National Library of Energy BETA

Sample records for wa seattle spokane

  1. Category:Seattle, WA | Open Energy Information

    Open Energy Info (EERE)

    Seattle, WA Jump to: navigation, search Go Back to PV Economics By Location Media in category "Seattle, WA" The following 16 files are in this category, out of 16 total....

  2. Climate Action Champions: Seattle, WA | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Seattle, WA Climate Action Champions: Seattle, WA The City of Seattle has long been at the leading edge of environmental innovation. Seattle has been recycling for over 25 years and today has one of the highest recycling and composting rates nationwide. In 2005, Seattle City Light became the first electric utility in the nation to be carbon neutral. Recently, Seattle was recognized as the “most sustainable city in the nation” by STAR communities with a 5-STAR rating and the highest

  3. DOE Zero Energy Ready Home Case Study: Dwell Development, Seattle, WA,

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Systems Home | Department of Energy Dwell Development, Seattle, WA, Systems Home DOE Zero Energy Ready Home Case Study: Dwell Development, Seattle, WA, Systems Home Case study of a DOE Zero Energy Ready Home in Seattle, WA, that scored HERS 34 without PV. This 2,000-square-foot system home has R-45 double-stud walls, an unvented flat roof with 2 inches of spray foam plus 18 inches blown cellulose, R-42 XPS under slab, triple-pane windows, and a ductless mini-split heat pump. PDF icon Dwell

  4. EA-1855: Creston-Bell Rebuild Project, Spokane and Lincoln Counties, WA

    Broader source: Energy.gov [DOE]

    Draft Environmental Assessment DOE will prepare an EA to evaluate the potential environmental impacts from rebuilding the Creston-Bell No. 1 115-kV transmission line, including the replacement of wood poles and associated structural components and conductor and access road improvements. The 54-mile long, wood pole line extends from the Bonneville Power Administration (BPA) Creston substation to the BPA Bell substation near Spokane in Lincoln and Spokane Counties, Washington.

  5. DOE Zero Energy Ready Home Case Study: TC Legend, Seattle, WA, Custom Home

    Broader source: Energy.gov [DOE]

    Case study of a DOE Zero Energy Ready Home in Seattle, WA, that scored HERS 37 without PV, HERS -1 with PV. This 1,915-square-foot custom home has SIP walls and roof, R-20 XPS under the slab, triple-pane windows, an air to water heat pump for radiant heat, and balanced ventilation with timer-controlled fans to bring in and exhaust air.

  6. Spokane Seattle Portland Y

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Um tan um Rid ge R a t t l e s n a k e M o u n t a i n G a b l e M o u n t a i n G a b l e B u t t e Sa dd le M ou nt a in s H w y . 2 4 0 Hwy. 24 Hw y. 243 H w y . 2 4 4 0 0 4 0 0 ...

  7. DOE Zero Energy Ready Home: Montlake Modern - Seattle, Washington...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Montlake Modern - Seattle, Washington DOE Zero Energy Ready Home: Montlake Modern - Seattle, Washington Case study of a DOE Zero Energy Ready Home in Seattle, WA, that scored HERS ...

  8. Climate Leadership Conference (Seattle, WA)

    Broader source: Energy.gov [DOE]

    Sustainability leaders from the private, public, academic, and non-profit communities meet to explore market transformation, carbon management, and building climate resilience on an annual basis.

  9. Seattle Biodiesel aka Seattle BioFuels | Open Energy Information

    Open Energy Info (EERE)

    Seattle Biodiesel aka Seattle BioFuels Jump to: navigation, search Name: Seattle Biodiesel (aka Seattle BioFuels) Place: Seattle, Washington Sector: Renewable Energy Product:...

  10. Spokane, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Spokane, Washington: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 47.6587802, -117.4260466 Show Map Loading map... "minzoom":false,"mappings...

  11. Spokane County, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    in Spokane County, Washington Avista Corp City of Cheney, Washington (Utility Company) Modern Electric Water Company Places in Spokane County, Washington Airway Heights, Washington...

  12. Spokane Valley, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    city in Spokane County, Washington.1 Utility Companies in Spokane Valley, Washington Modern Electric Water Company References US Census Bureau Incorporated place and minor...

  13. DOE Zero Energy Ready Home Case Study: Dwell Development, Seattle...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Case study of a DOE Zero Energy Ready Home in Seattle, WA, that scored HERS 34 without PV. This 2,000-square-foot system home has R-45 double-stud walls, an unvented flat roof with ...

  14. Seattle, Washington: Solar in Action (Brochure), Solar America Cities,

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Efficiency & Renewable Energy (EERE) | Department of Energy Seattle, Washington: Solar in Action (Brochure), Solar America Cities, Energy Efficiency & Renewable Energy (EERE) Seattle, Washington: Solar in Action (Brochure), Solar America Cities, Energy Efficiency & Renewable Energy (EERE) This brochure provides an overview of the challenges and successes of Seattle, WA, a 2008 Solar America City awardee, on the path toward becoming a solar-powered community.

  15. Seattle, Washington: Solar in Action (Brochure)

    SciTech Connect (OSTI)

    Not Available

    2011-10-01

    This brochure provides an overview of the challenges and successes of Seattle, WA, a 2008 Solar America City awardee, on the path toward becoming a solar-powered community. Accomplishments, case studies, key lessons learned, and local resource information are given.

  16. Spokane Tribal Hatchery, 2003 Annual Report.

    SciTech Connect (OSTI)

    Peone, Tim L.

    2004-05-01

    Due to the construction and operation of Grand Coulee Dam (1939), anadromous salmon have been eradicated and resident fish populations permanently altered in the upper Columbia River region. Federal and private hydropower dam operations throughout the Columbia River system severely limits indigenous fish populations in the upper Columbia. Artificial production has been determined appropriate for supporting a harvestable fishery for kokanee salmon (Oncorhynchus nerka) and rainbow trout (Oncorhynchus mykiss) in Lake Roosevelt and Banks Lake (Grand Coulee Dam impoundments). A collaborative multi-agency artificial production program for the Lake Roosevelt and Banks Lake fisheries exists consisting of the Spokane Tribal Hatchery, Sherman Creek Hatchery, Ford Trout Hatchery and the Lake Roosevelt Kokanee and Rainbow Trout Net Pen Rearing Projects. These projects operate complementary of one another to target an annual release of 1 million yearling kokanee and 500,000 yearling rainbow trout for Lake Roosevelt and 1.4 million kokanee fry/fingerlings for Banks Lake. Combined fish stocking by the hatcheries and net pen rearing projects in 2003 included: 899,168 kokanee yearlings released into Lake Roosevelt; 1,087,331 kokanee fry/fingerlings released into Banks Lake, 44,000 rainbow trout fingerlings and; 580,880 rainbow trout yearlings released into Lake Roosevelt. Stock composition of 2003 releases consisted of Lake Whatcom kokanee, 50:50 diploid-triploid Spokane Trout Hatchery (McCloud River) rainbow trout and Phalon Lake red-band rainbow trout. All kokanee were marked with either thermal, oxytetracyline or fin clips prior to release. Preliminary 2003 Lake Roosevelt fisheries investigations indicate hatchery/net pen stocking significantly contributed to harvestable rainbow trout and kokanee salmon fisheries. An increase in kokanee harvest was primarily owing to new release strategies. Walleye predation, early maturity and entrainment through Grand Coulee Dam continues to have a negative impact on adult kokanee returns and limits the success of hatchery/net pen stocking on the number of harvestable fish. Preliminary results of gonad necropsies indicate a reduced incidence of precocious kokanee produced at the Spokane Tribal Hatchery in 2003. This was a probable attribute of change in hatchery rearing practices employed on 2002 brood year kokanee produced in 2003, primarily thermal manipulation and feed protein source. Kokanee and rainbow trout fingerlings transferred to Lake Roosevelt and Banks Lake net pen rearing operations in the fall of 2003 for subsequent release as yearlings in 2004 consisted of 645,234 rainbow trout and 627,037 kokanee salmon. A total of 590,000 Lake Whatcom kokanee fingerlings were carried over at the Spokane Tribal Hatchery for stocking as yearlings in 2004. Recommendations for future hatchery/net pen operations include use of stocks compatible or native to the upper Columbia River, continue hatchery-rearing practices to reduce precocity rates of kokanee and continue new kokanee stocking strategies associated with increased kokanee harvest rates.

  17. Spokane Tribal Hatchery, 2005 Annual Report.

    SciTech Connect (OSTI)

    Peone, Tim L.

    2006-03-01

    Due to the construction and operation of Grand Coulee Dam (1939), anadromous salmon have been eradicated and resident fish populations permanently altered in the upper Columbia River region. Federal and private hydropower dam operations throughout the Columbia River system severely limits indigenous fish populations in the upper Columbia. Artificial production has been determined appropriate for supporting harvestable fisheries for kokanee salmon (Oncorhynchus nerka) and rainbow trout (Oncorhynchus mykiss) in Lake Roosevelt and Banks Lake (Grand Coulee Dam impoundments). The Spokane Tribe, Washington Department of Fish and Wildlife, Colville Confederated Tribes and Lake Roosevelt Development Association/Lake Roosevelt Volunteer Net Pen Project are cooperating in a comprehensive artificial production program to produce kokanee salmon (Oncorhynchus nerka) and rainbow trout (Oncorhynchus mykiss) for annual releases into the project area. The program consists of the Spokane Tribal Hatchery, Sherman Creek Hatchery, Ford Trout Hatchery and Lake Roosevelt Rainbow Trout Net Pen Rearing Projects. The Lake Roosevelt and Banks Lake Fisheries Evaluation Program monitor and evaluates release strategies and production methods for the aforementioned projects. Between 1985 and 2005 the projects have collectively produced up to 800,000 rainbow trout and 4 million kokanee salmon for release into Lake Roosevelt and 1.4 million kokanee fry for Banks Lake annually. In 2005, the annual release goal included 3.3 million kokanee fry, 475,000 kokanee yearlings and 500,000 rainbow trout yearlings. Fish produced by this project in 2005 to meet collective fish production and release goals included: 3,446,438 kokanee fingerlings, 347,730 rainbow trout fingerlings and 525,721 kokanee yearlings. Kokanee yearlings were adipose fin clipped before release. Stock composition consisted of Meadow Creek and Lake Whatcom kokanee, diploid-triploid Spokane Trout Hatchery (McCloud River) rainbow trout and Phalon Lake red-band rainbow trout. All kokanee were marked with either thermal, oxytetracyline or fin clips prior to release. Preliminary 2004 Lake Roosevelt fisheries investigations indicate hatchery/net pen stocking significantly contributed to rainbow trout catch and harvest rates while the impact on the kokanee fishery was minimal. Success of the Lake Roosevelt kokanee artificial production program appears to be limited primarily owing to predation, precocity and high entrainment rates through Grand Coulee Dam. Recommendations for future hatchery/net pen operations include use of stocks compatible or native to the upper Columbia River, continue kokanee fry and post-smolt releases, 100% triploid hatchery stock rainbow trout used and adipose fin clip hatchery stock rainbow trout prior to release. The Spokane Tribal Hatchery is funded by the Bonneville Power Administration under directives by the Northwest Power Conservation Council Columbia River Basin Fish & Wildlife Program, Resident Fish Substitution Measures, 1987 to current (Subbasin Plan), as partial mitigation for anadromous and resident fish losses in the blocked areas above Chief Joseph and Grand Coulee Dams.

  18. Spokane Tribal Hatchery, 2002 Annual Report.

    SciTech Connect (OSTI)

    Peone, Tim L.

    2003-03-01

    The Spokane Tribal Hatchery (Galbraith Springs) project originated from the Northwest Power Planning Council (NPPC) 1987 Columbia Basin Fish and Wildlife Program. The goal of this project is to aid in the restoration and enhancement of the Lake Roosevelt and Banks Lake fisheries adversely affected by the construction and operation of Grand Coulee Dam. The objective is to produce kokanee salmon and rainbow trout for release into Lake Roosevelt for maintaining a viable fishery. The goal and objective of this project adheres to the NPPC Resident Fish Substitution Policy and specifically to the biological objectives addressed in the NPPC Columbia River Basin Fish and Wildlife Program to mitigate for hydropower related fish losses in the blocked area above Chief Joseph/Grand Coulee Dams.

  19. Spokane Tribal Hatchery, 2004 Annual Report.

    SciTech Connect (OSTI)

    Peone, Tim L.

    2005-03-01

    Due to the construction and operation of Grand Coulee Dam (1939), anadromous salmon have been eradicated and resident fish populations permanently altered in the upper Columbia River region. Federal and private hydropower dam operations throughout the Columbia River system severely limits indigenous fish populations in the upper Columbia. Artificial production has been determined appropriate for supporting a harvestable fishery for kokanee salmon (Oncorhynchus nerka) and rainbow trout (Oncorhynchus mykiss) in Lake Roosevelt and Banks Lake (Grand Coulee Dam impoundments). A collaborative multi-agency artificial production program for the Lake Roosevelt and Banks Lake fisheries exists consisting of the Spokane Tribal Hatchery, Sherman Creek Hatchery, Ford Trout Hatchery and the Lake Roosevelt Kokanee and Rainbow Trout Net Pen Rearing Projects. These projects operate complementary of one another to target an annual release of 1 million yearling kokanee and 500,000 yearling rainbow trout for Lake Roosevelt and 1.4 million kokanee fry/fingerlings for Banks Lake. Fish produced by this project in 2004 to meet collective fish production and release goals included: 1,655,722 kokanee fingerlings, 537,783 rainbow trout fingerlings and 507,660 kokanee yearlings. Kokanee yearlings were adipose fin clipped before release. Stock composition consisted of Lake Whatcom kokanee, 50:50 diploid-triploid Spokane Trout Hatchery (McCloud River) rainbow trout and Phalon Lake red-band rainbow trout. All kokanee were marked with either thermal, oxytetracyline or fin clips prior to release. Preliminary 2004 Lake Roosevelt fisheries investigations indicate hatchery/net pen stocking significantly contributed to harvestable rainbow trout and kokanee salmon fisheries. An increase in kokanee harvest was primarily owing to new release strategies. Walleye predation, early maturity and entrainment through Grand Coulee Dam continues to have a negative impact on adult kokanee returns and limits the success of hatchery/net pen stocking on the number of harvestable fish. Recommendations for future hatchery/net pen operations include use of stocks compatible or native to the upper Columbia River, continue hatchery-rearing practices to reduce precocity rates of kokanee and continue new kokanee stocking strategies associated with increased kokanee harvest rates.

  20. DOE ZERH Case Study: Dwell Development, Reclaimed Modern, Seattle, WA

    SciTech Connect (OSTI)

    none,

    2015-09-01

    Case study of a DOE 2015 Housing Innovation Award winning custom home in the cold climate that got a HERS 30 without PV, with 2x8 24” on center walls with blown fiberglass and 4” polysio rigid foam; basement with 2” XPS interior, 4” under slab, 4” exterior of foundation wall; vented attic with R-100 blown cellulose; wo air-to-air heat pumps SEER 14.1; HSPF 9.6; heat pump water heater.

  1. HERO Seattle Mariners

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    HERO Seattle Mariners vs. St. Louis Cardinals Sunday, June 26, 2016 1:10 pm game time $65/person Payments over $250 must be cashier's check or cash $65/person includes bus ride, game ticket, snacks on the bus and pizza on the way home! Send payment to Linda Meigs (376-5785) @ A3-01 Enjoy Sunday afternoon at Safeco Field, cheering on your favorite team!

  2. Seattle Data Dashboard | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data Dashboard Seattle Data Dashboard The data dashboard for Seattle, Washington, a partner in the Better Buildings Neighborhood Program. File Seattle Data Dashboard More Documents & Publications Cincinnati Data Dashboard Austin Energy Data Dashboard Massachusetts -- SEP Data Dashboard

  3. Seattle, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Institutions in Seattle, Washington ARCH Venture Partners (Washington) Northwest National Marine Renewable Energy Center Washington Technology Center Registered Networking...

  4. Solar Works in Seattle: Domestic Hot Water

    Broader source: Energy.gov [DOE]

    Seattle's residential solar hot water workshop. Content also covers general solar resource assessment, siting, and financial incentives.

  5. Stormwater runoff policy on the Spokane/Rathdrum Prairie Aquifer

    SciTech Connect (OSTI)

    Hale, E.O.

    1990-01-01

    The Panhandle Health District, in conjunction with the Idaho Department of Water Resources, is developing a stormwater runoff control program under the US EPA Wellhead Protection Program. The goal of the project is to protect the Spokane Valley/Rathdrum Prairie Aquifer from widespread subsurface disposal of stormwater runoff via shallow injection wells. Studies conducted by the health district in 1976 and 1977 established that areas downgradient from urban land uses had elevated nitrate level sand that the aquifer is vulnerable to contamination from surface activities. The stormwater runoff controls are being developed in conjunction with similar programs, such as chemical storage and use, solid waste and subsurface sewage disposal. The expected result will be a groundwater management system that protects the resource by preventing contamination rather than a program that responds to poor water quality with costly remedial action.

  6. Indian Community Development Block Grant Program Workshop - Seattle...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Indian Community Development Block Grant Program Workshop - Seattle Indian Community Development Block Grant Program Workshop - Seattle May 18, 2016 9:00AM to 3:00PM PDT Seattle, ...

  7. SEATTLE HELPS COMMUNITIES POWER BUILDINGS EFFICIENTLY

    Broader source: Energy.gov [DOE]

    Seattle, Washington, is a diverse, environmentally aware city with a variety of languages, cultures, and income levels. Leveraging relationships with public, private, and nonprofit partners, the...

  8. Seattle, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Network Puget Sound Clean Air Agency Puget Sound Clean Cities Coalition Washington Clean Technology Alliance Registered Policy Organizations in Seattle, Washington Northwest SEED...

  9. Alternative Fuels Data Center: Seattle's Waste Haulers are Going Green

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Seattle's Waste Haulers are Going Green to someone by E-mail Share Alternative Fuels Data Center: Seattle's Waste Haulers are Going Green on Facebook Tweet about Alternative Fuels Data Center: Seattle's Waste Haulers are Going Green on Twitter Bookmark Alternative Fuels Data Center: Seattle's Waste Haulers are Going Green on Google Bookmark Alternative Fuels Data Center: Seattle's Waste Haulers are Going Green on Delicious Rank Alternative Fuels Data Center: Seattle's Waste Haulers are Going

  10. Seattle, Washington: Solar in Action (Brochure), Solar America...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Seattle, Washington Includes case studies on: * "Solar Works in Seattle" Workshops * Interconnection Training for Utility Staff * "Community Solar" Financing Program Implementation ...

  11. Seattle, Washington: Solar in Action (Brochure), Solar America...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Seattle, Washington: Solar in Action (Brochure), Solar America Cities, Energy Efficiency & Renewable Energy (EERE) Seattle, Washington: Solar in Action (Brochure), Solar America ...

  12. City of Seattle, Washington (Utility Company) | Open Energy Informatio...

    Open Energy Info (EERE)

    Light) Jump to: navigation, search Name: Seattle City of Place: Washington Phone Number: (206) 684-3000 Website: www.seattle.govlight Twitter: @SEACityLight Facebook: https:...

  13. DOE Zero Energy Ready Home Case Study: Montlake Modern - Seattle, Washington

    SciTech Connect (OSTI)

    none,

    2014-11-01

    This case study describes a DOE Zero Energy Ready Home in Seattle, WA, that scored HERS 42 without PV and a -1 with PV. This 3,192 ft2 custom home has 6-inch SIP walls, a 12-inch SIP roof, an R-28 ICF-insulated foundation slab edge with R-20 rigid foam under the slab; an air-to-water heat pump plus radiant floor heat; 100% LED lighting; filtered-fan-powered fresh air intake; triple-pane windows, 9.7 kWh PV for electric car charging station.

  14. Spotlight on Seattle, Washington: Community Partnerships Work to Extend

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Program Reach | Department of Energy Seattle, Washington: Community Partnerships Work to Extend Program Reach Spotlight on Seattle, Washington: Community Partnerships Work to Extend Program Reach Spotlight on Seattle, Washington: Community Partnerships Work to Extend Program Reach, as posted on the U.S. Department of Energy's Better Buildings Neighborhood Program website. PDF icon Spotlight on Seattle, Washington More Documents & Publications Seattle Summary of Reported Data Better

  15. Alternative Fuels Data Center: Seattle Bakery Delivers With Biodiesel

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Trucks Seattle Bakery Delivers With Biodiesel Trucks to someone by E-mail Share Alternative Fuels Data Center: Seattle Bakery Delivers With Biodiesel Trucks on Facebook Tweet about Alternative Fuels Data Center: Seattle Bakery Delivers With Biodiesel Trucks on Twitter Bookmark Alternative Fuels Data Center: Seattle Bakery Delivers With Biodiesel Trucks on Google Bookmark Alternative Fuels Data Center: Seattle Bakery Delivers With Biodiesel Trucks on Delicious Rank Alternative Fuels Data

  16. Alternative Fuels Data Center: Seattle Rideshare Fleet Adds EVs, Enjoys

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Success Seattle Rideshare Fleet Adds EVs, Enjoys Success to someone by E-mail Share Alternative Fuels Data Center: Seattle Rideshare Fleet Adds EVs, Enjoys Success on Facebook Tweet about Alternative Fuels Data Center: Seattle Rideshare Fleet Adds EVs, Enjoys Success on Twitter Bookmark Alternative Fuels Data Center: Seattle Rideshare Fleet Adds EVs, Enjoys Success on Google Bookmark Alternative Fuels Data Center: Seattle Rideshare Fleet Adds EVs, Enjoys Success on Delicious Rank Alternative

  17. Community Solar Public Opinion Research Results (Seattle)

    Broader source: Energy.gov [DOE]

    500 Seattle City Light customers were polled to determine interest in a community solar program, how people would participate and at what price levels. This is a presentation of the results.

  18. Seattle City Light- Vending Machine Rebate Program

    Broader source: Energy.gov [DOE]

    Seattle City Light offers qualifying customers $80 rebates for the purchase of VendingMiser Energy Efficient Vending Machines. VendingMiser reduces the energy consumption of cold drink vending...

  19. Seattle City Light- New Construction Incentive Program

    Broader source: Energy.gov [DOE]

    Seattle City Light (SCL) works with the design teams of their commercial and industrial customers to create high performance buildings with low long-term operating costs. The utility provides...

  20. EA-1741: Seattle Steam Company Combined Heat and Power at Post Street in Downtown Seattle, Washington

    Broader source: Energy.gov [DOE]

    This EA evaluates the environmental impacts of a proposal to provide an American Recovery Act and Reinvestment Act of 2009 financial assistance grant to Seattle Steam Company to facilitate the installation of a combined heat and power plant in downtown Seattle, Washington. NOTE: This Project has been cancelled.

  1. EIS-0091: Garrison-Spokane 500-kV Transmission Project

    Broader source: Energy.gov [DOE]

    The U.S. Department of Energy's Bonneville Power Administration (BPA) developed this statement to evaluate the environmental impacts of constructing between 254 and 271 miles of 500-kilovolt transmission line across western Montana and northern Idaho to the Spokane area in order to reinforce a section of the BPA electric power grid and to permit reliable integration of 1,240 megawatts of power produced by Colstrip Units 3 and 4, for use in Montana and throughout the Northwest.

  2. Orchestrating Market Success: Seattle Market Introduction Workshop Video

    Broader source: Energy.gov [DOE]

    View the video from Jim Brodrick's opening presentation at the July 2011 DOE SSL Market Introduction Workshop in Seattle, Washington.

  3. Washington: Community Power Works is Building a More Efficient Seattle

    Office of Energy Efficiency and Renewable Energy (EERE)

    The City of Seattle and several community organizations are working to improve energy efficiency and reduce carbon emissions.

  4. Seattle Structure Named WAN Sustainable Building of 2013

    Broader source: Energy.gov [DOE]

    World Architecture News (WAN) recently named the Bullit Center in Seattle, Washington, as the WAN Sustainable Building of the Year.

  5. DOE Zero Energy Ready Home Case Study: TC Legend, Seattle, WA...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and roof, R-20 XPS under the slab, triple-pane windows, an air to water heat pump for radiant heat, and balanced ventilation with timer-controlled fans to bring in and exhaust air. ...

  6. BayWa Group | Open Energy Information

    Open Energy Info (EERE)

    BayWa Group Jump to: navigation, search Name: BayWa Group Place: Munich, Germany Zip: 81925 Sector: Services, Solar Product: Germany-based company with international operations...

  7. Advance Patent Waiver W(A)2011-006 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    WA05022DOWCHEMICALCOMPANYWaiverofdomesticandForeig.pdf WA04033CARGILLWaiverofPatentRightstoCARGILLDOWNL.pdf WA00022CARGILLDOWPOLYMERSLLCWaiverofDomest...

  8. Text-Alternative Version: Seattle Market Introduction Workshop Video

    Broader source: Energy.gov [DOE]

    Following is a text version of Jim Brodrick's welcome presentation video from the July 2011 DOE SSL Market Introduction Workshop in Seattle, Washington.

  9. Seattle HomeWise: Weatherization | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Program Type Grant Program Rebate Amount Varies Summary The City of Seattle offers free weatherization services to residents who meet income qualifications. Services are...

  10. Seattle Summary of Reported Data | Department of Energy

    Energy Savers [EERE]

    Washington. PDF icon Seattle Summary of Reported Data More Documents & Publications Virginia -- SEP Summary of Reported Data NYSERDA Summary of Reported Data University Park...

  11. Seattle City Light- Commercial Energy Efficiency Rebate Programs

    Broader source: Energy.gov [DOE]

    Seattle City Light offers a variety of rebates to commercial and industrial customers through the Energy Smart Services Program. Energy Smart Services are available to commercial businesses,...

  12. Seattle City Light- Built Smart Program for Builders and Architects

    Broader source: Energy.gov [DOE]

    Seattle City Light provides incentives for builders, developers, and architects who construct energy efficient multi-family buildings. The program is designed to encourage the construction of...

  13. Seattle City Light- Residential Energy Efficiency Rebate Program

    Broader source: Energy.gov [DOE]

    Seattle City Light provides rebates to its customers for energy audits and purchasing and installing energy saving clothes washers, refrigerators, heat pump water heaters, ductless heat pumps,...

  14. Seattle, Washington A White House Climate Action Champions Case...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... City of Seattle recognizes its own energy impact and the importance of leading by example. ... of their lowest performers. 6 ResourcesLearning More 1. Contacts Authors Sandra Mallory, ...

  15. DOE Tour of Zero: The Net Zero in Seattle by TC Legend Homes...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Net Zero in Seattle by TC Legend Homes DOE Tour of Zero: The Net Zero in Seattle by TC Legend Homes Addthis 1 of 15 Northwest builder TC Legend Homes has built a certified U.S. DOE...

  16. Advance Patent Waiver W(A)2002-023 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2-023 Advance Patent Waiver W(A)2002-023 PDF icon Advance Patent Waiver W(A)2002-023 More Documents & Publications Advance Patent Waiver W(A)2006-028 WA05056IBMWATSONRESEARCH...

  17. DOE Commercial Building Energy Asset Rating Program Focus Groups with Primary Stakeholders in Seattle-- Final Report

    Broader source: Energy.gov [DOE]

    Collection, assessment, and analysis of Seattle stakeholder input and opinions regarding the commercial building energy asset rating program.

  18. WA_00_022_CARGILL_DOW_POLYMERS_LLC_Waiver_of_Domestic_and_Fo...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    22CARGILLDOWPOLYMERSLLCWaiverofDomesticandFo.pdf WA00022CARGILLDOWPOLYMERSLLCWaiverofDomesticandFo.pdf PDF icon WA00022CARGILLDOWPOLYMERSLLCWaiverofDom...

  19. WA_98_001_REYNOLDS_METALS_COMPANY_Waiver_of_Domestic_and_For...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8001REYNOLDSMETALSCOMPANYWaiverofDomesticandFor.pdf WA98001REYNOLDSMETALSCOMPANYWaiverofDomesticandFor.pdf PDF icon WA98001REYNOLDSMETALSCOMPANYWaiverofD...

  20. WA_02_035_BP_SOLAR_INTERNATIONAL_Waiver_of_Domestic_and_Fore...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    INTERNATIONALWaiverofDomesticandFore.pdf More Documents & Publications WA06016BPSOLARINTERNATIONALWaiverofPatentRightsUnd.pdf WA02034BPSOLARINTERNATIONALLLCW...

  1. WA_03_010_SHELL_SOLAR_INDUSTRIES_Waiver_of_Domestic_and_Fore...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    INDUSTRIESWaiverofDomesticandFore.pdf More Documents & Publications WA02039SHELLSOLARSYSTEMSWaiverofPatentRightsUnder.pdf WA05059SHELLSOLARINDUSTRIESLPWaive...

  2. Spokane Wall Insulation Project: a field study of moisture damage in walls insulated without a vapor barrier

    SciTech Connect (OSTI)

    Tsongas, G.

    1985-09-01

    Considerable uncertainty has existed over whether or not the addition of wall insulation without a vapor barrier might increase the risk of moisture damage to the structure. Although it was concluded from a 1979 field study that there is no such risk in mild climates like that of Portland, Oregon (4792 degree-days), it was not clear if a problem might exist in colder climates. Thus, a second major field study was undertaken in Spokane, Washington (6835 degree-days) aimed at finding out if such a moisture problem really exists. This report describes that study and its results and conclusions. During the study the exterior walls of 103 homes were opened, of which 79 had retrofitted cellulose, rock wool, or fiberglass, and 24 were uninsulated as a control group. Field and laboratory test results are presented which, contrary to diffusion theory predictions, show the absence of moisture accumulation and consequent moisture damage caused by the addition of retrofitted wall insulation. Infrared thermography results giving the percentage of wall insulation void area for 30 of the test homes are also presented. The study strongly concludes that the addition of wall insulation without a vapor barrier does not cause moisture problems in existing homes in climates similar to that of Spokane. Future research needs are described, and the overall advisability of future retrofitting of wall insulation is discussed. 23 refs., 7 figs., 16 tabs.

  3. Urban Wood-Based Bio-Energy Systems in Seattle

    SciTech Connect (OSTI)

    Stan Gent, Seattle Steam Company

    2010-10-25

    Seattle Steam Company provides thermal energy service (steam) to the majority of buildings and facilities in downtown Seattle, including major hospitals (Swedish and Virginia Mason) and The Northwest (Level I) Regional Trauma Center. Seattle Steam has been heating downtown businesses for 117 years, with an average length of service to its customers of 40 years. In 2008 and 2009 Seattle Steam developed a biomass-fueled renewable energy (bio-energy) system to replace one of its gas-fired boilers that will reduce greenhouse gases, pollutants and the amount of waste sent to landfills. This work in this sub-project included several distinct tasks associated with the biomass project development as follows: a. Engineering and Architecture: Engineering focused on development of system control strategies, development of manuals for start up and commissioning. b. Training: The project developer will train its current operating staff to operate equipment and facilities. c. Flue Gas Clean-Up Equipment Concept Design: The concept development of acid gas emissions control system strategies associated with the supply wood to the project. d. Fuel Supply Management Plan: Development of plans and specifications for the supply of wood. It will include potential fuel sampling analysis and development of contracts for delivery and management of fuel suppliers and handlers. e. Integrated Fuel Management System Development: Seattle Steam requires a biomass Fuel Management System to track and manage the delivery, testing, processing and invoicing of delivered fuel. This application will be web-based and accessed from a password-protected URL, restricting data access and privileges by user-level.

  4. RAPID/Roadmap/19-WA-e | Open Energy Information

    Open Energy Info (EERE)

    Permitting Information Desktop Toolkit BETA About Bulk Transmission Geothermal Hydropower Solar Tools Contribute Contact Us Water Well Notice of Intent for New Well (19-WA-e) A...

  5. RAPID/Roadmap/11-WA-b | Open Energy Information

    Open Energy Info (EERE)

    Permitting Information Desktop Toolkit BETA About Bulk Transmission Geothermal Hydropower Solar Tools Contribute Contact Us Human Remains Process (11-WA-b) This flowchart...

  6. RAPID/Roadmap/5-WA-a | Open Energy Information

    Open Energy Info (EERE)

    Geothermal Hydropower Solar Tools Contribute Contact Us Drilling and Well Development (5-WA-a) In Washington geothermal drilling and well development are regulated by the...

  7. RAPID/Roadmap/14-WA-c | Open Energy Information

    Open Energy Info (EERE)

    Geothermal Hydropower Solar Tools Contribute Contact Us Underground Injection Control Permit (14-WA-c) The Safe Drinking Water Act requires Washington to implement...

  8. RAPID/Roadmap/18-WA-b | Open Energy Information

    Open Energy Info (EERE)

    Transmission Geothermal Hydropower Solar Tools Contribute Contact Us Dangerous Solid Waste Permit (18-WA-b) The Washington State Department of Ecology (WSDE) oversees the...

  9. RAPID/Roadmap/14-WA-b | Open Energy Information

    Open Energy Info (EERE)

    RAPIDRoadmap14-WA-b < RAPID | Roadmap Jump to: navigation, search RAPID Regulatory and Permitting Information Desktop Toolkit BETA About Bulk Transmission Geothermal...

  10. RAPID/Roadmap/15-WA-a | Open Energy Information

    Open Energy Info (EERE)

    BETA About Bulk Transmission Geothermal Hydropower Solar Tools Contribute Contact Us Air Quality Permit - Notice of Construction Permit (15-WA-a) This flowchart illustrates...

  11. RAPID/Roadmap/15-WA-b | Open Energy Information

    Open Energy Info (EERE)

    BETA About Bulk Transmission Geothermal Hydropower Solar Tools Contribute Contact Us Air Quality Permit - Operating Permit (15-WA-b) This flowchart illustrates the process for...

  12. RAPID/Roadmap/12-WA-b | Open Energy Information

    Open Energy Info (EERE)

    Geothermal Hydropower Solar Tools Contribute Contact Us State Trust Lands Habitat Conservation Plan Compliance (12-WA-b) The State of Washington has a Habitat Conservation Plan...

  13. RAPID/Roadmap/19-WA-d | Open Energy Information

    Open Energy Info (EERE)

    BETA About Bulk Transmission Geothermal Hydropower Solar Tools Contribute Contact Us Water Conservancy Board Transfer or Change of Water Right (19-WA-d) In 1997, the Washington...

  14. RAPID/Roadmap/19-WA-c | Open Energy Information

    Open Energy Info (EERE)

    Geothermal Hydropower Solar Tools Contribute Contact Us Transfer or Change of Water Right (19-WA-c) Much of Washington's public waters have been accounted for through...

  15. RAPID/Roadmap/19-WA-b | Open Energy Information

    Open Energy Info (EERE)

    About Bulk Transmission Geothermal Hydropower Solar Tools Contribute Contact Us New Water Right Permit Process (19-WA-b) Washington uses a prior appropriation system for the...

  16. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  17. DOE - Office of Legacy Management -- Hanford Engineer Works - WA 01

    Office of Legacy Management (LM)

    Hanford Engineer Works - WA 01 FUSRAP Considered Sites Site: Hanford Engineer Works (WA.01 ) Designated Name: Alternate Name: Location: Evaluation Year: Site Operations: Site Disposition: Radioactive Materials Handled: Primary Radioactive Materials Handled: Radiological Survey(s): Site Status: Also see http://www.hanford.gov/ Documents Related to Hanford Engineer Works

  18. WA_06_016_BP_SOLAR_INTERNATIONAL_Waiver_of_Patent_Rights_Und...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    06016BPSOLARINTERNATIONALWaiverofPatentRightsUnd.pdf WA06016BPSOLARINTERNATIONALWaiverofPatentRightsUnd.pdf PDF icon WA06016BPSOLARINTERNATIONALWaiverofP...

  19. WA_04_033_CARGILL_Waiver_of_Patent_Rights_to_CARGILL_DOWN_L.pdf...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    33CARGILLWaiverofPatentRightstoCARGILLDOWNL.pdf WA04033CARGILLWaiverofPatentRightstoCARGILLDOWNL.pdf PDF icon WA04033CARGILLWaiverofPatentRightstoCARGI...

  20. WA_02_034_BP_SOLAR_INTERNATIONAL_LLC_Waiver_of_Domestic_and_...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    verofDomesticand.pdf More Documents & Publications WA02035BPSOLARINTERNATIONALWaiverofDomesticandFore.pdf WA06016BPSOLARINTERNATIONALWaiverofPatentRightsUnd...

  1. RAPID/Roadmap/6-WA-a | Open Energy Information

    Open Energy Info (EERE)

    in the Washington Administrative Code. 6-WA-a - Oversize-Overweight Load Permit.pdf Error creating thumbnail: Page number not in range. Error creating thumbnail: Page number...

  2. RAPID/Roadmap/3-WA-b | Open Energy Information

    Open Energy Info (EERE)

    the Washington State Department of Natural Resources. 3-WA-b - Land Access Overview.pdf Error creating thumbnail: Page number not in range. Error creating thumbnail: Page number...

  3. Hanford, WA Selected as Plutonium Production Facility | National...

    National Nuclear Security Administration (NNSA)

    Production Facility Hanford, WA Groves selects Hanford, Washington, as site for full-scale plutonium production and separation facilities. Three reactors--B, D, and F--are built....

  4. BayWa Sunways JV | Open Energy Information

    Open Energy Info (EERE)

    JV that specialises in developing, planning and realizing medium-sized to large photovoltaic systems and solar plants. References: BayWa & Sunways JV1 This article is a stub....

  5. RAPID/Roadmap/19-WA-a | Open Energy Information

    Open Energy Info (EERE)

    BETA About Bulk Transmission Geothermal Hydropower Solar Tools Contribute Contact Us Water Access and Water Rights Overview (19-WA-a) Pursuant to RCW 78.60.060, developers that...

  6. Best Practices Case Study: Quadrant Homes - Kentlake Highlands, Kent, WA

    SciTech Connect (OSTI)

    none,

    2010-09-01

    Case study of Quadrant Homes, a Seattle area builder who, despite the recession, sold three homes a day in the first half of 2009, by letting buyers choose from 300 floor plans and 10,000 options, including an energy efficiency package designed with help from DOEs Building America that cut energy use by 50% over a code-built home.

  7. EERE Success Story—Washington: Seattle Rises Above with Alternative Fuels

    Broader source: Energy.gov [DOE]

    From the airport's baggage carriers to the taxis, Seattle's efforts to reduce petroleum in transportation will improve their local energy and environmental security, as well as help tourists realize the benefits of alternative fuels.

  8. Seattle City Light- Multi-Family Residential Energy Efficiency Rebate Program

    Broader source: Energy.gov [DOE]

    Seattle City Light provides incentives for multi-family housing properties with 5 or more units to increase their energy efficiency. Rebates are offered for common area lighting and weatherization...

  9. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  10. WA_1994_003_GOLDEN_PHOTOCON_INC_Waiver_of_Domestic_and_Forei.pdf |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy WA_1994_003_GOLDEN_PHOTOCON_INC_Waiver_of_Domestic_and_Forei.pdf WA_1994_003_GOLDEN_PHOTOCON_INC_Waiver_of_Domestic_and_Forei.pdf PDF icon WA_1994_003_GOLDEN_PHOTOCON_INC_Waiver_of_Domestic_and_Forei.pdf More Documents & Publications WA_1995_030_GOLDEN_PHOTON_INC_Waiver_of_Domestic_and_Foreign.pdf WA_1993_033_GOLDEN_PHOTON_INC_Waiver_of_Domestic_and_Foreign.pdf WA_03_010_SHELL_SOLAR_INDUSTRIES_Waiver_of_Domestic_and_Fore.pdf

  11. Sumas, WA Liquefied Natural Gas Imports (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    (Million Cubic Feet) Sumas, WA Liquefied Natural Gas Imports (Million Cubic Feet) Year Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec 2014 5 2015 4 4 2 1 2016 1 2 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release Date: 5/31/2016 Referring Pages: U.S. Liquefied Natural Gas Imports by Point of Entry Sumas, WA LNG Imports from All Countries

  12. Microsoft Word - WA Parish_MAP_Final.docx

    Energy Savers [EERE]

    W.A. Parish Post-Combustion CO 2 Capture and Sequestration Project U. S. Department of Energy National Energy Technology Laboratory June 2013 INTRODUCTION: The United States (U.S.) Department of Energy (DOE) issued a final environmental impact statement (EIS; DOE/EIS-0473) for the W.A. Parish Post-Combustion CO 2 Capture and Sequestration Project (Parish PCCS Project) in March 2013. DOE announced its decision to provide $167 million in cost-shared funding to NRG Energy, Inc. (NRG) for the

  13. File:06-WA-b - Washington Construction Storm Water Permit.pdf...

    Open Energy Info (EERE)

    6-WA-b - Washington Construction Storm Water Permit.pdf Jump to: navigation, search File File history File usage Metadata File:06-WA-b - Washington Construction Storm Water...

  14. Mechanism of somatic hypermutation at the WA motif by human DNA...

    Office of Scientific and Technical Information (OSTI)

    at the WA motif by human DNA polymerase eta Citation Details In-Document Search Title: Mechanism of somatic hypermutation at the WA motif by human DNA polymerase eta Authors: ...

  15. LiveWall Operational Evaluation: Seattle Law Enforcement Pilot

    SciTech Connect (OSTI)

    Barr, Jonathan L.; Burtner, Edwin R.; Stein, Steven L.

    2013-10-01

    The LiveWall concept envisioned as an outgrowth of the Precision Information Environment (PIE) project allows communications between separate groups using interactive video, audio, and a shared desktop environment; this allows everyone to participate and collaborate in real time, regardless of location. The LiveWall concept provides a virtual window to other locations, where all parties can interact and collaboratively work with each other. This functionality is intended to improve multi-site coordination amongst emergency operations centers (EOC), field operations sites and across organizations and jurisdictions to accommodate communications during routine and emergency events. For the initial LiveWall operational evaluation PNNL partnered with the Seattle Police Department (SPD). This partnership allowed for the creation of an excellent LiveWall test bed specific to law enforcement. This partnership made it possible to test the LiveWall concept with scenarios involving the many facets of the law enforcement work done by SPD. PNNL and SPD agreed that integrating the systems into operations for a real event would be the best test of the technology and give SPD staff greater visibility into the functionality and benefits offered by the LiveWall concept.

  16. EIS-0397: Lyle Falls Fish Passage Project, WA

    Broader source: Energy.gov [DOE]

    This EIS analyzes BPA's decision to modify funding to the existing Lyle Falls Fishway on the lower Klickitat River in Klickitat County, WA. The proposed project would help BPA meet its off-site mitigation responsibilities for anadromous fish affected by the development of the Federal Columbia River Power System and increase overall fish production in the Columbia Basin.

  17. WA_01_018_IBM_Waiver_of_Governement_US_and_Foreign_Patent_Ri.pdf |

    Energy Savers [EERE]

    Department of Energy 1_018_IBM_Waiver_of_Governement_US_and_Foreign_Patent_Ri.pdf WA_01_018_IBM_Waiver_of_Governement_US_and_Foreign_Patent_Ri.pdf PDF icon WA_01_018_IBM_Waiver_of_Governement_US_and_Foreign_Patent_Ri.pdf More Documents & Publications WA_04_053_IBM_CORP_Waiver_of_the_Government_U.S._and_Foreign.pdf WA_00_015_COMPAQ_FEDERAL_LLC_Waiver_Domestic_and_Foreign_Pat.pdf Advance Patent Waiver W(A)2002-023

  18. WA_04_047_CATERPILLAR_INC_Waiver_of_Patent_Rights_to_Inventi.pdf |

    Energy Savers [EERE]

    Department of Energy 47_CATERPILLAR_INC_Waiver_of_Patent_Rights_to_Inventi.pdf WA_04_047_CATERPILLAR_INC_Waiver_of_Patent_Rights_to_Inventi.pdf PDF icon WA_04_047_CATERPILLAR_INC_Waiver_of_Patent_Rights_to_Inventi.pdf More Documents & Publications WA_04_046_CATERPILLAR_INC_Waiver_of_Patent_Rights_to_Inventi.pdf WA_04_071_CATERPILLAR_INC_Waiver_of_Patent_Rights_to_Inventi.pdf Advance Patent Waiver W(A)2005-052

  19. WA_04_069__EATON_CORPORATION_Waiver_of_Domestic_and_Foreign_.pdf |

    Energy Savers [EERE]

    Department of Energy 69__EATON_CORPORATION_Waiver_of_Domestic_and_Foreign_.pdf WA_04_069__EATON_CORPORATION_Waiver_of_Domestic_and_Foreign_.pdf PDF icon WA_04_069__EATON_CORPORATION_Waiver_of_Domestic_and_Foreign_.pdf More Documents & Publications WA_04_059_EATON_CORPORATION_Waiver_of_Patent_Rights_Under_a_.pdf WA_02_048_EATON_CORPORATION_Waviver_of_Patent_Rights_Under_A.pdf WA_04_074_EATON_CORPORATION_Waiver_of_Domestic_and_Foreign_I.pdf

  20. EcoCAR 3: Year 1 Finals in Seattle | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    EcoCAR 3: Year 1 Finals in Seattle EcoCAR 3: Year 1 Finals in Seattle Addthis 1 of 11 As part of the EcoCAR 3 Advanced Vehicle Technology Competition, university teams from throughout North America will redesign a 2016 Chevrolet Camaro to reduce its environmental impact while maintaining its "muscle car" performance. Image: Courtesy of EcoCAR 3 2 of 11 As part of EcoCAR 3, university teams will receive a set of keys to a brand new Chevrolet Camaro from General Motors to re-engineer

  1. ERSUG Meeting: January 12 - 13, 1995 (Richland, WA)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ERSUG Meeting: January 12 - 13, 1995 (Richland, WA) Dates January 12th & 13th, 1995 Location Pacific Northwest Laboratory Richland, Washington Presentations Summary of ERSUG Meeting January 12 - 13, 1995, Richland, Washington The latest Energy Research Supercomputer Users Group (ERSUG) meeting was held at Pacific Northwest Laboratory in Richland, Washington, on January 12 - 13, 1995. Some of the talks are summarized below. The View from Washington (Tom Kitchens) Tom Kitchens presented the

  2. MULTI-PV INVERTER UTILITY INTERCONNECTION EVALUATIONS Sigifredo...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    islanding Paper presented at the 36th IEEE Photovoltaic Specialists Conference, Seattle, WA (2011)...

  3. MULTI-PV INVERTER UTILITY INTERCONNECTION EVALUATIONS Sigifredo Gonzalez

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    islanding Paper presented at the 36th IEEE Photovoltaic Specialists Conference, Seattle, WA (2011)

  4. WA_97_027_GENERAL_ATOMICS__CORPORATION_Waiver_of_Domestic_an.pdf |

    Energy Savers [EERE]

    Department of Energy 97_027_GENERAL_ATOMICS__CORPORATION_Waiver_of_Domestic_an.pdf WA_97_027_GENERAL_ATOMICS__CORPORATION_Waiver_of_Domestic_an.pdf PDF icon WA_97_027_GENERAL_ATOMICS__CORPORATION_Waiver_of_Domestic_an.pdf More Documents & Publications WA_99_014_UNITED_SOLAR_SYSTEMS_CORP_Waiver_of_Domestic_and_F.pdf Class Patent Waiver W(C)2004-001 WA_97_006_MOTOROLA_MANUFACTURING_SYSTEMS_Waiver_of_Patent_Ri

  5. DOE Zero Energy Ready Home Case Study: TC Legend Homes, Bellingham, WA |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Bellingham, WA DOE Zero Energy Ready Home Case Study: TC Legend Homes, Bellingham, WA DOE Zero Energy Ready Home Case Study: TC Legend Homes, Bellingham, WA Case study of a DOE Zero Energy Ready home in Bellingham, WA, that achieves HERS 43 without PV or HERS 13 with 3.2 kW of PV. The 1,055-ft2 two-story production home has 6-in. SIP walls, a 10-in. SIP roof, and ICF foundation walls with R-20 high-density rigid EPS foam under the slab. A single ductless heat pump heats

  6. Advance Patent Waiver W(A)2006-028 | Department of Energy

    Energy Savers [EERE]

    6-028 Advance Patent Waiver W(A)2006-028 This document waives certain patent rights the Department of Energy (DOE) has to inventions conceived or first actually reduced to practice by COLONY PROJECT under agreement SUBC-B555909, as the DOE has determined that granting such a waiver best serves the interests of the United States and the general public. PDF icon Advance Patent Waiver W(A)2006-028 More Documents & Publications Advance Patent Waiver W(A)2005-048 2011_INCITE_Fact_Sheets.pdf

  7. Advance Patent Waiver W(A)2012-021 | Department of Energy

    Energy Savers [EERE]

    2-021 Advance Patent Waiver W(A)2012-021 This document waives certain patent rights the Department of Energy (DOE) has to inventions conceived or first actually reduced to practice by USEC, INC. under agreement DE-NE0000488, as the DOE has determined that granting such a waiver best serves the interests of the United States and the general public. PDF icon Advance Patent Waiver W(A)2012-021 More Documents & Publications WA_1993_042_UNITED_TECHNOLOGIES_CORPORATION_Waiver_of_the_Go.pdf

  8. DOE Zero Energy Ready Home Case Study: Clifton View Homes, Coupeville, WA,

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Systems Home | Department of Energy Coupeville, WA, Systems Home DOE Zero Energy Ready Home Case Study: Clifton View Homes, Coupeville, WA, Systems Home Case study of a DOE Zero Energy Ready Home on Whidbey Island, WA, that scored HERS 45 without PV. This 2,908-square-foot custom/system home has a SIP roof and walls, R-20 rigid foam under slab, triple-pane windows, ground source heat pump for radiant floor heat, and a unique balanced ventilation system using separate exhaust fans to bring

  9. Fisher & Paykel Appliances: ENERGY STAR Referral (WA42T26GW1) | Department

    Energy Savers [EERE]

    of Energy Fisher & Paykel Appliances: ENERGY STAR Referral (WA42T26GW1) Fisher & Paykel Appliances: ENERGY STAR Referral (WA42T26GW1) June 12, 2013 DOE referred the matter of Fisher & Paykel Appliances residential clothes washer, model WA42T26GW1, to the U.S. Environmental Protection Agency, brand manager for the ENERGY STAR Program, for appropriate action after DOE testing showed that the model does not meet the ENERGY STAR specification. PDF icon Fisher & Paykel Appliances:

  10. Advance Patent Waiver W(A)2010-006 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Advance Patent Waiver W(A)2010-006 This document waives certain patent rights the Department of Energy (DOE) has to inventions conceived or first actually reduced to practice by ...

  11. Best Practices Case Study: Devoted Builders, LLC, Mediterrtanean Villas, Pasco,WA

    SciTech Connect (OSTI)

    2010-12-01

    Devoted Builders of Kennewick, WA worked with Building America's BIRA team to achieve the 50% Federal tax credit level energy savings on 81 homes at its Mediterranean Villas community in eastern Washington.

  12. DOE Zero Energy Ready Home Case Study: TC Legend Homes, Bellingham, WA

    Broader source: Energy.gov [DOE]

    Case study of a DOE Zero Energy Ready home in Bellingham, WA, that achieves HERS 43 without PV or HERS 13 with 3.2 kW of PV.

  13. Modern Electric Water Company | Open Energy Information

    Open Energy Info (EERE)

    Modern Electric Water Company Jump to: navigation, search Name: Modern Electric Water Company Address: 904 North Pines Road Place: Spokane Valley, WA Zip: 99206 Phone Number: (509)...

  14. Inland Power & Light Company | Open Energy Information

    Open Energy Info (EERE)

    Power & Light Company Jump to: navigation, search Name: Inland Power & Light Company Address: 10110 W. Hallett Road Place: Spokane, WA Zip: 99224 Phone Number: (877) 668-8243...

  15. Washington State University | Open Energy Information

    Open Energy Info (EERE)

    University Jump to: navigation, search Name: Washington State University Place: Spokane, WA Website: www.washingtonstateuniversity. References: Washington State University1...

  16. ReliOn | Open Energy Information

    Open Energy Info (EERE)

    E. Euclid Avenue Place: Spokane, WA Zip: 99216 Region: Pacific Northwest Area Sector: Hydrogen Product: Fuel cells for backup and grid-supplement power Number of Employees:...

  17. DOE Zero Energy Ready Home Case Study: Dwell Development, Seattle, Washington

    SciTech Connect (OSTI)

    none,

    2013-09-01

    This Challenge Home is one of 42 homes in a micro-community of ultra-modern, energy-efficient homes built by Dwell Development on an urban gray-field site in South Seattle. Every home will achieve a 5-Star Built Green rating from the regional master builders association and meet the criteria of the Northwest ENERGY STAR program, which is more strict than the national ENERGY STAR criteria. Also, the home won a 2013 Housing Innovation Award in the "systems builder" category.

  18. Advance Patent Waiver W(A)2008-006 | Department of Energy

    Energy Savers [EERE]

    8-006 Advance Patent Waiver W(A)2008-006 This document waives certain patent rights the Department of Energy (DOE) has to inventions conceived or first actually reduced to practice by CATERPILLAR, INC under agreement DE-FC26-00AL67017, as the DOE has determined that granting such a waiver best serves the interests of the United States and the general public. PDF icon Advance Patent Waiver W(A)2008-006 More Documents & Publications

  19. Advance Patent Waiver W(A)2010-037 | Department of Energy

    Energy Savers [EERE]

    7 Advance Patent Waiver W(A)2010-037 This document waives certain patent rights the Department of Energy (DOE) has to inventions conceived or first actually reduced to practice by ALCATEL-LUCENT USA INC. under agreement DE-EE0002895, as the DOE has determined that granting such a waiver best serves the interests of the United States and the general public. PDF icon Advance Patent Waiver W(A)2010-037 More Documents & Publications A

  20. Advance Patent Waiver W(A)2010-038 | Department of Energy

    Energy Savers [EERE]

    8 Advance Patent Waiver W(A)2010-038 This document waives certain patent rights the Department of Energy (DOE) has to inventions conceived or first actually reduced to practice by ALCATEL-LUCENT USA INC. under agreement DE-EE0002887, as the DOE has determined that granting such a waiver best serves the interests of the United States and the general public. PDF icon Advance Patent Waiver W(A)2010-038 More Documents & Publications A

  1. New Whole-House Solutions Case Study: Quadrant Homes, Kent, WA

    Energy Savers [EERE]

    Quadrant Homes, a Weyerhaeuser real estate company and Seattle-area builder, offers buyers of its "custom" production homes over 300 house plans and 10,000 feature options to choose from. With technical assistance from DOE's Building America program in 2007, Quadrant developed a package of energy-efficiency measures designed to save home owners 50% over the state energy code at the time. Savings were modeled by the Washington State University (WSU) Extension Energy Office (a member of

  2. NCAI Mid-Year Conference and Marketplace | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NCAI Mid-Year Conference and Marketplace NCAI Mid-Year Conference and Marketplace June 27, 2016 8:00AM PDT to June 30, 2016 5:00PM PDT Spokane, Washington Spokane Convention Center 334 W. Spokane Falls Blvd. Spokane, WA 99201 The National Congress of American Indians (NCAI) is hosting its mid-year conference in late June. The conference will feature breakout sessions and committee meetings

  3. Sumas, WA Liquefied Natural Gas Imports from Canada (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    from Canada (Million Cubic Feet) Sumas, WA Liquefied Natural Gas Imports from Canada (Million Cubic Feet) Year Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec 2014 5 2015 4 4 2 1 2016 1 2 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release Date: 5/31/2016 Referring Pages: U.S. Liquefied Natural Gas Imports by Point of Entry Sumas, WA Natural Gas Imports by Pipeline from Canada

  4. W.A. Parish Post-Combustion CO{sub 2} Capture and Sequestration Project

    Office of Scientific and Technical Information (OSTI)

    Phase 1 Definition (Technical Report) | SciTech Connect SciTech Connect Search Results Technical Report: W.A. Parish Post-Combustion CO{sub 2} Capture and Sequestration Project Phase 1 Definition Citation Details In-Document Search Title: W.A. Parish Post-Combustion CO{sub 2} Capture and Sequestration Project Phase 1 Definition For a secure and sustainable energy future, the United States (U.S.) must reduce its dependence on imported oil and reduce its emissions of carbon dioxide (CO{sub 2})

  5. DRAFT ADVICE - UNACCEPTABLE PROGRAM IMPACTS UNDER FY 97 BUDGET

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Linda Hoffman, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA...

  6. Workplace Charging Challenge Partner: Avista Utilities | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Avista Utilities Workplace Charging Challenge Partner: Avista Utilities Workplace Charging Challenge Partner: Avista Utilities Joined the Challenge: November 2014 Headquarters: Spokane, WA Charging Location: Spokane, WA Domestic Employees: 1,643 Avista Utilities is committed to effective support for plug-in electric vehicle (PEV) adoption in its service territories. Avista installed two stations for a total of four charging outlets for public and employee use in the Spokane

  7. DOE Zero Energy Ready Home Case Study: Clifton View Homes, Whidbey Island, WA

    Broader source: Energy.gov [DOE]

    Case study of a DOE Zero Energy Ready home on Whidbey Island, WA, that scores HERS 37 without PV or HERS -13 with 10 kW PV, enough to power the home and an electric car. The two-story custom home...

  8. Gasoline and Diesel Fuel Update

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    CA Contra Costa County, CA Marin County, CA San Francisco County, CA San Mateo County, CA Santa Clara County, CA Seattle Island County, WA King County, WA Snohomish County, WA...

  9. Potential social, institutional, and environmental impacts of selected energy-conservation measures in two Washington communities. [Seattle and Yakima

    SciTech Connect (OSTI)

    Edelson, E.; Olsen, M.

    1980-03-01

    The likely environmental, social, and institutional impacts of selected energy-conservation measures in two communities in Washington state are reported. The five conservation measures investigated in this study were: (1) retrofitting existing buildings; (2) district heating and Integrated Community Energy Systems (ICES); (3) small automobiles and vehicle redesign; (4) land-use and housing modifications; and (5) electric-utility rate reform. Twenty potential impact areas were selected for analysis. These areas were divided into five categories of environmental impacts, economic impacts, community impacts, personal impacts, and overall quality of life in the community. The research was conducted in Seattle and Yakima, Washington. In each location, about two dozen public officials and business, labor, and community leaders were interviewed. Their diverse views are summarized. The Seattle respondents saw energy conservation as a highly desirable policy with a number of temporary, transitional problems arising as energy-conservation measures were implemented. Yakima respondents, in contrast, did not expect to encounter many serious energy problems in the foreseeable future and consequently viewed energy conservation as a relatively minor community concern. Moreover, they anticipated that many conservation measures, if implemented by the government, would encounter either apathy or resistance in their community. Two broad generalizations can bedrawn from these interviews: (1) energy conservation will basically be beneficial for the natural environment and our society; and (2) if energy conservation does become a dominant thrust in our society, it could stimulate and reinforce a much broader process of fundamental social change. (LCL)

  10. Spokane, Washington: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    Washington Avista Corp References US Census Bureau Incorporated place and minor civil division population dataset (All States, all geography) US Census Bureau...

  11. BPA-2014-01391-FOIA Correspondence

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1, 2014 In reply refer to: D-Bl James White Upper Columbia Salmon Recovery Board Ii Spokane Street Wenatchee, WA 98801 FOIA BPA-2014-01391-F Mr. White: We have received your...

  12. EIS-0473: W.A. Parish Post-Combustion CO2 Capture and Sequestration Project (PCCS), Fort Bend County, TX

    Broader source: Energy.gov [DOE]

    This EIS evaluates the environmental impacts of a proposal to provide financial assistance for a project proposed by NRG Energy, Inc (NRG). DOE selected NRG’s proposed W.A. Parish Post-Combustion CO2 Capture and Sequestration Project for a financial assistance award through a competitive process under the Clean Coal Power Initiative Program. NRG would design, construct and operate a commercial-scale carbon dioxide (CO2) capture facility at its existing W.A. Parish Generating Station in Fort Bend County, Texas; deliver the CO2 via a new pipeline to the existing West Ranch oil field in Jackson County, Texas, for use in enhanced oil recovery operations; and demonstrate monitoring techniques to verify the permanence of geologic CO2 storage.

  13. Workplace Charging Challenge Partner: Gonzaga University | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Gonzaga University Workplace Charging Challenge Partner: Gonzaga University Workplace Charging Challenge Partner: Gonzaga University Joined the Challenge: June 2015 Headquarters: Spokane, WA Charging Location: Spokane, WA Domestic Employees: 1,187 For Gonzaga University, installing plug-in electric vehicle charging stations is consummate with their mission to care for creation and be stewards of resources. As part of this missioned responsibility and in light of the growing pressures

  14. DOE Zero Energy Ready Home Case Study: Dwell Development, Reclaimed...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Seattle, WA, Systems Home DOE Zero Energy Ready Home: Montlake Modern - Seattle, Washington DOE Zero Energy Ready Home Case Study: Palo Duro Homes, Via del Cielo, Santa Fe, NM

  15. Origin State>> CA ID ID ID IL KY NV NY NY OH TN TN TN, WA, CA

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NV NY NY OH TN TN TN, WA, CA TN TN TN TN TX Total Shipments by Route Lawrence Livermore National Laboratory Advanced Mixed Waste Treatment Project Batelle Energy Alliance Idaho National Laboratory Argonne National Laboratory Paducah Gaseous Diffusion Plant National Security Technologies Brookhaven National Laboratory West Valley Environmental Services Portsmouth Gaseous Diffusion Plant Duratek/Energy Solutions Babcox & Wilcox Technical Services Y-12 Plant Materials & Energy Corporation

  16. Origin State>> CA ID ID ID IL MD NM NM NY OH TN TN TN, WA, CA

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NY OH TN TN TN, WA, CA TN TN TN TX Total Shipments by Route Lawrence Livermore National Laboratory Batelle Energy Alliance Idaho National Laboratory Advanced Mixed Waste Treatment Project Argonne National Laboratory Aberdeen Proving Ground Sandia National Laboratory Los Alamos National Laboratory Brookhaven National Laboratory Portsmouth Gaseous Diffusion Plant Duratek/Energy Solutions Babcox & Wilcox Technical Services Y-12 Plant Materials & Energy Corporation (M&EC) Perma-Fix

  17. Origin State>> CA ID ID ID IL NM NM OH TN TN TN, WA, CA TN TN

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NM NM OH TN TN TN, WA, CA TN TN TN TN TX Total Shipments by Route Lawrence Livermore National Laboratory Batelle Energy Alliance Idaho National Laboratory Advanced Mixed Waste Treatment Project Argonne National Laboratory Sandia National Laboratory Los Alamos National Laboratory Portsmouth Gaseous Diffusion Plant Duratek/Energy Solutions Babcox & Wilcox Technical Services Y-12 Plant Materials & Energy Corporation (M&EC) Perma-Fix Nuclear Fuels Services Wastren Advantage, Inc.

  18. Origin State>> CA ID ID IL IL KY NM NM NV NY OH TN TN TN, WA,

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    IL IL KY NM NM NV NY OH TN TN TN, WA, CA TN TN TN TN Total Shipments by Route Lawrence Livermore National Laboratory Batelle Energy Alliance Idaho National Laboratory Energx Argonne National Laboratory Argonne National Laboratory Paducah Gaseous Diffusion Plant Sandia National Laboratory Los Alamos National Laboratory National Security Technologies West Valley Environmental Services Portsmouth Gaseous Diffusion Plant Duratek/Energy Solutions Babcox & Wilcox Technical Services Y-12 Plant

  19. Hydrogen Infrastructure Expansion: Consumer Demand and Cost-Reduction...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Discrete Choice Consumer Survey * Received 500 responses from each city: * Los Angeles, CA * Atlanta, GA * Minneapolis, MN * Seattle, WA * Two choices: 1. Conventional vehicle 2. ...

  20. Clean Cities: Western Washington Clean Cities coalition

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Studies where her studies focused on policies to stimulate the growth of renewable energy. 1904 Third Ave, Ste 105 Seattle, WA 98101 Western Washington Success Stories Watch...

  1. GHG Management Institute | Open Energy Information

    Open Energy Info (EERE)

    GHG Management Institute Jump to: navigation, search Name: GHG Management Institute Address: Greenhouse Gas Management Institute 9215 View Avenue NW Seattle, WA USA 98117 Place:...

  2. Growth of oriented rare-earth-transition-metal thin films (Conference...

    Office of Scientific and Technical Information (OSTI)

    DOE Contract Number: W-31109-ENG-38 Resource Type: Conference Resource Relation: Conference: 1996 IEEE international magnetics conference, Seattle, WA (United States), 9-12 Apr ...

  3. Better Buildings Neighborhood Program Peer Exchange Call: Administerin...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    the reach of energy efficiency * Seattle, WA and Long Island, NY are successfully co-branding with utilities 492013 5 Future Program Sustainability Call Topics Program ...

  4. Optical reflectance as a dynamic temperature diagnostic. (Conference...

    Office of Scientific and Technical Information (OSTI)

    Resource Relation: Conference: Shock Compression of Condensed Matter conference held July 8-12, 2013 in Seattle, WA.; Related Information: Proposed for presentation at the Shock ...

  5. DOE Zero Energy Ready Home Case Study: Dwell Development, Reclaimed Modern,

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Seattle, WA | Department of Energy Dwell Development, Reclaimed Modern, Seattle, WA DOE Zero Energy Ready Home Case Study: Dwell Development, Reclaimed Modern, Seattle, WA DOE Zero Energy Ready Home Case Study: Dwell Development, Reclaimed Modern, Seattle, WA Case study of a DOE 2015 Housing Innovation Award winning custom home in the marine climate that got a HERS 55 without PV, or HERS 25 with PV, with 2x8 24" on center walls with R-27 dense-packed cellulose; R-20 rigid foam under

  6. Hit the Road: Applying Lessons from National Campaigns to a Local...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... campaign includes two-day dialogues in cities across the U.S. and recruitment of ... Raleigh, NC; Smart power systems, Seattle, WA; and Advanced manufacturing, St. ...

  7. Microsoft Word - HABAdv#224_Proposed COnsent Decree&TPA Modifications...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Seattle, WA 98101 Ins Triay Assistant Secretary for Environmental Management EM-1Forestal Building U.S. Department of Energy 1000 Independence Avenue Washington, D.C. 20585...

  8. DRAFT ADVICE - UNACCEPTABLE PROGRAM IMPACTS UNDER FY 97 BUDGET

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    John Iani, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Re: Principles for M-91 Negotiations Dear Mssrs. Klein,...

  9. Northwest SEED | Open Energy Information

    Open Energy Info (EERE)

    SEED Jump to: navigation, search Name: Northwest Sustainable Energy for Economic Development (SEED) Address: 1402 3rd Ave. Suite 901 Place: Seattle, WA Zip: 98101 Phone Number:...

  10. Building America Whole-House Solutions for New Homes: Rural Developmen...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Greenfield, Massachusetts DOE Zero Energy Ready Home Case Study: New Town Builders, Denver, CO DOE Zero Energy Ready Home Case Study: Dwell Development, Seattle, WA, Systems ...

  11. General Resources - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Help 314 1st Ave W Seattle, WA 98119 (800) 255-9752 Washington State Department of Labor and Industries P. O. Box 44000 Olympia, WA 98504-4000 (800) 547-8367 toll free (360)...

  12. Hanford Challenge

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Challenge 219 tst Ave S, Suite 120 Seattle, WA 98104 2013.292.2850 hanfordchallenge.org June 1,2010 Dorothy Riehle FOlA Office U.S. Department of Energy P. O. Box 550 Richland, WA...

  13. HIA 2015 DOE Zero Energy Ready Home Case Study: TC Legend Homes, Bellingham Power House, Bellingham, WA

    Energy Savers [EERE]

    Bellingham Power House Bellingham, WA DOE ZERO ENERGY READY HOME(tm) The U.S. Department of Energy invites home builders across the country to meet the extraordinary levels of excellence and quality specified in DOE's Zero Energy Ready Home program (formerly known as Challenge Home). Every DOE Zero Energy Ready Home starts with ENERGY STAR Certified Homes Version 3.0 for an energy-efficient home built on a solid foundation of building science research. Advanced technologies are designed in to

  14. Analyses of soils at commercial radioactive-waste-disposal sites. [Barnwell, SC; Richland, WA

    SciTech Connect (OSTI)

    Piciulo, P.L.; Shea, C.E.; Barletta, R.E.

    1982-01-01

    Brookhaven National Laboratory, in order to provide technical assistance to the NRC, has measured a number of physical and chemical characteristics of soils from two currently operating commercial radioactive waste disposal sites; one at Barnwell, SC, and the other near Richland, WA. Soil samples believed to be representative of the soil that will contact the buried waste were collected and analyzed. Earth resistivities (field measurements), from both sites, supply information to identify variations in subsurface material. Barnwell soil resistivities (laboratory measurements) range from 3.6 x 10/sup 5/ ohm-cm to 8.9 x 10/sup 4/ ohm-cm. Soil resistivities of the Hanford sample vary from 3.0 x 10/sup 5/ ohm-cm to 6.6 x 10/sup 3/ ohm-cm. The Barnwell and Hanford soil pH ranges from 4.8 to 5.4 and from 4.0 to 7.2 respectively. The pH of a 1:2 mixture of soil to 0.01 M CaCl/sub 2/ resulted in a pH for the Barnwell samples of 3.9 +- 0.1 and for the Hanford samples of 7.4 +- 0.2. These values are comparable to the pH measurements of the water extract of the soils used for the analyses of soluble ion content of the soils. The exchange acidity of the soils was found to be approximately 7 mg-eq per 100 g of dry soil for clay material from Barnwell, whereas the Hanford soils showed an alkaline reaction. Aqueous extracts of saturated pastes were used to determine the concentrations of the following ions: Ca/sup 2 +/, Mg/sup 2 +/, K/sup +/, Na/sup +/, HCO/sub 3//sup -/, SO/sub 4//sup =/, and Cl/sup -/. The sulfide content of each of the soils was measured in a 1:2.5 mixture of soil to an antioxidant buffer solution. The concentrations of soluble ions found in the soils from both sites are consistent with the high resistivities.

  15. HIA 2015 DOE Zero Energy Ready Home Case Study: Clifton View Homes, Marine Drive and Port Hadlcok, Coupeville and Port Hadlock WA

    Energy Savers [EERE]

    Homes Marine Drive and Port Hadlock Coupeville, WA Port Hadlock, WA DOE ZERO ENERGY READY HOME(tm) The U.S. Department of Energy invites home builders across the country to meet the extraordinary levels of excellence and quality specified in DOE's Zero Energy Ready Home program (formerly known as Challenge Home). Every DOE Zero Energy Ready Home starts with ENERGY STAR Certified Homes Version 3.0 for an energy-efficient home built on a solid foundation of building science research. Advanced

  16. Solar Policy Environment: Seattle

    Broader source: Energy.gov [DOE]

    The objective of the Emerald City Solar Initiative is to overcome the barriers to widespread deployment of solar energy technology, dramatically increasing residential, commercial, City-owned, and community-scale solar energy use. The City has assembled a strong team of partners that have proven track records in the fields of public planning, renewable energy resource mapping, financial analysis, site analysis, education and outreach, policy analysis and advocacy, community organizing and renewable energy project development.

  17. Evaluation of contaminant flux rates from sediments of Sinclair Inlet, WA, using a benthic flux sampling device. Final report

    SciTech Connect (OSTI)

    Chadwick, D.B.; Lieberman, S.H.; Reimers, C.E.; Young, D.

    1993-02-01

    A Benthic Flux Sampling Device (BFSD) was demonstrated on site to determine the mobility of contaminants in sediments off the Puget Sound Naval Shipyard (PSNS) in Sinclair Inlet, WA. Quantification of toxicant flux from the sediments will support ongoing assessment studies and facilitate the design of appropriate remediation strategies, if required. In general, where release of contaminants was found, the measured rates do not represent a significant source relative to other major inputs such as sewer discharges, nonpoint source runoff, and marinas. They may, however, represent an exposure pathway for benthic biota with a subsequent potential for toxicological effects and/or bioaccumulation. Environmental assessment, CIVAPP:Toxicity, CIVAPP:Marine chemistry, Hazardous waste.

  18. Wa s h i n g t o n U n i v e r s i t y i n S t . L o...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Wa s h i n g t o n U n i v e r s i t y i n S t . L o u i s - - P A R C ' s H o s t & A d mi n s t r a t i v e H o me - B o b B l a n k e n s h i p , P A R C D i r e c t o r - D e ...

  19. Franklin PUD, Pasco WA

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    have been replaced by Hans Berg (State of Washington, Wid Ritchie (Idaho Falls) and Shawn Collins (The Energy Project). A few participants reported new LIEE activities, due at...

  20. app_d

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 Appendix D - New Information - Document 56, U.S. EPA-Region 10 (Richard B. Parkin), Seattle, WA Page 1 of 3 Document 55, INEEL Citizens Advisory Board (Stan Hobson), Idaho Falls, ID Page 9 of 9 D-137 DOE/EIS-0287 Idaho HLW & FD EIS - New Information - Document 56, U.S. EPA-Region 10 (Richard B. Parkin), Seattle, WA Page 2 of 3 Document 56, U.S. EPA-Region 10 (Richard B. Parkin), Seattle, WA Page 3

  1. file://L:\DOE-hanford.gov\public\boards\hab\advice\advice100.ht

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Dick French, Manager Office of River Protection 2440 Stevens Center Richland, WA 99352 Subject: TPA Agency Processes for Responding to HAB Consensus Advice Dear Messrs.

  2. file://L:\DOE-hanford.gov\public\boards\hab\advice\advice111.ht

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Harry Boston, Manager Office of River Protection 2440 Stevens Center Richland, WA 99352 Chuck Findley, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Subject: FY2001 Performance Measures Dear Messrs. Klein, Boston, Findley, and

  3. Morris. Alexander From: Sent: To: Subject: FOIA-Central@hq.doe...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    12:04 PM FOIA-CentraJ DOE Headquarters FOIA Request Name:l crawfor Organization: MacDonald Hoague & Bayless FAX: 2063433961 Address: 705 Second Avenue Suite 1500 Seattle I WA...

  4. BPA-2010-01579-FOIA Correspondence

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Dan Seligman Attorney at Law Columbia Research Corporation PO Box 99249 Seattle, WA 98139 RE: BPA-2010-01579-F Dear Mr. Seligman: Thank you for your request for information that...

  5. Portland HQ Letterhead

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0, 2010 In reply refer to: DK-7 Dan Seligman Attorney at Law Columbia Research Corporation PO Box 99249 Seattle, WA 98139 RE: BPA-2010-01049-F Dear Mr. Seligman: This is a final...

  6. BPA-2010-00613-FOIA Correspondence

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Dan Seligman Attorney at Law Columbia Research Corporation P.O. Box 99249 Seattle, WA 98139 RE: FOIA BPA-2010-00613-F Dear Mr. Seligman: Thank you for your request for information...

  7. BPA-2011-01336-FOIA Correspondence

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 In reply refer to: DKE Mark Rosencrantz Ball Janik LLP 818 Stewart Street, Suite 1110 Seattle, WA 98101 FOIA BPA-2011-01336-F Dear Mr. Rosencrantz: Thank you for your request...

  8. BPA-2014-01135-FOIA Correspondence

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Daniel Crowner Patterson, Buchanan, Fobes & Leitch, Inc., P.S. 2112 Third Avenue, Suite 500 Seattle, WA 98121 FOIA BPA-2014-01135-F Dear Mr. Crowner: We have received your request...

  9. National Trust for Historic Preservation: America Saves! Energizing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Center of Wisconsin - Madison, WI - EnerPath - Rochester, NY - Ecology Action - Santa Cruz, CA - Community Power Works - Seattle, WA DOE Total Funding: 1,600,000 Cost ...

  10. Riley_Venayagamoorthy_PVSC2011_ForWebsite

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1-4179 C 37 th IEEE Photovoltaic Specialists Conference, Seattle, WA, June 2011 COMPARISON OF A RECURRENT NEURAL NETWORK PV SYSTEM MODEL WITH A TRADITIONAL COMPONENT-BASED PV...

  11. Microsoft Word - xx xx 13 Midway pole replacement news release...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    local utilities. The public meeting is: Wednesday, Feb. 20, 2013 4 p.m. to 7 p.m. Moxee City Hall 255 W. Seattle Ave. Moxee, WA 98936 Because there will not be a formal...

  12. BPA-2010-02110-FOIA Response

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5, 2010 In reply refer to: DK-7 Ms. Beth S. Ginsberg Stoel Rives, LLP 600 University Street, Suite 3600 Seattle, WA 98101-4109 RE: BPA-2010-02110-F Dear Ms. Ginsberg: Thank you for...

  13. BPA-2010-00989-F Correspondence

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    March 1, 2010 In reply refer to: DK-7 Ben Tansey, Sr. Contributing Editor Clearing Up, Energy News Data Publications P.O. Box 900928 Queen Anne Station Seattle, WA 98119-9228 FOIA...

  14. DOE NSTB Researchers Demonstrate R&D Successes to Asset Owners at EnergySec Conference

    Broader source: Energy.gov [DOE]

    More than 150 energy sector leaders—including nearly 100 asset owners and operators—gathered at the 2009 EnergySec Annual Summit in Seattle, WA, on Sept. 23-24, where researchers from the...

  15. Results of Hg speciation testing on tanks 30, 32, and 37 surface samples

    SciTech Connect (OSTI)

    Bannochie, C. J.

    2015-11-11

    The Savannah River National Laboratory (SRNL) was tasked with preparing and shipping samples for Hg speciation by Eurofins Frontier Global Sciences, Inc. in Seattle, WA on behalf of the Savannah River Remediation (SRR) Mercury Task Team.

  16. BPA-2011-00676-FOIA Correspondence

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 In reply refer to: DK-7 Dan Seligman, Attorney at Law Columbia Research Corporation P.O. Box 99249 Seattle, WA 98139 RE: BPA-2011-00676-F Dear Mr. Seligman: Thank you for your...

  17. PowerPoint Presentation

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Island Bus NaS Battery Energy Storage Project U.S. DOE Peer Review Seattle, WA October 8, 2009 Steve Eckroad Electric Power Research Institute Seckroad@epri.com (704) 595-2717 2 ...

  18. BPA-2013-01652-FOIA Correspondence

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Columbia Research Corporation PO Box 99249 Seattle, WA 98139 FOIA BPA-2013-01652-F Dear Mr. Seligman: Thank you for your request for records that you made to the Bonneville Power...

  19. HANFORD ADVISORY BOARD

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8-9, 2011 FINAL MEETING SUMMARY HANFORD ADVISORY BOARD September 8-9, 2011 Seattle, WA Topics in This Meeting Summary Executive Summary .......................................................................................................................... 1 Welcome, introductions, and announcements .................................................................................. 2 Tri-Party Agreement Agencies - Annual Updates

  20. HANFORD ADVISORY BOARD

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9-10, 2010 FINAL MEETING SUMMARY HANFORD ADVISORY BOARD September 9 - 10, 2010 Seattle, WA Topics in This Meeting Summary Executive Summary ........................................................................................................................................ 1 Welcome, introductions and announcements .................................................................................................. 2 Confirm June meeting summary adoption

  1. HANFORD ADVISORY BOARD

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3-4, 2009 FINAL MEETING SUMMARY HANFORD ADVISORY BOARD September 3-4, 2009 Seattle, WA Topics in This Meeting Summary Executive Summary........................................................................................................................................ 1 Welcome, introductions and announcements ................................................................................................. 2 Confirm June meeting summary adoption

  2. PowerPoint Presentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    May 7-10, Seattle, WA Impact to NERSC * Franklin Upgrade Option - Currently 19,000 dual core XT4 2.6GHz Rev-F Opterons - Have option to upgrade to quad-core in 2008 - What is...

  3. LBNL: Architecture 2030 District Program and Small Commercial Toolkit |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Architecture 2030 District Program and Small Commercial Toolkit LBNL: Architecture 2030 District Program and Small Commercial Toolkit LBNL: Architecture 2030 District Program and Small Commercial Toolkit Lead Performer: Lawrence Berkeley National Laboratory - Berkeley, CA Partners: - Architecture 2030 - Santa Fe, NM - Cleveland 2030 District - Cleveland, OH - Green Building Alliance/Pittsburgh 2030 District - Pittsburgh, PA - Seattle 2030 District - Seattle, WA -

  4. Women & the Department of Ecology

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    June 7, 2012 Site-wide Permit Update Status:  Comment period began May 1*. Public meetings:  About 40 people attended public workshop May 3 at Ecology office.  Over 300 people total attended hearings May 15-16 in Seattle & Portland.  Spokane & Richland hearings held this week. *Except for Single-Shell Tanks. SST permit is on track to be released for public comment by July 1. River Corridor workshops June 12 - Seattle June 13 - Portland June 14 - Hood River Other comment

  5. file://L:\DOE-hanford.gov\public\boards\hab\advice\advice36.htm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Washington, DC 20585 Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Mary Riveland, Director Washington Department of Ecology PO Box 47600 Olympia, WA 98504-7600 John Wagoner, Manager Department of Energy, Richland Operations PO Box 550 Richland, WA 99352 December 8, 1995 RE: Review of FY96 BEMR, MYPP and Site Level Assumptions (HAB Advice #36) Dear Messrs. Grumbly, Clarke and Wagoner, and Ms. Riveland: The FY96 BEMR, MYPP

  6. file://L:\DOE-hanford.gov\public\boards\hab\advice\advice67.htm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 John Wagoner, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Subject: TWRS Vadose Zone Characterization Dear Messrs. Clarke, Fitzsimmons and Wagoner: Background In February 1996, new data were disclosed that contamination in the form

  7. DRAFT ADVICE - UNACCEPTABLE PROGRAM IMPACTS UNDER FY 97 BUDGET

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7, 2001 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Harry Boston, Manager U.S. Department of Energy, Office of River Protection 2440 Stevens Richland, WA 99352 Chuck Findley, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Re: Community Relations Plan Dear Messrs. Klein,

  8. CHP at Post Street in Downtown Seattle

    SciTech Connect (OSTI)

    Gent, Stan

    2012-04-12

    The Post Street project had four (4), 7.960 MW, Solar Taurus-70-10801S natural gas combustion turbines. Each turbine equipped with a 40,000 lb/hr heat recovery steam generator (HRSG). The dual-fuel HRSGs was capable of generating steam using gas turbine exhaust heat or surplus electric power. The generation capacity was nominally rated at 29.2 MW. The project as proposed had a fuel rate chargeable to power of 4,900 - 5,880 Btu/kWh dependent on time of year. The CHP plant, when operating at 29.2 MW, can recycle turbine exhaust into supply 145 kpph of steam to SSC per hour. The actual SSC steam loads will vary based on weather, building occupation, plus additions / reductions of customer load served. SSC produces up to 80 kpph of steam from a biomass boiler, which is currently base loaded all year.

  9. Seattle harnessing sun's power | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    a year from the renewable energy produced by solar systems installed at public utility sites. ... anyone anywhere in the country has enough sun to realize renewable energy's benefits. ...

  10. Seattle Gasoline and Diesel Retail Prices

    U.S. Energy Information Administration (EIA) Indexed Site

    All Grades - Conventional Areas 2.359 2.371 2.340 2.362 2.380 2.447 2003-2016 Regular 2.307 2.319 2.285 2.309 2.327 2.393 2003-2016 Conventional Areas 2.307 2.319 2.285 2.309 2.327 ...

  11. SEATTLE HELPS COMMUNITIES POWER BUILDINGS EFFICIENTLY | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... including free energy assessments, support, and troubleshooting through a business upgrade coordinator, as well as translation services for non-English speaking business owners. ...

  12. 3rd Annual Arctic Encounter Symposium Seattle

    Broader source: Energy.gov [DOE]

    The Arctic Encounter Symposium will convene policymakers, industry leaders, and leading experts to confront the leading issues in Arctic policy, innovation, and development. The two-day program includes two keynote luncheons, expert plenary sessions and breakout sessions.

  13. Spotlight on Seattle, Washington: Community Partnerships Work...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Simultaneously, CPW is set to achieve significant energy, climate, and economic development goals with its 40 partners-setting the city up for program sustainability. Leverage ...

  14. Spotlight on Seattle, Washington: Community Partnerships Work...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Making the Program Work for Contractors Better Buildings - Spotlight on Portland, Oregon; Financing and Incetntives: Use Incentives to Get Attention and Encourage Deep Savings

  15. LCLS-II EA Preliminary Draft 4-1-14

    Energy Savers [EERE]

    Department of Energy LBNL: Architecture 2030 District Program and Small Commercial Toolkit LBNL: Architecture 2030 District Program and Small Commercial Toolkit LBNL: Architecture 2030 District Program and Small Commercial Toolkit Lead Performer: Lawrence Berkeley National Laboratory - Berkeley, CA Partners: - Architecture 2030 - Santa Fe, NM - Cleveland 2030 District - Cleveland, OH - Green Building Alliance/Pittsburgh 2030 District - Pittsburgh, PA - Seattle 2030 District - Seattle, WA -

  16. PS-6 From: Hustad,Kenneth H - PSE-SPOKANE Sent: Thursday, October...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Cc: John Porter Subject: RE: Benton REA BPA Contract Negotiations Ken Here is the language that has been prepared by Terry to address the Boardman Issue. AdditiQmlJ Langya2e...

  17. Staff exchange with Spokane Intercollegiate Research and Technology Institute (SIRTI), final project report

    SciTech Connect (OSTI)

    Alexander, G.M.

    1994-12-01

    Staff exchanges, such as the one described in this report, are intended to facilitate communication and collaboration among scientists and engineers at Department of Energy (DOE) laboratories, in U.S. industry, and academia. Funding support for these exchanges is provided by the DOE, Office of Energy Research, Laboratory Technology Transfer Program. Funding levels for each exchange typically range from $20,000 to $40,000. The exchanges offer the opportunity for the laboratories to transfer technology and expertise to industry, gain a perspective on industry`s problems, and develop the basis for further cooperative efforts through Cooperative Research and Development Agreements (CRADAS) or other mechanisms.

  18. file://L:\DOE-hanford.gov\public\boards\hab\advice\advice04.htm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Mary Riveland, Director Department of Ecology State of Washington PO Box 47600 Olympia, WA 98504-7600 September 22, 1994 Dear Messrs. Wagoner and Clarke, and Ms. Riveland: On behalf of the Hanford Advisory Board, I am forwarding to you the following statement of concerns, which was adopted by the Board at the September 8 & 9 meeting: The cleanup of contaminated sites and

  19. file://L:\DOE-hanford.gov\public\boards\hab\advice\advice29c.ht

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Riveland, Director The Washington Department of Ecology PO Box 47600 Olympia, WA 98504-7600 Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 August 11, 1995 Dear Ms. Riveland and Mr. Clarke: RE: Stewardship and Stockpile Scoping Hearings Enclosed is the Hanford Advisory Board's request toUSDOE to extend the public comment period on the stewardship and stockpile scoping hearings. We also urge the Washington State Department

  20. Marine Energy Technology Symposium

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Proceedings of the 2 nd Marine Energy Technology Symposium METS2014 April 15-18, 2014, Seattle, WA FIELD MEASUREMENT TEST PLAN TO DETERMINE EFFECTS OF HYDROKINETIC TURBINE DEPLOYMENT ON CANAL TEST SITE IN YAKIMA, WA, USA Budi Gunawan 1 , Jesse Roberts, Ann Dallman, Vincent Neary Sandia National Laboratories Albuquerque, NM, U.S. Shane Grovue Instream Energy Systems Vancouver, BC, CA Josh Mortensen, Bryan Heiner US Bureau of Reclamation Denver, CO, U.S. 1 Corresponding author:

  1. Email Template

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2, 2009 FINAL MEETING SUMMARY HANFORD ADVISORY BOARD PUBLIC INVOLVEMENT AND COMMUNICATION COMMITTEE MEETING September 2, 2009 Seattle, WA Topics in this Meeting Summary Welcome and Introductions ............................................................................................................. 1 Approve meeting summary ............................................................................................................. 2 Tri-Party Agreement (TPA) and Community Relations Plan

  2. Results of Hg speciation testing on 3Q15 tank 50, salt solution feed tank (SSFT), and solvent hold tank (SHT) materials

    SciTech Connect (OSTI)

    Bannochie, C.

    2015-08-13

    The Savannah River National Laboratory (SRNL) was tasked with preparing and shipping samples for Hg speciation by Eurofins Frontier Global Sciences, Inc. in Seattle, WA on behalf of the Savannah River Remediation (SRR) Mercury Task Team. The results are documented in this report.

  3. Table 20. Coal Imports by Customs District

    U.S. Energy Information Administration (EIA) Indexed Site

    3,861 82,165 21,532 281.6 Honolulu, HI 179,816 180,315 179,281 716,657 725,127 -1.2 Los Angeles, CA 61 - 2,622 221 9,435 -97.7 San Francisco, CA - - - 131 109 20.2 Seattle, WA ...

  4. BPA-2013-01652-FOIA Request

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Addre P.O. Box 99249 SS RECEIVED BY BFA FOLA OFFICE TillS DATE: q14, 13 DUE DATE: 0 ux 4q -,23 f City Seattle z State WA i 98139 P Phon 206-349-4769 e Ex. xxx-xxx-xxxx FAX...

  5. SPO Calendar | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 2016 < prev next > Sun Mon Tue Wed Thu Fri Sat 28 29 1 2 3 4 5 6 7 8 9 10 11 12 Climate Leadership Conference (Seattle, WA) 8:30AM to 12:00PM PST 13 14 15 16 17 18 19 20 21...

  6. file://L:\DOE-hanford.gov\public\boards\hab\advice\advice06.htm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1, 1994 John Wagoner, Manager Department of Energy, Richland Operations Office PO Box 550 (A7-50) Richland, WA 99352 Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Mary Riveland, Director Department of Ecology State of Washington PO Box 47600 Olympia, WA 98504-7600 Dear Messrs. Wagoner and Clarke and Ms. Riveland: On behalf of the Hanford Advisory Board, I am pleased to forward to you the advice the Board adopted at its

  7. file://L:\DOE-hanford.gov\public\boards\hab\advice\advice106.ht

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7, 2000 Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Subject: 618-10 and 618-11 Burial Grounds Dear Messrs. Clarke, Fitzsimmons, and Klein: The Hanford Advisory Board (HAB) has an acute concern with regard to the

  8. file://L:\DOE-hanford.gov\public\boards\hab\advice\advice75.htm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1997 Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 John Wagoner, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Subject: ERDF Expansion Dear Messrs. Clarke, Fitzsimmons and Wagoner: The U.S. Environmental Protection Agency, the Washington State Department of Ecology, and the U.S.

  9. file://L:\DOE-hanford.gov\public\boards\hab\advice\advice91.htm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2, 1999 Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 James Hall, Acting Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Subject: Plutonium Finishing Plant Dear Messrs. Clarke, Fitzsimmons and Hall: The Plutonium Finishing Plant (PFP) contains 17.8 metric tons of plutonium bearing

  10. file://L:\DOE-hanford.gov\public\boards\hab\advice\advice93.htm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 James Hall, Acting Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Subject: Tri-Party Agreement Milestones and Public Involvement Dear Messrs. Clarke, Fitzsimmons and Hall: The safe treatment and disposal of Hanford's tank waste remains a top priority of the Hanford Advisory Board (HAB). This advice recommends both

  11. file://L:\DOE-hanford.gov\public\boards\hab\advice\advice94a.ht

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Chuck Clarke, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 James Hall, Acting Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Subject: U.S. Department of Energy Fiscal Year 2001 Budget Dear Messrs. Clarke, Fitzsimmons and Hall: The Hanford Advisory Board (HAB) has completed its review of the

  12. DRAFT ADVICE - UNACCEPTABLE PROGRAM IMPACTS UNDER FY 97 BUDGET

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 John Iani, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Re: 100/300 Area Change Package Dear Messrs. Klein, Iani, and Fitzsimmons The Hanford Advisory Board applauds the Tri-Party agencies for reaching agreement on a proposed

  13. Microsoft Word - HABAdv #170 Hanford Buried Waste.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    70 Subject: Hanford Buried Waste Adopted: March 4, 2005 Page 1 March 4, 2005 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Roy Schepens, Manager U.S. Department of Energy, Office of River Protection P.O. Box 450 (H6-60) Richland, WA 99352 Ron Kreizenbeck, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Jay Manning, Director Washington State Department of Ecology P.O. Box 47600

  14. HABAdv#1671.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 Subject: U Plant Closure Plan Adopted: September 10, 2004 Page 1 September 10, 2004 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Linda Hoffman, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Ron Kreizeneeck, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Subject: U Plant Closure Plan Dear Mssrs. Klein, Kreizeneeck, and Ms.

  15. Habadv#165 RCBRA.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 Subject: River Corridor Baseline Risk Assessment (RCBRA) Adopted: September 10, 2004 Page 1 September 10, 2004 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Ron Kreizeneeck, Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Linda Hoffman, Director Washington State Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Subject: Risk Assessment Work Plan for the 100 Area

  16. Habadv-119.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 Subject: B Reactor Engineering Evaluation and Cost Analysis Adopted: June 8, 2001 Page 1 June 8, 2001 Keith Klein, Manager U.S. Department of Energy, Richland Operations P.O. Box 550 (A7-50) Richland, WA 99352 Chuck Findley, Acting Regional Administrator U.S. Environmental Protection Agency, Region 10 1200 Sixth Avenue Seattle, WA 98101 Tom Fitzsimmons, Director Washington Department of Ecology P.O. Box 47600 Olympia, WA 98504-7600 Re: B Reactor Engineering Evaluation and Cost Analysis Dear

  17. EIS-0346: Salmon Creek Project, WA

    Broader source: Energy.gov [DOE]

    This EIS analyzes BPA's proposal to fund activities that would restore sufficient water flows to Salmon Creek and rehabilitate its streambed as necessary to provide adequate passage for summer steelhead (Oncorhynchus mykiss) and possibly spring chinook (O. tshawytscha).

  18. DOE Climate Change Adaptation Training (Richland, WA)

    Broader source: Energy.gov [DOE]

    This free training is a primer on climate science, identifying climate hazards, conducting vulnerability assessments, leveraging climate change data and tools and understanding the energy-water-food nexus.

  19. 2715-WA_Carpenter's_Shop_Refurbishment.pdf

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

  20. Sumas, WA LNG Imports from Canada

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    12,530 7,769 9,768 6,016 10,409 3,547 1996-2014 Pipeline Prices 5.55 4.81 4.47 3.87 4.02 5.05 1996...

  1. app_d

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    17 DOE/EIS-0287 Idaho HLW & FD EIS - New Information - Document 47, Kemble & Mildred Stout, Spokane, WA Page 1 of 1 Document 48, U.S. Department of Interior (Preston A. Sleeger), Portland, OR Page 1 of 1 DOE/EIS-0287 D-118 Appendix D - New Information - Document 49, Lynn Sims, Portland, OR Page 1 of 1 Document 50, Public Comment Hearing, February 17, 2000, Boise, ID Page 1 of 6 D-119 DOE/EIS-0287 Idaho HLW & FD EIS - New Information - Document 50, Public Comment Hearing, February 17,

  2. DepoNet

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    DRAFT TANK CLOSURE AND WASTE MANAGEMENT ENVIRONMENTAL IMPACT STATEMENT PUBLIC HEARING DATE: FEBRUARY 23, 2010 6:00 p.m. RED LION INN AT THE PARK 303 WEST NORTH RIVER DRIVE SPOKANE, WA 99206 James Parham, Facilitator PANEL MEMBERS: Ms. Mary Beth Burandt, U.S. Department of Energy, Office of River Protection Jeff Lyon, Washington State Department of Ecology, Hanford Project Office Nationwide Scheduling Toll Free: 1.800.337.6638 Facsimile: 1.973.355.3094 www.deponet.com Public Hearing February 23,

  3. Oklahoma Community-Scale Tribal Renewable Energy Workshop | Department of

    Office of Environmental Management (EM)

    Issue 15 October/November/December 2014 Office of Worker Screening and Compensation Support I N S I D E T H I S I S S U E : Director's Note 1 Quilt 1 NDR 2 JOTG Town Hall 2 UI Recognition 3 SERT 4 Calendar 4 A NOTE FROM THE DIRECTOR By Greg Lewis The late summer and early fall have been an extremely busy time for AU-14, filled with a number of events and projects. In August, we attended Joint Outreach Task Group (JOTG) events in Spokane and Richland, WA, as well as an annual meeting of the

  4. Indian Community Development Block Grant Program Workshop- Seattle

    Broader source: Energy.gov [DOE]

    The U.S. Department of Housing and Urban Development (HUD) Southwest Office of Native American Programs is conducting this training workshop to assist applicants with the Indian Community Development Block Grant Program.

  5. Solar Works! In Seattle: Introduction to Solar Electric (PV)

    Broader source: Energy.gov [DOE]

    Presentation slides from residential PV workshop. Also covers general solar resource assessment, siting and financial incentives.

  6. City of Seattle - Sustainable Buildings and Sites Policy | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    with over 5,000 square feet of occupied space to achieve a Gold Rating using the US Green Building Council's (USGBC) LEED Rating System. In addition, these projects must meet...

  7. DOE Zero Energy Ready Home: Montlake Modern- Seattle, Washington

    Broader source: Energy.gov [DOE]

    This DOE Zero Energy Ready Home features structural insulated panel walls and roof, an air-to-water heat pump plus radiant floor heat; 100% LED lighting; filtered-fan-powered fresh air intake; triple-pane windows, and 9.7 kWh PV for electric car charging station.

  8. City of Seattle- Community Power Works Loan Program

    Broader source: Energy.gov [DOE]

    Once a home is assessed, customers select energy efficiency improvements, choose a contractor from a pool of approved contractors, and apply for financing.  Loan amounts are calculated after fact...

  9. City of Seattle, Washington (Utility Company) | Open Energy Informatio...

    Open Energy Info (EERE)

    27,512 519,210 39,402 4,885 105,963 220 3 50 3 55,758 999,805 391,180 2008-12 15,946 266,607 350,675 24,130 441,877 39,392 4,551 95,303 219 3 56 3 44,630 803,843 390,289 2008-11...

  10. Seattle, Washington, Summary of Reported Data From July 1, 2010...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... These partners help overcome language barriers that have prevented participation i n energy efficiency programs thanks to their expertise in 15 languages, including Spanish, ...

  11. Data-Driven Mailing Helps Heat Up Untapped Seattle Market

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... you're probably reaching folks who aren't strong prospects for energy efficiency upgrades. ... Whether it's the age of the home, heating source, or age of the families living there, use ...

  12. City of Seattle, Washington (Utility Company) | Open Energy Informatio...

    Open Energy Info (EERE)

    ) OTH SALES (MWH) OTH CONS TOT REV (THOUSAND ) TOT SALES (MWH) TOT CONS 2009-03 23,601 373,913 353,104 24,986 456,778 39,325 4,440 92,495 220 3 47 3 53,030 923,233 392,652...

  13. Northwest Distributed/Community Wind Workgroup Meeting- Seattle

    Broader source: Energy.gov [DOE]

    As part of the DOE's Northwest Wind Resource and Action Center, Northwest SEED will facilitate a workgroup meeting for stakeholders involved in the distributed and community wind sector in the...

  14. Washington: Seattle Rises Above with Alternative Fuels | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    on fuel due to the cost differential between compresses natural gas (CNG) and gasoline. ... who was a veteran started a taxi company with a 100% alternative fuel fleet-CNG For Hire. ...

  15. Seattle City Light - Multi-Family Residential Energy Efficiency...

    Broader source: Energy.gov (indexed) [DOE]

    for common area lighting and weatherization measures including the installation of dual-pane windows and increased insulation, although insulation-only jobs are not eligible...

  16. PowerPoint Presentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Howieson, Issue Manager Presentation Sept. 4, 2013 Public Comment Period: July 15 - August 16, 2013 Public Meetings: Tuesday, July 30, 2013 5:30 - 8:30 p.m. Richland Public Library 955 Northgate Drive Richland, WA Wednesday, July 31, 2013 6-9p.m. University Heights Center 5031 University Way NE Seattle, WA Thursday, August 8, 2013 6-9p.m. Best Western Hotel 1108 E Marina Dr. Hood River, OR Methods Contaminated soil removal, referred to as removal, treatment, and disposal (RTD) Monitored Natural

  17. Resident Fish Stock Status above Chief Joseph and Grand Coulee Dams; 2002-2003 Annual Report.

    SciTech Connect (OSTI)

    Connor, Jason M.; McLellan, Jason G.; Butler, Chris

    2006-02-01

    In 1980, the United States Congress enacted the Northwest Power Planning and Conservation Act (PL 96-501, 1980), which established the Northwest Power and Conservation Council (NPCC), formerly the Northwest Power Planning Council. The NPCC was directed by Congress to develop a regional Power Plan and also the Columbia River Basin Fish and Wildlife Program (FWP) to restore or replace losses of fish caused by construction and operation of hydroelectric dams in the Columbia River Basin. In developing the FWP, Congress specifically directed NPCC to solicit recommendations for measures to be included in the Program from the region's fish and wildlife agencies and Indian tribes. All measures adopted by the Council were also required to be consistent with the management objectives of the agencies and tribes [Section 4.(h)(6)(A)], the legal rights of Indian tribes in the region [Section 4.(h)(6)(D)] and be based upon and supported by the best available scientific knowledge [Section 4.(h)(6)(B)]. The Resident Fish Stock Status above Chief Joseph and Grand Coulee Dams Project, also known as the Joint Stock Assessment Project (JSAP) specifically addresses NPPC Council measure 10.8B.26 of the 1994 program. The Joint Stock Assessment Project is a management tool using ecosystem principles to manage artificial and native fish assemblages in altered environments existing in the Columbia River System above Chief Joseph and Grand Coulee Dams (Blocked Area). A three-phase approach of this project will enhance the fisheries resources of the Blocked Area by identifying data gaps, filling data gaps with research, and implementing management recommendations based on research results. The Blocked Area fisheries information is housed in a central location, allowing managers to view the entire system while making decisions, rather than basing management decisions on isolated portions of the system. The JSAP is designed and guided jointly by fisheries managers in the Blocked Area. The initial year of the project (1997) identified the need for a central data storage and analysis facility, coordination with the StreamNet project, compilation of Blocked Area fisheries information, and a report on the ecological condition of the Spokane River System. These needs were addressed in 1998 by acquiring a central location with a data storage and analysis system, coordinating a pilot project with StreamNet, compiling fisheries distribution data throughout the Blocked Area, identifying data gaps based on compiled information, and researching the ecological condition of the Spokane River. In order to ensure that any additional information collected throughout the life of this project will be easily stored and manipulated by the central storage facility, it was necessary to develop standardized methodologies between the JSAP fisheries managers. Common collection and analytical methodologies were developed in 1999. The project began addressing identified data gaps throughout the Blocked Area in 1999. Data collection of established projects and a variety of newly developed sampling projects are ongoing. Projects developed and undertaken by JSAP fisheries managers include investigations of the Pend Orielle River and its tributaries, the Little Spokane River and its tributaries, and water bodies within and near the Spokane Indian Reservation. Migration patterns of adfluvial and reservoir fish in Box Canyon Reservoir and its tributaries, a baseline assessment of Boundary Reservoir and its tributaries, ecological assessment of mountain lakes in Pend Oreille County, and assessments of streams and lakes on the Spokane Indian Reservation were completed by 2001. Assessments of the Little Spokane River and its tributaries, Spokane River below Spokane Falls, tributaries to the Pend Oreille River, small lakes in Pend Oreille County, WA, and water bodies within and near the Spokane Indian Reservation were conducted in 2002 and 2003. This work was done in accordance with the scope of work approved by Bonneville Power Administration (BPA).

  18. Resident Fish Stock above Chief Joseph and Grand Coulee Dams; 2003-2004 Annual Report.

    SciTech Connect (OSTI)

    Connor, Jason M.; McLellan, Jason G.; Butler, Chris

    2005-11-01

    In 1980, the United States Congress enacted the Northwest Power Planning and Conservation Act (PL 96-501, 1980), which established the Northwest Power and Conservation Council (NPCC), formerly the Northwest Power Planning Council. The NPCC was directed by Congress to develop a regional Power Plan and also the Columbia River Basin Fish and Wildlife Program (FWP) to restore or replace losses of fish caused by construction and operation of hydroelectric dams in the Columbia River Basin. In developing the FWP, Congress specifically directed NPCC to solicit recommendations for measures to be included in the Program from the region's fish and wildlife agencies and Indian tribes. All measures adopted by the Council were also required to be consistent with the management objectives of the agencies and tribes [Section 4.(h)(6)(A)], the legal rights of Indian tribes in the region [Section 4.(h)(6)(D)] and be based upon and supported by the best available scientific knowledge [Section 4.(h)(6)(B)]. The Resident Fish Stock Status above Chief Joseph and Grand Coulee Dams Project, also known as the Joint Stock Assessment Project (JSAP) specifically addresses NPPC Council measure 10.8B.26 of the 1994 program. The Joint Stock Assessment Project is a management tool using ecosystem principles to manage artificial and native fish assemblages in altered environments existing in the Columbia River System above Chief Joseph and Grand Coulee Dams (Blocked Area). A three-phase approach of this project will enhance the fisheries resources of the Blocked Area by identifying data gaps, filling data gaps with research, and implementing management recommendations based on research results. The Blocked Area fisheries information is housed in a central location, allowing managers to view the entire system while making decisions, rather than basing management decisions on isolated portions of the system. The JSAP is designed and guided jointly by fisheries managers in the Blocked Area. The initial year of the project (1997) identified the need for a central data storage and analysis facility, coordination with the StreamNet project, compilation of Blocked Area fisheries information, and a report on the ecological condition of the Spokane River System. These needs were addressed in 1998 by acquiring a central location with a data storage and analysis system, coordinating a pilot project with StreamNet, compiling fisheries distribution data throughout the Blocked Area, identifying data gaps based on compiled information, and researching the ecological condition of the Spokane River. In order to ensure that any additional information collected throughout the life of this project will be easily stored and manipulated by the central storage facility, it was necessary to develop standardized methodologies between the JSAP fisheries managers. Common collection and analytical methodologies were developed in 1999. The project began addressing identified data gaps throughout the Blocked Area in 1999. Data collection of established projects and a variety of newly developed sampling projects are ongoing. Projects developed and undertaken by JSAP fisheries managers include investigations of the Pend Orielle River and its tributaries, the Little Spokane River and its tributaries, and water bodies within and near the Spokane Indian Reservation. Migration patterns of adfluvial and reservoir fish in Box Canyon Reservoir and its tributaries, a baseline assessment of Boundary Reservoir and its tributaries, ecological assessment of mountain lakes in Pend Oreille County, and assessments of streams and lakes on the Spokane Indian Reservation were completed by 2001. Assessments of the Little Spokane River and its tributaries, Spokane River below Spokane Falls, tributaries to the Pend Oreille River, small lakes in Pend Oreille County, WA, and water bodies within and near the Spokane Indian Reservation were conducted in 2002 and 2003. This work was done in accordance with the scope of work approved by Bonneville Power Administration (BPA).

  19. Buildings Energy Data Book: 7.8 State Building Energy Codes

    Buildings Energy Data Book [EERE]

    3 Building Energy Rating and Disclosure Policies in the United States Commercial Buildings Commercial Buildings Public Buildings Homes Existing Policy Policy Being Considered Rating Requirement Disclosure Requirement Austin, TX Connecticut Arlington County, VA Alaska California Colorado Denver, CO Austin, TX District of Columbia Illinois Hawaii Kansas New York, NY Maine Michigan Montgomery County, MD San Francisco, CA Maryland Minnesota Nevada Seattle, WA Massachusetts Ohio New York Washington

  20. LED Street Lighting Conversion Workshop Presentations | Department of

    Energy Savers [EERE]

    Energy Research & Development » Technology Application R&D » Municipal Consortium » News & Events » LED Street Lighting Conversion Workshop Presentations LED Street Lighting Conversion Workshop Presentations This page provides links to the presentations given at the National League of Cities Mobile Workshop, LED Street Lighting Conversion: Saving Your Community Money, While Improving Public Safety, held November 13, 2013, in Seattle, WA. Presentations and Materials State of

  1. Electrostatic Transfer of Epitaxial Graphene. (Conference) | SciTech

    Office of Scientific and Technical Information (OSTI)

    Connect Electrostatic Transfer of Epitaxial Graphene. Citation Details In-Document Search Title: Electrostatic Transfer of Epitaxial Graphene. Abstract not provided. Authors: Biedermann, Laura Butler Publication Date: 2011-05-01 OSTI Identifier: 1109245 Report Number(s): SAND2011-3570C 471561 DOE Contract Number: AC04-94AL85000 Resource Type: Conference Resource Relation: Conference: MSE 520 Graduate Seminar Series (UW) held May 23, 2011 in Seattle, WA.; Related Information: Proposed for

  2. Final Report

    Office of Scientific and Technical Information (OSTI)

    Internal magnetic field, temperature, and density measurements on magnetized HED plasmas using Pulsed Polarimetry DOE Grant ER55034, UW grant # 61-9515 - High Energy Density, Office of Fusion Science Roger J Smith (PI) Dept. Aeronautics and Astronautics, University of Washington, Seattle, Wa 98195 smith@aa.washington.edu, 206 543 6323 (AA grants administrator) June 11, 2014 Report submitted to: Formerly Dr. Francis Thio Program Manager, DOE Office of Fusion Energy Sciences Nominal Grant Period:

  3. Integrated municipal solid waste management: Six case studies of system cost and energy use. A summary report

    SciTech Connect (OSTI)

    1995-11-01

    Report documents an evaluation of the environmental, economic, and energy impacts of integrated municipal solid waste management systems in six cities: Minneapolis, NW; Springfield, MA; Seattle, WA; Scottsdale, AZ; Palm Beach County, CA; and Sevierville, TN. The primary objective of these case studies was to develop and present consistent cost, resource use (especially energy), and environmental regulator information on each operating IMSWM system. The process is defined as using two or more alternative waste management techniques. Detailed reports on each system are available.

  4. Effects of Localized Energy Extraction in an Idealized, Energetically Complete Numerical Model of an Ocean-Estuary Tidal System

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    localized energy extraction in an idealized, energetically complete numerical model of an ocean-estuary tidal system MHK Instrumentation, Measurement & Computer Modeling Workshop, Broomfield CO, July 10 2012 Mitsuhiro Kawase and Marisa Gedney Northwest National Marine Renewable Energy Center / School of Oceanography University of Washington Seattle WA 98195 United States * Far-field (Estuary-wide) - Changes in the tidal range - Changes in tidal currents  Near-field (Vicinity of the

  5. Sort-Last Smackdown!. (Conference) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    SciTech Connect Search Results Conference: Sort-Last Smackdown!. Citation Details In-Document Search Title: Sort-Last Smackdown!. Abstract not provided. Authors: Moreland, Kenneth D. ; Kendall, Wesley ; Peterka, Tom ; Huang, Jian Publication Date: 2011-04-01 OSTI Identifier: 1108378 Report Number(s): SAND2011-2482C 470604 DOE Contract Number: AC04-94AL85000 Resource Type: Conference Resource Relation: Conference: Supercomputing held November 12-18, 2011 in Seattle, WA.; Related Information:

  6. HIA 2015 DOE Zero Energy Ready Home Case Study: Glastonbury Housesmith, Hickory Drive, South Glastonbury, CT

    Energy Savers [EERE]

    Dwell Development Reclaimed Modern Seattle, WA DOE ZERO ENERGY READY HOME(tm) The U.S. Department of Energy invites home builders across the country to meet the extraordinary levels of excellence and quality specified in DOE's Zero Energy Ready Home program (formerly known as Challenge Home). Every DOE Zero Energy Ready Home starts with ENERGY STAR Certified Homes Version 3.0 for an energy-efficient home built on a solid foundation of building science research. Advanced technologies are designed

  7. Microsoft Word - RM1_Tidal Turbine_UW Tidal Resource-Abstract.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reference Model #1 - Tidal Energy: Resource Dr. Brian Polagye Northwest National Marine Renewable Energy Center University of Washington, Seattle, WA Introduction Reference Model #1 is a tidal turbine operating in a narrow, tidal channel. The site is a generalized version of Tacoma Narrows, Puget Sound, Washington. The resource is a mixed, mainly semidiurnal tidal regime with two ebbs and floods each day of unequal strength (i.e., a diurnal inequality in which a strong ebb/flood exchange is

  8. R. Glenn Brook

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Glenn Brook glenn-brook@tennessee.edu Scaling to Petascale and Beyond: Performance Analysis and Optimization of Applications SC11 Tutorial - Seattle, WA - November 13, 2011 HPC Communication Considerations * Communication Cost: t comm = t s + L * t h + m/B e - t s = startup time ~ time to setup message and routing - t h = hop time, L = number of hops - m = message size, B e = effective bandwidth - Communication is expensive. Avoid it if possible! * Considerations: - Number and size of

  9. Reference Model #1 - Tidal Energy: Resource Dr. Brian Polagye

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reference Model #1 - Tidal Energy: Resource Dr. Brian Polagye Northwest National Marine Renewable Energy Center University of Washington, Seattle, WA 1 Introduction Reference Model #1 is a tidal turbine operating in a narrow, tidal channel. The site is a generalized version of Tacoma Narrows, Puget Sound, Washington. The resource is a mixed, mainly semidiurnal tidal regime with two ebbs and floods each day of unequal strength (i.e., a diurnal inequality in which a strong ebb/flood exchange is

  10. Microsoft Word - FOI 2010-00205 REQUEST.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Administration: Electronic FOIA Request Detail Thank you for your Freedom of Information Act Information Request. Within the next four weeks we will notify you of either how long the search will take to complete or the availability of the information you requested. Name: Brian D. Zeringer Organization: Lane Powell PC Address: 1420 Fifth Avenue, Suite 4100 Seattle, WA 98101 Country: United States Phone Number: 206-223-7073 Fax Number: 206-223-7107 E-mail: zeringerb@lanepowell.com Reasonably

  11. Advance Patent Waiver W(A)2011-062

    Broader source: Energy.gov [DOE]

    This is a request by ABENGOA SOLAR INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-08GO18038.

  12. Advance Patent Waiver W(A)2011-056

    Broader source: Energy.gov [DOE]

    This is a request by ABENGOA SOLAR INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-08GO18036.

  13. Advance Patent Waiver W(A)2011-063

    Broader source: Energy.gov [DOE]

    This is a request by ABENGOA SOLAR INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-08GO18156.

  14. Advance Patent Waiver W(A)2008-010

    Broader source: Energy.gov [DOE]

    This is a request by XANTREX TECHNOLOGY, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-07GO17043

  15. Advance Patent Waiver W(A)2007-021

    Broader source: Energy.gov [DOE]

    This is a request by SUN POWER CORPORATION for a DOE waiver of domestic and foreign patent rights under agreement DE-PS36-06GO96034

  16. Advance Patent Waiver W(A)2010-055

    Broader source: Energy.gov [DOE]

    This is a request by SUN POWER CORPORATIO for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0002066

  17. Advance Patent Waiver W(A)2006-032

    Broader source: Energy.gov [DOE]

    This is a request by HONEYWELL INTERNATIONAL, INC. for a DOE waiver of domestic and foreign patent rights under agreement UNKNOWN

  18. Advance Patent Waiver W(A)2012-003

    Broader source: Energy.gov [DOE]

    This is a request by CREE for a DOE Advance patent waiver of domestic and foreign patent rights under agreement DE-FOA-0000439.

  19. Advance Patent Waiver W(A)2005-031

    Broader source: Energy.gov [DOE]

    This is a request by OSRAM SYLVANIA PRODUCTS, INC for a DOE waiver of domestic and foreign patent rights under agreement DE-FG36-05GO85042.

  20. Advance Patent Waiver W(A)2005-043

    Broader source: Energy.gov [DOE]

    This is a request by GENERAL ELECTRIC COMPANY for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-05NT42451.

  1. Advance Patent Waiver W(A)2011-050

    Broader source: Energy.gov [DOE]

    This is a request by EMERSON ELECTRIC for a DOE waiver of domestic and foreign patent rights under agreement DE-FE0004000.

  2. Advance Patent Waiver W(A)2005-004

    Broader source: Energy.gov [DOE]

    This is a request by ALSTO for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-03NT41986.

  3. Advance Patent Waiver W(A)2012-024

    Broader source: Energy.gov [DOE]

    This is a request by SIEMENS ENERGY, INC. for a DOE Advance patent waiver of domestic and foreign patent rights under agreement DE-EE0005493.

  4. Advance Patent Waiver W(A)2010-061

    Broader source: Energy.gov [DOE]

    This is a request by PALTO ALTO RESEARCH CENTER, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0002765

  5. Advance Patent Waiver W(A)2010-066

    Broader source: Energy.gov [DOE]

    This is a request by A.O. SMITH CORP. for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003985

  6. EIS-0325: Schultz-Hanford Area Transmission Line Project, WA

    Broader source: Energy.gov [DOE]

    BPA proposes to construct a new 500-kilovolt (kV) transmission line in central Washington. This project would increase transmission system capacity north of Hanford.

  7. Advance Patent Waiver W(A)2008-015

    Broader source: Energy.gov [DOE]

    This is a request by BP SOLAR LTD. for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-GO17049

  8. Advance Patent Waiver W(A)2011-005

    Broader source: Energy.gov [DOE]

    This is a request by UNITED TECHNOLOGIES RESEARCH CENTER for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003954.

  9. RAPID/Roadmap/6-WA-b | Open Energy Information

    Open Energy Info (EERE)

    water information; Location of discharge into surface waterbody; State Environmental Policy Act Requirements; Public notice requirements; and Certification of the developer...

  10. RAPID/Roadmap/4-WA-a | Open Energy Information

    Open Energy Info (EERE)

    Use Lease Developers interested in conducting non-drilling exploration activities must consult with the WSDNR and negotiate the terms of a Land Use License. As there is no formal...

  11. Advance Patent Waiver W(A)2008-017

    Office of Energy Efficiency and Renewable Energy (EERE)

    This is a request by UNITED TECHNOLOGIES CORP for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-07GO17030

  12. Advance Patent Waiver W(A)2009-019

    Broader source: Energy.gov [DOE]

    This is a request by DOW CORNING CORPORATION for a DOE waiver of domestic and foreign patent rights under agreement DE-FG36-08GO18068

  13. Advance Patent Waiver W(A)2009-011

    Broader source: Energy.gov [DOE]

    This is a request by BOEING COMPANY for a DOE waiver of domestic and foreign patent rights under agreement DE-FG36-08GO18135

  14. Advance Patent Waiver W(A)2009-032

    Broader source: Energy.gov [DOE]

    This is a request by GENERAL ATOMICS for a DOE waiver of domestic and foreign patent rights under agreement DE-FG36-08GO18145

  15. RAPID/Roadmap/19-WA-f | Open Energy Information

    Open Energy Info (EERE)

    Permitting Information Desktop Toolkit BETA About Bulk Transmission Geothermal Hydropower Solar Tools Contribute Contact Us Water Well NOI for Replacement or Additional Wells...

  16. Advance Patent Waiver W(A)2009-018

    Broader source: Energy.gov [DOE]

    This is a request by CATERPILLAR, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-07NT43277

  17. Microsoft Word - WA Parish_MAP_Final.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... or working near Ecologically Significant Stream Segments during pipeline construction. ... If compensatory wetland mitigation becomes necessary as part of any USACE permit, NRG ...

  18. Advance Patent Waiver W(A)2012-027

    Broader source: Energy.gov [DOE]

    This is a request by DAIMIER TRUCKS NORTH AMERICA for a DOE Advance patent waiver of domestic and foreign patent rights under agreement DE-EE0003348.

  19. Advance Patent Waiver W(A)2012-029

    Broader source: Energy.gov [DOE]

    This is a request by ALCOA COMMERICAL WINDOWS, LLC for a DOE Advance patent waiver of domestic and foreign patent rights under agreement DE-EE0004012.

  20. Advance Patent Waiver W(A)2011-039

    Broader source: Energy.gov [DOE]

    This is a request by 3M COMPANY for a DOE waiver of domestic and foreign patent rights under agreement DE-FG36-08GO18134.

  1. Advance Patent Waiver W(A)2008-022

    Broader source: Energy.gov [DOE]

    This is a request by ABENGOA BIOENERGY BIOMASS OF KANSAS, LLC for a DOE waiver of domestic and foreign patent rights under agreement DE-FC3607017028

  2. Advance Patent Waiver W(A)2012-019

    Broader source: Energy.gov [DOE]

    This is a request by GE ENERGY for a DOE Advance patent waiver of domestic and foreign patent rights under agreement DE-FE0007902.

  3. Advance Patent Waiver W(A)2012-018

    Broader source: Energy.gov [DOE]

    This is a request by GE ENERGY for a DOE Advance patent waiver of domestic and foreign patent rights under agreement DE-FE0007859.

  4. Advance Patent Waiver W(A)2011-064

    Broader source: Energy.gov [DOE]

    This is a request by DELPHI AUTOMOTIVE SYSTEMS, LLC for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0005342.

  5. Advance Patent Waiver W(A)2009-048

    Office of Energy Efficiency and Renewable Energy (EERE)

    This is a request by GENERAL ELECTRIC COMPANY for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-08NT0005310

  6. Advance Patent Waiver W(A)2011-026

    Broader source: Energy.gov [DOE]

    This is a request by US SYNTHETIC CORPORATION for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003633.

  7. Advance Patent Waiver W(A)2007-014

    Broader source: Energy.gov [DOE]

    This is a request by DONALDSON COMPANY for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-06NT42861

  8. Advance Patent Waiver W(A)2010-021

    Broader source: Energy.gov [DOE]

    This is a request by PHILIPS LUMILEDS for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003249

  9. Advance Patent Waiver W(A)2010-047

    Broader source: Energy.gov [DOE]

    This is a request by APPLIED MATERIALS, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003331

  10. Sumas, WA Natural Gas Imports by Pipeline from Canada

    Gasoline and Diesel Fuel Update (EIA)

    332,358 313,922 312,236 333,050 359,343 429,642 1996-2015 Pipeline Prices 4.22 3.96 2.72 3.62 4.32 2.36 1996-2015 Liquefied Natural Gas Volumes 0 5 11 2013-2015 Liquefied Natural Gas Prices -- 8.42 6.22 2013

  11. Advance Patent Waiver W(A)2009-068

    Office of Energy Efficiency and Renewable Energy (EERE)

    This is a request by United Solar Systems Corp. for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-07GO17053

  12. Advance Patent Waiver W(A)2008-027

    Office of Energy Efficiency and Renewable Energy (EERE)

    This is a request by ALCOA, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-08GO180278

  13. Advance Patent Waiver W(A)2011-059

    Office of Energy Efficiency and Renewable Energy (EERE)

    This is a request by CARLISLE CONSTRUCTION MATERIALS, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0005435.

  14. Advance Patent Waiver W(A)2010-020

    Office of Energy Efficiency and Renewable Energy (EERE)

    This is a request by HALOTECHNICS, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-08GO18144

  15. Advance Patent Waiver W(A)2007-012

    Office of Energy Efficiency and Renewable Energy (EERE)

    This is a request by BOEING for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-06GO17052

  16. Advance Patent Waiver W(A)2011-030

    Broader source: Energy.gov [DOE]

    This is a request by EATON CORPORATION for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003911.

  17. Advance Patent Waiver W(A)2013-027

    Broader source: Energy.gov [DOE]

    This is a request by ELECTRICORE INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0005968

  18. Advance Patent Waiver W(A)2012-025

    Broader source: Energy.gov [DOE]

    This is a request by EATON CORPORATION for a DOE Advance patent waiver of domestic and foreign patent rights under agreement DE-OE0000592.

  19. Advance Patent Waiver W(A)2012-032

    Broader source: Energy.gov [DOE]

    This is a request by EATON CORPORATION for a DOE Advance patent waiver of domestic and foreign patent rights under agreement DE-EE0005665.

  20. Advance Patent Waiver W(A)2009-051

    Broader source: Energy.gov [DOE]

    This is a request by CATERPILLAR, INC. for a DOE waiver of domestic and foreign patent rights under agreement De-FC26-02AL67974

  1. Advance Patent Waiver W(A)2011-065

    Broader source: Energy.gov [DOE]

    This is a request by OWENS CORNING for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0005338.

  2. Advance Patent Waiver W(A)2009-007

    Broader source: Energy.gov [DOE]

    This is a request by UNITED TECHNOLOGIES CORP for a DOE waiver of domestic and foreign patent rights under agreement DE-AC02-05CH11231

  3. Advance Patent Waiver W(A)2011-038

    Broader source: Energy.gov [DOE]

    This is a request by A123 SYSTEMS, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0001187.

  4. Advance Patent Waiver W(A)2008-035

    Broader source: Energy.gov [DOE]

    This is a request by POET RESEARCH, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-08GO88033

  5. Advance Patent Waiver W(A)2012-020

    Broader source: Energy.gov [DOE]

    This is a request by CLIPPER WINDPOWER LLC for a DOE Advance patent waiver of domestic and foreign patent rights under agreement DE-EE0005141.

  6. Advance Patent Waiver W(A)2010-034

    Office of Energy Efficiency and Renewable Energy (EERE)

    This is a request by LUMINATION, LLC for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003232

  7. Advance Patent Waiver W(A)2005-061

    Broader source: Energy.gov [DOE]

    This is a request by CATERPILLAR for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-05NT42412.

  8. Advance Patent Waiver W(A)2005-052

    Broader source: Energy.gov [DOE]

    This is a request by CATERPILLAR, INC for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-05NT42423.

  9. Advance Patent Waiver W(A)2006-019

    Broader source: Energy.gov [DOE]

    This is a request by NALCO CHEMICAL CORPORATION for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-06FT42721

  10. Advance Patent Waiver W(A)2008-014

    Broader source: Energy.gov [DOE]

    This is a request by GENERAL MOTORS CORP for a DOE waiver of domestic and foreign patent rights under agreement DE-FG36-07GO17018

  11. Advance Patent Waiver W(A)2006-021

    Broader source: Energy.gov [DOE]

    This is a request by UTC FUEL CELLS, LLC for a DOE waiver of domestic and foreign patent rights under agreement DE-FG36-06GO86042

  12. Advance Patent Waiver W(A)2010-028

    Broader source: Energy.gov [DOE]

    This is a request by ARKEMA for a DOE waiver of domestic and foreign patent rights under agreement DE-PS36-08GO98009

  13. Advance Patent Waiver W(A)2010-049

    Broader source: Energy.gov [DOE]

    This is a request by PRAXAIR, INC for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-07NT43088

  14. Advance Patent Waiver W(A)2005-040

    Broader source: Energy.gov [DOE]

    This is a request by CORNING INCORPORATED for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-05NT42461.

  15. Advance Patent Waiver W(A)2010-024

    Broader source: Energy.gov [DOE]

    This is a request by EASTMAN CHEMICAL COMPANY for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-05NT42469

  16. Advance Patent Waiver W(A)2011-049

    Broader source: Energy.gov [DOE]

    This is a request by DOW CHEMICAL COMPANY for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003916.

  17. Advance Patent Waiver W(A)2012-016

    Broader source: Energy.gov [DOE]

    This is a request by LINDE, INC. for a DOE Advance patent waiver of domestic and foreign patent rights under agreement DE-FE0007453.

  18. EA-1949: Admiralty Inlet Pilot Tidal Project, Puget Sound, WA

    Broader source: Energy.gov [DOE]

    This EA analyzes the potential environmental effects of a proposal by the Public Utility District No. 1 of Snohomish County, Washington to construct and operate the Admiralty Inlet Tidal Project. The proposed 680-kilowatt project would be located on the east side of Admiralty Inlet in Puget Sound, Washington, about 1 kilometer west of Whidbey Island, entirely within Island County, Washington. The Federal Energy Regulatory Commission (FERC) is the lead agency. The DOE NEPA process for this project has been canceled.

  19. RAPID/Roadmap/14-WA-e | Open Energy Information

    Open Energy Info (EERE)

    wastewater pollutants to land must apply for a State Wastewater Discharge Permit. Industrial facilities that discharge wastewater to privately or publicly owned wastewater...

  20. Advance Patent Waiver W(A)2012-015

    Broader source: Energy.gov [DOE]

    This is a request by GENERAL ELECTRIC GLOBAL REARCH for a DOE Advance patent waiver of domestic and foreign patent rights under agreement DE-FE0005859.

  1. Advance Patent Waiver W(A)2005-048

    Broader source: Energy.gov [DOE]

    This is a request by IBM BLUEGENE/P DESIGN, PHASE III for a DOE waiver of domestic and foreign patent rights under agreement W-7405-ENG-48.

  2. Advance Patent Waiver W(A)2009-028

    Broader source: Energy.gov [DOE]

    This is a request by ARKEMA for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-08NT01582

  3. Advance Patent Waiver W(A)2005-053

    Broader source: Energy.gov [DOE]

    This is a request by ALLEGHENY TECHNLOGIES WAH CHANG DIVISION for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-05NT42513.

  4. Advance Patent Waiver W(A)2005-062

    Broader source: Energy.gov [DOE]

    This is a request by UNITED TECHNOLOGIES CORPORATION for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-05NT42626.

  5. Advance Patent Waiver W(A)2009-061

    Broader source: Energy.gov [DOE]

    This is a request by PPG INDUSTRIES for a DOE waiver of domestic and foreign patent rights under agreement DE-NT0003894

  6. Advance Patent Waiver W(A)2009-064

    Broader source: Energy.gov [DOE]

    This is a request by ROLLS ROYCE FUEL SYSTEMS for a DOE waiver of domestic and foreign patent rights under agreement DE-FE0000303

  7. Advance Patent Waiver W(A)2009-054

    Broader source: Energy.gov [DOE]

    This is a request by UNITED TECHNOLOGIES RESEARCH for a DOE waiver of domestic and foreign patent rights under agreement DE-PS36-08GO98010

  8. Advance Patent Waiver W(A)2009-010

    Broader source: Energy.gov [DOE]

    This is a request by SCHLUMBERGER TECHNOLOGY CORP for a DOE waiver of domestic and foreign patent rights under agreement DE-FG36-08GO18184

  9. Advance Patent Waiver W(A)2008-036

    Broader source: Energy.gov [DOE]

    This is a request by LIGNOL INNOVATIONS, LTD. for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-08GO18047

  10. Advance Patent Waiver W(A)2009-044

    Broader source: Energy.gov [DOE]

    This is a request by FORD MOTOR COMPANY for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-09GO19002

  11. Advance Patent Waiver W(A)2008-046

    Broader source: Energy.gov [DOE]

    This is a request by EATON CORPORATION for a DOE waiver of domestic and foreign patent rights under agreement DE-FG36-08GO18131

  12. Advance Patent Waiver W(A)2010-018

    Broader source: Energy.gov [DOE]

    This is a request by BOEING COMPANY for a DOE waiver of domestic and foreign patent rights under agreement DE-FG36-08GO18055

  13. Advance Patent Waiver W(A)2009-047

    Broader source: Energy.gov [DOE]

    This is a request by US SOLAR HOLDINGS LLP for a DOE waiver of domestic and foreign patent rights under agreement DE-FG36-08GO18155

  14. Advance Patent Waiver W(A)2011-031

    Broader source: Energy.gov [DOE]

    This is a request by PARKER HANNIFIN CORPORATION for a DOE waiver of domestic and foreign patent rights under agreement DE-FE0005508.

  15. Advance Patent Waiver W(A)2010-035

    Broader source: Energy.gov [DOE]

    This is a request by GE GLOBAL RESEARCH for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003251

  16. Advance Patent Waiver W(A)2008-002

    Broader source: Energy.gov [DOE]

    This is a request by FORD MOTOR COMPANY for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-07NT43276

  17. Advance Patent Waiver W(A)2005-036

    Broader source: Energy.gov [DOE]

    This is a request by POVAIR CORPORATION for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-02AL67627.

  18. Advance Patent Waiver W(A)2010-017

    Broader source: Energy.gov [DOE]

    This is a request by FORD MOTOR COMPANY for a DOE waiver of domestic and foreign patent rights under agreement DE-FG36-08GO18128

  19. Advance Patent Waiver W(A)2009-002

    Broader source: Energy.gov [DOE]

    This is a request by JOHNSON MATTNEY FUEL CELLS INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-FG36-07GO17019

  20. Advance Patent Waiver W(A)2009-025

    Broader source: Energy.gov [DOE]

    This is a request by GENERAL ELECTRIC for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-08NT05868

  1. Advance Patent Waiver W(A)2008-007

    Broader source: Energy.gov [DOE]

    This is a request by SCHOTT NORTH AMERICA, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-FG36-07GO17001

  2. Advance Patent Waiver W(A)2011-036

    Broader source: Energy.gov [DOE]

    This is a request by HONEYWELL LABORATORIES for a DOE waiver of domestic and foreign patent rights under agreement DE-OE0000544.

  3. Advance Patent Waiver W(A)2011-008

    Broader source: Energy.gov [DOE]

    This is a request by CERAMATEC, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0000395.

  4. Advance Patent Waiver W(A)2011-024

    Broader source: Energy.gov [DOE]

    This is a request by SCHWEITZER ENGINEERING LAB INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-OE0000538.

  5. Advance Patent Waiver W(A)2012-009

    Office of Energy Efficiency and Renewable Energy (EERE)

    This is a request by AE SOLAR for a DOE Advance patent waiver of domestic and foreign patent rights under agreement DE-EE0005340.

  6. Advance Patent Waiver W(A)2011-057

    Office of Energy Efficiency and Renewable Energy (EERE)

    This is a request by 3M COMPANY for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003837.

  7. Advance Patent Waiver W(A)2011-027

    Broader source: Energy.gov [DOE]

    This is a request by VARIAN ASSOCIATES, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0004737.

  8. Advance Patent Waiver W(A)2010-048

    Broader source: Energy.gov [DOE]

    This is a request by ROBERT BOSCH, LLC for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-07NT43274

  9. Advance Patent Waiver W(A)2010-046

    Broader source: Energy.gov [DOE]

    This is a request by NUVERA FUEL CELLS, INC for a DOE waiver of domestic and foreign patent rights under agreement DE-FG36-07GO17014

  10. Advance Patent Waiver W(A)2005-023

    Broader source: Energy.gov [DOE]

    This is a request by HEADWATER for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-04NT42448.

  11. Advance Patent Waiver W(A)2007-001

    Office of Energy Efficiency and Renewable Energy (EERE)

    This is a request by EASTMAN KODAK CO. for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-06NT42933

  12. EIS-0189: Tank Waste Remediation System (TWRS), Richland, WA (Programmatic)

    Broader source: Energy.gov [DOE]

    This environmental impact statement evaluates the Department of Energy (DOE)'s, in cooperation with the Washington State Department of Ecology (Ecology), decisions on how to properly manage and dispose of Hanford Site tank waste and encapsulated cesium and strontium to reduce existing and potential future risk to the public, Site workers, and the environment. The waste includes radioactive, hazardous, and mixed waste currently stored in 177 underground storage tanks, approximately 60 other smaller active and inactive miscellaneous underground storage tanks (MUSTs), and additional Site waste likely to be added to the tank waste, which is part of the tank farm system. In addition, DOE proposes to manage and dispose of approximately 1,930 cesium and strontium capsules that are by-products of tank waste. The tank waste and capsules are located in the 200 Areas of the Hanford Site near Richland, Washington.

  13. Advance Patent Waiver W(A)2010-051

    Broader source: Energy.gov [DOE]

    This is a request by UT-BATTELLE, LLC for a DOE waiver of domestic and foreign patent rights under agreement DE-AC05-00OR22725

  14. Advance Patent Waiver W(A)2011-040

    Broader source: Energy.gov [DOE]

    This is a request by SYPRIS ELECTRONICS for a DOE waiver of domestic and foreign patent rights under agreement DE-OE0000543.

  15. Advance Patent Waiver W(A)2005-049

    Broader source: Energy.gov [DOE]

    This is a request by AMERICAN AIR LIQUIDE for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-02NT41586.

  16. RAPID/Roadmap/11-WA-a | Open Energy Information

    Open Energy Info (EERE)

    may require obtaining a permit and providing public notice and notice to Indian Tribes. Once the necessary procedures have been followed, the developer may continue with the...

  17. Advance Patent Waiver W(A)2011-002

    Broader source: Energy.gov [DOE]

    This is a request by APPLIED MATERIALS, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003838.

  18. Advance Patent Waiver W(A)2010-045

    Broader source: Energy.gov [DOE]

    This is a request by LUMMUS COMPANY for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003457

  19. Title: Advance Patent Waiver W(A)2011-041

    Broader source: Energy.gov [DOE]

    This is a request by GENERAL MOTOR for a DOE waiver of domestic and foreign patent rights under agreement DE-AC36-08GO28308.

  20. Advance Patent Waiver W(A)2011-068

    Broader source: Energy.gov [DOE]

    This is a request by GE GLOBAL RESEARCHH CENTER for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-08NT05870.

  1. Advance Patent Waiver W(A)2008-004

    Broader source: Energy.gov [DOE]

    This is a request by HUNTSMAN ADVANCED MATERIALS AMERICANS, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-FG36-07GO17012

  2. Advance Patent Waiver W(A)2012-022

    Broader source: Energy.gov [DOE]

    This is a request by FORD MOTOR COMPANY for a DOE Advance patent waiver of domestic and foreign patent rights under agreement DE-FOA-0000421.

  3. Advance Patent Waiver W(A)2009-030

    Broader source: Energy.gov [DOE]

    This is a request by BALDOR ELECTRIC COMPANY for a DOE waiver of domestic and foreign patent rights under agreement DE-FG36-08GO18132

  4. Advance Patent Waiver W(A)2011-037

    Broader source: Energy.gov [DOE]

    This is a request by DELPHI AUTOMOTIVE SYSTEMS, LLC for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0000478.

  5. Advance Patent Waiver W(A)2011-010

    Broader source: Energy.gov [DOE]

    This is a request by CHEMTURA CORPORATION for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003986.

  6. Advance Patent Waiver W(A)2012-008

    Broader source: Energy.gov [DOE]

    This is a request by ROBERT BOSCH, LLC for a DOE Advance patent waiver of domestic and foreign patent rights under agreement DE-EE0003533.

  7. Advance Patent Waiver W(A)2012-002

    Broader source: Energy.gov [DOE]

    This is a request by NOVOZYMES NORTH AMERICA, INC. for a DOE Advance patent waiver of domestic and foreign patent rights under agreement DE-FE0007741.

  8. Advance Patent Waiver W(A)2011-058

    Broader source: Energy.gov [DOE]

    This is a request by GENERAL ELECTRIC CO. for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0005143.

  9. Advance Patent Waiver W(A)2011-007

    Broader source: Energy.gov [DOE]

    This is a request by BAYER MATERIALSCIENCE LLC for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0004571.

  10. Advance Patent Waiver W(A)2009-031

    Broader source: Energy.gov [DOE]

    This is a request by UNITED TECHNOLOGIES CORP for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-09GO19006

  11. Advance Patent Waiver W(A)2010-036

    Broader source: Energy.gov [DOE]

    This is a request by GE GLOBAL RESEARCH for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003251

  12. Advance Patent Waiver W(A)2010-029

    Broader source: Energy.gov [DOE]

    This is a request by OSRAM SYLVANI for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003241

  13. EIS-0244: Plutonium Finishing Plant Stabilization, Hanford Site, Richland, WA

    Broader source: Energy.gov [DOE]

    This EIS evaluates the impacts on the human environment of: Stabilization of residual, plutonium-bearing materials at the PFP Facility to a form suitable for interim storage at the PFP Facility. Immobilization of residual plutonium-bearing materials at the PFP Facility. Removal of readily retrievable, plutonium-bearing materials left behind in process equipment, process areas, and air and liquid waste management systems as a result of historic uses.

  14. Advance Patent Waiver W(A)2007-015

    Broader source: Energy.gov [DOE]

    This is a request by UNITED TECHNOLOGIES CORP for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-07NT43055

  15. Advance Patent Waiver W(A)2012-007

    Broader source: Energy.gov [DOE]

    This is a request by NAVISTAR for a DOE Advance patent waiver of domestic and foreign patent rights under agreement DE-EE0003303.

  16. Advance Patent Waiver W(A)2011-046

    Broader source: Energy.gov [DOE]

    This is a request by ALSTOM GRID INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-OE0000551.

  17. Advance Patent Waiver W(A)2010-052

    Broader source: Energy.gov [DOE]

    This is a request by A123 SYSTEMS, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-EE003513

  18. Advance Patent Waiver W(A)2005-058

    Broader source: Energy.gov [DOE]

    This is a request by ASTRONAUTICS CORPORATION for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-03NT1948.

  19. Advance Patent Waiver W(A)2008-005

    Broader source: Energy.gov [DOE]

    This is a request by AMERICAN SUPERCONDUCTOR CORPORATION for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-07NT43243

  20. Advance Patent Waiver W(A)2008-043

    Broader source: Energy.gov [DOE]

    This is a request by AMERICAN SUPERCONDUCTOR CORPORATION for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-07NT43240

  1. Advance Patent Waiver W(A)2005-027

    Broader source: Energy.gov [DOE]

    This is a request by WESTINGHOUSE ELECTRIC CORPORATION for a DOE waiver of domestic and foreign patent rights under agreement DE-FC07-05ID14636.

  2. Advance Patent Waiver W(A)2011-052

    Broader source: Energy.gov [DOE]

    This is a request by 3M COMPANY for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0000456.

  3. Advance Patent Waiver W(A)2009-052

    Broader source: Energy.gov [DOE]

    This is a request by 3M COMPANY for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-08GO18027

  4. Advance Patent Waiver W(A)2006-014

    Office of Energy Efficiency and Renewable Energy (EERE)

    This is a request by PPG INDUSTRIES, INC for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-04GO14044

  5. Advance Patent Waiver W(A)2009-049

    Broader source: Energy.gov [DOE]

    This is a request by SPX COOLING TECHNOLOGIESS for a DOE waiver of domestic and foreign patent rights under agreement DE-NT0005647

  6. Advance Patent Waiver W(A)2009-069

    Broader source: Energy.gov [DOE]

    This is a request by ENVIRON INTERNATIOAL CORPORATION for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0000069

  7. Advance Patent Waiver W(A)2010-057

    Broader source: Energy.gov [DOE]

    This is a request by HONEYWELL INTERNATIONAL, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003840

  8. Advance Patent Waiver W(A)2012-013

    Broader source: Energy.gov [DOE]

    This is a request by BAKER HUGHES OILFIELD OPERATIONS, INC. for a DOE Advance patent waiver of domestic and foreign patent rights under agreement DE-EE0005505.

  9. Advance Patent Waiver W(A)2009-009

    Broader source: Energy.gov [DOE]

    This is a request by BAKER HUGHES for a DOE waiver of domestic and foreign patent rights under agreement DE-FG08-GO18186

  10. Advance Patent Waiver W(A)2008-011

    Broader source: Energy.gov [DOE]

    This is a request by DSM lnnovation, Inc. for a DOE waiver of domestic and foreign patent rights under agreement DE-PS36-06GO97034

  11. Advance Patent Waiver W(A)2010-007

    Office of Energy Efficiency and Renewable Energy (EERE)

    This is a request by 3M COMPANY for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0000650

  12. Advance Patent Waiver W(A)2005-016

    Office of Energy Efficiency and Renewable Energy (EERE)

    This is a request by BAKER HUGHES INTERNATIONAL for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-05NT15488.

  13. Advance Patent Waiver W(A)2011-012

    Broader source: Energy.gov [DOE]

    This is a request by CAMBRIOS TECHNOLOGIES CORP. for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003254.

  14. Advance Patent Waiver W(A)2008-044

    Office of Energy Efficiency and Renewable Energy (EERE)

    This is a request by ALSTOM POWER, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-07NT43095

  15. Advance Patent Waiver W(A)2009-005

    Broader source: Energy.gov [DOE]

    This is a request by CONOCO PHILIPS for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-08NT0006553

  16. Advance Patent Waiver W(A)2013-011

    Broader source: Energy.gov [DOE]

    This is a request by DELPHI AUTOMOTIVE SYSTEMS, LLC for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0005752.

  17. Advance Patent Waiver W(A)2008-032

    Broader source: Energy.gov [DOE]

    This is a request by CUMMINS, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-07NT43279

  18. RAPID/Roadmap/9-WA-b | Open Energy Information

    Open Energy Info (EERE)

    the DNS and environmental checklist to agencies with jurisdiction, the department of ecology, and affected tribes and each local agency or political subdivision whose public...

  19. RAPID/Roadmap/8-WA-a | Open Energy Information

    Open Energy Info (EERE)

    the proposed project. Topics for discussion must include, but are not limited to: The nature of the project, the contents of the pre-application request and the status of the...

  20. RAPID/Roadmap/7-WA-a | Open Energy Information

    Open Energy Info (EERE)

    of Commerce, Department of Ecology, Department of Fish and Wildlife, Department of Natural Resources, and Utilities and Transportation Commission. Through this certification,...

  1. Advance Patent Waiver W(A)2010-030

    Broader source: Energy.gov [DOE]

    This is a request by RED ACQUISITION, LLC for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003364

  2. Advance Patent Waiver W(A)2009-059

    Broader source: Energy.gov [DOE]

    This is a request by PPG INDUSTRIES for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0000167

  3. Advance Patent Waiver W(A)2011-021

    Office of Energy Efficiency and Renewable Energy (EERE)

    This is a request by CUMMINS, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0004125.

  4. Advance Patent Waiver W(A)2010-054

    Broader source: Energy.gov [DOE]

    This is a request by UNITED TECHNOLOGIE for a DOE waiver of domestic and foreign patent rights under agreement DE-NT003894

  5. Advance Patent Waiver W(A)2008-029

    Broader source: Energy.gov [DOE]

    This is a request by BALLARD POWER SYSTEM, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-07GO17017

  6. Advance Patent Waiver W(A)2006-027

    Broader source: Energy.gov [DOE]

    This is a request by EASTMAN KODAK COMPANY for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-06NT42864

  7. Petra Nova - W.A. Parish Project | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mitsubishi Heavy Industries' (MHI) CO2 capture technology at an existing coal-fired power plant. ... in financial assistance through the Clean Coal Power Initiative (CCPI) Round ...

  8. Advance Patent Waiver W(A)2011-014

    Broader source: Energy.gov [DOE]

    This is a request by UNITED TECHNOLOGIES RESEARCH CENTER for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003955.

  9. Advance Patent Waiver W(A)2010-041

    Broader source: Energy.gov [DOE]

    This is a request by W.L. GORE & ASSOCIATES for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0000465

  10. Advance Patent Waiver W(A)2008-040

    Office of Energy Efficiency and Renewable Energy (EERE)

    This is a request by W. L. GORE & ASSOCIATES, INC, for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-08GO18052

  11. Advance Patent Waiver W(A)2010-065

    Broader source: Energy.gov [DOE]

    This is a request by DRESSER WAUKESHA for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0004016

  12. Advance Patent Waiver W(A)2005-009

    Office of Energy Efficiency and Renewable Energy (EERE)

    This is a request by LUCENT TECHNOLOGIES, INC for a DOE waiver of domestic and foreign patent rights under agreement DE-FG02-04ER46118.

  13. Advance Patent Waiver W(A)2012-030

    Broader source: Energy.gov [DOE]

    This is a request by SRI INTERNATIONAL for a DOE Advance patent waiver of domestic and foreign patent rights under agreement DE-FE0000896.

  14. Advance Patent Waiver W(A)2008-021

    Broader source: Energy.gov [DOE]

    This is a request by CARGILL, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-07GO17055

  15. Issaquah Highlands Zero Energy Affordable Housing (WA) - YWCA

    SciTech Connect (OSTI)

    Tom, Vincent; DeRobbio, Wendy; Hall, Linda

    2012-04-30

    The YWCA Family Village at Issaquah, Net Zero Energy Approach Project provides a compelling model for how the nation can seriously respond to the critical need for affordable housing while advancing environmental standards and reducing economic inequities. Affordable housing developments for vulnerable members of the community and in today's workforce cannot overlook issues, such as climate impact, energy security and water conservation. This project's advanced building design was based on the goal of creating a 100 year building that could achieve net zero energy usage if funding had been available to support the final pieces of energy generation. The team worked closely with community stakeholders to ensure the baseline components of high quality and efficient building envelopes along with efficient systems were in place to set the stage for future incorporation of energy generating systems such as solar panels. As built, these 146 homes, large child care center and community services areas are proving the value of investing upfront for the benefit of future generations by reducing ongoing utility and maintenance costs with an eye toward environmental stewardship and community/resident education. The DOE award helped fund two critical energy conservation features for the YWCA Family Village at Issaquah campus: 1) super-insulated roof assembly with a continuous air barrier and 2) domestic hot water preheat system. The roof system at the YWCA Family Village at Issaquah project was built to include 6" of Polyiso rigid insulation (R-38) on top of the roof sheathing to provide a super-insulated roof in line with the other green features of the project. Placing the rigid insulation on top of the roof sheathing allows the building to have a continuous layer of insulation and provides a continuous air barrier. The domestic hot water preheat system includes flat panel arrays on roofs of the buildings that heat the water using solar power, which reduces the amount of heating needed from the gas-fired boilers. The flat-plate panels on the roof of the building heats the water using solar power. A heat exchanger transfers heat from water warmed by the panels to potable water for the units. The warmed potable water mixes with the tap water supply to create hot water for the buildings. This boost of water warmed by the solar panels reduces the heating costs for eh project by reducing the need to heat the water via gas-fired boilers. Both of these energy upgrades were chosen because they significantly improve the energy efficiency for the life of the building and are reducing monthly utility costs for both the residents and the owners. Since the owner is a not-for-profit dedicated to long-term ownership and serving households with very-low and low-incomes, the costs savings will ultimately benefit current and future residents as the dollars saved will either be realized directly by the resident or be invested in the project. Technically, the design of these systems is easily understood and the principles could be applied to other projects. The incremental costs depend largely on the existing market rate of the components-none of which are considered "cutting edge" so a market does currently exist.

  16. Advance Patent Waiver W(A)2011-069

    Broader source: Energy.gov [DOE]

    This is a request by NAVISTAR for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003303.

  17. Advance Patent Waiver W(A)2005-038

    Broader source: Energy.gov [DOE]

    This is a request by PHILLIPS ELECTRONIC for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-05NT42342.

  18. Advance Patent Waiver W(A)2009-021

    Office of Energy Efficiency and Renewable Energy (EERE)

    This is a request by PHILIPS LUMILEDS for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-08NT01583

  19. RAPID/Roadmap/3-WA-d | Open Energy Information

    Open Energy Info (EERE)

    payments as determined by WSDNR, or as agreed on by the lessee and WSDNR; and Other terms and conditions as WSDNR deems advisable. RCW 79.13.030. WSDNR may enter into a lease,...

  20. EIS-0467: Hanford Site Natural Gas Pipeline, Richland, WA

    Broader source: Energy.gov [DOE]

    DOE has postponed preparation of this EIS to better align the completion of the EIS with planned future operations of facilities on Hanford’s Central Plateau (such as Hanford’s Waste Treatment and Immobilization Plant).

  1. Advance Patent Waiver W(A)2011-053

    Broader source: Energy.gov [DOE]

    This is a request by VOLVO TECHNOLOGY OF AMERICA, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0004125.

  2. Advance Patent Waiver W(A)2011-023

    Broader source: Energy.gov [DOE]

    This is a request by SCHWEITZER ENGINEERING LAB INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-OE0000537.

  3. RAPID/Roadmap/11-WA-c | Open Energy Information

    Open Energy Info (EERE)

    sites and artifacts, and traditional areas or items of religious, ceremonial and social uses to affected tribes. Washington defines an "Archaeological resource" as any...

  4. EIS-0330: Wallula Power Project, Walla Walla County, WA

    Broader source: Energy.gov [DOE]

    This EIS analyzes DOE's proposal to construct, operate, maintain, and decontaminate and decommission two depleted uranium hexafluoride (DUF 6) conversion facilities, at Portsmouth, Ohio, and Paducah, Kentucky.

  5. Advance Patent Waiver W(A)2011-071

    Broader source: Energy.gov [DOE]

    This is a request by THE DOW CHEMICAL COMPANY for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0005434.

  6. Advance Patent Waiver W(A)2013-008

    Broader source: Energy.gov [DOE]

    This is a request by GENERAL MOTORS LLC for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0005969.

  7. Advance Patent Waiver W(A)2009-063

    Broader source: Energy.gov [DOE]

    This is a request by CREE, INC for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-08NT01577

  8. Advance Patent Waiver W(A)2013-019

    Broader source: Energy.gov [DOE]

    This is a request by CREE, INC. for a DOE waiver of domestic and foreign patent rights under agreement NGB-3-23028-01.

  9. Advance Patent Waiver W(A)2011-025

    Broader source: Energy.gov [DOE]

    This is a request by CREE, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003246.

  10. Advance Patent Waiver W(A)2006-026

    Broader source: Energy.gov [DOE]

    This is a request by CREE, INC for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-06NT42932

  11. Advance Patent Waiver W(A)2009-056

    Broader source: Energy.gov [DOE]

    This is a request by CREE, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0000412

  12. Advance Patent Waiver W(A)2005-006

    Broader source: Energy.gov [DOE]

    This is a request by ABENGOA BIOENERGY CORPORATION for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-03GO13142.

  13. FITCH RATES ENERGY NORTHWEST, WA'S ELECTRIC REV RFDG BONDS 'AA...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    debt (4.1 billion). KEY RATING DRIVERS BONNEVILLE'S OBLIGATION SECURES BONDS: The rating on the Energy Northwest bonds reflects the credit quality of Bonneville and its...

  14. RAPID/Roadmap/1-WA-a | Open Energy Information

    Open Energy Info (EERE)

    areas (RCW 36.70A.170). Critical areas must be established based on the best available science as defined by WAC 365-195. Minimum guidelines for classifying and designating...

  15. Advance Patent Waiver W(A)2009-050

    Broader source: Energy.gov [DOE]

    This is a request by GED INTEGRATED SOLUTIONS for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0000167

  16. Advance Patent Waiver W(A)2007-005

    Broader source: Energy.gov [DOE]

    This is a request by EATON CORPORATION for a DOE waiver of domestic and foreign patent rights under agreement DE-FG36-06GO16054

  17. Advance Patent Waiver W(A)2009-045

    Broader source: Energy.gov [DOE]

    This is a request by BABCOCK & WILCO for a DOE waiver of domestic and foreign patent rights under agreement DE-AC52-09NA29596

  18. Advance Patent Waiver W(A)2012-005

    Broader source: Energy.gov [DOE]

    This is a request by PHILIPS LUMILEDS LIGHTING, LLC for a DOE Advance patent waiver of domestic and foreign patent rights under agreement DE-EE0005099.

  19. Advance Patent Waiver W(A)2008-012

    Broader source: Energy.gov [DOE]

    This is a request by DUPONT for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-07GOI7056

  20. Advance Patent Waiver W(A)2011-013

    Broader source: Energy.gov [DOE]

    This is a request by UNITED TECHNOLOGIES RESEARCH CENTER for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003953.

  1. Advance Patent Waiver W(A)2011-072

    Broader source: Energy.gov [DOE]

    This is a request by GE GLOBAL RESEARCHH CENTER for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0005344.

  2. Advance Patent Waiver W(A)2009-017

    Office of Energy Efficiency and Renewable Energy (EERE)

    This is a request by SPX COOLING TECHNOLOGIES for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-09NT06549

  3. Advance Patent Waiver W(A)2008-030

    Office of Energy Efficiency and Renewable Energy (EERE)

    This is a request by DOW CORNING CORPORATION for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-OBG01B02B

  4. Advance Patent Waiver W(A)2008-013

    Broader source: Energy.gov [DOE]

    This is a request by SANYO ELECTRIC COMPANY for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-07GO17050

  5. Advance Patent Waiver W(A)2009-006

    Broader source: Energy.gov [DOE]

    This is a request by UNITED TECHNOLOGIES CORP for a DOE waiver of domestic and foreign patent rights under agreement DE-AC02-05CH11231

  6. Advance Patent Waiver W(A)2008-008

    Broader source: Energy.gov [DOE]

    This is a request by PPG INDUSTRIES, INC for a DOE waiver of domestic and foreign patent rights under agreement DE-FG36-93CH10554

  7. Advance Patent Waiver W(A)2010-053

    Broader source: Energy.gov [DOE]

    This is a request by PPG INDUSTRIESS, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003586

  8. Advance Patent Waiver W(A)2010-032

    Broader source: Energy.gov [DOE]

    This is a request by PPG INDUSTRIES for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003209

  9. Advance Patent Waiver W(A)2004-084

    Broader source: Energy.gov [DOE]

    This is a request by MILLENNIUM INORGANIC CHEMICAL for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-04GO14153.

  10. Advance Patent Waiver W(A)2006-034

    Broader source: Energy.gov [DOE]

    This is a request by ENERGY CONVERSION DEVICES, INC. for a DOE waiver of domestic and foreign patent rights under agreement UNKNOWN

  11. RAPID/Roadmap/3-WA-e | Open Energy Information

    Open Energy Info (EERE)

    e < RAPID | Roadmap Jump to: navigation, search RAPID Regulatory and Permitting Information Desktop Toolkit BETA About Bulk Transmission Geothermal Hydropower Solar Tools...

  12. RAPID/Roadmap/3-WA-c | Open Energy Information

    Open Energy Info (EERE)

    c < RAPID | Roadmap Jump to: navigation, search RAPID Regulatory and Permitting Information Desktop Toolkit BETA About Bulk Transmission Geothermal Hydropower Solar Tools...

  13. Advance Patent Waiver W(A)2011-029

    Broader source: Energy.gov [DOE]

    This is a request by W. R. GRACE COMPANY for a DOE waiver of domestic and foreign patent rights under agreement DE-FOA-0000324.

  14. Advance Patent Waiver W(A)2005-005

    Broader source: Energy.gov [DOE]

    This is a request by HONEYWELL, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-00OR22809.

  15. Advance Patent Waiver W(A)2009-036

    Broader source: Energy.gov [DOE]

    This is a request by GENERAL ELECTRIC COMPANY for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-08NT01579

  16. Advance Patent Waiver W(A)2010-062

    Broader source: Energy.gov [DOE]

    This is a request by PARKER HANNIFIN CORPORATION for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0000296

  17. Advance Patent Waiver W(A)2010-022

    Broader source: Energy.gov [DOE]

    This is a request by PHILIPS LUMILEDS for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003210

  18. Advance Patent Waiver W(A)2010-056

    Broader source: Energy.gov [DOE]

    This is a request by PHILIPS RESEARCH LABORATORY for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003978

  19. Advance Patent Waiver W(A)2009-001

    Broader source: Energy.gov [DOE]

    This is a request by GE GLOBAL RESEARCHH CENTER for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-GO18085

  20. RAPID/Roadmap/13-WA-a | Open Energy Information

    Open Energy Info (EERE)

    application is submitted to the WSDE, the regional Coastal Zone Management 401 Water Quality Certification contact circulates the public notice; For Coast Guard permits, the...

  1. Advance Patent Waiver W(A)2013-016

    Broader source: Energy.gov [DOE]

    This is a request by GENERAL MOTORS LLC for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0005753.

  2. Advance Patent Waiver W(A)2013-015

    Broader source: Energy.gov [DOE]

    This is a request by Caterpillar Inc for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0005980.

  3. Advance Patent Waiver W(A)2013-005

    Broader source: Energy.gov [DOE]

    This is a request by STATOIL WIND US LLC for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0005988.

  4. Advance Patent Waiver W(A)2013-031

    Broader source: Energy.gov [DOE]

    This is a request by WESTINGHOUSE ELECTRIC COMPANY for a DOE waiver of domestic and foreign patent rights under agreement DE-NE0000566.

  5. Advance Patent Waiver W(A)2013-022

    Broader source: Energy.gov [DOE]

    This is a request by 3M COMPANY for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0005795.

  6. Advance Patent Waiver W(A)2013-018

    Broader source: Energy.gov [DOE]

    This is a request by General Motors, LLC for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0006082.

  7. Advance Patent Waiver W(A)2011-048

    Broader source: Energy.gov [DOE]

    This is a request by ADA-ES for a DOE waiver of domestic and foreign patent rights under agreement DE-FE0004343.

  8. Advance Patent Waiver W(A)2008-042

    Broader source: Energy.gov [DOE]

    This is a request by Novozymes Inc. for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-0BG01BOBO

  9. Advance Patent Waiver W(A)2011-009

    Broader source: Energy.gov [DOE]

    This is a request by SENER, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003592.

  10. Advance Patent Waiver W(A)2005-014

    Broader source: Energy.gov [DOE]

    This is a request by IBM for a DOE waiver of domestic and foreign patent rights under agreement W-7405-ENG-48.

  11. RAPID/Roadmap/6-WA-d | Open Energy Information

    Open Energy Info (EERE)

    of a Hydraulic Project Approval Permit issued by the Washington State Department of Fish and Wildlife. State waters include all marine waters and fresh waters of the state,...

  12. RAPID/Roadmap/12-WA-a | Open Energy Information

    Open Energy Info (EERE)

    take wildlife from the wild without permission from the Washington State Department of Fish and Wildlife (WDFW). The WDFW issues Live Wildlife Taking Permits under WAC 232-12-064....

  13. Advance Patent Waiver W(A)2009-004

    Broader source: Energy.gov [DOE]

    This is a request by SCHLUMBERGER TECHNOLOGY CORP for a DOE waiver of domestic and foreign patent rights under agreement DE-FG36-08GO18182

  14. Advance Patent Waiver W(A)2011-047

    Broader source: Energy.gov [DOE]

    This is a request by DELPHI AUTOMOTIVE SYSTEMS, LLC for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0000014.

  15. Advance Patent Waiver W(A)2009-029

    Broader source: Energy.gov [DOE]

    This is a request by GENERAL MOTORS for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-09GO19003

  16. Advance Patent Waiver W(A)2012-034

    Broader source: Energy.gov [DOE]

    This is a request by CORNING INCORPORATED for a DOE Advance patent waiver of domestic and foreign patent rights under agreement DE-EE0005757.

  17. Advance Patent Waiver W(A)2012-010

    Broader source: Energy.gov [DOE]

    This is a request by 3M COMPANY for a DOE Advance patent waiver of domestic and foreign patent rights under agreement DE-EE0002980.

  18. Advance Patent Waiver W(A)2011-070

    Broader source: Energy.gov [DOE]

    This is a request by CASCADE ENGINEERING INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0005440.

  19. Advance Patent Waiver W(A)2011-028

    Broader source: Energy.gov [DOE]

    This is a request by PPG INDUSTRIES, INC for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0004736.

  20. Advance Patent Waiver W(A)2005-017

    Office of Energy Efficiency and Renewable Energy (EERE)

    This is a request by OSRA for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-05NT42341.

  1. Advance Patent Waiver W(A)2008-028

    Broader source: Energy.gov [DOE]

    This is a request by INEOS USA LLC for a DOE waiver of domestic and foreign patent rights under agreement DE-FG36-04GO14315

  2. Advance Patent Waiver W(A)2011-001

    Broader source: Energy.gov [DOE]

    This is a request by PRAXAIR, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-FE0004908.

  3. Advance Patent Waiver W(A)2013-007

    Broader source: Energy.gov [DOE]

    This is a request by CA TCHLIGHT ENERGY, LLC for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0005974.

  4. Advance Patent Waiver W(A)2013-006

    Broader source: Energy.gov [DOE]

    This is a request by PRINCIPLE POWER, INC for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0005987.

  5. Advance Patent Waiver W(A)2013-013

    Broader source: Energy.gov [DOE]

    This is a request by BABCOCK & WILCOX mPOWER for a DOE waiver of domestic and foreign patent rights under agreement DE-NE0000583.

  6. Advance Patent Waiver W(A)2012-031

    Broader source: Energy.gov [DOE]

    This is a request by SRI INTERNATIONAL for a DOE Advance patent waiver of domestic and foreign patent rights under agreement DE-NT0005578.

  7. Advance Patent Waiver W(A)2012-033

    Broader source: Energy.gov [DOE]

    This is a request by GE-GLOBAL RESEARCH for a DOE Advance patent waiver of domestic and foreign patent rights under agreement DE-OE000593.

  8. Advance Patent Waiver W(A)2010-040

    Broader source: Energy.gov [DOE]

    This is a request by MODINE MANUFACTURING CO. for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0002895

  9. Advance Patent Waiver W(A)2010-019

    Broader source: Energy.gov [DOE]

    This is a request by PRAXAIR, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-08GO18063

  10. Advance Patent Waiver W(A)2011-003

    Broader source: Energy.gov [DOE]

    This is a request by PPG INDUSTRIES, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-EE0003170.

  11. Advance Patent Waiver W(A)2013-014

    Broader source: Energy.gov [DOE]

    This is a request by W.R GRACE AND CO for a DOE waiver of domestic and foreign patent rights under agreement DE- EE0005991.

  12. Advance Patent Waiver W(A)2005-010

    Broader source: Energy.gov [DOE]

    This is a request by ABB LUMMUS GLOBAL, INC for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-04GO14151.

  13. Advance Patent Waiver W(A)2011-033

    Broader source: Energy.gov [DOE]

    This is a request by ABB INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-OE0000547.

  14. Advance Patent Waiver W(A)2008-031

    Broader source: Energy.gov [DOE]

    This is a request by Novozymes North America for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-07NT43084

  15. RAPID/Roadmap/18-WA-a | Open Energy Information

    Open Energy Info (EERE)

    process tanks; Liquid traps or associated gathering lines directly related to oil or gas production and gathering operations; or Storage tanks situated in an...

  16. Advance Patent Waiver W(A)2005-011

    Broader source: Energy.gov [DOE]

    This is a request by UNITED TECHNOLOGIES CORPORATION for a DOE waiver of domestic and foreign patent rights under agreement DE-FC36-05GO15042.

  17. Advance Patent Waiver W(A)2010-042

    Broader source: Energy.gov [DOE]

    This is a request by UNIVERSITY OF NORTH DAKOTA for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-08NT43291

  18. Advance Patent Waiver W(A)2009-020

    Broader source: Energy.gov [DOE]

    This is a request by PRAXAIR, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-NT0005341

  19. Advance Patent Waiver W(A)2010-033

    Office of Energy Efficiency and Renewable Energy (EERE)

    This is a request by ROLLS ROYCE FUEL SYSTEMS for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-08NT01911

  20. Advance Patent Waiver W(A)2007-002

    Office of Energy Efficiency and Renewable Energy (EERE)

    This is a request by HONEYWELL INTERNATIONAL, INC. for a DOE waiver of domestic and foreign patent rights under agreement DE-FC26-06NT42947