation of the period do not provide sufficient information to warrant further search of historical records for information on these sites. These site files remain "open" to


DOE Awards Small Business Contract for West Valley NY Services | Department  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Contract for West Valley NY Services Contract for West Valley NY Services DOE Awards Small Business Contract for West Valley NY Services September 26, 2012 - 12:00pm Addthis Media Contact Bill Taylor bill.taylor@srs.gov 803-952-8564 CINCINNATI - The Department of Energy (DOE) today awarded a task order (contract) to Chenega Global Services, LLC of Anchorage, Alaska, for administrative and technical support services at the West Valley Demonstration Project, West Valley, New York. The contract has a one-year performance period with a value of $1.3 million, and contains two one-year extension options with a total value of $4.12 million. Chenega Global Services is a certified small and disadvantaged business under the Small Business Administration. The West Valley Demonstration Project is a former commercial nuclear fuel


Weatherization Subgrantees Reach More N.Y. Homes | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Subgrantees Reach More N.Y. Homes Subgrantees Reach More N.Y. Homes Weatherization Subgrantees Reach More N.Y. Homes April 22, 2010 - 4:37pm Addthis Lindsay Gsell Thanks to funds from the Recovery Act, New York expanded its network of weatherization subgrantees. The state has added nine additional subgrantees to its network of 66 community-based organizations that provide energy conservation services on a local level. New York's Division of Housing and Community Renewal received slightly more than $100 million for Weatherization Assistance Program in 2009, a significant increase from its previous annual allotment of approximately $60 million. In addition to this increase in annual funding, DHCR also received $394 million in WAP stimulus funding from the Recovery Act. "New York's success has been built on a network of sub grantees and


DOE - Office of Legacy Management -- West Milton Reactor Site - NY 21  

Office of Legacy Management (LM)

Milton Reactor Site - NY 21 Milton Reactor Site - NY 21 FUSRAP Considered Sites Site: West Milton Reactor Site (NY.21) Designated Name: Alternate Name: Location: Evaluation Year: Site Operations: Site Disposition: Radioactive Materials Handled: Primary Radioactive Materials Handled: Radiological Survey(s): Site Status: This site is one of a group of 77 FUSRAP considered sites for which few, if any records are available in their respective site files to provide an historical account of past operations and their relationship, if any, with MED/AEC operations. Reviews of contact lists, accountable station lists, health and safety records and other documentation of the period do not provide sufficient information to warrant further search of historical records for information on these sites. These site files remain "open" to


Submit Your Ideas for the NY Energy Data Jam | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Submit Your Ideas for the NY Energy Data Jam Submit Your Ideas for the NY Energy Data Jam Submit Your Ideas for the NY Energy Data Jam June 19, 2013 - 11:03am Q&A What idea would you present at the Data Jam? Join the Conversation Addthis Applications powered by open energy data were on display at the Energy Datapalooza in June 2012. | Photo by Sarah Gerrity, Energy Department. Applications powered by open energy data were on display at the Energy Datapalooza in June 2012. | Photo by Sarah Gerrity, Energy Department. Alex Cohen Alex Cohen Senior Digital Information Strategist How can I participate? Even if you cannot attend in person, we still want you to participate. Help us by starting the conversation. Email us at newmedia@hq.doe.gov and tell us your idea. Tweet questions to @ENERGY with the hashtag #EnergyJam.


Sediment Decontamination For Navigational And Environmental Restoration In NY/NJ Harbor Case Study: Passaic River, New Jersey  

E-Print Network (OSTI)

Sediment Decontamination For Navigational And Environmental Restoration In NY/NJ Harbor ­ Case, Arlington, VA 22230 Sediments in the NY/NJ Harbor are widely contaminated with toxic organic and inorganic compounds. Decontamination of these sediments is one tool that can be used to cope with the problems posed

Brookhaven National Laboratory


XNYGR/2795 SLF EBG Customizable Enrollment Form (NY) Page 1 of 3 Sun Life Insurance and Annuity Company of New York and  

E-Print Network (OSTI)

XNYGR/2795 SLF EBG Customizable Enrollment Form (NY) Page 1 of 3 Sun Life Insurance and Annuity% of the Basic Weekly Earnings #12;XNYGR/2795 SLF EBG Customizable Enrollment Form (NY) Page 2 of 3 Evidence

Suzuki, Masatsugu


DOE Zero Energy Ready Home Case Study: AquaZephyr, Ithaca, NY  

Energy.gov (U.S. Department of Energy (DOE))

Case study of a DOE Zero Energy Ready home in Ithaca, NY, that achieves a HERS 56 without PV or HERS 15 with 4-kW of PV. The two-story, 1,664-ft2 home is one of 17 single-family and 4 duplex homes...


May 21-22, 2012 Oncenter Complex Syracuse, NY Call for Posters  

E-Print Network (OSTI)

May 21-22, 2012 Oncenter Complex Syracuse, NY Call for Posters Present at the 2012 Biotechnology Symposium Poster Session Showcase your research to colleagues and professionals Network: Please submit your abstract and direct all questions to Advisory Council member and Poster Session Chair

Mather, Patrick T.


Concrete as a Green Building Material Columbia University, New York, NY 10027, USA  

E-Print Network (OSTI)

that influence resource utilization. Keywords: sustainable development, green buildings, supplementaryConcrete as a Green Building Material C. Meyer Columbia University, New York, NY 10027, USA to make it suitable as a "Green Building" material. Foremost and most successful in this regard is the use

Meyer, Christian

Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Physics of Nuclear Medicine Polytechnic Institute of NYU, Brooklyn, NY 11201  

E-Print Network (OSTI)

Physics of Nuclear Medicine Yao Wang Polytechnic Institute of NYU, Brooklyn, NY 11201 Based on J. L are from the textbook. #12;EL5823 Nuclear Physics Yao Wang, Polytechnic U., Brooklyn 2 Lecture Outline of decay · Radiotracers #12;EL5823 Nuclear Physics Yao Wang, Polytechnic U., Brooklyn 3 What is Nuclear

Suel, Torsten


SoMAS alumni have gone on to careers as: Acting Director, NY Sea Grant  

E-Print Network (OSTI)

· Environmental Affairs Officer on Marine & Coastal Biodiversity, UNEP Secretariat of Convention on Biological & Facilities Specialist, NY Sea Grant Extension · Director, Center for Marine & Wetland Studies, Conway, SC, Dewberry, Fairfax, VA · Marine Conservation Project Director, The Nature Conservancy · Marine Ecologist

Zhang, Minghua


Abstract No. jone0514 Elemental Distributions for NY/NJ Harbor Sediments  

E-Print Network (OSTI)

Abstract No. jone0514 Elemental Distributions for NY/NJ Harbor Sediments K. Jones (BNL), H. Feng (Montclair State U.) and A. Lanzirotti (U. of Chicago) Beamline(s): X26A Sediments in the New York/New Jersey Waterways Sediments, is a useful material for use in investigation of the spatial variability. This standard

Brookhaven National Laboratory


Abstract No. jone0499 FTIR Measurement of Organic Functional Groups in NY/NJ Harbor Sediments  

E-Print Network (OSTI)

Abstract No. jone0499 FTIR Measurement of Organic Functional Groups in NY/NJ Harbor Sediments H. Jones (BNL) Beamline(s): U2B Sediments in urban rivers and estuaries are usually contaminated contaminated sediments cause to the environment and human health is now widely recognized and has stimulated

Brookhaven National Laboratory


DOE Zero Energy Ready Home Case Study: Greenhill Contracting, New Paltz, NY  

Energy.gov (U.S. Department of Energy (DOE))

Case study of a DOE Zero Energy Ready home in New Paltz, NY, that achieved a HERS score of 37 without PV or 7 with 7.5-kW PV. The two-story 2,288-ft2 home is one of 9 certified homes. All of the...


Borer problems and their control in dwarf apple trees David Kain, Entomology, NYSAES, Geneva, NY  

E-Print Network (OSTI)

Borer problems and their control in dwarf apple trees David Kain, Entomology, NYSAES, Geneva, NY in western New York, were invading burrknots on dwarf apple trees. About the same time, Dick Straub seemed to be becoming more common in dwarf apple plantings, as well. Based on Deb's alert, we decided

Agnello, Arthur M.


Dating the Glass Lake Dugout by Dendrochronology (NY State Museum #CN-37516)  

E-Print Network (OSTI)

Dating the Glass Lake Dugout by Dendrochronology (NY State Museum #CN-37516) Carol Griggs, Dendrochronology Lab, Cornell University, cbg4@cornell.edu The Glass Lake Dugout was found at the bottom of Glass for the Glass Lake Dugout (Figure 2B). The series was compared with other site and regional white pine

Manning, Sturt


DOE Zero Energy Ready Home Case Study, Ithaca Neighborhood Housing Services, Ithaca, NY  

Energy.gov (U.S. Department of Energy (DOE))

Case study of a DOE Zero Energy Ready Home in Ithaca, NY, that scored HERS 50 without PV. These 1,160 ft2 affordable town houses have R-20 advance framed walls, R-52 blown cellulose in attic, radiant heat with 92.5 AFUE boiler, and triple-pane windows.


File:USDA-CE-Production-GIFmaps-NY.pdf | Open Energy Information  

Open Energy Info (EERE)

NY.pdf NY.pdf Jump to: navigation, search File File history File usage New York Ethanol Plant Locations Size of this preview: 776 × 600 pixels. Full resolution ‎(1,650 × 1,275 pixels, file size: 324 KB, MIME type: application/pdf) Description New York Ethanol Plant Locations Sources United States Department of Agriculture Related Technologies Biomass, Biofuels, Ethanol Creation Date 2010-01-19 Extent State Countries United States UN Region Northern America States New York External links http://www.nass.usda.gov/Charts_and_Maps/Ethanol_Plants/ File history Click on a date/time to view the file as it appeared at that time. Date/Time Thumbnail Dimensions User Comment current 16:19, 27 December 2010 Thumbnail for version as of 16:19, 27 December 2010 1,650 × 1,275 (324 KB) MapBot (Talk | contribs) Automated bot upload


MHK Projects/GCK Technology Shelter Island NY US | Open Energy Information  

Open Energy Info (EERE)

Shelter Island NY US Shelter Island NY US < MHK Projects Jump to: navigation, search << Return to the MHK database homepage Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":5,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"500px","height":"350px","centre":false,"title":"","label":"","icon":"File:Aquamarine-marker.png","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":41.0682,"lon":-72.3387,"alt":0,"address":"","icon":"http:\/\/prod-http-80-800498448.us-east-1.elb.amazonaws.com\/w\/images\/7\/74\/Aquamarine-marker.png","group":"","inlineLabel":"","visitedicon":""}]}


DOE - Office of Legacy Management -- Pfaltz and Bauer Inc - New York - NY  

Office of Legacy Management (LM)

New York - New York - NY 45 FUSRAP Considered Sites Site: Pfaltz and Bauer Inc - New York (NY.45) Designated Name: Alternate Name: Location: Evaluation Year: Site Operations: Site Disposition: Radioactive Materials Handled: Primary Radioactive Materials Handled: Radiological Survey(s): Site Status: This site is one of a group of 77 FUSRAP considered sites for which few, if any records are available in their respective site files to provide an historical account of past operations and their relationship, if any, with MED/AEC operations. Reviews of contact lists, accountable station lists, health and safety records and other documentation of the period do not provide sufficient information to warrant further search of historical records for information on these sites. These site files remain "open" to


File:EIA-Appalach1-NY-BOE.pdf | Open Energy Information  

Open Energy Info (EERE)

EIA-Appalach1-NY-BOE.pdf EIA-Appalach1-NY-BOE.pdf Jump to: navigation, search File File history File usage Appalachian Basin, New York Area Oil and Gas Fields By 2001 BOE Reserve Class Size of this preview: 776 × 600 pixels. Full resolution ‎(6,600 × 5,100 pixels, file size: 12.75 MB, MIME type: application/pdf) Description Appalachian Basin, New York Area Oil and Gas Fields By 2001 BOE Reserve Class Sources Energy Information Administration Authors Samuel H. Limerick; Lucy Luo; Gary Long; David F. Morehouse; Jack Perrin; Robert F. King Related Technologies Oil, Natural Gas Creation Date 2005-09-01 Extent Regional Countries United States UN Region Northern America States New York File history Click on a date/time to view the file as it appeared at that time. Date/Time Thumbnail Dimensions User Comment


Affirmatively furthering fair housing : overcoming barriers to implementation of the Westchester County, NY false claims case settlement  

E-Print Network (OSTI)

Westchester County, NY was sued by the Anti-Discrimination Center of Metro New York, Inc. (ADC) under the False Claims Act for allegedly failing to meet its Affirmatively Further Fair Housing obligation for Community ...

Stein, Julie Iris



CUT FLOWER CULTURAL PRACTICE STUDIES AND VARIETY TRIALS, 2013 H. C. Wien, Department of Horticulture, Cornell University, Ithaca NY  

E-Print Network (OSTI)

of Horticulture, Cornell University, Ithaca NY EXECUTIVE SUMMARY: ANEMONE/RANUNCULUS TUNNEL TRIAL. Page 5 lights, or to use a shorter duration of artificial light during the middle of the night

Pawlowski, Wojtek


Built waterfront through edge, connection, and exchange : reclaiming a waterfront for Greenpoint, a project in Brooklyn, N.Y.  

E-Print Network (OSTI)

Currently the waterfront of Brooklyn N.Y. between the Gowanus Canal of Redhook and the Newton Creek of Greenpoint is predominantly lined with various types of industrial and manufacturing uses. Scattered throughout are ...

Ziesemann, Rodney P. (Rodney Paul), 1967-



DOE Zero Energy Ready Home Case Study, Ferguson Design and Construction, Inc., Sagaponak, NY, Custom Home  

Energy.gov (U.S. Department of Energy (DOE))

Case study of a DOE Zero Energy Ready Home in Long Island, NY, that scored HERS 43 without PV. This 5,088 ft2 custom home has R-25 double-stud walls, a vaulted roof with R-40 blown cellulose, R-10 XPS under slab, a hydro air system with 91% efficient boiler for forced air and radiant floor heat, and 100% LED lights.


The binary properties of the pulsating subdwarf B eclipsing binary PG 1336-018 (NY Vir)  

E-Print Network (OSTI)

We present an unbiased orbit solution and mass determination of the components of the eclipsing binary NY Vir as a critical test for the formation scenarios of subdwarf B stars. We obtained high-resolution time series VLT/UVES spectra and high-speed multicolour VLT/ULTRACAM photometric observations of NY Vir, a rapidly pulsating subdwarf B star in a short period eclipsing binary. Combining the radial velocity curve obtained from the VLT/UVES spectra with the VLT/ULTRACAM multicolour lightcurves, we determined numerical orbital solutions for this eclipsing binary. Due to the large number of free parameters and their strong correlations, no unique solution could be found, only families of solutions. We present three solutions of equal statistical significance, two of which are compatible with the primary having gone through a core He-flash and a common-envelope phase described by the $\\alpha$-formalism. These two models have an sdB primary of 0.466 \\msol and 0.389 \\msol, respectively. Finally, we report the detection of the Rossiter-McLaughlin effect for NY Vir.

M. Vu?kovi?; C. Aerts; R. stensen; G. Nelemans; H. Hu; C. S. Jeffery; V. S. Dhillon; T. R. Marsh



Sequence and annotation of the 369-kb NY-2A and the 345-kb AR158 viruses that infect Chlorella NC64A  

E-Print Network (OSTI)

Sequence and annotation of the 369-kb NY-2A and the 345-kb AR158 viruses that infect Chlorella NC64, unicellular, eukaryotic, chlorella-like green alga, Chlorella NC64A. The 368,683-bp genome of NY-2A and the 344,690-bp genome of AR158 are the two largest chlorella virus genomes sequenced to date; NY-2A

Graves, Michael V.


Contribution of the Reaction Ny-]Nnk to Antikaon Production in Relativistic Heavy-Ion Collisions  

E-Print Network (OSTI)

, such as Fermi motions, coherent productions, and multiple collisions. Shor et aI. showed that the simple nucleon-nucleon collision model with Fermi motions underestimates the number of K by more than an order of magnitude. Muller' suggested that the decay... of the product o(NY~NNK)vNpN over the normalized nucleon momentum distribution f( p ), i.e., NA~NNK ?3.3)& 10 s1 19 ?1 NNK ?1.6)& 10 s (15) In the simplified kinetic model of Ref. 11, the number of antikaons NK is related to the initial number of hyperons...

Ko, Che Ming.



A mutation in the envelope protein fusion loop attenuates mouse neuroinvasiveness of the NY99 strain of West Nile virus  

SciTech Connect

Substitutions were engineered individually and in combinations at the fusion loop, receptor-binding domain and a stem-helix structure of the envelope protein of a West Nile virus strain, NY99, and their effects on mouse virulence and presentation of epitopes recognized by monoclonal antibodies (MAbs) were assessed. A single substitution within the fusion loop (L107F) attenuated mouse neuroinvasiveness of NY99. No substitutions attenuated NY99 neurovirulence. The L107F mutation also abolished binding of a non-neutralizing MAb, 3D9, whose epitope had not been previously identified. MAb 3D9 was subsequently shown to be broadly cross-reactive with other flaviviruses, consistent with binding near the highly conserved fusion loop.

Zhang Shuliu [Department of Microbiology and Immunology, University of Texas Medical Branch, 301 University Blvd., Galveston, TX 77555 (United States); Li Li; Woodson, Sara E. [Department of Pathology, University of Texas Medical Branch, 301 University Blvd., Galveston, TX 77555 (United States); Huang, Claire Y.-H.; Kinney, Richard M. [Arboviral Diseases Branch, Division of Vector-Borne Infectious Diseases, National Center for Zoonotic, Vector-Borne, and Enteric Diseases, Coordinating Center for Infectious Diseases, Centers for Disease Control and Prevention, U.S. Department of Health and Human Services, Fort Collins, CO (United States); Barrett, Alan D.T. [Department of Microbiology and Immunology, University of Texas Medical Branch, 301 University Blvd., Galveston, TX 77555 (United States)]|[Department of Pathology, University of Texas Medical Branch, 301 University Blvd., Galveston, TX 77555 (United States)]|[Center for Biodefense and Emerging Infectious Diseases, University of Texas Medical Branch, 301 University Blvd., Galveston, TX 77555 (United States)]|[Sealy Center for Vaccine Development, University of Texas Medical Branch, 301 University Blvd., Galveston, TX 77555 (United States)]|[Institute for Human Infections and Immunity, University of Texas Medical Branch, 301 University Blvd., Galveston, TX 77555 (United States); Beasley, David W.C. [Department of Microbiology and Immunology, University of Texas Medical Branch, 301 University Blvd., Galveston, TX 77555 (United States)]|[Center for Biodefense and Emerging Infectious Diseases, University of Texas Medical Branch, 301 University Blvd., Galveston, TX 77555 (United States)]|[Sealy Center for Vaccine Development, University of Texas Medical Branch, 301 University Blvd., Galveston, TX 77555 (United States)]|[Institute for Human Infections and Immunity, University of Texas Medical Branch, 301 University Blvd., Galveston, TX 77555 (United States)]. E-mail: d.beasley@utmb.edu


Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


The Pulsating sdB+M Eclipsing System NY Virginis and its Circumbinary Planets  

E-Print Network (OSTI)

We searched for circumbinary planets orbiting NY Vir in historical eclipse times including our long-term CCD data. Sixty-eight times of minimum light with accuracies better than 10 s were used for the ephemeris computations. The best fit to those timings indicated that the orbital period of NY Vir has varied due to a combination of two sinusoids with periods of $P_3$=8.2 yr and $P_4$=27.0 yr and semi-amplitudes of $K_3$=6.9 s and $K_4$=27.3 s, respectively. The periodic variations most likely arise from a pair of light-time effects due to the presence of third and fourth bodies that are gravitationally bound to the eclipsing pair. We have derived the orbital parameters and the minimum masses, $M_3 \\sin i_3$ = 2.8 M$\\rm_{Jup}$ and $M_4 \\sin i_4$ = 4.5 M$\\rm_{Jup}$, of both objects. A dynamical analysis suggests that the outer companion is less likely to orbit the binary on a circular orbit. Instead we show that future timing data might push its eccentricity to moderate values for which the system exhibits long...

Lee, Jae Woo; Youn, Jae-Hyuck; Han, Wonyong



Structural, optical and electrical properties of WOxNy filmsdeposited by reactive dual magnetron sputtering  

SciTech Connect

Thin films of tungsten oxynitride were prepared by dual magnetron sputtering of tungsten using argon/oxygen/nitrogen gas mixtures with various nitrogen/oxygen ratios. The presence of even small amounts of oxygen had a great effect not only on the composition but on the structure of WOxNy films, as shown by Rutherford backscattering and x-ray diffraction, respectively. Significant incorporation of nitrogen occurred only when the nitrogen partial pressure exceeded 89 percent of the total reactive gas pressure. Sharp changes in the stoichiometry, deposition rate, room temperature resistivity, electrical activation energy and optical band gap were observed when the nitrogen/oxygen ratio was high.The deposition rate increased from 0.31 to 0.89 nm/s, the room temperature resistivity decreased from 1.65 x 108 to 1.82 x 10-2 ?cm, the electrical activation energy decreased from 0.97 to 0.067 eV, and the optical band gap decreased from 3.19 to 2.94 eV upon nitrogen incorporation into the films. WOxNy films were highly transparent as long as the nitrogen incorporation was low, and were brownish (absorbing) and partially reflecting as nitrogen incorporation became significant.

Mohamed, Sodky H.; Anders, Andre



U.S. Total Exports  

U.S. Energy Information Administration (EIA) Indexed Site

International Falls, MN Noyes, MN Warroad, MN Babb, MT Havre, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT North Troy, VT LNG Imports into Cameron, LA LNG Imports into Cove Point, MD LNG Imports into Elba Island, GA LNG Imports into Everett, MA LNG Imports into Freeport, TX LNG Imports into Golden Pass, TX LNG Imports into Gulf Gateway, LA LNG Imports into Gulf LNG, MS LNG Imports into Lake Charles, LA LNG Imports into Neptune Deepwater Port LNG Imports into Northeast Gateway LNG Imports into Sabine Pass, LA U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Alamo, TX El Paso, TX Galvan Ranch, TX Hidalgo, TX McAllen, TX Penitas, TX LNG Imports from Algeria Cove Point, MD Everett, MA Lake Charles, LA LNG Imports from Australia Everett, MA Lake Charles, LA LNG Imports from Brunei Lake Charles, LA LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Equatorial Guinea Elba Island, GA Lake Charles, LA LNG Imports from Indonesia Lake Charles, LA LNG Imports from Malaysia Gulf Gateway, LA Lake Charles, LA LNG Imports from Nigeria Cove Point, MD Elba Island, GA Freeport, TX Gulf Gateway, LA Lake Charles, LA Sabine Pass, LA LNG Imports from Norway Cove Point, MD Sabine Pass, LA LNG Imports from Oman Lake Charles, LA LNG Imports from Peru Cameron, LA Freeport, TX Sabine Pass, LA LNG Imports from Qatar Cameron, LA Elba Island, GA Golden Pass, TX Gulf Gateway, LA Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf Gateway, LA Gulf LNG, MS Lake Charles, LA Neptune Deepwater Port Northeast Gateway Sabine Pass, LA LNG Imports from United Arab Emirates Lake Charles, LA LNG Imports from Yemen Everett, MA Freeport, TX Neptune Deepwater Port Sabine Pass, LA LNG Imports from Other Countries Lake Charles, LA Period: Monthly Annual


U.S. LNG Imports from Indonesia  

Gasoline and Diesel Fuel Update (EIA)

International Falls, MN Noyes, MN Warroad, MN Babb, MT Havre, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT North Troy, VT LNG Imports into Cameron, LA LNG Imports into Cove Point, MD LNG Imports into Elba Island, GA LNG Imports into Everett, MA LNG Imports into Freeport, TX LNG Imports into Golden Pass, TX LNG Imports into Gulf Gateway, LA LNG Imports into Gulf LNG, MS LNG Imports into Lake Charles, LA LNG Imports into Neptune Deepwater Port LNG Imports into Northeast Gateway LNG Imports into Sabine Pass, LA U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Alamo, TX El Paso, TX Galvan Ranch, TX Hidalgo, TX McAllen, TX Penitas, TX LNG Imports from Algeria Cove Point, MD Everett, MA Lake Charles, LA LNG Imports from Australia Everett, MA Lake Charles, LA LNG Imports from Brunei Lake Charles, LA LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Equatorial Guinea Elba Island, GA Lake Charles, LA LNG Imports from Indonesia Lake Charles, LA LNG Imports from Malaysia Gulf Gateway, LA Lake Charles, LA LNG Imports from Nigeria Cove Point, MD Elba Island, GA Freeport, TX Gulf Gateway, LA Lake Charles, LA Sabine Pass, LA LNG Imports from Norway Cove Point, MD Sabine Pass, LA LNG Imports from Oman Lake Charles, LA LNG Imports from Peru Cameron, LA Freeport, TX Sabine Pass, LA LNG Imports from Qatar Cameron, LA Elba Island, GA Golden Pass, TX Gulf Gateway, LA Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf Gateway, LA Gulf LNG, MS Lake Charles, LA Neptune Deepwater Port Northeast Gateway Sabine Pass, LA LNG Imports from United Arab Emirates Lake Charles, LA LNG Imports from Yemen Everett, MA Freeport, TX Neptune Deepwater Port Sabine Pass, LA LNG Imports from Other Countries Lake Charles, LA Period: Monthly Annual


U.S. LNG Imports from Brunei  

Gasoline and Diesel Fuel Update (EIA)

International Falls, MN Noyes, MN Warroad, MN Babb, MT Havre, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT North Troy, VT LNG Imports into Cameron, LA LNG Imports into Cove Point, MD LNG Imports into Elba Island, GA LNG Imports into Everett, MA LNG Imports into Freeport, TX LNG Imports into Golden Pass, TX LNG Imports into Gulf Gateway, LA LNG Imports into Gulf LNG, MS LNG Imports into Lake Charles, LA LNG Imports into Neptune Deepwater Port LNG Imports into Northeast Gateway LNG Imports into Sabine Pass, LA U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Alamo, TX El Paso, TX Galvan Ranch, TX Hidalgo, TX McAllen, TX Penitas, TX LNG Imports from Algeria Cove Point, MD Everett, MA Lake Charles, LA LNG Imports from Australia Everett, MA Lake Charles, LA LNG Imports from Brunei Lake Charles, LA LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Equatorial Guinea Elba Island, GA Lake Charles, LA LNG Imports from Indonesia Lake Charles, LA LNG Imports from Malaysia Gulf Gateway, LA Lake Charles, LA LNG Imports from Nigeria Cove Point, MD Elba Island, GA Freeport, TX Gulf Gateway, LA Lake Charles, LA Sabine Pass, LA LNG Imports from Norway Cove Point, MD Sabine Pass, LA LNG Imports from Oman Lake Charles, LA LNG Imports from Peru Cameron, LA Freeport, TX Sabine Pass, LA LNG Imports from Qatar Cameron, LA Elba Island, GA Golden Pass, TX Gulf Gateway, LA Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf Gateway, LA Gulf LNG, MS Lake Charles, LA Neptune Deepwater Port Northeast Gateway Sabine Pass, LA LNG Imports from United Arab Emirates Lake Charles, LA LNG Imports from Yemen Everett, MA Freeport, TX Neptune Deepwater Port Sabine Pass, LA LNG Imports from Other Countries Lake Charles, LA Period: Monthly Annual


U.S. LNG Imports from Egypt  

Gasoline and Diesel Fuel Update (EIA)

International Falls, MN Noyes, MN Warroad, MN Babb, MT Havre, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT North Troy, VT LNG Imports into Cameron, LA LNG Imports into Cove Point, MD LNG Imports into Elba Island, GA LNG Imports into Everett, MA LNG Imports into Freeport, TX LNG Imports into Golden Pass, TX LNG Imports into Gulf Gateway, LA LNG Imports into Gulf LNG, MS LNG Imports into Lake Charles, LA LNG Imports into Neptune Deepwater Port LNG Imports into Northeast Gateway LNG Imports into Sabine Pass, LA U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Alamo, TX El Paso, TX Galvan Ranch, TX Hidalgo, TX McAllen, TX Penitas, TX LNG Imports from Algeria Cove Point, MD Everett, MA Lake Charles, LA LNG Imports from Australia Everett, MA Lake Charles, LA LNG Imports from Brunei Lake Charles, LA LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Equatorial Guinea Elba Island, GA Lake Charles, LA LNG Imports from Indonesia Lake Charles, LA LNG Imports from Malaysia Gulf Gateway, LA Lake Charles, LA LNG Imports from Nigeria Cove Point, MD Elba Island, GA Freeport, TX Gulf Gateway, LA Lake Charles, LA Sabine Pass, LA LNG Imports from Norway Cove Point, MD Sabine Pass, LA LNG Imports from Oman Lake Charles, LA LNG Imports from Peru Cameron, LA Freeport, TX Sabine Pass, LA LNG Imports from Qatar Cameron, LA Elba Island, GA Golden Pass, TX Gulf Gateway, LA Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf Gateway, LA Gulf LNG, MS Lake Charles, LA Neptune Deepwater Port Northeast Gateway Sabine Pass, LA LNG Imports from United Arab Emirates Lake Charles, LA LNG Imports from Yemen Everett, MA Freeport, TX Neptune Deepwater Port Sabine Pass, LA LNG Imports from Other Countries Lake Charles, LA Period: Monthly Annual


U.S. LNG Imports from Canada  

U.S. Energy Information Administration (EIA) Indexed Site

International Falls, MN Noyes, MN Warroad, MN Babb, MT Havre, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT North Troy, VT LNG Imports into Cameron, LA LNG Imports into Cove Point, MD LNG Imports into Elba Island, GA LNG Imports into Everett, MA LNG Imports into Freeport, TX LNG Imports into Golden Pass, TX LNG Imports into Gulf Gateway, LA LNG Imports into Gulf LNG, MS LNG Imports into Lake Charles, LA LNG Imports into Neptune Deepwater Port LNG Imports into Northeast Gateway LNG Imports into Sabine Pass, LA U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Alamo, TX El Paso, TX Galvan Ranch, TX Hidalgo, TX McAllen, TX Penitas, TX LNG Imports from Algeria Cove Point, MD Everett, MA Lake Charles, LA LNG Imports from Australia Everett, MA Lake Charles, LA LNG Imports from Brunei Lake Charles, LA LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Equatorial Guinea Elba Island, GA Lake Charles, LA LNG Imports from Indonesia Lake Charles, LA LNG Imports from Malaysia Gulf Gateway, LA Lake Charles, LA LNG Imports from Nigeria Cove Point, MD Elba Island, GA Freeport, TX Gulf Gateway, LA Lake Charles, LA Sabine Pass, LA LNG Imports from Norway Cove Point, MD Sabine Pass, LA LNG Imports from Oman Lake Charles, LA LNG Imports from Peru Cameron, LA Freeport, TX Sabine Pass, LA LNG Imports from Qatar Cameron, LA Elba Island, GA Golden Pass, TX Gulf Gateway, LA Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf Gateway, LA Gulf LNG, MS Lake Charles, LA Neptune Deepwater Port Northeast Gateway Sabine Pass, LA LNG Imports from United Arab Emirates Lake Charles, LA LNG Imports from Yemen Everett, MA Freeport, TX Neptune Deepwater Port Sabine Pass, LA LNG Imports from Other Countries Lake Charles, LA Period: Monthly Annual


U.S. LNG Imports from Trinidad/Tobago  

Gasoline and Diesel Fuel Update (EIA)

International Falls, MN Noyes, MN Warroad, MN Babb, MT Havre, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT North Troy, VT LNG Imports into Cameron, LA LNG Imports into Cove Point, MD LNG Imports into Elba Island, GA LNG Imports into Everett, MA LNG Imports into Freeport, TX LNG Imports into Golden Pass, TX LNG Imports into Gulf Gateway, LA LNG Imports into Gulf LNG, MS LNG Imports into Lake Charles, LA LNG Imports into Neptune Deepwater Port LNG Imports into Northeast Gateway LNG Imports into Sabine Pass, LA U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Alamo, TX El Paso, TX Galvan Ranch, TX Hidalgo, TX McAllen, TX Penitas, TX LNG Imports from Algeria Cove Point, MD Everett, MA Lake Charles, LA LNG Imports from Australia Everett, MA Lake Charles, LA LNG Imports from Brunei Lake Charles, LA LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Equatorial Guinea Elba Island, GA Lake Charles, LA LNG Imports from Indonesia Lake Charles, LA LNG Imports from Malaysia Gulf Gateway, LA Lake Charles, LA LNG Imports from Nigeria Cove Point, MD Elba Island, GA Freeport, TX Gulf Gateway, LA Lake Charles, LA Sabine Pass, LA LNG Imports from Norway Cove Point, MD Sabine Pass, LA LNG Imports from Oman Lake Charles, LA LNG Imports from Peru Cameron, LA Freeport, TX Sabine Pass, LA LNG Imports from Qatar Cameron, LA Elba Island, GA Golden Pass, TX Gulf Gateway, LA Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf Gateway, LA Gulf LNG, MS Lake Charles, LA Neptune Deepwater Port Northeast Gateway Sabine Pass, LA LNG Imports from United Arab Emirates Lake Charles, LA LNG Imports from Yemen Everett, MA Freeport, TX Neptune Deepwater Port Sabine Pass, LA LNG Imports from Other Countries Lake Charles, LA Period: Monthly Annual


U.S. LNG Imports from Peru  

Gasoline and Diesel Fuel Update (EIA)

International Falls, MN Noyes, MN Warroad, MN Babb, MT Havre, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT North Troy, VT LNG Imports into Cameron, LA LNG Imports into Cove Point, MD LNG Imports into Elba Island, GA LNG Imports into Everett, MA LNG Imports into Freeport, TX LNG Imports into Golden Pass, TX LNG Imports into Gulf Gateway, LA LNG Imports into Gulf LNG, MS LNG Imports into Lake Charles, LA LNG Imports into Neptune Deepwater Port LNG Imports into Northeast Gateway LNG Imports into Sabine Pass, LA U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Alamo, TX El Paso, TX Galvan Ranch, TX Hidalgo, TX McAllen, TX Penitas, TX LNG Imports from Algeria Cove Point, MD Everett, MA Lake Charles, LA LNG Imports from Australia Everett, MA Lake Charles, LA LNG Imports from Brunei Lake Charles, LA LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Equatorial Guinea Elba Island, GA Lake Charles, LA LNG Imports from Indonesia Lake Charles, LA LNG Imports from Malaysia Gulf Gateway, LA Lake Charles, LA LNG Imports from Nigeria Cove Point, MD Elba Island, GA Freeport, TX Gulf Gateway, LA Lake Charles, LA Sabine Pass, LA LNG Imports from Norway Cove Point, MD Sabine Pass, LA LNG Imports from Oman Lake Charles, LA LNG Imports from Peru Cameron, LA Freeport, TX Sabine Pass, LA LNG Imports from Qatar Cameron, LA Elba Island, GA Golden Pass, TX Gulf Gateway, LA Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf Gateway, LA Gulf LNG, MS Lake Charles, LA Neptune Deepwater Port Northeast Gateway Sabine Pass, LA LNG Imports from United Arab Emirates Lake Charles, LA LNG Imports from Yemen Everett, MA Freeport, TX Neptune Deepwater Port Sabine Pass, LA LNG Imports from Other Countries Lake Charles, LA Period: Monthly Annual


U.S. LNG Imports from Malaysia  

Gasoline and Diesel Fuel Update (EIA)

International Falls, MN Noyes, MN Warroad, MN Babb, MT Havre, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT North Troy, VT LNG Imports into Cameron, LA LNG Imports into Cove Point, MD LNG Imports into Elba Island, GA LNG Imports into Everett, MA LNG Imports into Freeport, TX LNG Imports into Golden Pass, TX LNG Imports into Gulf Gateway, LA LNG Imports into Gulf LNG, MS LNG Imports into Lake Charles, LA LNG Imports into Neptune Deepwater Port LNG Imports into Northeast Gateway LNG Imports into Sabine Pass, LA U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Alamo, TX El Paso, TX Galvan Ranch, TX Hidalgo, TX McAllen, TX Penitas, TX LNG Imports from Algeria Cove Point, MD Everett, MA Lake Charles, LA LNG Imports from Australia Everett, MA Lake Charles, LA LNG Imports from Brunei Lake Charles, LA LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Equatorial Guinea Elba Island, GA Lake Charles, LA LNG Imports from Indonesia Lake Charles, LA LNG Imports from Malaysia Gulf Gateway, LA Lake Charles, LA LNG Imports from Nigeria Cove Point, MD Elba Island, GA Freeport, TX Gulf Gateway, LA Lake Charles, LA Sabine Pass, LA LNG Imports from Norway Cove Point, MD Sabine Pass, LA LNG Imports from Oman Lake Charles, LA LNG Imports from Peru Cameron, LA Freeport, TX Sabine Pass, LA LNG Imports from Qatar Cameron, LA Elba Island, GA Golden Pass, TX Gulf Gateway, LA Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf Gateway, LA Gulf LNG, MS Lake Charles, LA Neptune Deepwater Port Northeast Gateway Sabine Pass, LA LNG Imports from United Arab Emirates Lake Charles, LA LNG Imports from Yemen Everett, MA Freeport, TX Neptune Deepwater Port Sabine Pass, LA LNG Imports from Other Countries Lake Charles, LA Period: Monthly Annual


U.S. LNG Imports from Oman  

Gasoline and Diesel Fuel Update (EIA)

International Falls, MN Noyes, MN Warroad, MN Babb, MT Havre, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT North Troy, VT LNG Imports into Cameron, LA LNG Imports into Cove Point, MD LNG Imports into Elba Island, GA LNG Imports into Everett, MA LNG Imports into Freeport, TX LNG Imports into Golden Pass, TX LNG Imports into Gulf Gateway, LA LNG Imports into Gulf LNG, MS LNG Imports into Lake Charles, LA LNG Imports into Neptune Deepwater Port LNG Imports into Northeast Gateway LNG Imports into Sabine Pass, LA U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Alamo, TX El Paso, TX Galvan Ranch, TX Hidalgo, TX McAllen, TX Penitas, TX LNG Imports from Algeria Cove Point, MD Everett, MA Lake Charles, LA LNG Imports from Australia Everett, MA Lake Charles, LA LNG Imports from Brunei Lake Charles, LA LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Equatorial Guinea Elba Island, GA Lake Charles, LA LNG Imports from Indonesia Lake Charles, LA LNG Imports from Malaysia Gulf Gateway, LA Lake Charles, LA LNG Imports from Nigeria Cove Point, MD Elba Island, GA Freeport, TX Gulf Gateway, LA Lake Charles, LA Sabine Pass, LA LNG Imports from Norway Cove Point, MD Sabine Pass, LA LNG Imports from Oman Lake Charles, LA LNG Imports from Peru Cameron, LA Freeport, TX Sabine Pass, LA LNG Imports from Qatar Cameron, LA Elba Island, GA Golden Pass, TX Gulf Gateway, LA Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf Gateway, LA Gulf LNG, MS Lake Charles, LA Neptune Deepwater Port Northeast Gateway Sabine Pass, LA LNG Imports from United Arab Emirates Lake Charles, LA LNG Imports from Yemen Everett, MA Freeport, TX Neptune Deepwater Port Sabine Pass, LA LNG Imports from Other Countries Lake Charles, LA Period: Monthly Annual


U.S. LNG Imports from Australia  

Gasoline and Diesel Fuel Update (EIA)

International Falls, MN Noyes, MN Warroad, MN Babb, MT Havre, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT North Troy, VT LNG Imports into Cameron, LA LNG Imports into Cove Point, MD LNG Imports into Elba Island, GA LNG Imports into Everett, MA LNG Imports into Freeport, TX LNG Imports into Golden Pass, TX LNG Imports into Gulf Gateway, LA LNG Imports into Gulf LNG, MS LNG Imports into Lake Charles, LA LNG Imports into Neptune Deepwater Port LNG Imports into Northeast Gateway LNG Imports into Sabine Pass, LA U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Alamo, TX El Paso, TX Galvan Ranch, TX Hidalgo, TX McAllen, TX Penitas, TX LNG Imports from Algeria Cove Point, MD Everett, MA Lake Charles, LA LNG Imports from Australia Everett, MA Lake Charles, LA LNG Imports from Brunei Lake Charles, LA LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Equatorial Guinea Elba Island, GA Lake Charles, LA LNG Imports from Indonesia Lake Charles, LA LNG Imports from Malaysia Gulf Gateway, LA Lake Charles, LA LNG Imports from Nigeria Cove Point, MD Elba Island, GA Freeport, TX Gulf Gateway, LA Lake Charles, LA Sabine Pass, LA LNG Imports from Norway Cove Point, MD Sabine Pass, LA LNG Imports from Oman Lake Charles, LA LNG Imports from Peru Cameron, LA Freeport, TX Sabine Pass, LA LNG Imports from Qatar Cameron, LA Elba Island, GA Golden Pass, TX Gulf Gateway, LA Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf Gateway, LA Gulf LNG, MS Lake Charles, LA Neptune Deepwater Port Northeast Gateway Sabine Pass, LA LNG Imports from United Arab Emirates Lake Charles, LA LNG Imports from Yemen Everett, MA Freeport, TX Neptune Deepwater Port Sabine Pass, LA LNG Imports from Other Countries Lake Charles, LA Period: Monthly Annual


U.S. LNG Imports from Nigeria  

Gasoline and Diesel Fuel Update (EIA)

International Falls, MN Noyes, MN Warroad, MN Babb, MT Havre, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT North Troy, VT LNG Imports into Cameron, LA LNG Imports into Cove Point, MD LNG Imports into Elba Island, GA LNG Imports into Everett, MA LNG Imports into Freeport, TX LNG Imports into Golden Pass, TX LNG Imports into Gulf Gateway, LA LNG Imports into Gulf LNG, MS LNG Imports into Lake Charles, LA LNG Imports into Neptune Deepwater Port LNG Imports into Northeast Gateway LNG Imports into Sabine Pass, LA U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Alamo, TX El Paso, TX Galvan Ranch, TX Hidalgo, TX McAllen, TX Penitas, TX LNG Imports from Algeria Cove Point, MD Everett, MA Lake Charles, LA LNG Imports from Australia Everett, MA Lake Charles, LA LNG Imports from Brunei Lake Charles, LA LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Equatorial Guinea Elba Island, GA Lake Charles, LA LNG Imports from Indonesia Lake Charles, LA LNG Imports from Malaysia Gulf Gateway, LA Lake Charles, LA LNG Imports from Nigeria Cove Point, MD Elba Island, GA Freeport, TX Gulf Gateway, LA Lake Charles, LA Sabine Pass, LA LNG Imports from Norway Cove Point, MD Sabine Pass, LA LNG Imports from Oman Lake Charles, LA LNG Imports from Peru Cameron, LA Freeport, TX Sabine Pass, LA LNG Imports from Qatar Cameron, LA Elba Island, GA Golden Pass, TX Gulf Gateway, LA Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf Gateway, LA Gulf LNG, MS Lake Charles, LA Neptune Deepwater Port Northeast Gateway Sabine Pass, LA LNG Imports from United Arab Emirates Lake Charles, LA LNG Imports from Yemen Everett, MA Freeport, TX Neptune Deepwater Port Sabine Pass, LA LNG Imports from Other Countries Lake Charles, LA Period: Monthly Annual


U.S. LNG Imports from Yemen  

Gasoline and Diesel Fuel Update (EIA)

International Falls, MN Noyes, MN Warroad, MN Babb, MT Havre, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT North Troy, VT LNG Imports into Cameron, LA LNG Imports into Cove Point, MD LNG Imports into Elba Island, GA LNG Imports into Everett, MA LNG Imports into Freeport, TX LNG Imports into Golden Pass, TX LNG Imports into Gulf Gateway, LA LNG Imports into Gulf LNG, MS LNG Imports into Lake Charles, LA LNG Imports into Neptune Deepwater Port LNG Imports into Northeast Gateway LNG Imports into Sabine Pass, LA U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Alamo, TX El Paso, TX Galvan Ranch, TX Hidalgo, TX McAllen, TX Penitas, TX LNG Imports from Algeria Cove Point, MD Everett, MA Lake Charles, LA LNG Imports from Australia Everett, MA Lake Charles, LA LNG Imports from Brunei Lake Charles, LA LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Equatorial Guinea Elba Island, GA Lake Charles, LA LNG Imports from Indonesia Lake Charles, LA LNG Imports from Malaysia Gulf Gateway, LA Lake Charles, LA LNG Imports from Nigeria Cove Point, MD Elba Island, GA Freeport, TX Gulf Gateway, LA Lake Charles, LA Sabine Pass, LA LNG Imports from Norway Cove Point, MD Sabine Pass, LA LNG Imports from Oman Lake Charles, LA LNG Imports from Peru Cameron, LA Freeport, TX Sabine Pass, LA LNG Imports from Qatar Cameron, LA Elba Island, GA Golden Pass, TX Gulf Gateway, LA Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf Gateway, LA Gulf LNG, MS Lake Charles, LA Neptune Deepwater Port Northeast Gateway Sabine Pass, LA LNG Imports from United Arab Emirates Lake Charles, LA LNG Imports from Yemen Everett, MA Freeport, TX Neptune Deepwater Port Sabine Pass, LA LNG Imports from Other Countries Lake Charles, LA Period: Monthly Annual


U.S. LNG Imports from United Arab Emirates  

Gasoline and Diesel Fuel Update (EIA)

International Falls, MN Noyes, MN Warroad, MN Babb, MT Havre, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT North Troy, VT LNG Imports into Cameron, LA LNG Imports into Cove Point, MD LNG Imports into Elba Island, GA LNG Imports into Everett, MA LNG Imports into Freeport, TX LNG Imports into Golden Pass, TX LNG Imports into Gulf Gateway, LA LNG Imports into Gulf LNG, MS LNG Imports into Lake Charles, LA LNG Imports into Neptune Deepwater Port LNG Imports into Northeast Gateway LNG Imports into Sabine Pass, LA U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Alamo, TX El Paso, TX Galvan Ranch, TX Hidalgo, TX McAllen, TX Penitas, TX LNG Imports from Algeria Cove Point, MD Everett, MA Lake Charles, LA LNG Imports from Australia Everett, MA Lake Charles, LA LNG Imports from Brunei Lake Charles, LA LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Equatorial Guinea Elba Island, GA Lake Charles, LA LNG Imports from Indonesia Lake Charles, LA LNG Imports from Malaysia Gulf Gateway, LA Lake Charles, LA LNG Imports from Nigeria Cove Point, MD Elba Island, GA Freeport, TX Gulf Gateway, LA Lake Charles, LA Sabine Pass, LA LNG Imports from Norway Cove Point, MD Sabine Pass, LA LNG Imports from Oman Lake Charles, LA LNG Imports from Peru Cameron, LA Freeport, TX Sabine Pass, LA LNG Imports from Qatar Cameron, LA Elba Island, GA Golden Pass, TX Gulf Gateway, LA Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf Gateway, LA Gulf LNG, MS Lake Charles, LA Neptune Deepwater Port Northeast Gateway Sabine Pass, LA LNG Imports from United Arab Emirates Lake Charles, LA LNG Imports from Yemen Everett, MA Freeport, TX Neptune Deepwater Port Sabine Pass, LA LNG Imports from Other Countries Lake Charles, LA Period: Monthly Annual


U.S. LNG Imports from Algeria  

Gasoline and Diesel Fuel Update (EIA)

International Falls, MN Noyes, MN Warroad, MN Babb, MT Havre, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT North Troy, VT LNG Imports into Cameron, LA LNG Imports into Cove Point, MD LNG Imports into Elba Island, GA LNG Imports into Everett, MA LNG Imports into Freeport, TX LNG Imports into Golden Pass, TX LNG Imports into Gulf Gateway, LA LNG Imports into Gulf LNG, MS LNG Imports into Lake Charles, LA LNG Imports into Neptune Deepwater Port LNG Imports into Northeast Gateway LNG Imports into Sabine Pass, LA U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Alamo, TX El Paso, TX Galvan Ranch, TX Hidalgo, TX McAllen, TX Penitas, TX LNG Imports from Algeria Cove Point, MD Everett, MA Lake Charles, LA LNG Imports from Australia Everett, MA Lake Charles, LA LNG Imports from Brunei Lake Charles, LA LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Equatorial Guinea Elba Island, GA Lake Charles, LA LNG Imports from Indonesia Lake Charles, LA LNG Imports from Malaysia Gulf Gateway, LA Lake Charles, LA LNG Imports from Nigeria Cove Point, MD Elba Island, GA Freeport, TX Gulf Gateway, LA Lake Charles, LA Sabine Pass, LA LNG Imports from Norway Cove Point, MD Sabine Pass, LA LNG Imports from Oman Lake Charles, LA LNG Imports from Peru Cameron, LA Freeport, TX Sabine Pass, LA LNG Imports from Qatar Cameron, LA Elba Island, GA Golden Pass, TX Gulf Gateway, LA Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf Gateway, LA Gulf LNG, MS Lake Charles, LA Neptune Deepwater Port Northeast Gateway Sabine Pass, LA LNG Imports from United Arab Emirates Lake Charles, LA LNG Imports from Yemen Everett, MA Freeport, TX Neptune Deepwater Port Sabine Pass, LA LNG Imports from Other Countries Lake Charles, LA Period: Monthly Annual


U.S. Natural Gas Imports by Pipeline from Mexico  

U.S. Energy Information Administration (EIA) Indexed Site

International Falls, MN Noyes, MN Warroad, MN Babb, MT Havre, MT Port of Del Bonita, MT Port of Morgan, MT Sweetgrass, MT Whitlash, MT Portal, ND Sherwood, ND Pittsburg, NH Champlain, NY Grand Island, NY Massena, NY Niagara Falls, NY Waddington, NY Sumas, WA Highgate Springs, VT North Troy, VT LNG Imports into Cameron, LA LNG Imports into Cove Point, MD LNG Imports into Elba Island, GA LNG Imports into Everett, MA LNG Imports into Freeport, TX LNG Imports into Golden Pass, TX LNG Imports into Gulf Gateway, LA LNG Imports into Gulf LNG, MS LNG Imports into Lake Charles, LA LNG Imports into Neptune Deepwater Port LNG Imports into Northeast Gateway LNG Imports into Sabine Pass, LA U.S. Pipeline Total from Mexico Ogilby, CA Otay Mesa, CA Alamo, TX El Paso, TX Galvan Ranch, TX Hidalgo, TX McAllen, TX Penitas, TX LNG Imports from Algeria Cove Point, MD Everett, MA Lake Charles, LA LNG Imports from Australia Everett, MA Lake Charles, LA LNG Imports from Brunei Lake Charles, LA LNG Imports from Canada Highgate Springs, VT LNG Imports from Egypt Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf LNG, MS Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Equatorial Guinea Elba Island, GA Lake Charles, LA LNG Imports from Indonesia Lake Charles, LA LNG Imports from Malaysia Gulf Gateway, LA Lake Charles, LA LNG Imports from Nigeria Cove Point, MD Elba Island, GA Freeport, TX Gulf Gateway, LA Lake Charles, LA Sabine Pass, LA LNG Imports from Norway Cove Point, MD Sabine Pass, LA LNG Imports from Oman Lake Charles, LA LNG Imports from Peru Cameron, LA Freeport, TX Sabine Pass, LA LNG Imports from Qatar Cameron, LA Elba Island, GA Golden Pass, TX Gulf Gateway, LA Lake Charles, LA Northeast Gateway Sabine Pass, LA LNG Imports from Trinidad/Tobago Cameron, LA Cove Point, MD Elba Island, GA Everett, MA Freeport, TX Gulf Gateway, LA Gulf LNG, MS Lake Charles, LA Neptune Deepwater Port Northeast Gateway Sabine Pass, LA LNG Imports from United Arab Emirates Lake Charles, LA LNG Imports from Yemen Everett, MA Freeport, TX Neptune Deepwater Port Sabine Pass, LA LNG Imports from Other Countries Lake Charles, LA Period: Monthly Annual


Masato R. Nakamura, Eng.Sc.D. 420 Central Park West #1C New York, NY 10025  

E-Print Network (OSTI)

Project · Designed reactors for gasification of solid waste using Computer Aided Design (CAD) software.Sc.D), Earth and Environmental Engineering, May 2008 Stochastic simulation and integrated modeling of waste, NY Research Associate, May 2008 ­ August 2010 Solid Waste Modeling Project · Developed a 2


Highland Hospital Archives, Williams Health Sciences Library 1000 South Ave, Rochester, NY 14620 Finding Aid for the Highland Hospital Archives  

E-Print Network (OSTI)

Highland Hospital Archives, Williams Health Sciences Library 1000 South Ave, Rochester, NY 14620 Finding Aid for the Highland Hospital Archives John R. Williams Sr. Collection Box 1 Correspondence Photographs Box 2 Articles, Memos, Pamphlets Book: Writings Hahnemann Hospital Collection Box 1 Hahnemann

Goldman, Steven A.


Hindawi Publishing Corporation 410 Park Avenue,15th Floor,#287 pmb,New York,NY 10022,USA  

E-Print Network (OSTI)

Corporation 410 Park Avenue,15th Floor,#287 pmb,New York,NY 10022,USA http. Bona USA J. R. Cannon USA S.-N. Chow USA B. S. Dandapat India E. DiBenedetto USA R. Finn USA R. L. Fosdick USA J. Frehse Germany A. Friedman USA R. Grimshaw UK J. Malek Czech Republic J. T. Oden USA R

Shen, Xuemin "Sherman"

Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


DOE Challenge Home Case Study, Ferguson Design and Construction, Inc., Sagaponak, NY, Custom Home  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Ferguson Design & Ferguson Design & Construction, Inc. Sagaponack, NY BUILDING TECHNOLOGIES OFFICE DOE Challenge Home builders are in the top 1% of builders in the country meeting the extraordinary levels of excellence and quality specifi ed by the U.S. Department of Energy. Every DOE Challenge Home starts with ENERGY STAR for Homes Version 3 for an energy-effi cient home built on a solid foundation of building science research. Then, even more advanced technologies are designed in for a home that goes above and beyond current code to give you the superior quality construction, HVAC, appliances, indoor air quality, safety, durability, comfort, and solar-ready components along with ultra-low or no utility bills. This provides homeowners with a quality home that will last for generations to come.



Office of Legacy Management (LM)

? ? z _ - c 0-e . CRANE CO. 757 THIRD AVENUE NEW YORK. N.Y. THOMAS UNGERLAND ASSOCIATE GENERAL COUNSEL December 14, 1987 James J. Fiore Director Office of Nuclear Energy Department of Energy Washington, D.C. Re: Crane - Indian Orchard Dear M r. Fiore: W e acknowledge receipt of your letter to Paul Hundt, dated September 29, 1987, which requests certain information about Crane's plant site in Indian Orchard, Massachusetts. The plant is not currently operating. Crane was unable to locate any records concerning the machining of uranium in the 1947-48 period for a customer, Brookhaven Labs, at the Indian Orchard, facility. It is believed that the records, which were kept on the second floor at 305 Hamshire Street, Indian Orchard, Massachusetts were moved ten or fifteen years ago


2012 SG Peer Review - Interoperability of Demand Response Resources in New York - Andre Wellington, ConEd NY  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Interoperability of Demand Response Interoperability of Demand Response Resources in NY Andre Wellington Con Edison June 8, 2012 December 2008 Interoperability of Demand Resource Resources in NY Objective Life-cycle Funding ($M) FY08 - FY13 $6.8 million Technical Scope (Insert graphic here) Develop and demonstrate technology required to integrate customer owned resources into the electrical distribution system * Evaluate interconnection designs * Design and install thermal storage plant with enhanced capabilities * Develop AutoDR application for targeted distributed resources 2 December 2008 Needs and Project Targets Develop the technology required to integrate customer owned distributed resources into the distribution system to enable the of deferment capital investments. * Remote dispatch of customer resources



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

NEW YORK DEPARTMENT OF PUBLIC SERVICE NEW YORK DEPARTMENT OF PUBLIC SERVICE THREE EMPIRE STATE PLAZA, ALBANY, NY 12223-1350 www.dps.ny.gov PUBLIC SERVICE COMMISSIO~ PETER McGOWAN GARRY A. BROWN General Counsel Chairman PATRICIA L. ACAMPORA MAUREEN F. HARRIS JACLYN A, BRILLING ROBERT E. CURRY JR. Secretary JAMES L. LAROCCA Commissioners January 31, 2012 FILED ELECTRONICALLY @ http://energy.gov/oelcongestion-study-2012 Office of Electricity Delivery and Energy Reliability, OE-20 U.S. Department of Energy 1000 Independence Avenue, SW Washington, D.C. i0585 Re: Preparation ofthe 2012 Congestion Study Dear Sir or Madam: I am writing in response to the Notice of Regional Workshops and Request For Written Comments, 76 Federal Register No. 218, 70122 (November 10,2011). Enclosed please find the comments of


Hindawi Publishing Corporation 410 Park Avenue,15th Floor,#287 pmb,New York,NY 10022,USA  

E-Print Network (OSTI)

,15th Floor,#287 pmb,New York,NY 10022,USA http://www.hindawi.com/journals/denm/ Differential is not possible, you can contact denm.support@hindawi.com. Associate Editors N. Bellomo Italy J. L. Bona USA J. R. Cannon USA S.-N. Chow USA B. S. Dandapat India E. DiBenedetto USA R. Finn USA R. L. Fosdick USA J. Frehse

Plataniotis, Konstantinos N.


Hindawi Publishing Corporation 410 Park Avenue,15th Floor,#287 pmb,New York,NY 10022,USA  

E-Print Network (OSTI)

,NY 10022,USA http://www.hindawi.com/journals/denm/ Differential Equations & Nonlinear Mechanics Website.support@hindawi.com. Associate Editors N. Bellomo Italy J. L. Bona USA J. R. Cannon USA S.-N. Chow USA B. S. Dandapat India E. DiBenedetto USA R. Finn USA R. L. Fosdick USA J. Frehse Germany A. Friedman USA R. Grimshaw UK J. Malek Czech

Lim, Jong-Tae


420 West 118th St, New York, NY 10027 | http://energypolicy.columbia.edu | @ColumbiaUEnergy 1 June 14, 2014  

E-Print Network (OSTI)

West 118th St, New York, NY 10027 | http://energypolicy.columbia.edu | @ColumbiaUEnergy 1 June 14, 2014 the oil producing area around the giant Kirkuk field. ISIS forces occupied Mosul and reportedly control. Proven Oil Reserves billion barrels BP EIA Venezuela 298 298 Saudi Arabia 266 268 Canada 174 173 Iran 157

Qian, Ning


Presented at the 13 National Conference on Building Commissioning, May 4-6, 2005, New York, NY, and published in the Proceedings.  

E-Print Network (OSTI)

LBNL-58648 th Presented at the 13 National Conference on Building Commissioning, May 4-6, 2005, New York, NY, and published in the Proceedings. This work was supported by the State Technologies, Moosung Kim Lawrence Berkeley National Laboratory May 2005 #12;National Conference on Building


The U.S. Department of Energy's Brookhaven National Laboratory P.O. Box 5000, Upton NY 11973 631 344-2345 www.bnl.gov Nuclear Physics  

E-Print Network (OSTI)

the Office of Nuclear Physics within the U.S. Department of Energy's Office of Science, RHIC gives physicists of Nuclear Physics within the U.S. Department of Energy's Office of Science Total Upgrade Cost: $ 700 millionThe U.S. Department of Energy's Brookhaven National Laboratory · P.O. Box 5000, Upton NY 11973


2007 IEEE Workshop on Applications of Signal Processing to Audio and Acoustics October 21-24, 2007, New Paltz, NY PROBABILISTIC MODEL BASED SIMILARITY MEASURES FOR AUDIO  

E-Print Network (OSTI)

2007 IEEE Workshop on Applications of Signal Processing to Audio and Acoustics October 21-24, 2007, New Paltz, NY PROBABILISTIC MODEL BASED SIMILARITY MEASURES FOR AUDIO QUERY-BY-EXAMPLE Tuomas Virtanen This paper proposes measures for estimating the similarity of two audio signals, the objective being in query

Virtanen, Tuomas


DOE/EA-1631: Final Environmental Assessment for Department of Energy Loan Guarantee for Beacon Power Corporation Frequency Regulation Facility in Stephentown, NY (February 2009)  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

31 31 Environmental Assessment for DEPARTMENT OF ENERGY LOAN GUARANTEE FOR BEACON POWER CORPORATION FREQUENCY REGULATION FACILITY IN STEPHENTOWN, N.Y. U.S. Department of Energy Loan Guarantee Program Office Washington, DC 20585 February 2009 FINAL ENVIRONMENTAL ASSESSMENT Environmental Assessment for Department of Energy Loan Guarantee for Beacon Power Corporation Frequency Regulation Facility in Stephentown, N.Y. DOE/EA-1631 TABLE OF CONTENTS LIST OF ACRONYMS iii 1.0 PURPOSE AND NEED 1 1.1 Introduction 1 1.2 Purpose and Need for Agency Action 1 2.0 DESCRIPTION OF PROPOSED ACTION AND NO ACTION ALTERNATIVE 3 2.1 Location 3 2.2 Proposed Action 3 2.2.1 Flywheel 3 2.2.2 Project Elements 4 2.2.3 Project Systems 5 2.2.4 Construction


The U.S. Department of Energy's Brookhaven National Laboratory P.O. Box 5000, Upton NY 11973 631 344-2345 www.bnl.gov The Relativistic Heavy Ion Collider  

E-Print Network (OSTI)

The U.S. Department of Energy's Brookhaven National Laboratory · P.O. Box 5000, Upton NY 11973 RHIC colli- sions -- including photons, electrons, muons, and quark- containing particles -- using large steel magnets that surround the collision zone. · Photons, electrons, and muons are not affected


Office of Technology Transfer and Innovation Partnerships, PO Box 6000, Binghamton, NY, 13902-6000. Ph: (607) 777-5870. FORM TT-2 Revised 03/19/09 FORM TT -2  

E-Print Network (OSTI)

Office of Technology Transfer and Innovation Partnerships, PO Box 6000, Binghamton, NY, 13902-6000. Ph: (607) 777-5870. FORM TT-2 Revised 03/19/09 FORM TT - 2 Technology Transfer NEW TECHNOLOGY DISCLOSURE PLEASE SUBMIT COMPLETED FORM TO OFFICE OF TECHNOLOGY TRANSFER AND INNOVATIVE PARTNERSHIPS 1

Suzuki, Masatsugu


The U.S. Department of Energy's Brookhaven National Laboratory P.O. Box 5000, Upton NY 11973 631 344-2345 www.bnl.gov National Synchrotron Light Source II  

E-Print Network (OSTI)

The U.S. Department of Energy's Brookhaven National Laboratory · P.O. Box 5000, Upton NY 11973 · 631 344-2345 · www.bnl.gov FACTS (04-14) National Synchrotron Light Source II NSLS-II by the Numbers World's Premier SynchrotronWill Light theWay to New Discoveries Like all synchrotrons, the National

Ohta, Shigemi


2005 IEEE Workshop on Applications of Signal Processing to Audio and Acoustics October 16-19, 2005, New Paltz, NY A PROTOTYPE SYSTEM FOR OBJECT CODING OF MUSICAL AUDIO  

E-Print Network (OSTI)

2005 IEEE Workshop on Applications of Signal Processing to Audio and Acoustics October 16-19, 2005, New Paltz, NY A PROTOTYPE SYSTEM FOR OBJECT CODING OF MUSICAL AUDIO Emmanuel Vincent and Mark D coding of musical audio, and more precisely with the extraction of pitched sound objects in polyphonic

Paris-Sud XI, Université de


Table 2 -Lime use and practices on Corn, major producing states, 2001 CO GA IL IN IA KS KY MI MN MO NE NY NC ND OH PA SD TX WI Area  

E-Print Network (OSTI)

Table 2 - Lime use and practices on Corn, major producing states, 2001 CO GA IL IN IA KS KY MI MN.7 Table 2 - Lime use and practices on Corn, major producing states, 2000 CO IL IN IA KS KY MI MN MO NE NY use and practices on Corn, major producing states, 1999 CO IL IN IA KS KY MI MN MO NE NC OH SD TX WI

Kammen, Daniel M.


Microsoft Word - non-graphics title pages.doc  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

43 43 Prepared by: U.S. Department of Energy Natural Gas Imports and Exports First Quarter Report 2011 LNG LNG Japan Trinidad and Tobago Canada Yemen Egypt Mexico Peru India South Korea Norway Qatar Spain United Kingdom POINTS OF IMPORT 1. Sumas, Washington 2. Eastport, Idaho 3. Whitlash / Babb / Port of Del Bonita / Sweetgrass, Montana 4. Port of Morgan, Montana / Portal, North Dakota 5. Sherwood, North Dakota 6. Noyes / Warroad, Minnesota 7. Detroit / St. Clair / Marysville, Michigan 8. Niagara Falls / Grand Island, New York 9. Waddington, New York 10. Massena / Champlain, New York 11. Highgate Springs, Vermont 12. Pittsburg, New Hampshire 13. Calais, Maine 14. Ogilby, California 15. Alamo / Hidalgo, Texas 16. McAllen / Galvan Ranch, Texas 17. Northeast Gateway Deepwater Port 18.



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

3 3 Prepared by: U.S. Department of Energy Natural Gas Imports and Exports Fourth Quarter Report 2012 LNG LNG Japan Trinidad and Tobago Canada Mexico Qatar Brazil Norway Yemen Portugal POINTS OF IMPORT 1. Sumas, Washington 2. Eastport, Idaho 3. Whitlash / Babb / Port of Del Bonita / Sweetgrass, Montana 4. Port of Morgan, Montana / Portal, North Dakota 5. Sherwood, North Dakota 6. Noyes / Warroad, Minnesota 7. Detroit / St. Clair / Marysville, Michigan 8. Niagara Falls / Grand Island, New York 9. Waddington, New York 10. Massena / Champlain, New York 11. Highgate Springs, Vermont 12. Pittsburg, New Hampshire 13. Calais, Maine 14. Ogilby, California 15. Alamo / Hidalgo, Texas 16. McAllen / Galvan Ranch, Texas 17. Northeast Gateway Deepwater Port 18. Neptune Deepwater Port 19. Everett,



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

2 2 Prepared by: U.S. Department of Energy Natural Gas Imports and Exports Second Quarter Report 2011 LNG LNG Japan Trinidad and Tobago Canada Yemen Egypt Mexico Peru India South Korea Qatar Spain China Brazil POINTS OF IMPORT 1. Sumas, Washington 2. Eastport, Idaho 3. Whitlash / Babb / Port of Del Bonita / Sweetgrass, Montana 4. Port of Morgan, Montana / Portal, North Dakota 5. Sherwood, North Dakota 6. Noyes / Warroad, Minnesota 7. Detroit / St. Clair / Marysville, Michigan 8. Niagara Falls / Grand Island, New York 9. Waddington, New York 10. Massena / Champlain, New York 11. Highgate Springs, Vermont 12. Pittsburg, New Hampshire 13. Calais, Maine 14. Ogilby, California 15. Alamo / Hidalgo, Texas 16. McAllen / Galvan Ranch, Texas 17. Northeast Gateway Deepwater Port 18. Neptune Deepwater



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

58 58 Prepared by: U.S. Department of Energy Natural Gas Imports and Exports First Quarter Report 2012 LNG LNG Japan Trinidad and Tobago Canada Yemen Mexico Qatar Brazil Egypt Norway India POINTS OF IMPORT 1. Sumas, Washington 2. Eastport, Idaho 3. Whitlash / Babb / Port of Del Bonita / Sweetgrass, Montana 4. Port of Morgan, Montana / Portal, North Dakota 5. Sherwood, North Dakota 6. Noyes / Warroad, Minnesota 7. Detroit / St. Clair / Marysville, Michigan 8. Niagara Falls / Grand Island, New York 9. Waddington, New York 10. Massena / Champlain, New York 11. Highgate Springs, Vermont 12. Pittsburg, New Hampshire 13. Calais, Maine 14. Ogilby, California 15. Alamo / Hidalgo, Texas 16. McAllen / Galvan Ranch, Texas 17. Northeast Gateway Deepwater Port 18. Neptune Deepwater Port 19. Everett,

Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

60 60 Prepared by: U.S. Department of Energy Natural Gas Imports and Exports Second Quarter Report 2012 LNG LNG Japan Trinidad and Tobago Canada Yemen Mexico Qatar POINTS OF IMPORT 1. Sumas, Washington 2. Eastport, Idaho 3. Whitlash / Babb / Port of Del Bonita / Sweetgrass, Montana 4. Port of Morgan, Montana / Portal, North Dakota 5. Sherwood, North Dakota 6. Noyes / Warroad, Minnesota 7. Detroit / St. Clair / Marysville, Michigan 8. Niagara Falls / Grand Island, New York 9. Waddington, New York 10. Massena / Champlain, New York 11. Highgate Springs, Vermont 12. Pittsburg, New Hampshire 13. Calais, Maine 14. Ogilby, California 15. Alamo / Hidalgo, Texas 16. McAllen / Galvan Ranch, Texas 17. Northeast Gateway Deepwater Port 18. Neptune Deepwater Port 19. Everett, Massachusetts 20.



Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

4 4 Prepared by: U.S. Department of Energy Natural Gas Imports and Exports Third Quarter Report 2011 LNG LNG Japan Trinidad and Tobago Canada Yemen Mexico Nigeria Qatar China Brazil POINTS OF IMPORT 1. Sumas, Washington 2. Eastport, Idaho 3. Whitlash / Babb / Port of Del Bonita / Sweetgrass, Montana 4. Port of Morgan, Montana / Portal, North Dakota 5. Sherwood, North Dakota 6. Noyes / Warroad, Minnesota 7. Detroit / St. Clair / Marysville, Michigan 8. Niagara Falls / Grand Island, New York 9. Waddington, New York 10. Massena / Champlain, New York 11. Highgate Springs, Vermont 12. Pittsburg, New Hampshire 13. Calais, Maine 14. Ogilby, California 15. Alamo / Hidalgo, Texas 16. McAllen / Galvan Ranch, Texas 17. Northeast Gateway Deepwater Port 18. Neptune Deepwater Port 19. Everett,


FRONTCOVER (3rd Qtr 2012).pdf  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

1 1 Prepared by: U.S. Department of Energy Natural Gas Imports and Exports Third Quarter Report 2012 LNG LNG Japan Trinidad and Tobago Canada Mexico Qatar POINTS OF IMPORT 1. Sumas, Washington 2. Eastport, Idaho 3. Whitlash / Babb / Port of Del Bonita / Sweetgrass, Montana 4. Port of Morgan, Montana / Portal, North Dakota 5. Sherwood, North Dakota 6. Noyes / Warroad, Minnesota 7. Detroit / St. Clair / Marysville, Michigan 8. Niagara Falls / Grand Island, New York 9. Waddington, New York 10. Massena / Champlain, New York 11. Highgate Springs, Vermont 12. Pittsburg, New Hampshire 13. Calais, Maine 14. Ogilby, California 15. Alamo / Hidalgo, Texas 16. McAllen / Galvan Ranch, Texas 17. Northeast Gateway Deepwater Port 18. Neptune Deepwater Port 19. Everett, Massachusetts 20. Cove


FRONTCOVER (4Q11).pdf  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

6 6 Prepared by: U.S. Department of Energy Natural Gas Imports and Exports Fourth Quarter Report 2011 LNG LNG Japan Trinidad and Tobago Canada Yemen Mexico Qatar China Brazil Chile Egypt South Korea Norway POINTS OF IMPORT 1. Sumas, Washington 2. Eastport, Idaho 3. Whitlash / Babb / Port of Del Bonita / Sweetgrass, Montana 4. Port of Morgan, Montana / Portal, North Dakota 5. Sherwood, North Dakota 6. Noyes / Warroad, Minnesota 7. Detroit / St. Clair / Marysville, Michigan 8. Niagara Falls / Grand Island, New York 9. Waddington, New York 10. Massena / Champlain, New York 11. Highgate Springs, Vermont 12. Pittsburg, New Hampshire 13. Calais, Maine 14. Ogilby, California 15. Alamo / Hidalgo, Texas 16. McAllen / Galvan Ranch, Texas 17. Northeast Gateway Deepwater Port 18. Neptune Deepwater


ZERH Training Session: Syracuse, NY  

Energy.gov (U.S. Department of Energy (DOE))

The DOE Zero Energy Ready Home is a high performance home which is so energy efficient, that a renewable energy system can offset all or most of its annual energy Consumption.US DOE Zero Energy...



NLE Websites -- All DOE Office Websites (Extended Search)

Metadata also available as Metadata: IdentificationInformation DataQualityInformation SpatialDataOrganizationInformation SpatialReferenceInformation EntityandAttributeI...


Ny teknik fr smskalig kraftvrme.  

E-Print Network (OSTI)

?? As a part of the fight against the global warming the energy production needs to be more efficient and redirected towards sustainable options. One (more)

Eriksson, sa



U.S. Natural Gas Pipeline Exports by Point of Exit  

U.S. Energy Information Administration (EIA) Indexed Site

25,575 142,032 133,749 128,589 130,297 122,391 1997-2013 25,575 142,032 133,749 128,589 130,297 122,391 1997-2013 To Canada 70,735 81,695 75,846 66,473 68,325 69,733 1973-2013 Eastport, ID 6 2011-2013 Calais, ME 2,021 1,528 433 652 122 185 2011-2013 Detroit, MI 3,571 4,430 3,769 3,933 4,131 3,885 2011-2013 Marysville, MI 2,983 1,470 995 1,856 1,521 1,400 2011-2013 Sault Ste. Marie, MI 1,531 1,171 935 1,231 849 911 2011-2013 St. Clair, MI 43,917 56,075 54,114 42,609 45,524 47,795 2011-2013 Noyes, MN 76 171 316 1,331 447 445 2011-2013 Babb, MT 2011-2011 Havre, MT 184 188 174 177 183 166 2011-2013 Pittsburg, NH 2011-2013 Grand Island, NY 47 20 10 10 11 2011-2013 Massena, NY 2012-2012 Niagara Falls, NY 13,738 13,789 13,174 13,904 13,939 13,022 2011-2013 Waddington, NY


Microsoft Word - FUSRAP Colonie NY.rtf  

Office of Legacy Management (LM)

Colonie Interim Storage Site Colonie Interim Storage Site (CISS) Colonie, New York FACT SHEET Jan 2004 DESCRIPTION: The site consists of a total area of 11.2 acres plus 56 vicinity properties. The site was owned and operated by National Lead Industries (NL) from 1937-1984. The facility was used for electroplating and manufacturing various components from uranium and thorium. Radioactive materials released from the plant exhaust stacks spread to site buildings, portions of the grounds, and 56 commercial and residential vicinity properties (VPs). NL also dumped contaminated casting sand into the former Patroon Lake. The New York State Supreme Court shut down the NL plant in 1984. AUTHORIZATION/PROJECT DESCRIPTION: Responsibility for the Colonie site was assigned to the U.S. Department of Energy (DOE) as a decontamination research and development project by the U.S.


Microsoft Word - NY.17-16.doc  

Office of Legacy Management (LM)

Printed with soy ink on recycled paper Printed with soy ink on recycled paper Department of Energy Washington, DC 20585 Ms. Judith Leithner Project Manager, Buffalo District U.S. Army Corps of Engineers Department of the Army 1776 Niagara Street Buffalo, New York 14207-3199 Dear Ms. Leithner: This is in reference to the Niagara Falls Storage Site (NFSS) Vicinity Properties E', E, and G located in Lewiston, New York. In accordance with the terms of the March 1999 Memorandum of Understanding (MOU) between the Department of Energy (DOE) and the U.S. Army Corps of Engineers (U.S. ACE), DOE is in the process of completing closure documentation for several sites remediated by DOE prior to assignment of the Formerly Utilized Sites Remedial Action Program (FUSRAP) to the U.S. ACE. Under contract to the U.S. ACE (U.S. ACE Contract


Acceleration Of Wound Healing Ny Photodynamic Therapy  

DOE Patents (OSTI)

Disclosed is a method for accelerating wound healing in a mammal. The method includes identifying an unhealed wound site or partially-healed wound site in a mammal; administering a photosensitizer to the mammal; waiting for a time period wherein the photosensitizer reaches an effective tissue concentration at the wound site; and photoactivating the photosensitizer at the wound site. The dose of photodynamic therapy is selected to stimulate the production of one or more growth factor by cells at the wound site, without causing tissue destruction.

Hasan, Tayyaba (Arlington, MA); Hamblin, Michael R. (Revere, MA); Trauner, Kenneth (Sacramento, CA)



Offshore Wind in NY State (New York)  

Energy.gov (U.S. Department of Energy (DOE))

NYSERDA has expressed support for the development of offshore wind and committed funding to several publicly-available assessments that measure the potential energy benefits and environmental...


Projection Radiography Polytechnic University, Brooklyn, NY 11201  

E-Print Network (OSTI)

­ Compensation and Scatter control ­ Film screen detector · Image formation ­ Geometric effect ­ Extended source: · The produced x-ray power Px (in[W]) is given by: ­ Material constant k = 1.1?10-9 for Tungsten (Z=74). 2 tube P kZ V = = = = = Electrical power consumption of tube: Ptube = Itube ? Vtube [W] [From Graber

Suel, Torsten


PO Box 5786 Ithaca, NY 148525786  

E-Print Network (OSTI)

a case of "kennel cough", a single serum sample can determine whether the animal has been infected that cough are not infected with canine influenza virus. The standard respirato ry pathogens of dogs have

Keinan, Alon


Seneca Army Depot EPA ID#: NY0213820830  

E-Print Network (OSTI)

addressed through removal actions, investigations and remedial actions. Response Action Status Ash Landfill conservation/ recreation. The Final Remedial Investigation (RI) Report was completed in June 1994. The removal additional continuous reactive walls to remediate the VOCs in groundwater. A Record of Decision (ROD


Caldwell Hall Ithaca, NY 14853-2602  

E-Print Network (OSTI)

graphics building technology and environmental science Architecture [M.Arch. professional] architecture applied econometrics and quantitative analysis economics of development environmental management (M Resource Economics [M.S., Ph.D., M.P.S.(A.L.S.)] environmental economics resource economics APPLIED

Angenent, Lars T.


E-Print Network 3.0 - atmospheric pressure interface Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

dynamically induced horizontal static pressure gradients at the surface-atmosphere interface (Waddington et al... role of pressure pumping due to atmospheric pressure...


Microsoft Word - NY17-15 01-50.rtf  

Office of Legacy Management (LM)

OR/20722-84 OR/20722-84 Formerly Utilized Sites Remedial Action Program (FUSRAP) Contract No. DE-ACO5-810R20722 POST-REMEDIAL ACTION REPORT FOR THE NIAGARA FALLS STORAGE SITE VICINITY PROPERTIES - 1983 AND 1984 Lewiston, New York December 1986 Bechtel National, Inc. This report was prepared as an account of work sponsored by the United States Government. Neither the United States nor the United States Department of Energy, nor any of their employees, nor any of their contractors, subcontractors, or their employees, makes any warranty, express or implied, or assumes any legal liability or responsibility for the accuracy, completeness or usefulness of any information, apparatus, product disclosed, or represents that its use would not infringe privately owned rights.


Methane Gas Utilization Project from Landfill at Ellery (NY)  

SciTech Connect

Landfill Gas to Electric Energy Generation and Transmission at Chautauqua County Landfill, Town of Ellery, New York. The goal of this project was to create a practical method with which the energy, of the landfill gas produced by the decomposing waste at the Chautauqua County Landfill, could be utilized. This goal was accomplished with the construction of a landfill gas to electric energy plant (originally 6.4MW and now 9.6MW) and the construction of an inter-connection power-line, from the power-plant to the nearest (5.5 miles) power-grid point.

Pantelis K. Panteli



1714(1) Winter 2006 Yellowstone Science NY ECOSYSTEM  

E-Print Network (OSTI)

;Yellowstone Science 14(1) · Winter 200618 photosynthetic members supplying energy to others. However, while in any of these ecosystems. One of the most important of these exchanged materials is energy. When we walk around the GYE, the energy source for the richness of life we can see is appar- ent

Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


GE Global Research, Niskayuna, NY | GE Global Research  

NLE Websites -- All DOE Office Websites (Extended Search)

to develop applications supporting renewable power generation, grid technologies, electric drives, power distribution and controls Software Sciences & Analytics brings...


Physics of Radiography Polytechnic University, Brooklyn, NY 11201  

E-Print Network (OSTI)

an electron accelerated through an X-ray tube where the anode if made of tungsten. If the anode is held at 120 will have 120 KeV kinetic energy when reaching the anode, by definition of eV ­ The average binding energy

Suel, Torsten



SciTech Connect

We have investigated the feasibility of using natural attenuation methods for ecosystem restoration in New York/New Jersey Harbor. Measurements were made of the most probable number of sulfate-reducing bacteria (SRB) in native sediments and in samples, which had been supplemented with an appropriate electron donor and electron acceptor. The results showed that the activity of the endogenous microbial population in the native sediment was high enough to make possible adequate chemical transformation rates. The bioavailability of the zinc in the sediments was measured using the BIOMET biosensor technique. The bioavailability of the zinc was effectively eliminated following the microbial activities. We concluded that natural attenuation could be used effectively in treating sediments from Newark Bay and surrounding waters and that the resultant materials could likely be used in environmental restoration projects of the type proposed for construction in South Kearny, NJ.




Hadron Collider Physics XII 511 June 1997, Stony Brook, NY  

E-Print Network (OSTI)

that cover different ranges of pseudorapidity, out to j = 4:2. D0 features a uniform design of depleted uranium and liquid argon calorimetry. The segmentation in j \\Gamma OE is 0:1 \\Theta 0:1, but the third




E-Print Network (OSTI)

Plan ____________________________________________________ 14 Cornell University Fire Safety Plan including programs in: Fire Protection, Emergency Services, Emergency Management o Fire Protection Services o Research and Laboratory Safety o Chemical Safety o Radiation Safety o Biological Safe

Chen, Tsuhan


Stephen E. Schwartz Brookhaven National Laboratory Upton NY 11973  

E-Print Network (OSTI)

@bnl.govhttp://www.ecd.bnl.gov/steve DEFINING AND QUANTIFYING FEEDBACKS IN EARTH'S CLIMATE SYSTEM American Geophysical Union, Fall Meeting, 2008 of shortwave and longwave feedbacks. #12;CLIMATE SENSITIVITY ESTIMATES THROUGH THE AGES Estimates of central power: Q J= 1 4 S JS is solar constant is planetary coalbedo Longwave emitted power: E T= s 4 = 0

Schwartz, Stephen E.


Dept. of Applied Physics and Applied Math, Columbia University. NY, NY 10027. 212-854-4496 Web-site: http://depts.washington.edu/ufa/home.html  

E-Print Network (OSTI)

-site: http://depts.washington.edu/ufa/home.html 16 February 2006 Fusion Energy Science Research: Burning-step towards the development of fusion energy as a major new source of non-carbon based energy for our nation innovative confinement experiments and theory programs, university-based fusion science researchers provide


Richard DeBlasio - Research Fellow | NREL  

NLE Websites -- All DOE Office Websites (Extended Search)

NV. DeBlasio, R.; Waddington, D.; Mrig, L."Outdoor Performance and Stability Testing of Thin Film Devices." (1987). Solar Cells (21); pp. 343-351. DeBlasio, R.; Hogan, S.J....


Funding for state, city, and county governments in the state includes:  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

NY NY New York Total Sum City, County, and SEO Allocations All $175,122,300 NY New York State Energy Office $29,760,600 NY Albany City $1,104,000 NY Amherst City $1,052,700 NY Babylon City $1,545,200 NY Binghamton City $204,200 NY Brookhaven City $4,141,200 NY Buffalo City $2,736,900 NY Cheektowaga City $718,800 NY Clarkstown City $751,300 NY Clay City $515,100 NY Clifton Park City $149,200 NY Colonie City $661,900 NY Freeport City $173,100 NY Greece City $831,900 NY Greenburgh City $186,000 NY Hamburg City $187,300 NY Hempstead City $4,577,700 NY Hempstead City $479,800 NY Henrietta City $213,700 NY Huntington City $1,725,200 NY Irondequoit City $440,000 NY Islip City $3,026,100 NY


Self-Assembling DoxorubicinTocopherol Succinate Prodrug as a New Drug Delivery System: Synthesis, Characterization, and in Vitro and in Vivo Anticancer Activity  

Science Journals Connector (OSTI)

Gong, X., Moghaddam, M. J., Sagnella, S. M., Conn, C. E., Danon, S. J., Waddington, L. J., and Drummond, C. J. ( 2011) Lyotropic liquid crystalline self-assembly material behavior and nanoparticulate dispersions of a phytanyl pro-drug analogue of capecitabine-a chemotherapy agent ACS Appl. ... Gong, Xiaojuan; Moghaddam, Minoo J.; Sagnella, Sharon M.; Conn, Charlotte E.; Danon, Stephen J.; Waddington, Lynne J.; Drummond, Calum J. ...

Nicolas Duhem; Fabienne Danhier; Vincent Pourcelle; Jean-Marc Schumers; Olivier Bertrand; Ccile S. LeDuff; Stephanie Hoeppener; Ulrich S. Schubert; Jean-Franois Gohy; Jacqueline Marchand-Brynaert; Vronique Prat



Microsoft Word - Remedial Action Program Update.rtf  

Office of Legacy Management (LM)

District Sites Niagara Falls Storage Site Lewiston, NY Ashland 1, Tonawanda, NY Linde Air Products, Tonawanda, NY Seaway Industrial Park, Tonawanda, NY Former Harshow Chemical...


File:EIA-Appalach1-NY-LIQ.pdf | Open Energy Information  

Open Energy Info (EERE)

LIQ.pdf LIQ.pdf Jump to: navigation, search File File history File usage Appalachian Basin, New York Area Oil and Gas Fields By 2001 Liquids Reserve Class Size of this preview: 776 × 600 pixels. Full resolution ‎(6,600 × 5,100 pixels, file size: 12.86 MB, MIME type: application/pdf) Description Appalachian Basin, New York Area Oil and Gas Fields By 2001 Liquids Reserve Class Sources Energy Information Administration Authors Samuel H. Limerick; Lucy Luo; Gary Long; David F. Morehouse; Jack Perrin; Robert F. King Related Technologies Oil, Natural Gas Creation Date 2005-09-01 Extent Regional Countries United States UN Region Northern America States New York File history Click on a date/time to view the file as it appeared at that time. Date/Time Thumbnail Dimensions User Comment


222 Rachel Carson Way Laura Alexandra Russo Comstock Hall Ithaca, NY 14850 Cornell University  

E-Print Network (OSTI)

PUBLICATIONS: Submitted or in preparation Russo, L, Miller, A, Bjornstad, O, Tooker, J, and Shea, K. "The." submitted Marins, A, Costa, D, Russo, L, Campbell, C, Bjornstad, O, and Shea, K. "The role of mound size

Danforth, Bryan Nicholas


Scott M. Kaufman US Project Manager The Carbon Trust Brooklyn, NY January 2009 -present  

E-Print Network (OSTI)

. Helped design and install small-scale composting units at institutions in NYC. Taught 7 week course partner cities. Manager, Manhattan Compost Program NYC Dept. of Sanitation / The New York Botanical


Asteroid 2002NY40 as a source of meteorite-dropping bolides  

Science Journals Connector (OSTI)

......initial mass) for being convinced about its landing. In any case, no meteorites have yet...2006, Meteor Showers and Their Parent Comets. Cambridge University Press, Cambridge...Terentjeva A. , 1989, Asteroids, Comets Meteors III. Uppsala Astronomical Observatory......

Josep M. Trigo-Rodrguez; Esko Lyytinen; Daniel C. Jones; Jos M. Madiedo; Alberto J. Castro-Tirado; Iwan Williams; Jordi Llorca; Stanislav Vtek; Martin Jelnek; Blanca Troughton; Francisco Glvez



Magnetic measurements of recent sediments from Big Moose Lake, Adirondack Mountains, N.Y., USA  

Science Journals Connector (OSTI)

Measurements of anhysteretic (ARM) and isothermal (IRM) remanences in cores 6 and 8 from Big Moose Lake reveal evidence for changes in magnetic mineralogy and grain size within and between the two cores. It is...

Frank Oldfield



Wastetoenergy an important topic to explore Albany Times Union Albany NY  

E-Print Network (OSTI)

and technology will solve our waste and energy problems, create new jobs, and help us to reduce our reliance U.S. energy independence in his Aug. 25 letter. However he didn't focus on our municipal solid wastes. Each ton of that waste has the energy of about a barrel of oil. Clean wastetoenergy

Columbia University


Cognitive Architectures and Multi-Agent Social Rensselaer Polytechnic Institute, Troy, NY 12180, USA  

E-Print Network (OSTI)

Cognitive Architectures and Multi-Agent Social Simulation Ron Sun Rensselaer Polytechnic Institute, a cognitive architecture is a domain-generic computational cognitive model that may be used for a broad analysis of cognition and behavior. Cognitive architectures embody theories of cognition in computer

Varela, Carlos


Differentially Private Kalman Filtering Jerome Le Ny and George J. Pappas  

E-Print Network (OSTI)

in emerging applications such as smart grids or intelligent transportation systems, where users continuously- preserving traffic monitoring system. I. INTRODUCTION In many applications, such as smart grids, population studies the H2 (Kalman) filtering problem in the situation where a signal estimate must be constructed

Pappas, George J.


Differentially Private Kalman Filtering Jerome Le Ny and George J. Pappas  

E-Print Network (OSTI)

in emerging applications such as smart grids or intelligent transportation systems, where users continuously monitoring system. I. INTRODUCTION Many large-scale systems, such as smart grids, pop- ulation health studies the H2 (Kalman) filtering problem in the situation where a signal estimate must be constructed

Pappas, George J.

Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Investigators Agree N.Y. Blackout of 1977 Could Have Been Avoided  

Science Journals Connector (OSTI)

...management, with mining, oil and gas development, and construction of...classifications not constrain mining and oil and gas development. To take the 0036-8075...training pro-grams, provided all its gas turbines with remote-start capabilities for...





E-Print Network (OSTI)

as energy) of routing measure- ments and the resulting inference performance at the fusion center at intermediate nodes in a cost-efficient manner, and yet provide guaranteed inference performance at the fusion-Collecting Data Fusion for Cost-Performance Tradeoff in Distributed Inference Animashree Anandkumar, Meng Wang

Anandkumar, Animashree


Ny stamstation i Yttermalung fr anslutning av vindkraft; New Substation in Yttermalung to Connect Wind Farms.  

E-Print Network (OSTI)

?? Since 2004, wind power has had the largest installation of new capacity compared to other energy sources in Sweden. Accommodating new wind power may (more)

Wstljung, Martin




E-Print Network (OSTI)

-deep drilling program and landmark compromise on the Clean Coal Program to ensure that it actually leads to true


Dental radiographic exposure normalization program (DENT). The experience in Nassau County, NY  

SciTech Connect

A Federally sponsored program for reducing unnecessary exposures from dental radiographic procedures is monitored over four years. The results are encouraging.

Goren, A.D.; Sciubba, J.J.; Moskowitz, G.W.; Mehta, S.; Theesfeld, R.L.



GE Teams with NY College to Pilot SOFC Technology |GE Global...  

NLE Websites -- All DOE Office Websites (Extended Search)

Hudson Valley Community College to Pilot GE Solid Oxide Fuel Cell Technology Hudson Valley Community College to Pilot GE Solid Oxide Fuel Cell Technology GE - Fuel Cells to install...


Nov/Dec 2011 ListProc Newsletter Employee Safety NY Pumpkin Pollination Infant Bot, Again  

E-Print Network (OSTI)

in the Clouds Bee School Nuisance Beekeeping Small Hive Beetle Pub Behavior potential early honey flows. Early spring plants became spring plants and provided food for the bees later federal and state regulations? Will you be dealing with certified farmer markets or county health boards

Ferrara, Katherine W.


NiCoForm, Inc., Rochester, NY, and the Alliance for  

E-Print Network (OSTI)

stampers for low cost pro- duction of micro-fluidics and micro-optics devices. Electroplating the alloy, such as optical gratings, to those of hundreds of microns, e.g., micro-fluidic channels. The channels and optical and lines embossed into a plastic substrate for micro-fluidic applications. JGSM student team works

Danforth, Bryan Nicholas


54 Lomb Memorial Drive, Rochester, NY 146235603 Co-op/Internship in Advanced Imaging Detector  

E-Print Network (OSTI)

in utilizing SILVACO for process simulation and device modeling. Additional course work in mathematics

Figer, Donald F.


Ranjith K. Annepu 3149 Broadway, Apt 6, New York, NY, 10027  

E-Print Network (OSTI)

-India into a self sustaining and successful organization. Sustainable Solid Waste Management in India - Developed


Thermal sludge dryer demonstration: Bird Island Wastewater Treatment Plant, Buffalo, NY. Final report  

SciTech Connect

The Buffalo Sewer Authority (BSA), in cooperation with the New York State Energy Research and Development Authority (Energy Authority), commissioned a demonstration of a full scale indirect disk-type sludge dryer at the Bird Island Wastewater Treatment Plant (BIWWTP). The purpose of the project was to determine the effects of the sludge dryer on the sludge incineration process at the facility. Sludge incineration is traditionally the most expensive, energy-intensive unit process involving solids handling at wastewater treatment plants; costs for incineration at the BIWWTP have averaged $2.4 million per year. In the conventional method of processing solids, a series of volume reduction measures, which usually includes thickening, digestion, and mechanical dewatering, is employed prior to incineration. Usually, a high level of moisture is still present within sewage sludge following mechanical dewatering. The sludge dryer system thermally dewaters wastewater sludge to approximately 26%, (and as high as 38%) dry solids content prior to incineration. The thermal dewatering system at the BIWWTP has demonstrated that it meets its design requirements. It has the potential to provide significant energy and other cost savings by allowing the BSA to change from an operation employing two incinerators to a single incinerator mode. While the long-term reliability of the thermal dewatering system has yet to be established, this project has demonstrated that installation of such a system in an existing treatment plant can provide the owner with significant operating cost savings.




SUNFLOWER SEEDLING DAYLENGTH RESPONSE H. Chris Wien, Dept. of Horticulture, Cornell University, Ithaca, NY 14853  

E-Print Network (OSTI)

SUNFLOWER SEEDLING DAYLENGTH RESPONSE H. Chris Wien, Dept. of Horticulture, Cornell University Premier Lemon 35 80 44 62 ESD Premier Light Yellow 39 95 45 63 ESD Procut Apricot Lite 106 113 62 64 DN

Pawlowski, Wojtek



SciTech Connect

Sediments found in the New York/New Jersey Harbor are widely contaminated with organic and inorganic compounds of anthropogenic origin. As a result, the environmental health of the Harbor has deteriorated and the efficient operation of the Port compromised by difficulties in disposing of sediments resulting from maintenance and improvements of navigational channels. Knowledge of the properties of the sediments on a micro-scale is useful in understanding the transport of contaminants through the environment, for developing effective methods for sediment decontamination, and for subsequent beneficial use of the cleaned sediments. We have investigated several properties of these sediments using synchrotron radiation techniques. These include computed microtomography using absorption and fluorescence contrast mechanisms, x-ray microscopy, microbeam x-ray fluorescence, and Fourier Transform Infrared Spectroscopy (FTIR) for measurements of microstructure, distribution of metals on individual sediment particles, and chemical forms of the contaminants on a micrometer scale. Typical results obtained with these techniques are presented.




BuildSmart NY Innovators Summit Offers Sneak Peek at Better Buildings Challenge Solutions to Come  

Energy.gov (U.S. Department of Energy (DOE))

As the newest state partner in the Better Buildings Challenge, New York is off to an impressive start. New York is committed to making its entire portfolio of buildings 20% more efficient by 2020.


EIS-0003: Proton-Proton Storage Accelerator Facility (Isabelle), Brookhaven National Laboratory, Upton, NY  

Energy.gov (U.S. Department of Energy (DOE))

The U.S. Department of Energy developed this EIS to analyze the significant environmental effects associated with construction and operation of the ISABELLE research facility to be built at Brookhaven National Laboratory.


Creating the city : toward 21st-century production in Brooklyn, NY  

E-Print Network (OSTI)

In the past decade, the creative city discourse has pulsated with activity, with academics, policy wonks, national organizations, and community non-profits attempting to find footholds in the conversation. By applying the ...

Chung, Connie Jean



Revving up Energy Efficiency at the Cummins Plant in Jamestown, NY  

Office of Energy Efficiency and Renewable Energy (EERE)

Better Buildings, Better Plants Challenge partner, Cummins Inc., is recognized for achieving 33% energy savings as a result of infrastructure upgrades and a new 2 MW solar rooftop


Stratigraphy, structural geology and metamorphism of the Inwood Marble Formation, northern Manhattan, NYC, NY  

E-Print Network (OSTI)

of recrystallized dolomite and subordinate calcite marble the Inwood Marble was used for quarrying and mineral of northern Manhattan and by the late 1700s commercial quarries were in full operation. This work continued

Merguerian, Charles


Phenomenological modelling of viscoplasticity Mechanics of Materials Laboratory, Rensselaer Polytechnic Institute, Troy, NY 12180-3590,  

E-Print Network (OSTI)

331 Phenomenological modelling of viscoplasticity E. Krempl Mechanics of Materials Laboratory. - The essentials of phenomenological modeling of metal deformation behavior at small strain are introduced together interpreted from a materials science viewpoint are re-analyzed from a phenomenological point of view

Paris-Sud XI, Université de


File:EIA-Appalach1-NY-GAS.pdf | Open Energy Information  

Open Energy Info (EERE)

GAS.pdf GAS.pdf Jump to: navigation, search File File history File usage Appalachian Basin, New York Area Oil and Gas Fields By 2001 Gas Reserve Class Size of this preview: 776 × 600 pixels. Full resolution ‎(6,600 × 5,100 pixels, file size: 12.75 MB, MIME type: application/pdf) Description Appalachian Basin, New York Area Oil and Gas Fields By 2001 Gas Reserve Class Sources Energy Information Administration Authors Samuel H. Limerick; Lucy Luo; Gary Long; David F. Morehouse; Jack Perrin; Robert F. King Related Technologies Oil, Natural Gas Creation Date 2005-09-01 Extent Regional Countries United States UN Region Northern America States New York File history Click on a date/time to view the file as it appeared at that time. Date/Time Thumbnail Dimensions User Comment

Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


DOE Zero Energy Ready Home Case Study: AquaZephyr, Ithaca, NY...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

of an energy-efficient cooperative. The homes have very simple designs and achieve the Passive House Standard with double-stud walls filled with R-22 closed-cell spray foam plus...


Investigators Agree N.Y. Blackout of 1977 Could Have Been Avoided  

Science Journals Connector (OSTI)

...vul-nerable overhead lines, and taken doz-ens...cor-poration to operate transmission lines in the state. The State...lightning bolts hit transmission circuits and knocked...Reorganization Panel Says Federal Data Processing Is Lagging...




E-Print Network 3.0 - aloe glycoprotein ny945 Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

of Jerusalem Collection: Biotechnology ; Biology and Medicine 15 Mini-Review Facing extremes: archaeal surface-layer (glyco)proteins Summary: Mini-Review Facing extremes:...


School of Civil & Environmental Engineering -Graduate (Not including Engineering Management)  

E-Print Network (OSTI)

Engineer New York City NY MENG Entergy Civil/Structural Engineer Buchanan NY MENG Environmental Science

Lipson, Michal



Gasoline and Diesel Fuel Update (EIA)

Table. 11 Summary of U.S. Natural Gas Exports By Point of Exit, 1998-2002 (Volumes in Million Cubic Feet, Prices in Dollars per Thousand Cubic Feet) Imports and Exports - Table 11 Pipeline (Canada) East Port, ID.............. NA NA NA NA NA NA NA NA 176 4.40 Detroit, MI.................. 24,908 2.26 25,049 2.30 36,007 3.74 35,644 4.57 7,431 3.03 Marysville, MI ............ 3,377 2.17 691 2.47 5,320 2.91 3,651 3.92 NA NA St. Clair, MI ............... 11,397 2.23 11,258 2.51 29,654 3.73 122,293 3.82 164,084 3.42 Noyes, MN ................ NA NA NA NA NA NA NA NA 71 1.99 Babb, MT................... NA NA NA NA NA NA 549 3.55 143 2.28 Havre, MT ................. NA NA 1,510 2.05 1,606 3.25 2,428 3.40 15,892 2.74 Port of Morgan, MT ... NA NA NA NA NA NA NA NA 1 3.47 Niagara Falls, NY ...... NA NA NA NA NA NA 594 2.49 39 5.04 Sumas, WA ............... 208 2.80 NA NA NA NA 1,529 4.44 1,477 2.59 Total..........................


Evolution of alphaviruses in the eastern equine encephalomyelitis complex.  

Science Journals Connector (OSTI)

...N.Y. North Carolina Tennessee Mississippi Michigan Connecticut Maryland Maryland Onandaga County, N.Y. Onandaga County, N.Y. Oneida County, N.Y. Oswego County, N.Y. Oswego County, N.Y. Oswego County, N.Y. Suffolk County...

S C Weaver; A Hagenbaugh; L A Bellew; L Gousset; V Mallampalli; J J Holland; T W Scott



2012 SG Peer Review - Recovery Act: Secure Interoperable Open Smart Grid Demonstration Project - Tom Magee, ConEd NY  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Demonstration Project Demonstration Project Patricia Robison Con Edison June 8, 2012 December 2008 Smart Grid Demonstration Project Objective Life-cycle Funding FY10 - FY13 $45.4 m Technical Scope (Insert graphic here) 2 *Integrate Legacy and Smart Grid information systems *Integrate external DR into distribution grid systems: - EV/Battery storage - Building Management Systems (BMS) - Standby generation - Photovoltaic Demonstrate secure interoperable services between utility distribution systems and customer owned distributed resources (DR) December 2008 Needs and Project Targets Integrate customer owned resources into distribution operations to enable customer participation and defer capital investment *Integrate DR resources into operator platform *Implement secure communications to DR resources


NY/NJ distributed wind power field verification project. Quarterly report for the period November - December 1999  

SciTech Connect

This report details the Significant Accomplishments for this quarter. The accomplishments are: (1) began preparations for host site installations; and (2) data acquisition system installation at the National Wind Technology Center (NWTC) near Boulder, CO.

Putnam, Robert Jr.



Rensselaer Polytechnic Institute 110 8th Street Public Safety and Parking Access Building | Troy, NY 12180 USA .  

E-Print Network (OSTI)

Liquor Law Referral 40 127 69 2 0 0 0 0 0 41 127 69 Drug Law Arrest 0 0 0 0 0 0 0 0 0 0 0 0 Drug Law Referral 8 17 13 0 0 0 0 0 0 8 17 13 Illegal Weapons Arrest 0 0 0 0 0 0 0 0 0 0 0 0 Illegal Weapons Referral 0 0 0 0 0 0 0 0 0 0 0 0 HATE CRIME STATISTICS When a hate crime is reported, it will be identified

Varela, Carlos


Fjrrvrme - ny lokalisering av kraftvrme i Enkping; District Heating - New Localisation of a CHP Plant in Enkping.  

E-Print Network (OSTI)

?? The municipality of Enkping is presently working out a new layout plan for the town of Enkping and new residences are planned in the (more)

Katarina, Nilsson



Newly Discovered Ophiolite Scrap in the Hartland Formation of Midtown Charles Merguerian, Geology Department, 114 Hofstra University, Hempstead, NY 11549  

E-Print Network (OSTI)

, and antigorite together with amphiboles, chlorite, brucite, magnesite, talc, calcite, and relict chromite

Merguerian, Charles


Adhesion and Chaining of Magnetic Particles K. German, H. Mizes, L. Belkhir and R. Lewis, Xerox Corporation, Webster, NY 14580  

E-Print Network (OSTI)

field gradient. For our model magnetic system, the field lines emanate from the north poles and loop with the magnetic field lines. This effect is shown in figure 2. Initially (a), the chain stands erect over, but instead are fanned of chains of magnetizable particles placed into a magnetic field. The chains fonn


Nitrogen Doping and Thermal Stability in HfSiOxNy Studied by Photoemission and X-ray Absorption Spectroscopy  

SciTech Connect

We have investigated nitrogen-doping effects into HfSiO{sub x} films on Si and their thermal stability using synchrotron-radiation photoemission and x-ray absorption spectroscopy. N 1s core-level photoemission and N K-edge absorption spectra have revealed that chemical-bonding states of N-Si{sub 3-x}O{sub x} and interstitial N{sub 2}-gas-like features are clearly observed in as-grown HfSiO{sub x}N{sub y} film and they decrease upon ultrahigh vacuum (UHV) annealing due to a thermal instability, which can be related to the device performance. Annealing-temperature dependence in Hf 4f and Si 2p photoemission spectra suggests that the Hf-silicidation temperature is effectively increased by nitrogen doping into the HfSiO{sub x} although the interfacial SiO{sub 2} layer is selectively reduced. No change in valence-band spectra upon UHV annealing suggests that crystallization of the HfSiO{sub x}N{sub y} films is also hindered by nitrogen doping into the HfSiO{sub x}.

Toyoda, Satoshi; Okabayashi, Jun; Takahashi, Haruhiko; Oshima, Masaharu; /Tokyo U.; Lee, Dong-Ick; Sun, Shiyu; sun, Steven; Pianetta, Piero A.; /SLAC, SSRL; Ando, Takashi; Fukuda, Seiichi; /SONY, Atsugi




E-Print Network (OSTI)

in Cognitive Neuroscience Concepts and principles in the analysis of brain networks Gagan S. Wig,1 Bradley L. Louis, MO 63110. gwig@npg.wustl.edu The brain is a large-scale network, operating at multiple levels of information processing ranging from neurons, to local circuits, to systems of brain areas. Recent advances


THE 2009 CUT FLOWER TRIALS H.C. Wien, Department of Horticulture, Cornell University, Ithaca, NY 14853  

E-Print Network (OSTI)

a solarpowered landscape light with 6 LED's, or a 9 watt fluorescent bulb powered by the electric grid. Light

Pawlowski, Wojtek


Recycling flows in eMergy evaluation: A Mathematical Paradox? N.Y. Amponsah, O. Le Corre1  

E-Print Network (OSTI)

37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 Recycling involving recycling or reuse of waste. If waste exergy (its residual usefulness) is not negligible, wastes could serve as input to another process or be recycled. In cases of continuous waste recycle or reuse

Paris-Sud XI, Université de


Please return completed form to: Siena College Health Service 515 Loudon Road, Loudonville, NY 12211 SIENA COLLEGE HEALTH RECORD  

E-Print Network (OSTI)

Seizure Disorder Thyroid Disorder Cancer Asthma Diabetes Pneumonia Sickle Cell/ Sickle Cell Trait Heart# ______________________________________________________________________________________________________________________________ (AREA CODE) HOME TEL. NUMBER (AREA CODE) CELL NUMBER ______________________________________________________________________________________________________________________________ If there was a campus emergency, who would you call? EMERGENCY CONTACT: NAME/RELATIONSHIP (AREA CODE) CELL NUMBER



E-Print Network (OSTI)

to passivate the phosphorous-diffused emitter at the front. The passivation of these SiNx films deposited



E-Print Network (OSTI)

of Palau, P. subniger of the Mascarenes, and P. brunneus of coastal north-eastern Australia as flying Islands, New Zealand, Lord Howe Island, Guam, the Marianas, Palau, and the Carolines (Flannery, 1995

Mathis, Wayne N.


ANDRS ESTRADA WIECHERS 435 W 119th st. 10H New York, NY 10027 +1 (347) 599-4982  

E-Print Network (OSTI)

- CONACYT Scholarship - COMECYT Scholarship 2012 - Solar water heating system installation 2011 (Federal Environmental Protection Agency) Social Service: Industrial Inspection Department Assist ENGINEERING (Ingeniería Ambiental S.A. de C.V.) Design and construct electrical control panels for pumping

Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Assessment of microbial processes on radionuclide mobility in shallow land burial. [West Valley, NY; Beatty, Nevada; Maxey Flats, Kentucky  

SciTech Connect

The impact of microbial metabolism of the organic substituents of low level radioactive wastes on radionuclide mobility in disposal sites, the nature of the microbial transformations involved in this metabolism and the effect of the prevailing environmental parameters on the quantities and types of metabolic intermediates accumulated were examined. Since both aerobic and anaerobic periods can occur during trench ecosystem development, oxidation capacities of the microbial community in the presence and absence of oxygen were analyzed. Results of gas studies performed at three commercial low level radioactive waste disposal sites were reviewed. Several deficiencies in available data were determined. Further research needs are suggested. This assessment has demonstrated that the biochemical capabilities expressed within the low level radioactive waste disposal site are common to a wide variety of soil bacteria. Hence, assuming trenches would not be placed in sites with such extreme abiotic conditions that all microbial activity is precluded, the microbial populations needed for colonization and decomposition of the organic waste substances are readily provided from the waste itself and from the soil of existing and any proposed disposal sites. Indeed, considering the ubiquity of occurrence of the microorganisms responsible for waste decomposition and the chemical nature of the organic waste material, long-term prevention of biodecomposition is difficult, if not impossible.

Colombo, P.; Tate, R.L. III; Weiss, A.J.



A corporate fitness center : an example for the reuse of the Empire Stores, Brooklyn, N.Y.  

E-Print Network (OSTI)

The proliferation of over 500 fitness programs for the employees of American corporations marks a turning point for the way American corporations regard employee and corporate health. Typically, sports facilities were the ...

Georgopulos, Diane Theodora



New York Times Magazine Tomorrow's NY Times Magazine article (The Civil Heretic) on Freeman Dyson includes an  

E-Print Network (OSTI)

they continue to build coal plants and even investigate unconventional fossil fuels and coal-to-liquids. I because they fear the advice will be "stop building coal plants now!" These governments are all guilty starting price (on oil, gas and coal at the mine or port of entry) equivalent to $1/gallon gasoline ($115

Hansen, James E.



E-Print Network (OSTI)

inflammatory and oxidative processes are highlighted. Finally, the utility of oxylipin metabolic profiling death.1 Inflammation and oxidative stress in the CF RT The interrelated RT pathobiology of CF involves to the pro-oxidant status of the CF RT. Although active RT oxidative processes represent a w

Hammock, Bruce D.



E-Print Network (OSTI)

into account the potential risks of climate change on the city's water supply, drainage, and wastewater Panel on Climate Change 2010 Report Chapter 1: New York City adaptation in context Cynthia Rosenzweig1.3 Current actions in New York City 1.4 National and global climate change adaptation initiatives 1.5 Keys


Eleanor J. Blitzer Cornell University 3126 Comstock Hall Ithaca, NY 14853 510.590.7702 ejb278@cornell.edu  

E-Print Network (OSTI)

field and lab research projects testing direct and indirect interactions in leafminer-parasitoid systems and 5 academic institutions PRESENTATIONS "Ecology of Interactions ­ direct and indirect competition 2007 Testing apparent competition in a leafminer-parasitoid system National Science Foundation, $90

Danforth, Bryan Nicholas


Fitch Rates University of Rochester, NY's Revs 'AA-'; Outlook Stable Ratings 11 Aug 2011 6:24 PM (EDT)  

E-Print Network (OSTI)

market share, strong financial metrics, growing volumes and status as a sole provider of higher acuity as of March 2011 (9 months interim results), reflect UR's continued ability to weather a difficult economic

Portman, Douglas


Ny tenkning med gammel teknologi GrsteinVed hjelp av en bitte liten bit av silisium og aluminium  

E-Print Network (OSTI)

banebrytende tekno- logien som danner grunnlaget for forskningen på radarteknologi. ­ I utgangspunktet brukes hovedfagsstudent Håkon A. Hjortland greide i 2006 med professorens hjelp å utvikle verdens første og eneste «single

Sahay, Sundeep


Ann. N.Y. Acad. Sci. ISSN 0077-8923 Introduction to Climate Change Adaptation in New  

E-Print Network (OSTI)

actions that reduce greenhouse gas emissions will help to decrease the magnitude and impact of future energy demand; more frequent and more extensive street, basement, and sewer flooding; and permanent change and impact scientists, university scholars, and private-sector experts to advise on issues related


Wei Xu and Klaus Mueller are with the Computer Science Department, Stony Brook University, Stony Brook, NY 11790 USA (phone  

E-Print Network (OSTI)

are preferably used when the projection data are noisy, irregular in acquisition, or limited in number or size with such a data-intensive approach by using commodity high-performance computing hardware (GPUs), which themselves Tomography, GPU, Image Quality Metrics I. INTRODUCTION An effective way to limit the overall radiation dose

Mueller, Klaus


Wei Xu and Klaus Mueller are with the Computer Science Department, Stony Brook University, Stony Brook, NY 11790 USA (phone  

E-Print Network (OSTI)

cope well with limited projection sets and noisy data. These scenarios occur most often in low-dose CT--Iterative Reconstruction, Ordered Subsets, Computed Tomography, GPU, Bilateral Filter, Total Variation Minimization I, where one seeks to either limit the dose per projection, or the number of projections overall, or both

Mueller, Klaus



E-Print Network (OSTI)

in Cognitive Neuroscience The emotion paradox in the aging brain Mara Mather The USC Davis School Mather, Ph.D., The USC Davis School of Gerontology, University of Southern California, 3715 Mc questions about which aspects of these age-related changes in emotional processing can be accounted

Mather, Mara


The Impact of Wind Power Projects on Residential Property Values in the United States: A Multi-Site Hedonic Analysis  

E-Print Network (OSTI)

and Oneida Counties (New York)NYMCOC Madison and Oneida Counties, NY Madison County, NYNYMCOC Madison and Oneida Counties, NY Madison County, NY

Hoen, Ben



EIS-0492: Notice of Intent to Prepare an Environmental Impact...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Statement EIS-0492: Notice of Intent to Prepare an Environmental Impact Statement Oregon LNG Export Project (Warrenton, OR) and Washington Expansion Project (between Sumas and...


INTRODUCTION Seventy years ago, Spemann and Mangold (1924) demon-  

E-Print Network (OSTI)

of a unique region of the amphibian embryo, the dorsal lip of the blastopore. Trans- plantation of this region to the ventral side of a host embryo results in the induction of new neural tissue, the dorsalisation embryos (Waddington 1932, 1933) identified the tip of the primitive streak, Hensen's node (after Hensen

Stern, Claudio


Modeling Regulatory Networks to Understand Plant Development: Small Is Beautiful  

Science Journals Connector (OSTI)

...is unstable. The bottom of a valley is also a steady state of the...practice. Other more complex long-term behavior can be observed...states (e.g., two distinct valleys, in the case of Figure 1A...mathematically, it was suggested quite long ago (Waddington, 1940; Delbruck...

Alistair M. Middleton; Etienne Farcot; Markus R. Owen; Teva Vernoux



Tracking the Sun IV: An Historical Summary of the Installed Cost of Photovoltaics in the United States from 1998 to 2010  

E-Print Network (OSTI)

NV Generations Rebate Program NY NYSERDA PV IncentiveNY OH OR PV Incentive Program Energy Office Renewable Technology Rebate

Darghouth, Naim



Benchmarking Non-Hardware Balance-of-System (Soft) Costs for U.S. Photovoltaic Systems Using a Bottom-Up Approach and Installer Survey  

E-Print Network (OSTI)

Distributed Renewable Energy. New York, NY: Network for NewProcedures. New York, NY: Network for New Energy Choices.

Ardani, Kristen



Age Effects on Conflict Monitoring: Behavioral and ERP data Doreen Nessler, Letecia Latif, Ray Johnson, Jr., and David Friedman  

E-Print Network (OSTI)

Johnson, Jr.², and David Friedman¹ ¹Cognitive Electrophysiology Laboratory, NY Psychiatric Institute, NY

Johnson Jr.,, Ray


,"New York Underground Natural Gas Storage - All Operators"  

U.S. Energy Information Administration (EIA) Indexed Site

"Sourcekey","N5030NY2","N5010NY2","N5020NY2","N5070NY2","N5050NY2","N5060NY2" "Date","New York Natural Gas Underground Storage Volume (MMcf)","New York Natural Gas in...

Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.



Gasoline and Diesel Fuel Update (EIA)

Table. 11 Summary of U.S. Natural Gas Exports By Point of Exit, 1997-2001 (Volumes in Million Cubic Feet, Prices in Dollars per Thousand Cubic Feet) Imports and Exports - Table 11 Pipeline (Canada) Detroit, MI................ 31,080 2.55 24,908 2.26 25,049 2.30 36,007 3.74 35,644 4.57 Marysville, MI .......... 5,286 2.36 3,377 2.17 691 2.47 5,320 2.91 3,651 3.92 St. Clair, MI.............. 20,080 2.51 11,397 2.23 11,258 2.51 29,654 3.73 122,293 3.82 Babb, MT................. NA NA NA NA NA NA NA NA 549 3.55 Harve, MT................ NA NA NA NA 1,510 2.05 1,606 3.25 2,428 3.40 Niagara Falls, NY .... NA NA NA NA NA NA NA NA 594 2.49 Sumas, WA ............. NA NA 208 2.80 NA NA NA NA 1,529 4.44 Total........................ 56,447 2.52 39,891 2.25 38,508 2.35 72,586 3.66 166,690 3.97 Pipeline (Mexico) Douglas, AZ............. 3,901 2.38 4,133 1.89 4,041 2.37 8,829 4.23 8,050 3.50 Calexico,CA.............


Public Relations Office 500 University Avenue Rochester, NY 14607-1484 585.276.8900 585.473.6266 fax mag.rochester.edu NEWS  

E-Print Network (OSTI)

29, 2013 Description: This exhibition, which celebrates MAG's centennial, includes both historical (March 30­April 7), free to age 18 and under if accompanied by an adult. Half-price admission Thursdays historical and con- temporary objects that explore how memory shapes both personal and cultural identities

Portman, Douglas


Daily Gazette, Schenectady NY Letters to the Editor for Thursday, July 10, 2008 Nothing to fear, and much to gain, from waste-to-energy  

E-Print Network (OSTI)

, and much to gain, from waste-to-energy Schenectady is one of those misguided cities that sends its municipal solid wastes to distant landfills, costing much money, wasting valuable energy and increasing global warming and pollution of our environment. Waste-to-energy (WTE) is safe. I advised the Israel

Columbia University


Session S2G 978-1-4244-1970-8/08/$25.00 2008 IEEE October 22 25, 2008, Saratoga Springs, NY  

E-Print Network (OSTI)

showcase event), student engagement projects with SMEs, and internships. The second, "Agile Methods-oriented practice with ASU's University Technology Office, and an off-campus 2-day workshop with students and real that they do not focus sufficient resources on the transfer of knowledge and technology to society. A grant



E-Print Network (OSTI)

Sifton's Top 10 New Restaurants of 2011 3. Basics: The Hormone Surge of Middle Childhood 4. The Fat Trap

Rhoads, James


Internship Philips Research North America, Briarcliff Manor, NY Philips Research North America (PRNA) is one of Philips' six worldwide research laboratories where  

E-Print Network (OSTI)

of Healthcare and Lighting and in the areas of Controls, Communication, & Healthcare Informatics (CCHI/C++. · Interest in medical imaging, background/knowledge in ultrasound is preferred. · Clinical experience

Adams, Mark


Internship Philips Research North America, Briarcliff Manor, NY Philips Research North America (PRNA) is one of Philips' six worldwide research laboratories where  

E-Print Network (OSTI)

of Healthcare and Lighting and in the areas of Controls, Communication, & Healthcare Informatics (CCHI. · Interest in medical imaging, background/knowledge in ultrasound is preferred by not required. · Clinical

Adams, Mark


Why Audit? NY SD 7 Legislation Risk-limiting audits Ballot-level audits AUDITS: THE AFTER-MATH OF ELECTION  

E-Print Network (OSTI)

-MATH OF ELECTION REFORM Conference on Innovative Electoral Reforms and Strategies Philip B. Stark Department by hand. · Other reasons too: process improvement, deterrence, etc. · Compliance audits vs. materiality by hand. · Other reasons too: process improvement, deterrence, etc. · Compliance audits vs. materiality

Stark, Philip B.


Health assessment for Griffiss Air Force Base NPL (National Priorities List) site, Rome, Oneida County, New York, Region 2. CERCLIS No. NY4571924451. Final report  

SciTech Connect

The Griffiss Air Force Base National Priorities List Site is located near the City of Rome, New York. Most of these sites have not been sufficiently investigated at this time for a complete determination of their possible health effects. Residential wells south of Griffiss Air Force Base are contaminated with volatile organic compounds: trichloroethene and 1,1,2,2-tetrachloroethane. The measured concentrations of trichloroethene and 1,1,2,2-tetrachloroethane, to date, are below levels of concern. The site is of potential public health concern because of the risk to human health that could result from possible future exposure to hazardous substances at levels that may result in adverse health effects over time.

Not Available



Public health assessment for Griffiss Air Force Base, Rome, Oneida County, New York, Region 2. Cerclis No. NY4571924451. Addendum. Final report  

SciTech Connect

The public health assessment addendum addresses the two public health issues identified at Griffiss Air Force Base by the Agency for Toxic Substances and Disease Registry (ATSDR): (1) exposures to contaminated fish from Three Mile and Six Mile Creeks, and (2) past exposures to contaminated groundwater through private wells off base. Frequent consumption of contaminated fish from Three Mile and Six Mile Creeks could pose a health problem. However, if NYSDOH fish consumption guidelines are followed, fish consumption should not present a public health hazard. ATSDR cannot evaluate exposures to contaminated groundwater through private well use prior to 1982 because there are no sampling data.




Combination cancer vaccine of CHP-NY-ESO-1 and CHP-HER2 with immuno-adjuvant, OK-432, for chemorefractory metastatic or recurrent esophageal cancer patients  

Science Journals Connector (OSTI)

...cholesteryl hydrophobized polysacharide(CHP-HER2) Shigehisa Kitano Shinichi Kageyama...hydrophobized polysacharide-HER2 protein complex (CHP-HER2) is a cancer vaccine with a novel...hydrophobized polysaccharides, pullulan (CHP) containing truncated recombinant HER2...

Shugo Ueda; Masatoshi Aoki; Hiroyoshi Nishikawa; Michiko Hirayama; Shigehisa Kitano; Eriko Hayashi; Michiyuki Kanai; Arimichi Takabayashi; Hiroshi Shiku; Shinichi Kageyama



Hunter College Degree Audit Unit Office of the Registrar Room 217 North 695 Park Avenue New York, NY 10065 Page 1 of 4  

E-Print Network (OSTI)

the Student Help Desk . The name on your diploma and transcript will be printed as it appears on your Hunter. Please note that DIG is an advisement tool only, not an official audit. The degree audit is mandatory

Qiu, Weigang


Ann. N.Y. Acad. Sci. 986: 116126 (2003). 2003 New York Academy of Sciences. Ion Occlusion/Deocclusion Partial Reactions in  

E-Print Network (OSTI)

-type ion-motive ATPases, transported ions approach their binding sites from one membrane surface, become an alternating-gate transport mechanism, in which the pump acts like an ion channel with two gates that open ion transport, the probability of the pump's two gates being open simultaneously must be extremely low

Gadsby, David


The U.S. Department of Energy's Brookhaven National Laboratory P.O. Box 5000, Upton NY 11973 a passion for discovery  

E-Print Network (OSTI)

, but the reaction process is very wasteful, producing enough carbon monoxide (CO) to eventually stop the reaction, releasing it after reacting with a titanium catalyst. The researchers want to know why titanium works, and have postulated that the reaction may form nanoparticles of a titanium/aluminum alloy. Learning about


The Department of Industrial and Systems Engineering (ISE) at RENSSELAER POLYTECHNIC INSTITUTE in Troy, NY invites applications for a tenure-track faculty position at the Assistant or  

E-Print Network (OSTI)

The Department of Industrial and Systems Engineering (ISE) at RENSSELAER POLYTECHNIC INSTITUTE in Industrial and Systems Engineering or a closely related field. The ISE department is in a period of growth undergraduate and graduate courses in both the Industrial Systems Engineering curriculum, develop and maintain

Mitchell, John E.


Ann. N.Y. Acad. Sci. 956: 537542 (2002). 2002 New York Academy of Sciences. A Three-Channel Model for Generating the  

E-Print Network (OSTI)

-Channel Model for Generating the Vestibulo-Ocular Reflex in Each Eye LAURENCE R. HARRIS,a KARL A. BEYKIRCH velocity ranges,7 as dis- cussed elsewhere.8 Address for correspondence: Laurence R. Harris, Department of Psychology, York Univer- sity, 4700 Keele Street, Toronto, Ontario M3J 1P3, Canada. Voice: 416-736-2100, ext

Harris, Laurence R.



SciTech Connect

BNL is proud to acknowledge all of our 2001 sponsors, with their help and support this has correctly become an oilheat industry conference. It is quite gratifying to see an industry come together to help support an activity like the technology conference, for the benefit of the industry as a whole and to celebrate the beginning of the National Oilheat Research Alliance. This meeting is the fourteenth oil heat industry technology conference to be held since 1984 and the first under a new name, NORA, the National Oilheat research Alliance, and the very first in the new century. The conference is a very important part of the effort in technology transfer, which is supported by the Oilheat Research Program. The Oilheat Research Program at BNL is under the newly assigned program management at the Office of Power Technology within the US DOE. The foremost reason for the conference is to provide a platform for the exchange of information and perspectives among international researchers, engineers, manufacturers, service technicians, and marketers of oil-fired space-conditioning equipment. The conference provides a conduit by which information and ideas can be exchanged to examine present technologies, as well as helping to develop the future course for oil heating advancement. These conferences also serve as a stage for unifying government representatives, researchers, fuel oil marketers, and other members of the oil-heat industry in addressing technology advancements in this important energy use sector. The specific objectives of the conference are to: (1) Identify and evaluate the current state-of-the-art and recommend new initiatives for higher efficiency, a cleaner environment, and to satisfy consumer needs cost-effectively, reliably, and safely; (2) Foster cooperative interactions among federal and industrial representatives for the common goal of sustained economic growth and energy security via energy conservation. Seventeen technical presentations will be made during the two-day program, all related to oil-heat technology and equipment, these will cover a range of research, developmental, and demonstration activities being conducted within the United States and Europe, including: (1) High-flow Fan Atomization Burner (HFAB) Development and Field Trials; (2) Field Test of the Flame Quality Monitor; (3) NORA/DOE/ BNL Oilheat Five-Year Research Plan; (4) US Department of Energy's Building Cooling Heating and Power for Buildings Program; (5) NORA Education Committee Report; (6) Marketing Oil Heat in Europe: A study in contrasts; (7) Diagnosing Burner Problems with Recorded Data ''The solution to any problem is obvious.. . once it is found''; (8) Variable Firing Rate Oil Burner Using Pulse Fuel Flow Control; (9) Oil-Fired Hydronic Heating Appliances with Reduced Electric Power Consumption and Battery Backup; (10) Peep Into The Nozzle Using Computational Fluid Dynamics; (11) Results of a Parametric Investigation of Spray Characteristics Using a HFAB Type Atomizer; (12) Progression and Improvements in the Design of Blue-flame Oil Burners; (13) Biodiesel as a Heating Oil Blend Stock; (14) Lab Tests of Biodiesel Blends in Residential Heating Equipment; (15) Alternative Fuel Oils and the Effect of Selected Properties in Combustion; (16) New York State Premium Low-Sulfur Heating Fuel Marketplace Demonstration; and (17)The Need for a New Fuel Oil Stability Specification.




Final Focus Area Selection Report 255 Fuller Road, Suite 274, Albany, NY 12203 USA (518) 437-8661 / Fax: (518) 437-8659  

E-Print Network (OSTI)

existing facilities. Wind plant capacity factors were calculated by matching wind map-derived resource statistics with a generic turbine power curve reflecting current megawatt-scale wind technologies. 2 for Task 2 (Selection of Focus Areas) of the Energy Commission project "Wind Energy Resource Modeling


630 West 168 Street, Mail Box 8; New York, NY 10032 Tel. (212) 305-6780 Fax (212)795-5847 COLUMBIA UNIVERSITY  

E-Print Network (OSTI)

that a Hot Work Permit shall be issued by the Facilities Operations before conducting any operation involving

Jia, Songtao


Overview of the Muon Accelerator Front-End D. Stratakis, H. K. Sayed, J. S. Berg, Brookhaven National Laboratory, Upton, NY, U.S.A  

E-Print Network (OSTI)

Overview of the Muon Accelerator Front-End D. Stratakis, H. K. Sayed, J. S. Berg, Brookhaven.S.A P. Snopok, Illinois Institute of Technology, IL, U.S.A. Abstract: A key challenge for muon accelerators is that the initial muon beam occupies a region in phase space that vastly exceeds the acceptance

McDonald, Kirk

Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


630 West 168 Street, Mail Box 8; New York, NY 10032 Tel. (212) 305-6780 Fax (212)795-5847 COLUMBIA UNIVERSITY  

E-Print Network (OSTI)

UNIVERSITY ENVIRONMENTAL HEALTH & SAFETY Policy and Procedure Notice For Shut-Down of Fire Protection Systems the fire protection system(s) out of service, the following departments must be informed at least two work, then forward memo or e-mail when work is completed in order to restore fire protection. A shutdown

Jia, Songtao


Encouraging and sustaining integration of child mental health into primary care: interviews with primary care providers participating in Project TEACH (CAPES and CAP PC) in NY  

Science Journals Connector (OSTI)

AbstractObjective Project Training and Education for the Advancement of Children's Health (TEACH) provides training, consultation and referral support to build child and adolescent mental health (MH) expertise among primary care providers (PCPs). This study describes how TEACH engages PCP, how program components lead to changes in practice and how contextual factors influence sustainability. Method Thirty \\{PCPs\\} randomly selected from 139 trained \\{PCPs\\} and 10 \\{PCPs\\} from 143 registered with TEACH but not yet trained completed semistructured interviews. PCP selection utilized purposeful sampling for region, rurality and specialty. Interviews were recorded, transcribed and analyzed using grounded theory. Results PCP participation was facilitated by perceived patient needs, lack of financial and logistic barriers and continuity of PCPprogram relationships from training to ongoing consultation. Trained \\{PCPs\\} reported more confidence interacting with families about MH, assessing severity, prescribing medication and developing treatment plans. They were encouraged by satisfying interactions with MH specialists and positive feedback from families. Barriers included difficulties implementing screening, time constraints, competing demands, guarded expectations for patient outcomes and negative impressions of the MH system overall. Conclusions Programs like TEACH can increase PCP confidence in MH care and promote increased MH treatment in primary care and through collaboration with specialists. Sustainability may depend on the PCP practice context and implementation support.

Anne M. Gadomski; Lawrence S. Wissow; Lawrence Palinkas; Kimberly E. Hoagwood; Jeffrey M. Daly; David L. Kaye



ACEEE Summer Study on Energy in Industry, West Point, NY, July 19-22. 1 Modeling and Simulation of Air Compressor Energy Use  

E-Print Network (OSTI)

is described. Techniques for calibrating the software to measured energy use data, and estimating energy assessments of mid-sized industries, we found that the average unit energy cost of compressed air ranges from% of a plant's annual electric costs. The wide range in unit energy costs is a function of many factors

Kissock, Kelly


50. W. Rall, Ann. N.Y. Acad. Sci. 96, 1071 (1962). 51. H. Agmon-Snir, I. Segev, J. Neurophysiol. 70, 2066  

E-Print Network (OSTI)

, 2066 (1993). 52. R. Iansek, S. J. Redman, J. Physiol. (London) 234, 613 (1973). 53. J. J. B. Jack, S. J. Redman, K. Wong, J. Physiol. (London) 321, 65 (1981). 54. C. Stricker, A. C. Field, S. J. Redman, J, J. D. Lambert, J. Physiol. (London) 507, 441 (1998). 59. S. Cash, R. Yuste, J. Neurosci. 18, 10

Segev, Idan


Physician Name Phone Fax Street Suite City State Zip Specialty ABACI,ASLI 585-271-0444 585-271-1464 980 WESTFALL RD ROCHESTER NY 14619  

E-Print Network (OSTI)

-000-0000 955 E 11400 S SANDY UT 84094 ABBISI,SAIFY A 814-642-7205 814-642-9189 45 PINE STREET PORT ALLEGANY PA

Goldman, Steven A.


,/: : A THE AMERICAN SOCIETY OF MECHANICAL ENGINEERS 87-WA/AES-4 ! .,~,'~(345 E. 47 St., New York, N.Y. 10017 .,. *  

E-Print Network (OSTI)

, evaporator, condenser, and expansion valve) fuel usage reductions were 19% and 17%, respectively. remain. NOMENCLATURE C coefficient of performance oRNL-oDS 6-7998 f engine energy fraction COO, , . . _*'COOLING L), respectively, calculated coefficients of performance were 0.3 for the cooling mode (Ce) and 1.3 for the heating

Oak Ridge National Laboratory


Museums, U.S.A. A History and Guide. Herbert Katz and Marjorie Katz. Doubleday, Garden City, N.Y., 1965. xii + 395 pp. Illus. $6.50  

Science Journals Connector (OSTI)

...the com-munication system required." Requisite...antennae, or PCM systems. The chapter on power systems is comprehensive...this is a very useful handbook in a field of endeavor...installations (whether restoration, fabrication, re-creation...

Silvio A. Bedini



(12) United States Patent Grier et al.  

E-Print Network (OSTI)

IN POTENTIAL ENERGY LANDSCAPES Inventors: David G. Grier, New York, NY (US); Marco Polin, New York, NY (US); Sang-Hyuk Lee, Rego Park, NY (US); Yael Roichman, NeW York, NY (US); Kosta Ladavac, Ridge?eld, CT (US) Assignee: New York University, NeW York, NY (Us) Notice: Subject to any disclaimer, the term ofthis patent

Grier, David


,"New York Natural Gas Summary"  

U.S. Energy Information Administration (EIA) Indexed Site

480SNY3","N3050NY3","N3010NY3","N3020NY3","N3035NY3","NA1570SNY3","N3045NY3" "Date","New York Natural Gas Wellhead Price (Dollars per Thousand Cubic Feet)","New York Natural...


,"New York Natural Gas Summary"  

U.S. Energy Information Administration (EIA) Indexed Site

50NY3","N3010NY3","N3020NY3","N3035NY3","N3045NY3" "Date","Natural Gas Citygate Price in New York (Dollars per Thousand Cubic Feet)","New York Price of Natural Gas Delivered to...


Browse by Discipline -- E-print Network Subject Pathways: Energy Storage,  

Office of Scientific and Technical Information (OSTI)

X Y Z X Y Z Waddington, Ian (Ian Waddington) - Department of Physics and Astronomy, University of Sussex Wadehra, Jogindra M. (Jogindra M. Wadehra) - Department of Physics and Astronomy, Wayne State University Wagner, Carlos E.M. (Carlos E.M. Wagner) - High Energy Physics Division, Argonne National Laboratory & Department of Physics, University of Chicago Walker, Michael B. (Michael B. Walker) - Department of Physics, University of Toronto Walker, Thad G. (Thad G. Walker) - Department of Physics, University of Wisconsin at Madison Wallace, David (David Wallace) - Department of Physics, University of Oxford Wallin, Mats (Mats Wallin) - Department of Physics, Royal Institute of Technology, Sweden Wallraff, Andreas (Andreas Wallraff) - Departement Physik, Eidgenössische Technische Hochschule Zürich (ETHZ)


DOE - Office of Legacy Management -- International Rare Metals Refinery Inc  

Office of Legacy Management (LM)

Rare Metals Refinery Rare Metals Refinery Inc - NY 38 FUSRAP Considered Sites Site: International Rare Metals Refinery, Inc. (NY.38 ) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: Canadian Radium and Uranium Corporation NY.38-1 Location: 69 Kisko Avenue , Mt. Kisko , New York NY.38-1 NY.38-3 Evaluation Year: 1987 NY.38-4 Site Operations: Manufactured and distributed radium and polonium products. NY.38-5 Site Disposition: Eliminated - No Authority - Site was a commercial operation not under the jurisdiction of DOE predecessor agencies NY.38-2 NY.38-4 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Radium, Plutonium NY.38-5 Radiological Survey(s): Yes NY.38-1 NY.38-5 Site Status: Eliminated from consideration under FUSRAP


34730,"AGWAY PETRO CORP",1,231,"PROPANE/NGL",0712,"CHAMPL-RS...  

U.S. Energy Information Administration (EIA) Indexed Site

NY INC",1,461,"DISTILLATE, < 0.05% SUL (DOMESTIC)",1001,"NEW YORK, NY","NEW YORK",1,,"GERMANY, FD (W)",130,0,0,,,,, 34730,"BEAR STEARNS NY INC",2,461,"DISTILLATE, < 0.05% SUL...


Subcellular metabolic organization in the context of dynamic energy budget and biochemical systems theories  

Science Journals Connector (OSTI)

...metabolites, energy compounds and...engineering. New York, NY: Marcel...cellular systems. New York, NY: Chapman...2010 Dynamic energy budget theory...biologists. New York, NY: Cambridge...context of dynamic energy budget and biochemical...



An Estimate of Energy Use in Laboratories, Cleanrooms, and Data Centers in New York  

E-Print Network (OSTI)

Average commercial electricity cost ($/ kWh) NY - AverageNY - Average commercial electricity cost ($/kWh) NY - Datarep ort. Total costs for electricity and fu el w ere calcu

Mathew, Paul



Testing dark energy with the Advanced Liquid-mirror Probe of Asteroids, Cosmology and Astrophysics  

Science Journals Connector (OSTI)

......Papers Testing dark energy with the Advanced...Columbia University, New York, NY 10027, USA 2...Columbia University, New York, NY 10027, USA 3...Columbia University, New York, NY 10027, USA 4...for studying dark energy. The bulk of the......

Pier Stefano Corasaniti; Marilena LoVerde; Arlin Crotts; Chris Blake



DOE Zero Energy Ready Home Case Study: Greenhill Contracting...  

Energy Savers (EERE)

Study: Greenhill Contracting, New Paltz, NY DOE Zero Energy Ready Home Case Study: Greenhill Contracting, New Paltz, NY Case study of a DOE Zero Energy Ready home in New Paltz, NY,...


DOE - Office of Legacy Management -- Enterprise Metal Products...  

Office of Legacy Management (LM)

, New York NY.0-10-1 Evaluation Year: 1987 NY.0-10-1 Site Operations: Machined magnesium metal NY.0-10-1 Site Disposition: Eliminated - Potential for contamination remote...


Survey of Energy-Efficient and Power-Proportional Storage Systems  

Science Journals Connector (OSTI)

......Cost-and Energy- aware Load...October 10. ACM, New York, NY, USA...Conserving Disk Energy. Proc. 18th...7988. ACM, New York, NY, USA...169182. ACM, New York, NY, USA...2010) SRCMap: Energy Proportional......

Pablo Llopis; Javier Garcia Blas; Florin Isaila; Jesus Carretero



DOE - Office of Legacy Management -- Rockefeller Institute for...  

Office of Legacy Management (LM)

Rockefeller Institute for Medical Research - NY 0-21 FUSRAP Considered Sites Site: ROCKEFELLER INSTITUTE FOR MEDICAL RESEARCH (NY.0-21) Eliminated from consideration under FUSRAP...

Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Scandalous Figures: Authorial Self in Eliza Haywood, Laurence Sterne, Charlotte Smith, and Lord Byron  

E-Print Network (OSTI)

Celestina. Edited by Loraine Fletcher. Orchard Park, NY:Emmeline. Edited by Loraine Fletcher. Orchard Park, NY:Press, 2007. Fletcher, Loraine. Charlotte Smith: A Critical

Campion, Amy Thomas




E-Print Network (OSTI)

, and manufactured in NY State with 100% windpower. 94 Bright Manufactured In NY State 100% PCW A. Letterhead 8.5 x

Aronov, Boris


Secondhand Smoke and the Family Courts: The Role of Smoke Exposure in Custody and Visitation Decisions  

E-Print Network (OSTI)

640 (N.Y. Supreme Ct. , Oneida County 2002). Id. The Court12 (N.Y. Supreme Ct. , Oneida County 2002). See Grusendorf

Dachille, Kathleen H; Callahan, Kristine



DOE Zero Energy Ready Home Case Study, Ferguson Design and Constructio...  

Energy Savers (EERE)

Home Case Study, Ferguson Design and Construction, Inc., Sagaponak, NY, Custom Home DOE Zero Energy Ready Home Case Study, Ferguson Design and Construction, Inc., Sagaponak, NY,...


Gasoline and Diesel Fuel Update  

NLE Websites -- All DOE Office Websites (Extended Search)

County, NY Essex County, NJ Fairfield County, CT Hudson County, NJ Hunterdon County, NJ Kings County, NY Litchfield County (partial), CT Middlesex County, NJ Monmouth County, NJ...


DOE - Office of Legacy Management -- Brookhaven National Laboratory...  

Office of Legacy Management (LM)

Brookhaven National Laboratory Buildings 353 354 467 and 468 - NY 14 FUSRAP Considered Sites Site: Brookhaven National Laboratory Buildings 353 354 467 and 468 (NY.14 ) Designated...


DOE - Office of Legacy Management -- Knolls Atomic Power Laboratory...  

Office of Legacy Management (LM)

Knolls Atomic Power Laboratory - NY 16 FUSRAP Considered Sites Site: Knolls Atomic Power Laboratory (NY.16) Designated Name: Alternate Name: Location: Evaluation Year: Site...


DOE - Office of Legacy Management -- West Valley Demonstration...  

Office of Legacy Management (LM)

Valley Demonstration Project - NY 23 FUSRAP Considered Sites Site: West Valley Demonstration Project (NY.23) Designated Name: Alternate Name: Location: Evaluation Year: Site...


East Asian Security in 2025  

E-Print Network (OSTI)

East Asian Security in 2025 Who We Are Reagan Heavin Energy Adam Hudson State Capacity Brandon Krueger Military Sean ONeil Demographics Griffin Rozell Balance of Power Matt Suma Economy East Asian Security in 2025 China...: Competition, Cooperation, Plateau? Reagan Heavin Adam Hudson Brandon Krueger Sean ONeil Griffin Rozell Matt Suma 24 April 2008 East Asian Security in 2025 Agenda Conclusions Projections Drivers Four Outcomes Questions East Asian Security in 2025...

Heavin, Reagan; Hudson, Adam; Krueger, Brandon; O'Neil, Sean; Rozell, Griffin; Suma, Matt



DOE - Office of Legacy Management -- Curtiss-Wright Corp Metals Processing  

Office of Legacy Management (LM)

Curtiss-Wright Corp Metals Curtiss-Wright Corp Metals Processing Div - NY 40 FUSRAP Considered Sites Site: Curtiss-Wright Corp., Metals Processing Div. (NY.40 ) Eliminated from further consideration under FUSRAP - Referred to DOD Designated Name: Not Designated Alternate Name: Curtiss-Wright Corporation NY.40-1 Location: Buffalo , New York NY.40-1 Evaluation Year: 1987 NY.40-2 Site Operations: Performed casting, forging, and extrusion operations for the U.S. Air Force and the AEC. NY.40-1 NY.40-2 Site Disposition: Eliminated - Referred to DOD NY.40-2 NY.40-3 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Uranium NY.40-1 Radiological Survey(s): None Indicated Site Status: Eliminated from further consideration under FUSRAP - Referred to DOD NY.40-2


Proc. Natl. Acad. Sci. USA Vol. 94, pp. 48724877, May 1997  

E-Print Network (OSTI)

, GUNTER SCHNEIDER, AND JOHN SHANKLIN* *Biology Department, Brookhaven National Laboratory, Upton, NY 11973


Revised 10/3/13 h:\\dept\\forms\\propinf.doc  

E-Print Network (OSTI)

Identification Number) 16-0743209 U.S. Congressional District 25th, New York N.Y. Senatorial District (RC) 55 th (MC) 56th N.Y. Assembly District 131st N.Y. State Charitable Organization Registration # 11-41-70 N.Y. State DOH Animal Care & Use Certificate # A-050 NYS Vendor ID number 1000007489 U of R Dun & Bradstreet

Mahon, Bradford Z.


Development of an Experimental Database and Kinetic Models for Surrogate Jet Fuels  

E-Print Network (OSTI)

. Lenhert, Praxair Research Center, Tonawanda, NY 14150 Heinz Pitsch, Stanford University, Stanford, Ca

Pitsch, Heinz


0% 10% 20% 30% Employment Agency (9)  

E-Print Network (OSTI)

Hospital Cardiovascular Technician Syracuse NY Danbury Hospital/Praxair Cancer Center Medical Assistant

Doyle, Robert


Novel Mesoporous Silicates with Two-Dimensional Mesostructure Direction Using Rigid Bolaform  

E-Print Network (OSTI)

, Praxair, 175 East Park Drive, Tonawanda, NY 14151-0044. # Present address: Dr. Jianglin Feng, Department

Kim, Ji Man


Dynamic Considerations in the Synthesis of Self-Optimizing Control Structures  

E-Print Network (OSTI)

Praxair Technology Center, Praxair Inc., Tonawanda, NY 14150 Antonio Araujo and Sigurd Skogestad Dept

Skogestad, Sigurd


Multiscale optimization models for powerintensive processes  

E-Print Network (OSTI)

Collaborators: Jose M. Pinto, Praxair Inc., Danbury, CT Nikhil Arora, Praxair Inc., Tonawanda, NY #12;Demand

Grossmann, Ignacio E.


Experiments with relativistic electrons producing tunable X-rays from Cu crystals B. Sones, Y. Danon*, E. Blain*  

E-Print Network (OSTI)

. Danon*, E. Blain* Department of Physics, United States Military Academy, West Point, NY 10996 Bryndol

Danon, Yaron


Electron Acceleration for X-ray Production Using Paired Pyroelectric Crystals Jeffrey Geuther, Yaron Danon, Frank Saglime, Bryndol Sones  

E-Print Network (OSTI)

, Yaron Danon, Frank Saglime, Bryndol Sones Rensselaer Polytechnic Institute, 110 8th Street, Troy, NY

Danon, Yaron



E-Print Network (OSTI)

. Yakimenko, Brookhaven National Lab., Upton, NY W. D. Kimura, STI Optronics, Bellevue, WA Abstract We

Brookhaven National Laboratory

Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.



E-Print Network (OSTI)

,, Brookhaven National Laboratory, Upton, Long Island, NY 11973, USA W. D. Kimura, STI Optronics, Inc., Bellevue

Brookhaven National Laboratory


The Process Specification Language (PSL) Overview and Version 1.0 Specification  

E-Print Network (OSTI)

Technology Park Troy, NY 12180 Josh Lubell National Institute of Standards and Technology 100 Bureau Drive

Grüninger, Michael


Study of a Personal Environmental Control System Using Opposing Airstreams  

E-Print Network (OSTI)

ventilation application. Healthy Buildings 2003, Singapore.jet local ventilation. Healthy Building 2009, Syracuse, NY.

Liu, Chonghui; Higuchi, Hiroshi; Arens, Edward; Zhang, Hui



DOE - Office of Legacy Management -- American Machine and Foundry Co -  

NLE Websites -- All DOE Office Websites (Extended Search)

Buffalo - NY 63 Buffalo - NY 63 FUSRAP Considered Sites Site: American Machine and Foundry Co - Buffalo (NY.63 ) Eliminated from further consideration under FUSRAP Designated Name: Not Designated Alternate Name: AMF NY.63-1 Location: Buffalo , New York NY.63-1 Evaluation Year: 1990 NY.63-1 Site Operations: Design engineering for the development of electrical and mechanical controls. NY.63-1 Site Disposition: Eliminated - Potential for radioactive contamination considered remote. Radioactive material, if any was used at the site, would have been limited to test quantities. NY.63-2 Radioactive Materials Handled: None Indicated - test quantities, if any NY.63-1 Primary Radioactive Materials Handled: None Indicated, But Could Have Included Test Quantities of Finished Uranium Metal NY.63-1


The U.S. Department of Energy's Brookhaven National Laboratory P.O. Box 5000, Upton, NY 11973 631 344-2345 www.bnl.gov a passion for discovery  

E-Print Network (OSTI)

architecture Blue Gene/Q. HPC Code Center At the CSC's High Performance Computing (HPC) Code Center, scientists can supply their own code--or ideas--to process massive datasets on high performance computing Sciences · High Performance Computing Consortium (HPC2 ) 57,344 processors and rely on parallel programming


The U.S. Department of Energy's Brookhaven National Laboratory P.O. Box 5000, Upton NY 11973 631 344-2345 www.bnl.gov Basic Energy Sciences  

E-Print Network (OSTI)

with state-of-the-art capabilities to probe the unique properties of matter at an extremely small scale in Chemistry Upgraded Capabilities In order to address the increasingly complex scientific challenges of tomorrow, plans to upgrade NSLS are under way. NSLS-II, now under construction, will be a state

Ohta, Shigemi


Plant Tumor Research. A. C. Braun, Ed. Karger, Basel, 1972 (U.S. distributor, Phiebig, White Plains, N.Y.). x, 236 pp., illus. $17.40. Progress in Experimental Tumor Research  

Science Journals Connector (OSTI)

...possibility of combining tidal power production with a pumped-storage scheme. The objective of the paper entitled "Mathematical...to aqueous solutions. The inclusion of chapters on seawater and biological fluids, to remind the reader that these...

Tom Stonier



New York State Geological Association 67th Annual meeting & Eastern Section of the American Association of Petroleum Geologists 26th Annual meeting, Union College, Schenectady, NY, October 13-15, 1995  

E-Print Network (OSTI)

1 New York State Geological Association 67th Annual meeting & Eastern Section of the American In The New York Capital District W.S.F. Kidd, A. Plesch, and F.W. Vollmer This trip will cover the full width and Structure of the Taconic Flysch, Melange, and Allochthon, in the New York Capital District. pp. 57

Kidd, William S. F.


Engineering Aspects of Magnetohydrodynamics. Proceedings of the third annual symposium (Rochester, N.Y.), March 1962. Norman W. Mather and George W. Sutton, Eds. Gordon and Breach, New York, 1964. xiv + 675 pp. Illus. $34.50  

Science Journals Connector (OSTI)

...actually misleading. The maps, diagrams, and bibliographies are helpful...as-pects of magnetohydrodynamics (MHD) held at the University of...an ac-count of the original MHD generator experiments undertaken...Corporation in 1938. In the field of MHD power generation, the paper...

William D. Jackson



Stress Proteins In Biology and Medicine. Richard I. Morimoto, Alfred Tissires, and Costa Georgopoulos, Eds. Cold Spring Harbor Laboratory, Cold Spring Harbor, NY 1990. x, 450 pp., illus. $97. Cold Spring Harbor Monograph Series 19  

Science Journals Connector (OSTI)

...entertainments, struggles to locate and acquire suitable real estate, the rearing and careers of offspring, and comic episodes...50; paper, $19.95. After the Green Revolution. Sustainable Agriculture for Development. Gordon R. Conway and...

Lawrence E. Hightower



Shortening in the southern Lhasa block during India-Asia collisionY. Pan and W.S.F. Kidd Dept of Earth and Atmospheric Sciences, University at Albany, Albany NY 12222, USA.  

E-Print Network (OSTI)

Shortening in the southern Lhasa block during India-Asia collisionY. Pan and W.S.F. Kidd Dept Wangming, J.F. Dewey, A. Gansser, N.B.W. Harris, Jin Chengwei, W.S.F. Kidd, M.R. Leeder, Li Huan, Lin Jinlu., T.M. Harrison, W.S.F. Kidd, Xu Ronghua

Kidd, William S. F.


2003 Marcel Dekker, Inc. All rights reserved. This material may not be used or reproduced in any form without the express written permission of Marcel Dekker, Inc. MARCEL DEKKER, INC. 270 MADISON AVENUE NEW YORK, NY 10016  

E-Print Network (OSTI)

water and patients are increasing in number. Project Well is a program chosen for implementation in some design is modified by use of tube well hand pumps to withdraw water. The project includes community. It was found that the patients consumed water from shallow tube wells of about 60­90 feet (24­36 m) deep

California at Berkeley, University of


2002 Marcel Dekker, Inc. All rights reserved. This material may not be used or reproduced in any form without the express written permission of Marcel Dekker, Inc. MARCEL DEKKER, INC. 270 MADISON AVENUE NEW YORK, NY 10016  

E-Print Network (OSTI)

soil that had been surface- contaminated with diesel fuel (2.4 L m?2 ) and flooded with water conditions (biostimulation). Key Words: Diesel-contaminated soil; Bioremediation; BTEX; Azolla plants degradation of diesel hydrocarbons for the treatment of diesel-contaminated soil and water from United States

Cohen, Michael F.


The U.S. Department of Energy's Brookhaven National Laboratory P.O. Box 5000, Upton NY 11973 631 344-2345 www.bnl.gov Office of Technology Commercialization  

E-Print Network (OSTI)

diagnostics and homeland security; and catalysts for producing methanol-powered fuel cells. Sponsored Research

Ohta, Shigemi


TEST RESULTS OF HTS COILS AND AN R&D MAGNET FOR RIA* , M. Anerella, M. Harrison, J. Schmalzle, W. Sampson, BNL, UPTON, NY, 11973 U.S.A.  

E-Print Network (OSTI)

TEST RESULTS OF HTS COILS AND AN R&D MAGNET FOR RIA* R. Gupta# , M. Anerella, M. Harrison, J This paper presents the successful construction and test results of a magnetic mirror model for the Rare Isotope Accelerator (RIA) that is based on High Temperature Superconductors (HTS). In addition

Gupta, Ramesh


Page not found | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

81 - 3190 of 26,777 results. 81 - 3190 of 26,777 results. Download New Mexico Recovery Act State Memo http://energy.gov/downloads/new-mexico-recovery-act-state-memo Download Motion to Intervene Out of Time of Sumas Energy 2, Inc on Proposed Open-Access Requirement International Electric Transmission Facilities and Delegation to the Federal Energy Regulatory Commission. Motion to intervene out ouf time by Sumas Energy 2, Inc on the proposed change in open-access requirement international electric transmission facilities and delegation to the Federal Energy... http://energy.gov/oe/downloads/motion-intervene-out-time-sumas-energy-2-inc-proposed-open-access-requirement Download EA-386 IPR-GDF Suez Energy Marketing North America, Inc. (GSEMNA) Order authorizing GSEMNA to export electric energy to Mexico.


DOE - Office of Legacy Management -- Cornell University Medical College -  

Office of Legacy Management (LM)

Cornell University Medical College Cornell University Medical College - NY 28 FUSRAP Considered Sites Site: CORNELL UNIVERSITY MEDICAL COLLEGE (NY.28 ) Eliminated from further consideration under FUSRAP Designated Name: Not Designated Alternate Name: Cornell University and Medical College NY.28-1 Location: New York , New York NY.28-1 Evaluation Year: 1987 NY.28-1 Site Operations: Research activities involving small quantities of radioactive materials in a controlled environment. NY.28-1 Site Disposition: Eliminated - Potential for contamination considered remote - Only research quantities of material used NY.28-1 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Not Specified NY.28-1 Radiological Survey(s): None Indicated Site Status: Eliminated from further consideration under FUSRAP


DOE - Office of Legacy Management -- Titanium Alloys Manufacturing Co Div  

NLE Websites -- All DOE Office Websites (Extended Search)

Titanium Alloys Manufacturing Co Titanium Alloys Manufacturing Co Div of National Lead of Ohio - NY 41 FUSRAP Considered Sites Site: TITANIUM ALLOYS MANUFACTURING CO., DIV. OF NATIONAL LEAD OF OHIO (NY.41) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: Titanium Alloy Metals Titanium Alloy Manufacturing Division Titanium Alloy Manufacturing (TAM) Division of National Lead Company The Titanium Pigment Co. NL Industries ICD/Niagara NY.41-1 NY.41-2 NY.41-3 Location: Niagara Falls , New York NY.41-1 Evaluation Year: 1993 NY.41-4 Site Operations: Produced commercial grade zirconium tetrachloride; conducted research and development relating to solid metallic hydride moderators; and experimental work relative to the conversion of thorium scrap to anhydrous tetrachloride. NY.41-5


LIST OF 361 ACORN COUNCIL AFFLILIATES, SUBSIDIARIES AN ALLIED ORGANIZATION (Note: The word ACORN is not always included in the associated entity name)  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

361 ACORN COUNCIL AFFLILIATES, SUBSIDIARIES, AND ALLIED 361 ACORN COUNCIL AFFLILIATES, SUBSIDIARIES, AND ALLIED ORGANIZATIONS (Note: The word "ACORN" is not always included in the associated entity name) 1. Association of Community Organizations for Reform Now (ACORN) 2. ACORN National Office: Brooklyn, NY 3. ACORN Bronx, NY 4. ACORN Brooklyn, NY 5. ACORN Buffalo, NY 6. ACORN Hempstead, NY 7. ACORN HOUSING CORPORATION Brooklyn, NY 8. PROJECT VOTE Brooklyn, NY 9. MHANY Brooklyn, NY 10. ACORN National Office: Washington, D.C. 11. ACORN Washington, DC 12. ACORN HOUSING CORPORATION Washington, DC 13. ACORN Political 1334 G St, NW Suite B Washington, DC 20005 14. AISJ Washington, DC 15. ACORN National Office: Little Rock, AR 16. ACORN Pine Bluff, AR 17. ACORN Housing Corporation Little Rock, AR


DOE - Office of Legacy Management -- Nuclear Development Corp of America -  

Office of Legacy Management (LM)

Nuclear Development Corp of America Nuclear Development Corp of America - NY 32 FUSRAP Considered Sites Site: NUCLEAR DEVELOPMENT CORP. OF AMERICA (NY.32) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: None Location: 5 New Street , White Plains , New York NY.32-1 Evaluation Year: 1987 NY.32-2 Site Operations: Conducted experiments involving uranium recovery from scrap. NY.32-2 Site Disposition: Eliminated - No Authority - Facility was licensed to handle nuclear materials NY.32-2 NY.32-3 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Uranium NY.32-2 Radiological Survey(s): None Indicated Site Status: Eliminated from consideration under FUSRAP Also see Documents Related to NUCLEAR DEVELOPMENT CORP. OF AMERICA

Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


DOE - Office of Legacy Management -- The Carborundum Co Inc Buffalo Ave  

Office of Legacy Management (LM)

Buffalo Ave Buffalo Ave Plant - NY 31 FUSRAP Considered Sites Site: THE CARBORUNDUM CO., INC., BUFFALO AVE. PLANT (NY.31) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: Carborundum Company NY.31-1 Location: Buffalo Avenue , Niagra Falls , New York NY.31-1 Evaluation Year: 1987 NY.31-1 Site Operations: Produced Zirconium and Hafnium; fabricated nuclear reactor fuel elements and conducted research and development with Plutonium. NY.31-1 Site Disposition: Eliminated - Operated under an AEC license NY.31-1 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Zirconium, Hafnium, Plutonium NY.31-1 Radiological Survey(s): None Indicated Site Status: Eliminated from consideration under FUSRAP Also see


DOE - Office of Legacy Management -- University of Rochester Medical Lab -  

Office of Legacy Management (LM)

Rochester Medical Lab Rochester Medical Lab - NY 20 FUSRAP Considered Sites Site: UNIVERSITY OF ROCHESTER MEDICAL LAB. (NY.20) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: None Location: Rochester , New York NY.20-1 Evaluation Year: 1987 NY.20-1 Site Operations: Research activities involving small quantities of radioactive materials in a controlled environment. NY.20-1 Site Disposition: Eliminated - Potential for contamination remote NY.20-2 Radioactive Materials Handled: Yes Primary Radioactive Materials Handled: Not Specified NY.20-1 Radiological Survey(s): None Indicated Site Status: Eliminated from consideration under FUSRAP Also see Documents Related to UNIVERSITY OF ROCHESTER MEDICAL LAB. NY.20-1 - Aerospace Corporation Letter; C. Young to A. Wallo;


Tracing the History of Nuclear Releases: Determination of 129I in  

E-Print Network (OSTI)

in tree rings and bark samples from four trees at West Valley, NY, and from one tree at Rochester, NY. West Valley was the site of short-lived nuclear fuel reprocessing activities (1966-1972), while

Fehn, Udo


Tracking the Sun II: The Installed Cost of Photovoltaics in the U.S. from 1998-2008  

E-Print Network (OSTI)

RenewableGenerations Rebate Program NY NYSERDA PV IncentiveRebate Program NV 10-100 kW >100 kW ?10 kW NY NYSERDA PV

Barbose, Galen L



Causes of the liability insurance crisis  

Science Journals Connector (OSTI)

...1987 ). HUNTER, R, NY TIMES 0413 F3 ( 1986...in the Economic Studies Program at the Brookings Institution...where constitute premium rebates. Still another criticism...Penpective (New York, NY, 1987). The average accounting...

S Harrington; RE Litan



Binghamton University Showcase of Community Opportunities Participant Contact Information --Tuesday, Sept. 21, 2010  

E-Print Network (OSTI)

-2411 sgdovin@co.broome.ny.us Broome County Public Library Lisa Wise 607-778-6407 lwise@co.broome.ny.us Broome Alison Newcomer 914-632-0022 alison@crossculturalsolutions.org Emeritus at Woodland Manor Krys Zduniak

Suzuki, Masatsugu



National Nuclear Security Administration (NNSA)

45 Yucca Wash Sites 46 Site 8-Yucca Wash Quarry (26Ny1011), 47 Site 9-Sever Tanks (26Ny 1964) 49 Site 10-Yellow Rockshelters 51 Site 11 - Boulder Rockshetters 52...


Mid-American Review of Sociology, Volume 8, Number 1 (SPRING, 1983): Back Matter  

E-Print Network (OSTI)

: Human Sciences Press, 1982. Dougherty, Flavian (ed.). The Meaning of Human Suffering. NY: Human Sciences Press, 1982. Glauber, 1. Peter. Stuttering: A Psychoanalytic Understanding. NY: Human Sciences Press, 1982. Malerstein, A.J. and Mary Ahern. A...



Workbook Contents  

U.S. Energy Information Administration (EIA) Indexed Site

,"Next Release Date:","2272015" ,"Excel File Name:","n3010ny3m.xls" ,"Available from Web Page:","http:tonto.eia.govdnavnghistn3010ny3m.htm" ,"Source:","Energy Information...


Entertainment Technology Center, CMU Internship Survey Results, Dec 2013, May 2014, and Dec 2014  

E-Print Network (OSTI)

Programmer Beijing China 1st Playable Productions Programmer Troy NY Arkadium Intern New York NY Autodesk Intern ­ Graphics Software Development Greenbelt MD Autodesk Game Design Intern San Francisco CA Ba

Matsuda, Noboru


Dynamic energy budget approaches for modelling organismal ageing  

Science Journals Connector (OSTI)

...quantitative approach. New York, NY: Harwood Academic...1928 The rate of living. New York, NY: Knopf. Ricklefs...A. L. M. 2010 Dynamic energy budget theory restores coherence...Nothobranchius furzeri as a new model system for aging studies...



Minimization of a free-energy-like potential for non-equilibrium flow systems at steady state  

Science Journals Connector (OSTI)

...Engl. transl. Brose, H. L.). New York, NY: Macmillan. Prigogine, I...irreversible processes, 3rd edn. New York, NY: Interscience. Prigogine...Sagan, D. 2005 Into the cool: energy flow, thermodynamics and life...



Energy-based analysis of biochemical cycles using bond graphs  

Science Journals Connector (OSTI)

...encouragement to embark on a new research direction...Hill, TL . 1989 Free energy transduction and biochemical cycle kinetics. New York, NY: Springer...cellular systems. New York, NY: Chapman Hall...D . 1977 Power and energy in linearized physical...



Abstract 2830: Energy balance and breast cancer risk among sisters pairs in the Breast Cancer Family Registry Study  

Science Journals Connector (OSTI)

...Philadelphia, PA 7City University of New York - Queens College, Flushing, NY 8Columbia University, New York, NY. Animal models have shown strong evidence that energy restriction inhibits mammary tumor...

Fang Fang Zhang; Esther M. John; Dee W. West; Julia Knight; Irene Andrulis; Saundra Buys; Mary Daly; Beth Stearman; Manleen Kaur; Jamboor Vishwanatha; Alfredo Morabia; and Mary Beth Terry



Parameter estimation for energy balance models with memory  

Science Journals Connector (OSTI)

...model based on the energy balance of the Earth...climate dynamics. New York, NY: Springer...JA Coakley. 1981 Energy balance climate models...Climate sensitivity, energy balance models...Sciences, vol. 119. New York, NY: Springer...



Past Quadrennial Energy Review (QER) Meetings | Department of...  

Energy Savers (EERE)

Past Quadrennial Energy Review (QER) Meetings October 6, 2014 QER Public Meeting in New York, NY: Energy Infrastructure Finance October 6, 2014, 9:30 a.m. New York, NY September 8,...


Energy Conservation Policy Issues and End-Use Scenarios of Savings Potential--Part 5. Energy Efficient Buildings: The Cause of Litigation Against Energy Conservation Building Codes  

E-Print Network (OSTI)

Impact Evaluation of New York State Energy Code (ASHRAE 90-N.Y. , N.Y. : New York State Energy Research and DevelopmentJ. "New York Puts Together Its Own State Energy Policy and

Benenson, P.



EV Community Readiness projects: New York City and Lower Hudson...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

EV Community Readiness projects: New York City and Lower Hudson Valley Clean Communities, Inc. (NY, MA, PA); NYSERDA (ME, NH, VT, MA, RI, CT, NY, NJ, PA, DE, MD, DC) EV Community...


Nomograms Provide Improved Accuracy for Predicting Survival after Radical Cystectomy  

Science Journals Connector (OSTI)

...2nd ed. Wiley Series in Probability and Mathematical Statistics. NY (NY): John Wiley...value, agreement, and kappa statistics were calculated using the...epidemiology Data Collection statistics & numerical data Female Health...

Shahrokh F. Shariat; Pierre I. Karakiewicz; Ganesh S. Palapattu; Gilad E. Amiel; Yair Lotan; Craig G. Rogers; Amnon Vazina; Patrick J. Bastian; Amit Gupta; Arthur I. Sagalowsky; Mark Schoenberg; and Seth P. Lerner



DOE - Office of Legacy Management -- Utica Drop Forge and Tool...  

Office of Legacy Management (LM)

Name: None Location: Utica , New York NY.39-1 Evaluation Year: 1994 NY.39-2 Site Operations: Interest expressed by Utica Drop Forge & Tool Corporation to Conduct Uranium...

Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


State-resolved photochemistry and spectroscopic characterization of atmospherically relevant hydroperoxides  

E-Print Network (OSTI)

screws. Place cladding back in laser and tighten the boltNY82-20 YAG laser showing oscillator cladding. [File: FA.15]NY82-20 YAG laser showing oscillator cladding bolt. [File:

Matthews, Jamie



Comparison of Allocation Schemes for Virtual Machines in Energy-Aware Server Farms  

Science Journals Connector (OSTI)

......and e- Science, New York, NY, USA MGC '09...and Zhao, F. Energy Aware Consolidation...Event-DrivenProcessorPowerManagement.e-Energy'10:Proc. 1st Int. Conf. Energy-Efficient Computing and Networking, New York, NY, USA, pp......

Tien Van Do



Dynamic energy budget theory and population ecology: lessons from Daphnia  

Science Journals Connector (OSTI)

...A. L. M. 2000 Dynamic energy and mass budgets in biological systems. New York, NY: Cambridge University...A. L. M. 2010 Dynamic energy budget theory for metabolic organization. New York, NY: Cambridge University...



Continued Protein Synthesis at Low [ATP] and [GTP] Enables Cell Adaptation during Energy Limitation  

Science Journals Connector (OSTI)

...Arguably, new protein synthesis...crucial when energy supplies are...1971. Adenylate energy charge in Escherichia...University Press, New York, NY. 12 Dinnbier...Effects of reduced energy production on...and Company, New York, NY. 45 Swartz...

Michael C. Jewett; Mark L. Miller; Yvonne Chen; James R. Swartz



Saving Energy in Wireless Local Area Sensor Networks  

Science Journals Connector (OSTI)

......Engineers, Inc. New York, USA. [4...Investigating the Energy Consumption of...INFOCOM 2002), New York, NY, USA...a Hybrid, Energy-efficient Approach...2002) An Energy Efficient MAC...INFOCOM 2002), New York, NY, USA......

Jaime Lloret; Sandra Sendra; Hugo Coll; Miguel Garcia



Bond energy effects on strength, cooperativity and robustness of molecular structures  

Science Journals Connector (OSTI)

...robustness at smaller bond energy lower strength at smaller bond energy bond spacing L 0 higher...biology of the cell. New York, NY: Taylor Francis...Cracks and fracture. New York, NY: Academic Press. Bond energy effects on strength...



Energy flows, metabolism and translation  

Science Journals Connector (OSTI)

...L. , Pascal, R. 2011 Energy sources, self-organization...E. 1946 What's life. New York, NY: McMillan. 14 Lotka...nonequilibrium systems. New York, NY: Wiley. 17 Morowitz, H. , Smith, E. 2007 Energy flow and the organization...



Wave power extraction from a bottom-mounted oscillating water column converter with a V-shaped channel  

Science Journals Connector (OSTI)

...CW Finkl. 2009 Ocean energy. Berlin, Germany...ME . 1981 Ocean wave energy conversion. New York, NY: Wiley Interscience...Justino. 1999 OWC wave energy devices with air flow...mathematical tables. New York, NY: Dover. 23 Mavrakos...



The implications of the declining energy return on investment of oil production  

Science Journals Connector (OSTI)

...power, and society. New York, NY: Wiley. 6 Odum, HT . 1973 Energy, ecology, and economics...Cleveland. 1986 Energy and resource quality...economic process. New York, NY: Wiley. 36...R Kaufmann. 1984 Energy and the U.S. economy...



Decoding the energy landscape: extracting structure, dynamics and thermodynamics  

Science Journals Connector (OSTI)

...of least potential energy. Proc. R. Soc...Introductory graph theory. New York, NY: Dover. 65...pathways, and the energy landscape of protein...global appearance of energy landscapes. Science...scientists and engineers. New York, NY: Wiley. 138...



Energy and the English Industrial Revolution  

Science Journals Connector (OSTI)

...revised edn (1906). New York, NY:Kelley. 10...Wrigley, EA . 2010 Energy and the English Industrial...Cottrell, F . 1955 Energy and society: the relation between energy, social changes...economic development. New York, NY: McGraw-Hill...



DOE - Office of Legacy Management -- Allegheny-Ludlum Steel Corp...  

Office of Legacy Management (LM)

Watervliet, New York and Dunkirk, New York; September 1985 NY.01-4 - AEC Memorandum; Smith to Parsegian; Rolling Schedule; February 18, 1952 NY.01-5 - AEC Report; Production...


DOE - Office of Legacy Management -- Sylvania Corning Nuclear...  

Office of Legacy Management (LM)

to SYLVANIA CORNING NUCLEAR CORP., INC., SYLVANIA LABORATORIES NY.07-1 - Letter, Smith to Norris, Contract at (30-1)-1293- U Metal Requirements, March 5, 1953 NY.07-2 -...


Regulation of the Chlamydomonas Cell Cycle by a Stable, Chromatin-Associated Retinoblastoma Tumor Suppressor Complex  

Science Journals Connector (OSTI)

...Strategies and Techniques. (Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press), pp...transition: More than a cell cycle engine switch. Curr. Opin. Plant Biol...A Laboratory Manual. (Cold Spring Harbor, NY: Cold Spring Harbor...

Bradley J.S.C. Olson; Michael Oberholzer; Yubing Li; James M. Zones; Harjivan S. Kohli; Katerina Bisova; Su-Chiung Fang; Jill Meisenhelder; Tony Hunter; James G. Umen



doi:10.1016/j.gca.2005.04.004 Clay mineral weathering and contaminant dynamics in a caustic aqueous system  

E-Print Network (OSTI)

.S. including Hanford, WA; Savannah River, SC; Idaho Falls, ID; West Valley, NY and Oak Ridge, TN (DOE, 1995

Chorover, Jon


The decay K + n at E787/E949  

E-Print Network (OSTI)

, Upton, NY 11973, USA Abstract. The E787/E949 experiment at the Alternating Gradient Synchroton (AGS


Tracking the Sun VI: An Historical Summary of the Installed Price of Photovoltaics in the United States from 1998 to 2012  

E-Print Network (OSTI)

Renewable Generations Rebate Program NY NYSERDA - PVNY TX NYSERDA - PV Incentive Programs PA No. Systems NV Energy - Renewable Generations Rebate

Barbose, Galen



Reading Difficulty in Adults with Intellectual Disabilities: Analysis with a Hierarchical Latent Trait Model  

E-Print Network (OSTI)

Trait Model Martin Jansche Google, Inc. New York, NY, USA jansche@acm.org Lijun Feng City University

Tomkins, Andrew


A Support Vector Approach to Censored Targets Pannagadatta K. Shivaswamy  

E-Print Network (OSTI)

@cs.columbia.edu Martin Jansche Google, Inc. New York, NY 10011 jansche@acm.org Abstract Censored targets

Wei, Chu



E-Print Network (OSTI)

of Computer Science Columbia University New York, NY 10027 agus@cs.columbia.edu Martin Jansche, Michiel

Tomkins, Andrew

Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


22 RIS N Y T 1/01 Husk hensynet til  

E-Print Network (OSTI)

Rostrup Nielsen betragter det ny kur- sus som et godt initiativ: - Jeg stiller gerne op en anden gang. Det


North American Standard Level VI Inspection Program Update: Ensuring Safe Transportation of Radioactive Material  

Energy.gov (U.S. Department of Energy (DOE))

Presentation made by Carlisle Smith for the NTSF annual meeting held from May 14-16, 2013 in Buffalo, NY


Surface Transportation Board Website Citations  

Energy.gov (U.S. Department of Energy (DOE))

Presentation made by Ray English for the NTSF annual meeting held from May 14-16, 2013 in Buffalo, NY.


E-Print Network 3.0 - apocynin decreases hydrogen Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

& Compression Summary: Hydrogen Delivery Liquefaction & Compression Raymond Drnevich Praxair - Tonawanda, NY Strategic... Initiatives for Hydrogen Delivery Workshop - May 7, 2003...


E-Print Network 3.0 - advanced reciprocating compression Sample...  

NLE Websites -- All DOE Office Websites (Extended Search)

Machines... Hydrogen Delivery Liquefaction & Compression Raymond Drnevich Praxair - Tonawanda, NY Strategic... Liquefaction Hydrogen Compression 12;3 Praxair at a...


Implementation of Section 180(c) of the Nuclear Waste Policy Act  

Energy.gov (U.S. Department of Energy (DOE))

Presentation made by Corinne Macaluso for the NTSF annual meeting held from May 14-16, 2013 in Buffalo, NY.


Measurement of Prompt Fission Neutron Spectrum Using a Gamma Tagging Method E. Blain, A. Daskalakis, Y. Danon  

E-Print Network (OSTI)

, Y. Danon Rensselaer Polytechnic Institute, 110 8th St. Troy NY, 12180 blaine2@rpi.edu INTRODUCTION

Danon, Yaron


U.S. Global Threat Reduction Initiative/U.S.-Origin Nuclear Fuel Removals  

Energy.gov (U.S. Department of Energy (DOE))

Presentation made by Chuck Messick for the NTSF annual meeting held from May 14-16, 2013 in Buffalo, NY.


Jos HolgunVeras, Ph.D. Jack Reily, Ph.D. Carlos Gonzalez, M.S. Wilfredo Yushimito, M.S. Robyn Marquis Felipe Aros  

E-Print Network (OSTI)

the NYMTC area and Manhattan. Table 1 shows the number of origin/destinations pairs in three known counties when the P&R facility is located at the outside County # of Centroids OD Pairs From County to Manhattan Kings NY 511 161,987 Queens NY 434 137,578 Bronx NY 273 86,541 Nassau NY 237 75,129 Figure 3: NYMTC

Mitchell, John E.


Enhancing Railroad Hazardous Materials Transportation Safety Rail Routing  

Energy.gov (U.S. Department of Energy (DOE))

Presentation made by Kevin Blackwell for the NTSF annual meeting held from May 14-16, 2013 in Buffalo, NY



E-Print Network (OSTI)

, Upton, NY 11973, USA W. Kimura, STI Optronics, Inc., Bellevue, WA 98004, USA F. Zhou, Stanford Linear

Brookhaven National Laboratory



E-Print Network (OSTI)

. Yakimenko, BNL, Upton, NY, USA W. D. Kimura STI Optronics, Inc., Bellevue, WA, USA Abstract We present some

Brookhaven National Laboratory


METEOROLOGICAL Journal of Climate  

E-Print Network (OSTI)

for Coastal Research, GKSS Research Centre, Geesthacht, Germany y CREST, City College of New York, NY, USA z

Siebesma, Pier


2012 WOMEN'S SOCCER Spring/Summer Clinics  

E-Print Network (OSTI)

Adams Road 800.225.1517 AIRPORTS Albany International, Albany, NY: 1 hour away Logan Airport, Boston, MA

Aalberts, Daniel P.


Genomic Analysis of Burkholderia And Rhodococcus equi Bacteriophages  

E-Print Network (OSTI)

Bcep1 and the other Bcep781 phages, we can conclude that BcepNY3 is part of the Bcep781 family. 27 TABLE 8. Coding regions of BcepNY3 Gene F/R Function Homology Amino Acid BcepNY3 gp01 R Hyp. conserved Similar... to Bcep1 gp2 MPLIEGKSDKSRSENIRTEVEAGKSPKQAEAI GYAVQRRAQHGADFARDCDMNLRHVMDV AKDYKR BcepNY3 gp02 R Hyp. conserved Similar to Bcep1 gp3 MAGTLTTANSTMYCTTEALFPTAQRIQGYA ADDAFDPDAVENGEYSMGIDGTLSAGFVFN EVPLTITLQADSPSLAQFEQIWMYEFQNRTKL...

Orchard II, Robert C.




E-Print Network (OSTI)

-Saunders powerhouse near Massena, N.Y. It is capable of simulation on varying time increments and includes flow under


Update on Tribal Issues- Mapping Tool, Policy Statement, and Protocol Manual  

Energy.gov (U.S. Department of Energy (DOE))

Presentation made by Stuart Easson for the NTSF annual meeting held from May 14-16, 2013 in Buffalo, NY.


Enabling Energy-Efficient Approaches to Thermal Comfort Using Room Air Motion  

E-Print Network (OSTI)

the ASHRAE Database. Healthy Buildings, Syracuse NY, 13 17of the California Healthy Building Study: A Summary, Indoor

Pasut, Wilmer; Arens, Edward; Zhang, Hui; Kaam, Soazig; Zhai, Yongchao



Nuclear Fuels Storage and Transportation Planning Project (NFST) Program Status  

Energy.gov (U.S. Department of Energy (DOE))

Presentation made by Jeff Williams for the NTSF annual meeting held from May 14-16, 2013 in Buffalo, NY.


Nicole Slevin Marketing & Public Relations  

E-Print Network (OSTI)

Nicole Slevin Marketing & Public Relations nas96@cornell.edu 64 Ferndale-Loomis Rd Liberty, NY Project Opportunity CALLICOON, NY--Sullivan County families, youth, and land owners are invited to explore in Callicoon, NY. Youth interested in becoming involved in a livestock educational project or families

Keinan, Alon

Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


This Week In Petroleum Printer-Friendly Version  

Annual Energy Outlook 2012 (EIA)

are up 0.78 values are up 1.28 Gasoline (NY) 99.2 values are down -3.7 values are up 11.9 Diesel Fuel (NY) 98.3 values are down -2.9 values are up 8.5 Heating Oil (NY) 98.0 values...


Microbial activity of trench leachates from shallow-land, low-level radioactive waste disposal sites.  

Science Journals Connector (OSTI)

...Ill.; Barnwell, S.C.; West Valley, N.Y.; and Richland, Wash...sites at Maxey Flats, Ky., and West Valley, N.Y., contained 14C, 3H...disposal sites of Maxey Flats, Ky., West Valley, N.Y., Sheffield, Ill...

A J Francis; S Dobbs; B J Nine



Tracking the Sun III; The Installed Cost of Photovoltaics in the United States from 1998-2009  

E-Print Network (OSTI)

RenewableGenerations Rebate Program NY NYSERDA PV IncentiveNY OR Program Administrator(s) and Program Name NPC/SPPC RenewableGenerations RebateRebate Program NV 10-100 kW >100 kW ?10 kW NYSERDA PV Incentive Program NY

Barbose, Galen



Tomato Fruit and Seed Colonization by Clavibacter michiganensis subsp. michiganensis through External and Internal Routes  

Science Journals Connector (OSTI)

...michiganensis subsp. michiganensis strains used in this study Strain County of origin Yr collected Voltage (kV/cm) a Transformation...0690-FS Rensselaer, NY 2006 12.5 16 (18) This study 0767-FS Oneida, NY 2007 7.5 16 (27) This study 11015-FS Albany, NY...

Matthew A. Tancos; Laura Chalupowicz; Isaac Barash; Shulamit Manulis-Sasson; Christine D. Smart



Early bioenergetic evolution  

Science Journals Connector (OSTI)

...Stouthamer, AH . 1978 Energy-yielding pathways...Gunsalus, IC). New York, NY: Academic...Morowitz, HJ . 1968 Energy flow in biology. New York, NY: Academic...sulfur for high-energy bonds? In Horizons...pp. 127-142. New York, NY: Academic...



Match Report by State Class of 2008  

E-Print Network (OSTI)

-Preliminary 7 Ophthalmology 1 Orthopaedic Surgery 1 Pediatrics 1 PM&R 3 Radiology-Diagnostic 1 Urology 1 UMDNJ Medicine-Preliminary 1 Pediatrics 1 PM&R 1 Radiology-Diagnostic 1 NY Beth Israel Med Ctr-NY Psychiatry 1 Pediatrics-Primary 1 Radiology-Diagnostic 1 Surgery-Preliminary 1 Urology 1 NY Hosp Med Ctr Queens Medicine

Garfunkel, Eric


A foetal energy balance equation based on maternal exercise and diet  

Science Journals Connector (OSTI)

...metabolic rate in energy metabolismJ.M...H.N TuckerIn Energy metabolism: tissue...corollariesNew York, NY:Raven19-60...processes3rd edn.New York, NY:Wiley...body composition. New York, NY:Springer...of in vivo human energy metabolism during...



Bifurcation theory, adaptive dynamics and dynamic energy budget-structured populations of iteroparous species  

Science Journals Connector (OSTI)

...42, 2nd edn. New York, NY: Springer-Verlag...M. 2000 Dynamic energy and mass budgets...112, 3rd edn. New York, NY: Springer-Verlag...Mathematics, vol. 2. New York, NY: Springer-Verlag...dynamics and dynamic energy budget-structured...



Universal growth law for knot energy of Faddeev type in general dimensions  

Science Journals Connector (OSTI)

...law for knot energy of Faddeev type...SciencesNew York University, New York, NY 10012...University, New York, NY 10033...relating knot energy and knot topology...2nd edn. New York, NY: MSRI...Wang1994Mobius energy of knots and...



Criteria for Selection of Surrogates Used To Study the Fate and Control of Pathogens in the Environment  

Science Journals Connector (OSTI)

...turn, will impact health assessments...Water quality: guidelines, standards...assessment of risk reduction from hand washing...137. Wiley, New York, NY...Henry Holt, New York, NY...J. Wiley, New York, NY...the decimal reduction time. Biomed...Bioaerosol emission rate and plume...

Ryan G. Sinclair; Joan B. Rose; Syed A. Hashsham; Charles P. Gerba; Charles N. Haas



0% 10% 20% 30% Employment Agency (2)  

E-Print Network (OSTI)

Sales Engineer Monessen PA Fuel Cell Energy Advanced Technologies Chemical Engineer Danbury CT OSIsoft Binghamton NY Kiewit Engineer Denver CO McLaren Engineering Group Marine Structural Engineer Nyack NY MTA Associate Engineer New York NY National Fuel Gas Company Associate Engineer Erie PA National Fuel Gas

Doyle, Robert


Computational prediction of methylation status in human genomic sequences  

E-Print Network (OSTI)

H. Bestor , and Michael Q. Zhang* *Cold Spring Harbor Laboratory, Cold Spring Harbor, NY 11724 and ¶Department of Chemical Engineering, Columbia University, New York, NY 10032 Communicated by Michael H. Wigler, Cold Spring Harbor Laboratory, Cold Spring Harbor, NY, April 12, 2006 (received for review October 25


Transient ST-Segment Episode Detection for ECG Beat Classification  

E-Print Network (OSTI)

Transient ST-Segment Episode Detection for ECG Beat Classification Suma C. Bulusu, Miad Faezipour on the application of signal processing and artificial intelligence to the heart signal known as the ECG. The Electrocardiogram (ECG) is an electrical recording of the heart behavior and is crucial to investigating cardiac

Ng, Vincent


Page not found | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

401 - 14410 of 28,905 results. 401 - 14410 of 28,905 results. Download EA-165 NP Energy INC. http://energy.gov/oe/downloads/ea-165-np-energy-inc Homepage Office of Hearings and Appeals http://energy.gov/oha/office-hearings-and-appeals Download Index2.doc http://energy.gov/management/downloads/index2doc Download Sylvania Corporation, Hicksville, NY and Bayside, NY - Addendum to July 8, 2004 Sylvania Corporation, Hicksville, NY and Bayside, NY - Addendum to July 8, 2004, additional_sylvania.pdf memorandum Date: October 6, 2004 Reply to Attn of: Department of Energy Headquarters FOIA... http://energy.gov/management/downloads/sylvania-corporation-hicksville-ny-and-bayside-ny-addendum-july-8-2004 Download Ex Parte Communication, Docket EERE-BT-DET-0033 On January 22, 2013, representatives from the Edison Electric Institute


DOE - Office of Legacy Management -- Carnegie Institute of Washington Dept  

Office of Legacy Management (LM)

Carnegie Institute of Washington Carnegie Institute of Washington Dept of Genetics - NY 0-07 FUSRAP Considered Sites Site: Carnegie Institute of Washington (Dept. of Genetics) (NY.0-07 ) Eliminated from consideration under FUSRAP Designated Name: Not Designated Alternate Name: None Location: Cold Spring Harbor , New York NY.0-07-1 Evaluation Year: 1987 NY.0-07-1 Site Operations: This site served as a meeting place on June 25, 1942 for the 'Executive Committee of S-1,' a group comprised of various military and academic personnel. Discussions took place regarding what contracts should be extended beyond July 1, 1942 for scientific and other technical work done for the U.S. Government. NY.0-07-2 Site Disposition: Eliminated NY.0-07-1 Radioactive Materials Handled: None Indicated


Alternative Fuels Data Center: Alternative Fuel and Advanced Vehicle  

Alternative Fuels and Advanced Vehicles Data Center (EERE)

Laws & Incentives Laws & Incentives Printable Version Share this resource Send a link to Alternative Fuels Data Center: Alternative Fuel and Advanced Vehicle Funding - New York, NY to someone by E-mail Share Alternative Fuels Data Center: Alternative Fuel and Advanced Vehicle Funding - New York, NY on Facebook Tweet about Alternative Fuels Data Center: Alternative Fuel and Advanced Vehicle Funding - New York, NY on Twitter Bookmark Alternative Fuels Data Center: Alternative Fuel and Advanced Vehicle Funding - New York, NY on Google Bookmark Alternative Fuels Data Center: Alternative Fuel and Advanced Vehicle Funding - New York, NY on Delicious Rank Alternative Fuels Data Center: Alternative Fuel and Advanced Vehicle Funding - New York, NY on Digg Find More places to share Alternative Fuels Data Center: Alternative


An Exhibition Review, with a Gallery of Selected Images of "Dutch New York Between East and West: The World of Margrieta van Varick"  

E-Print Network (OSTI)

inventory) included a kast. reviews 89 Exhibit 170. Richard Varick by Ralph Earl, 1787. (New York) Oil on canvas, 31 ?" x 27 ?." Albany Institute of History & Art, NY. A descendant of Margrieta Van Varick, Richard Varick was a notable military..., would have brought back to the West as sale items or souvenirs. We know from her estate inventory (NY, 1696), that Van Varick?s stock in Brooklyn, NY, included exotic goods from artisanal manufac- turers and suppliers in the East Indies...

Mulvihill, Maureen E.



An Exhibition Review, with a Gallery of Selected Images.  

E-Print Network (OSTI)

inventory) included a kast. reviews 89 Exhibit 170. Richard Varick by Ralph Earl, 1787. (New York) Oil on canvas, 31 ?? x 27 ?.? Albany Institute of History & Art, NY. A descendant of Margrieta Van Varick, Richard Varick was a notable military..., would have brought back to the West as sale items or souvenirs. We know from her estate inventory (NY, 1696), that Van Varick?s stock in Brooklyn, NY, included exotic goods from artisanal manufac- turers and suppliers in the East Indies...

Mulvihill, Maureen E.



Revisiting External Validity: Concerns about Trolley Problems and Other Sacrificial Dilemmas in Moral Psychology  

E-Print Network (OSTI)

Memory. New York, NY: Psychology Press. Bandura, A. (1999).Personality and Social Psychology Review, Bartels, D. M. ,Medin (Vol. Eds. ), Psychology of Learning and Motivation,

Bauman, Christopher W; McGraw, A. Peter; Bartels, Daniel M; Warren, Caleb



A Multi-stage Stochastic Integer Programming Approach for ...  

E-Print Network (OSTI)

IBM T. J. Watson Research Center. Yorktown Heights, NY 10598 ... In all of these applications, the expansion of production capacity requires the commitment of...


Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


E-Print Network 3.0 - accelerator design workshop Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Urbana-Champaign Collection: Computer Technologies and Information Sciences 9 J. Scott Berg, Robert Palmer, Alessandro Ruggiero, Dejan Trbojevic BNL, P. O. Box 5000, Upton, NY,...


Piety and activism in Egypt : reflections on framing, motivation, contradiction and desire  

E-Print Network (OSTI)

autonomy in contemporary Egypt - Part III: individual,ideology in contemporary Egypt. Albany, NY: State University2005. Voter Apathy Marks Egypt Poll. BBC News. http://

Lewis, Leslie R.



E-Print Network 3.0 - analyzer vertically scanning Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

University, New York, NY 10027 Effects of Scanning Schemes on Laser Tube Bending Four laser... scanning schemes for tube bending, including point-source circumferential ......


A Combined Water Heater, Dehumidifier, and Cooler (WHDC)  

Energy.gov (U.S. Department of Energy (DOE))

Lead Performer: University of Florida, Gainesville, FloridaPartners: -- Oak Ridge National Laboratory - Oak Ridge, TN -- Stony Brook University - Stony Brook, NY


Language Ideologies and the Media in Post-Soviet Ukraine  

E-Print Network (OSTI)

References Arel, D. 1995. Ukraine: The Temptation of theand Cultural Correction in Ukraine. Ithaca, NY: Cornell2005. Dyczok, M. 2003. Ukraines media landscape, in W. W.

Kulyk, Volodymyr



Tracking the Sun IV: An Historical Summary of the Installed Cost of Photovoltaics in the United States from 1998 to 2010  

E-Print Network (OSTI)

Energy & Climate Commission Solar Rebate Program (a) IL DCEOSolar and Wind Energy Rebate Program MassCEC PV incentive MARenewable NV Generations Rebate Program NY NYSERDA PV

Darghouth, Naim



George Bellows Paints California: A Summer Escape Out West  

E-Print Network (OSTI)

Sun (New York City, NY), December 26, 1915, sec. 5, p. 7.City, New York Sun, December 26, 1915, sec. 5, p. 7. The

Wallace, Margaret Ann



Meeting of the American Association and its Affiliated Societies  

Science Journals Connector (OSTI)

... it was held at New York, N.Y., during the recent convocation week (December 26, 1906, to January 2), under the presidency of the distinguished pathologist Dr. ...



Contract Number: Performance Period FY2011 FY2012 FY2013 FY2014  

Office of Environmental Management (EM)

Fee Information August 2011 through April 2019 EM Contractor Fee September 2014 West Valley Demonstration Project - West Valley, NY Site: 477,476,867 West Valley...


Tracking the Sun: The Installed Cost of Photovoltaics in the U.S. from 1998-2007  

E-Print Network (OSTI)

Rebate Program NJ Clean Energy Program: Customer Onsite Renewable Energy (CORE) Program NYRebate Program MW No. Systems NJ Clean Energy Program: Customer Onsite Renewable Energy Program MW NY

Wiser, Ryan



Natural Gas Heat Pump and Air Conditioner | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Natural Gas Heat Pump and Air Conditioner Natural Gas Heat Pump and Air Conditioner Lead Performer: Thermolift - Stony Brook, NY Partners: -- New York State Energy Research &...


DOE Office of Nuclear Energy Transportation Planning, Route Selection, and Rail Issues  

Energy.gov (U.S. Department of Energy (DOE))

Presentation made by Judith Holm, Alex Thrower, Mark Abkowitz, and Tim Runyon for the NTSF annual meeting held from May 14-16, 2013 in Buffalo, NY.


SciTech Connect:  

Office of Scientific and Technical Information (OSTI)

MO (United States) West Valley Demonstration Project, West Valley, NY (United States) Western Area Power Administration, Golden, CO (United States) Yucca Mountain Project, Las...


Proceedings of Human Language Technology Conference and Conference on Empirical Methods in Natural Language Processing (HLT/EMNLP), pages 692699, Vancouver, October 2005. c 2005 Association for Computational Linguistics  

E-Print Network (OSTI)

for Computational Linguistics Maximum Expected F-Measure Training of Logistic Regression Models Martin Jansche Center for Computational Learning Systems Columbia University New York, NY 10027, USA jansche


E-Print Network 3.0 - aerobic digestion Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Council (WTERT) Collection: Renewable Energy 8 www.manuremanagement.cornell.edu Biogas Casebook Summary: Riverhead, NY 11901 Corwin Duck FarmCorwin Duck Farm Digester type...


E-Print Network 3.0 - autothermal aerobic digestion Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Council (WTERT) Collection: Renewable Energy 12 www.manuremanagement.cornell.edu Biogas Casebook Summary: Riverhead, NY 11901 Corwin Duck FarmCorwin Duck Farm Digester type...


E-Print Network 3.0 - aerobic digestion atad Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

Council (WTERT) Collection: Renewable Energy 11 www.manuremanagement.cornell.edu Biogas Casebook Summary: Riverhead, NY 11901 Corwin Duck FarmCorwin Duck Farm Digester type...


Miniaturized Air to Refrigerant Heat Exchangers | Department...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

- Grenada, MS -- International Copper Association - New York, NY -- Wieland - Ulm, Germany -- Heat Transfer Technologies - Abington, PA DOE Funding: 1,500,000 Cost Share: NA...


Heating, Ventilation, and Air Conditioning Projects | Department...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

- Grenada, MS -- International Copper Association - New York, NY -- Wieland - Ulm, Germany -- Heat Transfer Technologies - Abington, PA Multi-Function Fuel-Fired Heat Pump...


New York | Department of Energy  

Energy Savers (EERE)

commercial, and government Website: www.nyserda.ny.gov Learn More: Read Green Jobs Green New York (GYGNY) case studies Read home performance case studies Read program...

Note: This page contains sample records for the topic "waddington ny sumas" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Overview for Newcomers  

Energy.gov (U.S. Department of Energy (DOE))

Presentation made by Richard Arnold, Rich Pinney, Mike Wangler, and Neal Weber for the NTSF annual meeting held from May 14-16, 2013 in Buffalo, NY.


Seismological Society of America members: July 10, 1951  

Science Journals Connector (OSTI)

...Tinghir Co., 39 Broadway, New York, N.y., 1940. Flores, Rodrigo .......................... Casilla...Rua Santos Pousada 297, Porto, Portugal. Franklin Institute, Library...


Technology makes reds "pop" in LED displays | GE Global Research  

NLE Websites -- All DOE Office Websites (Extended Search)

Televisions Research breakthrough will vastly improve color and crispness of images on LED devices NISKAYUNA, NY, July, 24, 2014 - GE announced today a research breakthrough that...


E-Print Network 3.0 - anden delrapport fra Sample Search Results  

NLE Websites -- All DOE Office Websites (Extended Search)

more money... Rostrup Nielsen betragter det ny kur- sus som et godt initiativ: - Jeg stiller gerne op en anden gang. Det Source: Ris National Laboratory Collection:...


Secretary Chu Announces More than $57 Million in Recovery Act...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

use of renewables. Consolidated Edison Company of New York - Interoperability of Demand Response Resources Demonstration in New York (New York City, NY) - 5,631,110 Consolidated...


Estimating Large-Customer Demand Response Market Potential: Integrating Price and Customer Behavior  

E-Print Network (OSTI)

Estimating Large-Customer Demand Response Market Potential:Syracuse, NY ABSTRACT Demand response (DR) is increasinglyestimated. Introduction Demand response (DR) is increasingly

Goldman, Charles; Hopper, Nicole; Bharvirkar, Ranjit; Neenan, Bernie; Cappers, Peter



A Methodology for Estimating Large-Customer Demand Response Market Potential  

E-Print Network (OSTI)

Estimating Large-Customer Demand Response Market PotentialEstimating Large-Customer Demand Response Market PotentialSyracuse, NY ABSTRACT Demand response (DR) is increasingly

Goldman, Charles; Hopper, Nicole; Bharvirkar, Ranjit; Neenan, Bernie; Cappers, Peter



SciTech Connect:  

Office of Scientific and Technical Information (OSTI)

MA (United States) Brookhaven National Laboratory (BNL), Upton, NY (United States) Carlsbad Field Office (United States) Chicago Operations Office, Argonne, IL (United States)...


NETL F 451.1/1-1, Categorical Exclusion Designation Form  

NLE Websites -- All DOE Office Websites (Extended Search)

SCCCrosscutting Research Div. FY15-16(11012014-10312015) Jason Hissam Troy, NY Additive Manufacturing for Cost Efficient Production of Compact Ceramic Heat Exchangers and...


E-Print Network 3.0 - african buffalos inferred Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

Hall, Buffalo, NY 14260-2000, USA Stuart C. Shapiro (shapiro@cse.buffalo.edu) ... Source: Shapiro, Stuart C. - Department of Computer Science and Engineering, State University of...


orge Ventoci la j Catherine-~ vin Ilustraciones de Ologwagdi  

E-Print Network (OSTI)

mecanismo, Reducci6n de Emisiones por Deforestaci6nyDegradaci6nde Bosques(REDD+),unaestrategiade mitigaci6n

Potvin, Catherine


DOE Awards Support Service Contract | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

MD., and the Separations Process Research Unit (SPRU) in Niskayuna, NY. The support services include: Support related to the technical and engineering activities associated...


E-Print Network 3.0 - arthur d little coal liquefaction process...  

NLE Websites -- All DOE Office Websites (Extended Search)

Review External... Hydrogen Delivery Liquefaction & Compression Raymond Drnevich Praxair - Tonawanda, NY Strategic... Liquefaction Hydrogen Compression 12;3 Praxair at a...


Industrial Scale Demonstration of Smart Manufacturing Achieving...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

TX National Center for Manufacturing Sciences Ann Arbor, MI Nimbis Services McLean, VA Praxair Tonawanda, NY Rockwell Automation Milwaukee, WI For additional information, please...


E-Print Network 3.0 - advanced liquefaction processes Sample...  

NLE Websites -- All DOE Office Websites (Extended Search)

Review External... Hydrogen Delivery Liquefaction & Compression Raymond Drnevich Praxair - Tonawanda, NY Strategic... Liquefaction Hydrogen Compression 12;3 Praxair at a...


E-Print Network 3.0 - adiabatic compressed air Sample Search...  

NLE Websites -- All DOE Office Websites (Extended Search)

& Compression Summary: Hydrogen Delivery Liquefaction & Compression Raymond Drnevich Praxair - Tonawanda, NY Strategic... Liquefaction Hydrogen Compression 12;3 Praxair at a...


Other Participants 1998 | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

Beavercreek High School , Beavercreek , OH Bethlehem High School , Delmar , NY Bishop Kelly High School , Tulsa , OK Centennial High School , Peoria , AZ Chapel Hill High School...


Ricksttra 1:1; Ricksattra 1:1.  

E-Print Network (OSTI)

?? Ricksttra 1:1 r en fastighet p 42 hektar placerad i Eker. r 2010 fick fastighten en ny gare med nya ambitioner, men med lite (more)

Asmar, Dilmon



Clear Skies  

NLE Websites -- All DOE Office Websites (Extended Search)

A. A. lacis NASA Goddard Space Flight Center Institute for Space Studies New York, NY 10025 "convective adjustment"takes place. Energy is transported upward within the troposphere...


ARM - Program Participants  

NLE Websites -- All DOE Office Websites (Extended Search)

Space Studies, New York, NY NASA - Goddard Space Flight Center, Greenbelt, MD NASA - Jet Propulsion Laboratory, Pasadena, CA NASA - Langley Research Center, Hampton, VA LaRC's...