National Library of Energy BETA

Sample records for ups uninterruptible power

  1. Uninterruptible power supply (UPS) systems

    SciTech Connect (OSTI)

    1997-04-01

    Use of this purchase specification is not mandatory. User should review the document and determine if it meets the user`s purpose. This document contains a fill-in-the-blanks guide specification for the procurement of uninterruptible power supply (UPS) systems greater than 10 kVA, organized as follows: Parts 1 through 7--technical requirements; Appendix A--technical requirements to be included in the proposal; Appendix B--UPS system data sheets to be completed by each bidder (Seller) and submitted with the proposal; Appendix C--general guidelines giving the specifier parameters for selecting a UPS system; it should be read before preparing an actual specification, and is not attached to the specification; Attachment 1--sketches prepared by the purchaser (Owner); Attachment 2--sample title page.

  2. PUREX (SAMCONS) uninterruptible power supply (UPS) acceptance test procedure

    SciTech Connect (OSTI)

    Blackaby, W.B.

    1997-09-01

    This Acceptance Test Procedure for the PUREX Surveillance and Monitoring and Control System (SAMCONS) Uninterruptible Power Supply (UPS) provides for testing and verifying the proper operation of the control panel alarms and trouble functions, the 6roper functioning of the AC inverter, ability of the battery supply to maintain the SAMCONS load for a minimum of two hours , and proper interaction with the SAMCONS Video graphic displays for alarm displays.

  3. PUREX SAMCONS uninterruptible power supply (UPS) acceptance test report

    SciTech Connect (OSTI)

    Blackaby, W.B.

    1997-10-07

    This Acceptance Test Report for the PUREX Surveillance and Monitoring and Control System (SAMCONS) Uninterruptible Power Supply (UPS) Acceptance Test Procedure validates the operation of the UPS, all alarming and display functions and the ability of the UPS to supply power to the SAMCONS as designed. The proper installation of the PUREX SAMCONS Trailer UPS components and wiring will be systematically evaluated by performance of this procedure. Proper operation of the SAMCONS computer UPS will be verified by performance of a timed functional load test, and verification of associated alarms and trouble indications. This test procedure will be performed in the SAMCONS Trailer and will include verification of receipt of alarms at the SAMCONS computer stations. This test may be performed at any time after the completion of HNF-SD-CP-ATP-083, PUREX Surveillance and Monitoring and Control System (SAMCONS) Acceptance Test Procedure, when computer display and alarm functions have been proven to operate correctly.

  4. Covered Product Category: Uninterruptible Power Supplies (for Data Center,

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Computer, and Telecommunication Applications) | Department of Energy Categories » Covered Product Category: Uninterruptible Power Supplies (for Data Center, Computer, and Telecommunication Applications) Covered Product Category: Uninterruptible Power Supplies (for Data Center, Computer, and Telecommunication Applications) The Federal Energy Management Program (FEMP) provides acquisition guidance for uninterruptible power supplies (UPS), a product category covered by the ENERGY STAR program.

  5. Autonomous uninterruptible power-supply apparatus

    SciTech Connect (OSTI)

    Masson, J.H.

    1984-12-20

    This invention relates broadly to a power supply apparatus, and in particular to an autonomous uninterruptible power supply apparatus. The purpose of an uninterruptible power supply (UPS) is to protect critical electrical loads from transient or steady-stage outages or disturbances in the primary power source. The basic configuration of a typical, commercially available, uninterruptible power supply is comprised at a minimum of a standby battery and a battery charger and may also include an inverter for AC applications. Systems of this type can be found in most computer installations and laboratory systems that cannot tolerate even momentary disturbances of input power. This document describes an autonomous uninterruptible power-supply apparatus utilizing a digital-processor unit as a control and monitor unit to measure and control input and output parameters in the power supply. A battery charger is utilized to maintain the voltage and current levels with the backup battery supply source which powers an inverter unit that converts the DC power to an AC output.

  6. Uninterruptible power supply cogeneration system

    SciTech Connect (OSTI)

    Gottfried, C.F.

    1987-08-11

    A power system is described for providing an uninterruptible power supply comprising: a first generator means for supplying energy to a primary load; a second generator means connected to an electrical utility, the first and second generator means being connected by a common shaft, the first generator means being electrically isolated from the electrical utility; prime mover means connected to the common shaft, the prime mover means for supplying mechanical energy to the shaft; and controller means interposed electrically between the second generator means and the secondary external load, the controller means causing the second generator means to become disconnected from the secondary load upon interruptions in the secondary load.

  7. Standard terminal panel and UPS (uninterruptible power supply) design for exterior intrusion detectors and data collection applications

    SciTech Connect (OSTI)

    Wolfenbarger, F.M.

    1989-01-01

    Need for standardization has been discussed for years by many government agencies. In the past, every perimeter site upgrade resulted in the design, specification, procurement, and fabrication of a unique power and signal junction box. To save design and specification cost, a standard terminal panel and uninterruptible power supply (UPS) design for an exterior intrusion sensor detection system was developed for a security system within the Sandia National Laboratories complex at Albuquerque, New Mexico. In facilitating this requirement a design was sought that could easily be modified for other government or commercial applications and one that could easily be fabricated in the shop. Also of primary importance was the need for lightning protection for both the communications and voltage sources. A 12V dc UPS with a current capacity of up to 4 amperes complements the standard terminal design and allows uninterrupted sensor operation for a number of hours should the primary ac source be interrupted. This report encompasses the features of the designs. The designs are also being used and continuously evaluated in Sandia's Area III exterior test field. 7 figs.

  8. Selecting a static uninterruptible power supply

    SciTech Connect (OSTI)

    Palko, E.

    1996-10-01

    In the not-so-distant past, quality electric power received from the utility company could be properly defined as a power supply with reasonably good voltage regulation accompanied by relatively few and brief outages. This simple but adequate definition lost all validity with the launching of the solid-state electronic revolution--and most notably, with the proliferation of digital electronics. There are numerous types of power conditioners that eliminate or minimize power quality problems on an individual basis. Such equipment includes surge suppressors that effectively arrest transient spikes, voltage regulators that cope with problems of voltage deviation, and shielded isolation transformers that effectively screen out electrical noise. There are also hybrid conditioners that combine two or more of these individual functions. But when problems are severe, and supplied systems and equipment have a low tolerance level for even occasional and minor power quality aberrations--and where operations must be maintained on total loss of power--only a uninterruptible power supply (UPS) suffices. Static UPSs are offered in three basic versions--online, line interactive, and offline. Each is described.

  9. Bimode uninterruptible power supply compatibility in renewable hybrid energy systems

    SciTech Connect (OSTI)

    Bower, W. ); O'Sullivan, G. )

    1990-08-01

    Inverters installed in renewable hybrid energy systems are typically used in a stand-alone mode to supply ac power to loads from battery storage when the engine-generator is not being used. Similarities in topology and in the performance requirements of the standby uninterruptible power supply (UPS) system and the hybrid system suggest the UPS could be used in hybrid energy systems. Another alternative to inverters with add-on charging circuits or standby UPS hardware is the Bimode UPS. The bimode UPS uses common circuitry and power components for dc to ac inversion and battery charging. It also provides an automatic and nearly instantaneous ac power transfer function when the engine-generator is started or stopped. The measured operating and transfer characteristics of a bimode UPS in a utility system and in a hybrid system are presented. The applicability of the bimode UPS to hybrid systems and its compatibility in a PV/engine-generator hybrid system are given.

  10. An integrated flyback converter for DC uninterruptible power supply

    SciTech Connect (OSTI)

    Ma, K.W.; Lee, Y.S.

    1996-03-01

    An integrated flyback converter performing the combined functions of uninterruptible power supply (UPS) and switch-mode power supply (SMPS) is presented. This converter has a high voltage main power input and a low voltage backup battery input. DC output is obtained form the main input via a flyback converter during normal operation and from the backup battery via another flyback converter when input power fails. High conversion efficiency is achieved in normal, backup, and charging modes as there is only a single dc-dc conversion in each mode. The converter circuit is very simple, with two switching transistors, a relay for mode switching, and a single magnetic structure only. This new design offers substantial improvement in efficiency, size, and cost over the conventional cascade of UPS and SMPS due to single voltage conversion, high frequency switching, and removal of design redundancy. The operation, design, analysis, and experimental results of the converter are presented.

  11. Choosing an uninterruptible power supply for a hydro plant

    SciTech Connect (OSTI)

    Clemen, D.M.

    1994-06-01

    Uninterruptible power systems maintain electric power to the plant computer and other essential equipment in hydropower plants when the main power supplies fail. Project owners and engineers can ensure they obtain a reliable system by carefully analyzing plant needs and writing precise specifications.

  12. Direct current uninterruptible power supply method and system

    DOE Patents [OSTI]

    Sinha, Gautam

    2003-12-02

    A method and system are described for providing a direct current (DC) uninterruptible power supply with the method including, for example: continuously supplying fuel to a turbine; converting mechanical power from the turbine into alternating current (AC) electrical power; converting the AC electrical power to DC power within a predetermined voltage level range; supplying the DC power to a load; and maintaining a DC load voltage within the predetermined voltage level range by adjusting the amount of fuel supplied to the turbine.

  13. Two-phase uninterruptible power supply

    SciTech Connect (OSTI)

    Severinsky, A.J.; Rajagopalan, S.

    1991-12-24

    This patent describes a two-phase AC power supply. It comprises AC systems; connectors; electric currents; and phase shift.

  14. Covered Product Category: Uninterruptible Power Supplies (for...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Average Efficiency 98.4% 96.7% 93.5% Annual Energy Use 6,010 kWhyear 6,180 kWhyear 6,500 ... most of the design range and that allow power data collection to track power usage. ...

  15. Covered Product Category: Uninterruptible Power Supplies (for Data Center, Computer, and Telecommunication Applications)

    Broader source: Energy.gov [DOE]

    FEMP provides acquisition guidance and Federal efficiency requirements across a variety of product categories, including uninterruptible power supplies (UPS), which are covered by the ENERGY STAR® program. Federal laws and requirements mandate that agencies meet these efficiency requirements in all procurement and acquisition actions that are not specifically exempted by law.

  16. Method and apparatus for line power monitoring for uninterruptible power supplies

    SciTech Connect (OSTI)

    Baxter, R.V. Jr.; Stich, F.A.

    1993-07-20

    AC line waveform monitoring apparatus is described for detecting AC line power faults and providing a fault signal for control of an uninterruptible power supply comprising: (a) means for sampling an AC line power signal at times synchronized with the cycle of the AC line waveform; (b) means for producing a reference waveform at selected sample times during the period of the AC line signal given previous reference waveform values and a prior cycle wherein a reference waveform value at each sample time comprises a selectively weighted average of value at that sample time in the prior cycle of the AC line signal and the previous reference waveform value at that sample time; (c) an uninterruptible power supply including an auxiliary power supply battery, the uninterruptible power supply receiving the AC line power and normally providing the AC line power to a load and responsive to a fault signal to switch to provide power to the load from the battery; (d) means for comparing the AC line signal waveform with the reference waveform at corresponding times in the reference waveform and the signal waveform and providing the fault signal to the uninterruptible power supply so that it provides power to the load from the battery when a selected difference condition is exceeded.

  17. Development of long life three phase uninterruptible power supply using flywheel energy storage unit

    SciTech Connect (OSTI)

    Takahashi, Isao; Okita, Yoshihisa; Andoh, Itaru

    1995-12-31

    According to development of computer applications, uninterruptible power supplies (UPS) are indispensable to the industrial field. But the cost for maintaining the conventional UPS is very high, because frequent replacement of parts which have short life time is necessary. This paper describes the research and development of a new UPS which has long life parts for maintenance free. To lengthen the life time, the following techniques are introduced: (1) a flywheel energy storage unit having more than 20 years life time; (2) electrolytic capacitor less inverter and converter. By using these techniques, a three phase UPS rating 5kVA, 200V is developed, and excellent performance is obtained: input power factor is over 99.7%; output voltage distortion is under 1.5%; transformer less UPS achieves light weight system; the UPS have function of automatic output voltage balance using auxiliary diode rectifier; input current harmonic distortion is less than 1.2%, even if the single phase load is connected.

  18. Three-phase uninterruptible power supply maintaining reserve energy sources in idling condition with unbalanced loads

    SciTech Connect (OSTI)

    Boettcher, C.W.; Hamilton, B.H.; Zweig, W.L.

    1980-12-09

    A control arrangement for a three-phase, uninterruptible power supply generates timing signals to drive the static switches of inverters located in each phase. This control arrangement precisely controls the phase differences of the inverter signals with relation to each other so that while the overall three-phase power supplied by the inverters is nulled, power circulation through the inverters compensates for unbalanced output loads thereby maintaining balanced phase angles between the output voltage and a balanced input impedance at the input of the power supply.

  19. Computer systems protection: Uninterruptible power supplies. January 1983-September 1989 (Citations from the Computer data base). Report for January 1983-September 1989

    SciTech Connect (OSTI)

    Not Available

    1989-09-01

    This bibliography contains citations concerning equipment used to protect computer systems from electrical-power fluctuations and outages. Voltage regulators and back-up power supplies are evaluated. Surge suppressors as part of the uninterruptible power-supply system (UPS) are briefly mentioned; they are covered in depth in another bibliography. IEEE test results and general performance evaluations are included. UPS for large data centers and for minicomputers are discussed. Market forecasts are presented. (This updated bibliography contains 361 citations, 105 of which are new entries to the previous edition.)

  20. Aging Management Guideline for commercial nuclear power plants: Battery chargers, inverters and uninterruptible power supplies. Final report

    SciTech Connect (OSTI)

    Berg, R.; Stroinski, M.; Giachetti, R.

    1994-02-01

    This Aging Management Guideline (AMG) describes recommended methods for effective detection and mitigation of age-related degradation mechanisms in BWR and PWR commercial nuclear power plant battery chargers, inverters and uninterruptible power supplies important to license renewal. The intent of this AMG is to assist plant maintenance and operations personnel in maximizing the safe, useful life of these components. It also supports the documentation of effective aging management programs required under the License Renewal Rule 10 CFR Part 54. This AMG is presented in a manner that allows personnel responsible for performance analysis and maintenance to compare their plant-specific aging mechanisms (expected or already, experienced) and aging management program activities to the more generic results and recommendations presented herein.

  1. 2-kW d-c instantaneous uninterruptible power-supply description. Interim report, 1 October 1987-1 October 1989

    SciTech Connect (OSTI)

    Northup, R.L.; Hammond, R.E.

    1989-11-01

    A 2-kW uninterruptible power supply was designed, built, and tested to demonstrate the feasibility of using uninterruptible power supplies (UPSs) to sustain critical loads onboard U.S. Navy ships. Performance requirements were met or exceeded. The design approach is modular and is shown to be expandable from its present 2-kW implementation to 10-kW or more. Implementation would be on Navy ships being newly constructed.

  2. MGE UPS SYSTEMS SA | Open Energy Information

    Open Energy Info (EERE)

    SA Jump to: navigation, search Name: MGE UPS SYSTEMS SA Place: Saint Ismier, France Zip: 38 334 Product: Provides a comprehensive range of Uninterruptible Power Supply and power...

  3. Sentry Power LLC | Open Energy Information

    Open Energy Info (EERE)

    Sentry Power LLC Place: New Castle, Delaware Zip: 19720 Product: Sentry Power sells battery-driven back up uninterrupted power supply systems for commercial and residential...

  4. MGE UPS SYSTEMS Inc | Open Energy Information

    Open Energy Info (EERE)

    conversion and distribtution products such as uninterruptible power supplies, inverters, rectifiers and surge suppressors. References: MGE UPS SYSTEMS Inc1 This article...

  5. Sentry Power Technology | Open Energy Information

    Open Energy Info (EERE)

    Place: New Castle, Delaware Zip: 19720 Product: The company develop and sell battery-driven back up uninterrupted power supply power supply systems. References: Sentry...

  6. Sequential power-up circuit

    DOE Patents [OSTI]

    Kronberg, James W.

    1992-01-01

    A sequential power-up circuit for starting several electrical load elements in series to avoid excessive current surge, comprising a voltage ramp generator and a set of voltage comparators, each comparator having a different reference voltage and interfacing with a switch that is capable of turning on one of the load elements. As the voltage rises, it passes the reference voltages one at a time and causes the switch corresponding to that voltage to turn on its load element. The ramp is turned on and off by a single switch or by a logic-level electrical signal. The ramp rate for turning on the load element is relatively slow and the rate for turning the elements off is relatively fast. Optionally, the duration of each interval of time between the turning on of the load elements is programmable.

  7. Sequential power-up circuit

    DOE Patents [OSTI]

    Kronberg, J.W.

    1992-06-02

    A sequential power-up circuit for starting several electrical load elements in series to avoid excessive current surge, comprising a voltage ramp generator and a set of voltage comparators, each comparator having a different reference voltage and interfacing with a switch that is capable of turning on one of the load elements. As the voltage rises, it passes the reference voltages one at a time and causes the switch corresponding to that voltage to turn on its load element. The ramp is turned on and off by a single switch or by a logic-level electrical signal. The ramp rate for turning on the load element is relatively slow and the rate for turning the elements off is relatively fast. Optionally, the duration of each interval of time between the turning on of the load elements is programmable. 2 figs.

  8. Alternative Fuels Data Center: Sacramento Powers up with Electric Vehicles

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Powers up with Electric Vehicles to someone by E-mail Share Alternative Fuels Data Center: Sacramento Powers up with Electric Vehicles on Facebook Tweet about Alternative Fuels Data Center: Sacramento Powers up with Electric Vehicles on Twitter Bookmark Alternative Fuels Data Center: Sacramento Powers up with Electric Vehicles on Google Bookmark Alternative Fuels Data Center: Sacramento Powers up with Electric Vehicles on Delicious Rank Alternative Fuels Data Center: Sacramento Powers up with

  9. OSTI Pact with Internet Archive Ensures Uninterrupted Research Access |

    Office of Scientific and Technical Information (OSTI)

    OSTI, US Dept of Energy, Office of Scientific and Technical Information OSTI Pact with Internet Archive Ensures Uninterrupted Research Access One sure thing about the World Wide Web: like the weather, it will change. Given this dynamic nature of the Web and the importance of preservation of scientific information in a digital environment, OSTI recently partnered with Internet Archive to ensure uninterrupted access to more than 1 million online research papers from the E-print Network. The

  10. Alternative Fuels Data Center: Companies Power up Through Workplace

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Charging Challenge Companies Power up Through Workplace Charging Challenge to someone by E-mail Share Alternative Fuels Data Center: Companies Power up Through Workplace Charging Challenge on Facebook Tweet about Alternative Fuels Data Center: Companies Power up Through Workplace Charging Challenge on Twitter Bookmark Alternative Fuels Data Center: Companies Power up Through Workplace Charging Challenge on Google Bookmark Alternative Fuels Data Center: Companies Power up Through Workplace

  11. Accelerating Innovation: PowerAmerica Is Up and Running | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2, 2015 - 2:00pm Addthis Accelerating Innovation: PowerAmerica Is Up and Running -Rob ... PowerAmerica, also called the Next Generation Power Electronics Manufacturing Innovation ...

  12. Power Air H Plus Korean Back up Power System JV | Open Energy...

    Open Energy Info (EERE)

    Plus Korean Back up Power System JV Jump to: navigation, search Name: Power AirH-Plus Korean Back-up Power System JV Place: Korea (Republic) Product: Power Air signed a MOU with...

  13. Fuel Cell Powers Up Festivities at Secretary Chu's Holiday Party |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Powers Up Festivities at Secretary Chu's Holiday Party Fuel Cell Powers Up Festivities at Secretary Chu's Holiday Party December 16, 2011 - 11:25am Addthis A clean, efficient fuel cell powered the tree lights at the 2011 Energy Department holiday party. | Energy Department file photo. A clean, efficient fuel cell powered the tree lights at the 2011 Energy Department holiday party. | Energy Department file photo. Sunita Satyapal Director, Fuel Cell Technologies Office How

  14. Solar Technology Acceleration Center is Powering Up - News Releases...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Solar Technology Acceleration Center is Powering Up October 21, 2009 Members of the Solar Technology Acceleration Center (SolarTAC) and supporters convened in Aurora, Colo., today, ...

  15. Microsoft Word - 04ASME_LIST_UpDate_Final_Sutherland.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... The power pack contains lightening protection, noise suppression circuitry and an uninterruptible power supply. The latter provides power to the GBU for approximately 30 minutes if ...

  16. Accelerating Innovation: PowerAmerica Is Up and Running | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PowerAmerica, also called the Next Generation Power Electronics Manufacturing Innovation ... Power Electronics Manufacturing Innovation Institute (fact sheet) Next Generation ...

  17. Energy Department Turns Up the Heat and Power on Industrial Energy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Turns Up the Heat and Power on Industrial Energy Efficiency Energy Department Turns Up the Heat and Power on Industrial Energy Efficiency March 13, 2013 - 12:19pm Addthis Learn how ...

  18. MIT's Plasma Science Fusion Center: I-Mode Powers Up on Alcator...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    I-Mode Powers Up on Alcator C-Mod Tokamak American Fusion News Category: Massachusetts Institute of Technology (MIT) Link: MIT's Plasma Science Fusion Center: I-Mode Powers Up on...

  19. Start-up Plan for Plutonium-238 Production for Radioisotope Power...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Start-up Plan for Plutonium-238 Production for Radioisotope Power System (Report to Congress - June 2010) Start-up Plan for Plutonium-238 Production for Radioisotope Power System ...

  20. Accelerating Innovation: PowerAmerica Is Up and Running

    Broader source: Energy.gov [DOE]

    The excitement and drive to deliver was evident to me last week when I joined nearly 100 PowerAmerica members for their kick-off meeting at NC State University in Raleigh, North Carolina. PowerAmerica, also called the Next Generation Power Electronics Manufacturing Innovation Institute, will develop advanced manufacturing processes and work to accelerate the commercialization of wide bandgap (WBG) technologies.

  1. KITSAP COUNTY POWERS UP WITH ENERGY EFFICIENCY | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... to real estate agents, and provide Certified Green Appraisal training to appraisers. ... RePower Kitsap found that a centralized data collection and reporting system aided in ...

  2. Alternative Fuels Data Center: Florida Schools First in State to Power up

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    With Propane Florida Schools First in State to Power up With Propane to someone by E-mail Share Alternative Fuels Data Center: Florida Schools First in State to Power up With Propane on Facebook Tweet about Alternative Fuels Data Center: Florida Schools First in State to Power up With Propane on Twitter Bookmark Alternative Fuels Data Center: Florida Schools First in State to Power up With Propane on Google Bookmark Alternative Fuels Data Center: Florida Schools First in State to Power up

  3. Revamped Simulation Tool to Power Up Wave Energy Development

    Broader source: Energy.gov [DOE]

    Scientists and engineers face considerable challenges when modeling new wave energy technologies. The DOE's Water Power Program announces the release of their new, updated WEC-Sim modeling tool, which will be a great help in this area.

  4. Electromechanical battery design suitable for back-up power applications

    DOE Patents [OSTI]

    Post, Richard F.

    2002-01-01

    The windings that couple energy into and out of the rotor of an electro-mechanical battery are modified. The normal stator windings of the generator/motor have been replaced by two orthogonal sets of windings. Because of their orthogonality, they are decoupled from each other electrically, though each can receive (or deliver) power flows from the rotating field produced by the array of permanent magnets. Due to the orthogonal design of the stator windings and the high mechanical inertia of the flywheel rotor, the resulting power delivered to the computer system is completely insensitive to any and all electrical transients and variabilities of the power from the main power source. This insensitivity includes complete failure for a period determined only by the amount of stored kinetic energy in the E-M battery modules that are supplied. Furthermore there is no need whatsoever for fast-acting, fractional-cycle switches, such as are employed in conventional systems, and which are complicated to implement.

  5. Microsoft PowerPoint - 2009.10.27 Bridge Inspection Follow-up | Department

    Energy Savers [EERE]

    of Energy 2009.10.27 Bridge Inspection Follow-up Microsoft PowerPoint - 2009.10.27 Bridge Inspection Follow-up PDF icon Microsoft PowerPoint - 2009.10.27 Bridge Inspection Follow-up More Documents & Publications Slide 1 Slide 1 Microsoft Word - Issue FY2009 Q4 Draft 20090910.doc

  6. Secretary Chu Announces up to $62 Million for Concentrating Solar Power

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Research and Development | Department of Energy up to $62 Million for Concentrating Solar Power Research and Development Secretary Chu Announces up to $62 Million for Concentrating Solar Power Research and Development May 7, 2010 - 12:00am Addthis Washington, DC - U.S. Department of Energy Secretary Steven Chu today announced the selections of projects for investment of up to $62 million over five years to research, develop, and demonstrate Concentrating Solar Power (CSP) systems capable of

  7. Improving the reliability of Class 1E power distribution to instrumentation and control cabinets on nuclear power plants in the USA. Final report

    SciTech Connect (OSTI)

    Brennen, M.B.

    1995-09-01

    This study was conducted to explore nontraditional electric power distribution concepts to improve the reliability of uninterruptible power to vital Instrumentation and Control (I and C) cabinets in future US nuclear power plants. The study incorporated comparative technical and economic evaluations of existing and nontraditional uninterruptible power supply (UPS) concepts. All nontraditional distribution concepts were based on available or already emerging components or semiconductor devices. Another purpose of the study was to reduce the cost and complexity of present power distribution and to lower maintenance, replacement, degradation and fault location requirements. The possible reduction of distribution losses, especially during operation under battery power, was also evaluated. The study indicates that direct current distribution at 48 or 125 Vdc levels would have more than an order of magnitude improvement over the reliability of present alternating current supplies at comparable cost. Furthermore, losses under battery power could be reduced significantly with respect to present distribution losses. An inherent advantage of DC distribution is that power transfer from the failed power bus to an operational bus occurs naturally and instantaneously via two simple and reliable semiconductor diodes. AC distribution, on the other hand, requires complex synchronization, decision making and gated semiconductor switching devices for power bus transfer all of which could be eliminated. Some of the concepts presented may also be applied to make existing vital (Class 1E) uninterruptible power supplies in US nuclear plants more reliable.

  8. DOE Announces up to $52.5 Million for Concentrating Solar Power Research

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and Development | Department of Energy up to $52.5 Million for Concentrating Solar Power Research and Development DOE Announces up to $52.5 Million for Concentrating Solar Power Research and Development July 15, 2009 - 12:00am Addthis WASHINGTON, D.C. - The U.S. Department of Energy today announced plans to provide up to $52.5 million to research, develop, and demonstrate Concentrating Solar Power systems capable of providing low-cost electrical power both day and night. Today's announcement

  9. Start-up Plan for Plutonium-238 Production for Radioisotope Power System

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    (Report to Congress - June 2010) | Department of Energy Start-up Plan for Plutonium-238 Production for Radioisotope Power System (Report to Congress - June 2010) Start-up Plan for Plutonium-238 Production for Radioisotope Power System (Report to Congress - June 2010) The Administration has requested the restart of plutonium-238 (Pu-238) production in fiscal year (FY) 2011. The following joint start-up plan, consistent with the President's request, has been developed collaboratively between

  10. EV Everywhere: Innovative Battery Research Powering Up Plug-In Electric

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Vehicles | Department of Energy Innovative Battery Research Powering Up Plug-In Electric Vehicles EV Everywhere: Innovative Battery Research Powering Up Plug-In Electric Vehicles January 24, 2014 - 1:14pm Addthis Chemist Kris Pupek and student researcher Thoe Michaelos prepare validation experiments for the synthesis of battery materials at Argonne National Laboratory in Lemont, Illinois. Battery research at Argonne, and other national laboratories like it, are helping plug-in electric

  11. EcoCAR 3: Year 1 Finals Power Up University Teams | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    EcoCAR 3: Year 1 Finals Power Up University Teams EcoCAR 3: Year 1 Finals Power Up University Teams June 4, 2015 - 12:30pm Addthis 1 of 11 As part of the EcoCAR 3 Advanced Vehicle Technology Competition, university teams from throughout North America will redesign a 2016 Chevrolet Camaro to reduce its environmental impact while maintaining its "muscle car" performance. Image: Courtesy of EcoCAR 3 2 of 11 As part of EcoCAR 3, university teams will receive a set of keys to a brand new

  12. LOCA feasibility study of Almaraz NPP 110% power up-rate

    SciTech Connect (OSTI)

    Orive, Raul; Gallego, Ines; Garcia, Pablo; Concejal, Alberto; Martinez-Murillo, Juan-Carlos

    2006-07-01

    Knowledge about accidents and fuel response in extreme conditions has progressed in parallel with the simulation tools development and consequently results are today highly satisfactory. This fact allows nuclear power plants (NPP) to carry out optimization processes of its operation and yield improvements due to the development of new methodologies and tools. Power up-rates open a demand in areas like the analyses of Loss Of Coolant Accidents (LOCA's), which impact on plant design may limit the maximum operation power in a nuclear power plant. TRAC-PF1 is a thermal-hydraulic calculation code that allows the complete treatment of two-phase flows in balance, combining a three dimensional vessel, that simulates in detail the accident phenomena, with one dimensional components. TRAC-PF1 code capacities in the reproduction of experiments, transients and accidents have been widely proved. IBERINCO has modified the original code to develop a conservative model applicable to a 3-loop Westinghouse NPP. These circumstances have allowed Almaraz NPP to get deeper in the study of the plant behaviour during a LOCA, after a hypothetical Power Up-rate. The scope of the study includes the development of the plant model and the reproduction of several accidents with loss of coolant. These accidents have been simulated with the improved option and the conservative version of the modified code (TRAC-PF1/IBER). The limiting case at the current power is analyzed in 110% Power Up-rate conditions and different sensitivity studies are performed, focused in impact of axial power distribution, discharge coefficients and emergency core cooling system availability. These studies allow to verify the effectiveness of Almaraz NPP safety systems in LOCA scenarios to guarantee the required safety margins. (authors)

  13. Powering Up the Women's Procurement Program Presenters: Ann Sullivan Denise Farris

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Powering Up the Women's Procurement Program Presenters: Ann Sullivan Denise Farris Madison Services Group, Inc. Farris Law Firm LLC WIPP Government Relations WIPP Member 1156 15 th Street, NW, Suite 1100 1600 Genessee, Suite 433 Washington, DC 20005 Kansas City, MO 64106 Tel: 202 626 8528 Tel: 816 842 0800 Fax: 202 872 8543 Fax: 816 842 0877 Email: asullivan@madisonservicesgroup.com Email: dfarris@farrislawfirm.com 1 A Brief History of the WOSB Program « In 2000, Public Law 106-554

  14. Flywheel Energy Storage -- An Alternative to Batteries for UPS Systems

    SciTech Connect (OSTI)

    Brown, Daryl R.; Chvala, William D.

    2003-11-12

    Direct current (DC) system flywheel energy storage technology can be used as a substitute for batteries for providing backup power to an uninterruptible power supply (UPS) system. Although the initial cost will usually be higher, flywheels offer a much longer life, reduced maintenance, a smaller footprint, and better reliability compared to a battery. The combination of these characteristics will generally result in a lower life-cycle cost for a flywheel compared to a battery. This paper describes the technology, its variations, and installation requirements, as well as provides application advice. One Federal application is highlighted as a “case study,” followed by an illustrative life-cycle cost comparison of batteries and flywheels. A list of manufacturers, with contact information is also provided.

  15. Start-up fuel and power flattening of sodium-cooled candle core

    SciTech Connect (OSTI)

    Takaki, Naoyuki; Sagawa, Yu; Umino, Akitake; Sekimoto, Hiroshi

    2013-07-01

    The hard neutron spectrum and unique power shape of CANDLE enable its distinctive performances such as achieving high burnup more than 30% and exempting necessity of both enrichment and reprocessing. On the other hand, they also cause several challenging problems. One is how the initial fuel can be prepared to start up the first CANDLE reactor because the equilibrium fuel composition that enables stable CANDLE burning is complex both in axial and radial directions. Another prominent problem is high radial power peaking factor that worsens averaged burnup, namely resource utilization factor in once-through mode and shorten the life time of structure materials. The purposes of this study are to solve these two problems. Several ideas for core configurations and startup fuel using single enrichment uranium and iron as a substitute of fission products are studied. As a result, it is found that low enriched uranium is applicable to ignite the core but all concepts examined here exceeded heat limits. Adjustment in enrichment and height of active and burnt zone is opened for future work. Sodium duct assemblies and thorium fuel assemblies loaded in the center region are studied as measures to reduce radial power peaking factor. Replacing 37 fuels by thorium fuel assemblies in the zeroth to third row provides well-balanced performance with flattened radial power distribution. The CANDLE core loaded with natural uranium in the outer and thorium in the center region achieved 35.6% of averaged burnup and 7.0 years of cladding life time owing to mitigated local fast neutron irradiation at the center. Using thorium with natural or depleted uranium in CANDLE reactor is also beneficial to diversifying fission resource and extending available term of fission energy without expansion of needs for enrichment and reprocessing.

  16. High-Definition Differential Ion Mobility Spectrometry with Resolving Power up to 500

    SciTech Connect (OSTI)

    Shvartsburg, Alexandre A.; Seim, Thomas A.; Danielson, William F.; Norheim, Randolph V.; Moore, Ronald J.; Anderson, Gordon A.; Smith, Richard D.

    2013-01-20

    As the resolution of analytical methods improve, further progress tends to be increasingly limited by instrumental parameter instabilities that could be ignored before. This is now the case with differential ion mobility spectrometry (FAIMS), where fluctuations of the voltages and gas pressure have become critical. A new high-definition generator for FAIMS compensation voltage reported here provides a stable and accurate output than can be scanned with negligible steps. This reduces the spectral drift and peak width, thus improving the resolving power (R) and resolution. The gain for multiply-charged peptides that have narrowest peaks is up to ~40%, and R ~ 400 - 500 is achievable using He/N2 or H2/N2 gas mixtures.

  17. Managing the Night Off-Peak Power Demand in the Central Region UPS with Newly Commissioned NPP Capacities

    SciTech Connect (OSTI)

    Aminov, R. Z.; Pron, D. M.

    2014-01-15

    The use of hydrogen technologies as a controlled-load consumer based on the newly commissioned base-load nuclear power plants to level out the daily load profile is justified for the Unified Power System (UPS) of the Central Region of Russia, as an example, for the period till 2020.

  18. DOE Announces up to $52.5 Million for Concentrating Solar Power...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Concentrating Solar Power (CSP) technologies concentrate the sun's energy and capture that energy as heat, which then drives an engine or turbine to produce electrical power. CSP ...

  19. Microsoft Word - M-2 WTP Contract Section J - Conformed Thru...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... UPS Battery LVE-MCC-10201B Motor Control Center UPE-UPS-10002A Uninterruptible Power Supply UPE-BATT-10001A UPS Battery UPE-UPS-10002B Uninterruptible Power Supply ...

  20. Geek-Up[6.10.2011]: Thermoelectrics' Great Power, Key Ingredient in Bone's Nanostructure

    Broader source: Energy.gov [DOE]

    Advanced thermoelectric materials could be used to develop vehicle exhaust systems that convert exhaust heat into electricity, concentrate solar energy for power generation and recover waste heat from industrial processes.

  1. Application Of The Iberdrola Licensing Methodology To The Cofrentes BWR-6 110% Extended Power Up-rate

    SciTech Connect (OSTI)

    Mata, Pedro; Fuente, Rafael de la; Iglesias, Javier; Sedano, Pablo G.

    2002-07-01

    Iberdrola (spanish utility) and Iberdrola Ingenieria (engineering branch) have been developing during the last two years the 110% Extended Power Up-rate Project (EPU 110%) for Cofrentes BWR-6. IBERDROLA has available an in-house design and licensing reload methodology that has been approved by the Spanish Nuclear Regulatory Authority. This methodology has been already used to perform the nuclear design and the reload licensing analysis for Cofrentes cycles 12 to 14. The methodology has been also applied to develop a significant number of safety analysis of the Cofrentes Extended Power Up-rate including: Reactor Heat Balance, Core and Fuel performance, Thermal Hydraulic Stability, ECCS LOCA Evaluation, Transient Analysis, Anticipated Transient Without Scram (ATWS) and Station Blackout (SBO) Since the scope of the licensing process of the Cofrentes Extended Power Up-rate exceeds the range of analysis included in the Cofrentes generic reload licensing process, it has been required to extend the applicability of the Cofrentes licensing methodology to the analysis of new transients. This is the case of the TLFW transient. The content of this paper shows the benefits of having an in-house design and licensing methodology, and describes the process to extend the applicability of the methodology to the analysis of new transients. The case of analysis of Total Loss of Feedwater with the Cofrentes Retran Model is included as an example of this process. (authors)

  2. Tomorrow`s energy today for cities and counties: Cogeneration powers up cost-competitive energy

    SciTech Connect (OSTI)

    1995-11-01

    Cities and counties build many multi-million dollar facilities, and supplying energy to run these facilities is a long-term obligation for a community. Cogeneration offers local governments an opportunity to reduce the cost of providing electricity, heating, and cooling to their buildings. Sometimes cogeneration is combined with district heating and cooling systems. This kind of cogeneration results in system efficiencies as high as 70%--about twice the efficiency of a conventional power plant that produces only electricity! The article describes cogeneration combined with district cooling in Trenton, NJ, and cogeneration on a small scale in San Jose, California.

  3. SAND2007-5138

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... 30 The enclosure also housed auxiliary power supplies and the uninterruptible power supply (UPS) unit that supplied AC power to all of the instrumentation and data systems. ...

  4. Method of and apparatus for preheating pressurized fluidized bed combustor and clean-up subsystem of a gas turbine power plant

    DOE Patents [OSTI]

    Cole, Rossa W.; Zoll, August H.

    1982-01-01

    In a gas turbine power plant having a pressurized fluidized bed combustor, gas turbine-air compressor subsystem and a gas clean-up subsystem interconnected for fluid flow therethrough, a pipe communicating the outlet of the compressor of the gas turbine-air compressor subsystem with the interior of the pressurized fluidized bed combustor and the gas clean-up subsystem to provide for flow of compressed air, heated by the heat of compression, therethrough. The pressurized fluidized bed combustor and gas clean-up subsystem are vented to atmosphere so that the heated compressed air flows therethrough and loses heat to the interior of those components before passing to the atmosphere.

  5. Scaling Up

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scaling Up Scaling Up Many scientists appreciate Python's power for prototyping and developing scientific computing and data-intensive applications. However, creating parallel Python applications that scale well in modern high-performance computing environments can be challenging for a variety of reasons. Approaches to parallel processing in Python at NERSC are described on this page. Here we outline various approaches to scaling parallel Python applications at NERSC so that users may select the

  6. OUT Success Stories: Battery Electricity Storage for Quality Power

    SciTech Connect (OSTI)

    Recca, L.

    2000-08-31

    A 3.5-megawatt valve-regulated lead-acid (VRLA) battery system installed at a lead recycling plant in California provides one hour of energy storage for both peak-shaving and uninterruptible power. It incorporates improvements in battery materials, manufacturing processes, and quality control.

  7. Geek-Up[11.05.10]: Quark Gluon Plasma, Solar-Power Generating Windows and CCS Field Studies

    Broader source: Energy.gov [DOE]

    Large Hadron Collider's (LHC) first record-setting run of high-energy proton collisions, new transparent film capable of absorbing light and generating electrical charge developed, and field test finds that opportunities to permanently store carbon in unmineable seams of lignite may be more widespread than previously documented -- all in this week's Geek-Up.

  8. Start-up Plan for Plautonium-238 Production for Radioisotope Power System (Report to Congress- June 2010)

    Office of Energy Efficiency and Renewable Energy (EERE)

    The Administration has requested the restart of plutonium?238 (Pu?238) production in fiscal year (FY) 2011. The following joint start?up plan, consistent with the President's request, has been developed collaboratively between the Department of Energy (DOE) and the National Aeronautics and Space Administration (NASA), and defines the roles and contributions of major users of Pu?238 in response to Congressional request.

  9. Benchmark Evaluation of Start-Up and Zero-Power Measurements at the High-Temperature Engineering Test Reactor

    SciTech Connect (OSTI)

    Bess, John D.; Fujimoto, Nozomu

    2014-10-09

    Benchmark models were developed to evaluate six cold-critical and two warm-critical, zero-power measurements of the HTTR. Additional measurements of a fully-loaded subcritical configuration, core excess reactivity, shutdown margins, six isothermal temperature coefficients, and axial reaction-rate distributions were also evaluated as acceptable benchmark experiments. Insufficient information is publicly available to develop finely-detailed models of the HTTR as much of the design information is still proprietary. However, the uncertainties in the benchmark models are judged to be of sufficient magnitude to encompass any biases and bias uncertainties incurred through the simplification process used to develop the benchmark models. Dominant uncertainties in the experimental keff for all core configurations come from uncertainties in the impurity content of the various graphite blocks that comprise the HTTR. Monte Carlo calculations of keff are between approximately 0.9 % and 2.7 % greater than the benchmark values. Reevaluation of the HTTR models as additional information becomes available could improve the quality of this benchmark and possibly reduce the computational biases. High-quality characterization of graphite impurities would significantly improve the quality of the HTTR benchmark assessment. Simulation of the other reactor physics measurements are in good agreement with the benchmark experiment values. The complete benchmark evaluation details are available in the 2014 edition of the International Handbook of Evaluated Reactor Physics Benchmark Experiments.

  10. Benchmark Evaluation of Start-Up and Zero-Power Measurements at the High-Temperature Engineering Test Reactor

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Bess, John D.; Fujimoto, Nozomu

    2014-10-09

    Benchmark models were developed to evaluate six cold-critical and two warm-critical, zero-power measurements of the HTTR. Additional measurements of a fully-loaded subcritical configuration, core excess reactivity, shutdown margins, six isothermal temperature coefficients, and axial reaction-rate distributions were also evaluated as acceptable benchmark experiments. Insufficient information is publicly available to develop finely-detailed models of the HTTR as much of the design information is still proprietary. However, the uncertainties in the benchmark models are judged to be of sufficient magnitude to encompass any biases and bias uncertainties incurred through the simplification process used to develop the benchmark models. Dominant uncertainties in themore » experimental keff for all core configurations come from uncertainties in the impurity content of the various graphite blocks that comprise the HTTR. Monte Carlo calculations of keff are between approximately 0.9 % and 2.7 % greater than the benchmark values. Reevaluation of the HTTR models as additional information becomes available could improve the quality of this benchmark and possibly reduce the computational biases. High-quality characterization of graphite impurities would significantly improve the quality of the HTTR benchmark assessment. Simulation of the other reactor physics measurements are in good agreement with the benchmark experiment values. The complete benchmark evaluation details are available in the 2014 edition of the International Handbook of Evaluated Reactor Physics Benchmark Experiments.« less

  11. Economic analysis of operating alternatives for the South Vandenberg Power Plant at Vandenberg Air Force Base, California

    SciTech Connect (OSTI)

    Daellenbach, K.K.; Dagle, J.E.; Reilly, R.W.; Shankle, S.A.

    1993-02-01

    Vandenberg Air Force Base (VAFB), located approximately 50 miles northwest of Santa Barbara, California, commissioned the Pacific Northwest Laboratory to conduct an economic analysis of operating alternatives of the South Vandenberg Power Plant (SVPP). Recent concern over SVPP operating and environmental costs prompted VAFB personnel to consider other means to support the Missile Operation Support Requirement (MOSR). The natural gas-fired SVPP was originally designed to support the Space Transportation System launch activities. With cancellation of this mission, the SVPP has been used to provide primary and backup electric power to support MOSR activities for the Space Launch Complexes. This document provides economic analysis in support of VAFB decisions about future operation of the SVPP. This analysis complied with the life-cycle cost (LCC) analytical approach detailed in 10 CFR 436, which is used in support of all Federal energy decisions. Many of the SVPP operational and environmental cost estimates were provided by VAFB staff, with additional information from vendors and engineering contractors. The LCC analysis consisted of three primary operating strategies, each with a level of service equal to or better than the current status-quo operation. These scenarios are: Status-quo operation where the SVPP provides both primary and backup MOSR power; Purchased utility power providing primary MOSR support with backup power provided by an Uninterruptible Power Supply (UPS) system. The SVPP would be used to provide power for long-duration power outages; Purchased utility power provides primary MOSR support with backup power provided by a UPS system. A new set of dedicated generators would provide backup power for long-duration power outages.

  12. TeamWorks - A publication of the U.S. Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... The primary maintenance events during this time include (1) replacing an uninterruptible power supply (UPS) in the support building, (2) replacing Head Rope 6 on the Waste Hoist ...

  13. Carlsbad Field Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... phones, equipment, unobstructed access, signs, debris, and ventilation Uninterruptible Power Supply (Central UPS) Facility Operations Daily See List 3 WP 04-ED1542 Inspecting for ...

  14. Microsoft Word - FINAL Class 1 Revise TRUPACT-III Management...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... phones, equipment, unobstructed access, signs, debris, and ventilation Uninterruptible Power Supply (Central UPS) Facility Operations Daily See List 3 WP 04-ED1542 Inspecting for ...

  15. Section E Nuclear Facility D&D, Remainder of Hanford

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    months Completed annual surveillance of Redox facilities. Completed replacement of PUREX uninterruptible power supply (UPS) battery cell. EMS Objectives and Target Status...

  16. Powercom Co Ltd | Open Energy Information

    Open Energy Info (EERE)

    Powercom Co Ltd Place: Chung Ho, Taipei, Taiwan Product: Manufacturers of Uninterruptible Power Supplies (UPS) and PV cells and modules. References: Powercom Co Ltd1 This article...

  17. Multimode power processor

    DOE Patents [OSTI]

    O'Sullivan, George A.; O'Sullivan, Joseph A.

    1999-01-01

    In one embodiment, a power processor which operates in three modes: an inverter mode wherein power is delivered from a battery to an AC power grid or load; a battery charger mode wherein the battery is charged by a generator; and a parallel mode wherein the generator supplies power to the AC power grid or load in parallel with the battery. In the parallel mode, the system adapts to arbitrary non-linear loads. The power processor may operate on a per-phase basis wherein the load may be synthetically transferred from one phase to another by way of a bumpless transfer which causes no interruption of power to the load when transferring energy sources. Voltage transients and frequency transients delivered to the load when switching between the generator and battery sources are minimized, thereby providing an uninterruptible power supply. The power processor may be used as part of a hybrid electrical power source system which may contain, in one embodiment, a photovoltaic array, diesel engine, and battery power sources.

  18. Multimode power processor

    DOE Patents [OSTI]

    O'Sullivan, G.A.; O'Sullivan, J.A.

    1999-07-27

    In one embodiment, a power processor which operates in three modes: an inverter mode wherein power is delivered from a battery to an AC power grid or load; a battery charger mode wherein the battery is charged by a generator; and a parallel mode wherein the generator supplies power to the AC power grid or load in parallel with the battery. In the parallel mode, the system adapts to arbitrary non-linear loads. The power processor may operate on a per-phase basis wherein the load may be synthetically transferred from one phase to another by way of a bumpless transfer which causes no interruption of power to the load when transferring energy sources. Voltage transients and frequency transients delivered to the load when switching between the generator and battery sources are minimized, thereby providing an uninterruptible power supply. The power processor may be used as part of a hybrid electrical power source system which may contain, in one embodiment, a photovoltaic array, diesel engine, and battery power sources. 31 figs.

  19. Computational Design and Prototype Evaluation of Aluminide-Strengthened Ferritic Superalloys for Power-Generating Turbine Applications up to 1,033 K

    SciTech Connect (OSTI)

    Peter Liaw; Gautam Ghosh; Mark Asta; Morris Fine; Chain Liu

    2010-04-30

    The objective of the proposed research is to utilize modern computational tools, integrated with focused experiments, to design innovative ferritic NiAl-strengthened superalloys for fossil-energy applications at temperatures up to 1,033 K. Specifically, the computational alloy design aims toward (1) a steady-state creep rate of approximately 3 x 10{sup -11} s{sup -1} at a temperature of 1,033 K and a stress level of 35 MPa, (2) a ductility of 10% at room temperature, and (3) good oxidation and corrosion resistance at 1,033 K. The research yielded many outstanding research results, including (1) impurity-diffusion coefficients in {alpha} Fe have been calculated by first principles for a variety of solute species; (2) the precipitates were characterized by the transmission-electron microscopy (TEM) and analytical-electron microscopy (AEM), and the elemental partitioning has been determined; (3) a bending ductility of more than 5% has been achieved in the unrolled materials; and (4) optimal compositions with minimal secondary creep rates at 973 K have been determined. Impurity diffusivities in {alpha} Fe have been calculated within the formalisms of a harmonic transition-state theory and Le Claire nine-frequency model for vacancy-mediated diffusion. Calculated diffusion coefficients for Mo and W impurities are comparable to or larger than that for Fe self-diffusion. Calculated activation energies for Ta and Hf impurities suggest that these solutes should display impurity-diffusion coefficients larger than that for self-diffusion in the body-centered cubic Fe. Preliminary mechanical-property studies identified the alloy Fe-6.5Al-10Ni-10Cr-3.4Mo-0.25Zr-0.005B (FBB-8) in weight percent (wt.%) for detailed investigations. This alloy shows precipitation of NiAl particles with an average diameter of 130 nm. In conjunction with the computational alloy design, selected experiments are performed to investigate the effect of the Al content on the ductility and creep of prototype Fe-Ni-Cr-Al-Mo alloys. Three-point-bending experiments show that alloys containing more than 5 wt.% Al exhibit poor ductility (< 2%) at room temperature, and their fracture mode is predominantly of a cleavage type. Two major factors governing the poor ductility are (1) the volume fraction of NiAl-type precipitates, and (2) the Al content in the {alpha}-Fe matrix. A bend ductility of more than 5% can be achieved by lowering the Al concentration to 3 wt.% in the alloy. The alloy containing about 6.5 wt.% Al is found to have an optimal combination of hardness, ductility, and minimal creep rate at 973 K. A high volume fraction of precipitates is responsible for the good creep resistance by effectively resisting the dislocation motion through Orowan-bowing and dislocation-climb mechanisms. The effects of stress on the creep rate have been studied. With the threshold-stress compensation, the stress exponent is determined to be 4, indicating power-law dislocation creep. The threshold stress is in the range of 40-53 MPa. The addition of W can significantly reduce the secondary creep rates. Compared to other candidates for steam-turbine applications, FBB-8 does not show superior creep resistance at high stresses (> 100 MPa), but exhibit superior creep resistance at low stresses (< 60 MPa).

  20. Microsoft Word - DOE-ID-INL-15-041.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of TRA-666A to accept standby power. 3. Install an Uninterruptible Power Supply (UPS) capable of powering the tritium monitoring equipment, and logging computer, for 1.5 hours. ...

  1. Berkeley Lab's New Computing Sciences Facility Features First...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... Branch circuits run from 408 to 208V PDUs (power distribution units) to racks just below floor tile. Red is UPS (uninterruptible power supply), blue is normal power. "With the ...

  2. Keeping Up With Your Audience, So They Keep Up with Your Program |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Up With Your Audience, So They Keep Up with Your Program Keeping Up With Your Audience, So They Keep Up with Your Program Keeping Up With Your Audience, So They Keep Up with Your Program - BBNP Program Implementation - Snapshot Series Webinar, May 17, 2012 PDF icon Keeping Up With Your Audience More Documents & Publications PowerSaver Loan Program Opportunities through the PowerSaver Loan Program Effective Loan Program Design and Integration with Contractors

  3. Powering Up for Recovery in Michigan

    Broader source: Energy.gov [DOE]

    Elizabeth Rolinski can’t wait to reopen the factory she was once forced to shutter. When the Department of Energy awarded Johnson Controls Inc. a $300 million grant to manufacture high-performance batteries for electric cars, it helped attract the company to reinvest in American workers in this all-American town.

  4. Powering up America’s Waterways

    Broader source: Energy.gov [DOE]

    A new report looks at the tremendous potential to generate clean hydroelectric energy at existing dams across the U.S.

  5. Microsoft Word - DOE-ID-INL-12-027 _INL-12-105_.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    To support the transition, INL would also install a 30 minute battery backed uninterruptible power supply (UPS) for the ATR 670-E-9 electrical bus. The incorporation of a 30 minute ...

  6. CX-004209: Categorical Exclusion Determination

    Broader source: Energy.gov [DOE]

    Building 922 Uninterruptable Power System (UPS) ReplacementCX(s) Applied: B2.1Date: 09/27/2010Location(s): Allegheny County, PennsylvaniaOffice(s): National Energy Technology Laboratory

  7. DATE

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    10-009 SECTION A. Project Title Idaho Falls (IF)-608 Uninterrupted Power Supply Upgrade Project SECTION B. Project Description: This project increases the Uninterrupted Power Supply (UPS) capacity in the IF-608 Information Operations and Research Center (IORC) by removing two existing UPS systems (50 KVA and 36 KVA) and installing a 225 KVA system. A ~15 ton cooling unit will be installed on the roof for heat removal. Associated work will include additional electrical panel(s) and electrical

  8. Water Power | Open Energy Information

    Open Energy Info (EERE)

    Get Involved Help Apps Datasets Community Login | Sign Up Search Gateway Edit History Water Power Jump to: navigation, search Water Power Community Forum Provides the community...

  9. Water Power | Open Energy Information

    Open Energy Info (EERE)

    Get Involved Help Apps Datasets Community Login | Sign Up Search Gateway Edit History Water Power (Redirected from Water) Jump to: navigation, search Water Power Community Forum...

  10. DOE Traineeship In Power Engineering (Leveraging Wide Bandgap Power

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Electronics) | Department of Energy DOE Traineeship In Power Engineering (Leveraging Wide Bandgap Power Electronics) DOE Traineeship In Power Engineering (Leveraging Wide Bandgap Power Electronics) July 20, 2015 - 1:00pm Addthis DOE Traineeship In Power Engineering (Leveraging Wide Bandgap Power Electronics) The Advanced Manufacturing Office announced up to $10 million is available to establish 5-year graduate-level university-led DOE Traineeship(s) in Power Engineering (leveraging emerging

  11. Power Plant Cycling Costs

    SciTech Connect (OSTI)

    Kumar, N.; Besuner, P.; Lefton, S.; Agan, D.; Hilleman, D.

    2012-07-01

    This report provides a detailed review of the most up to date data available on power plant cycling costs. The primary objective of this report is to increase awareness of power plant cycling cost, the use of these costs in renewable integration studies and to stimulate debate between policymakers, system dispatchers, plant personnel and power utilities.

  12. Up-and-down chopper circuit

    DOE Patents [OSTI]

    Goffeau, Jacques R.

    1979-01-01

    An improved Up-and-Down Chopper Circuit is provided which is useful for voltage regulation in a bi-directional DC power system. In the down mode, power is switched from a DC power source to a lower voltage energy storing load while in the up mode stored energy in the load is transferred to the higher voltage source. The system uses Darlington transistor switches in a conventional connection. The improvement relates to circuit additions to eliminate the effects of inter-electrode capacitance inherent with this Darlington transistor switching arrangement.

  13. Greening up fossil fuels with carbon sequestration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Greening up fossil fuels with carbon sequestration 1663 Los Alamos science and technology magazine Latest Issue:March 2016 past issues All Issues » submit Greening up fossil fuels with carbon sequestration Researchers make progress fighting climate change by capturing carbon dioxide from power plants and storing it deep underground in geological reservoirs March 25, 2013 Greening up fossil fuels with carbon sequestration Most of the world's existing energy supply is stored underground in

  14. Setting up File Permissions

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Setting up File Permissions Setting up File Permissions Recommendations for Setting up "Shared" Directories This section shows the recommended commands for setting up shared directories. Please read the full page to get an understanding of what these commands are doing. These recommendations are based on the common use-case at the JGI for user/group read/write and global read access. Creating a New Shared Directory dmj@genepool04:~$ umask 002 # or have this set in .bashrc.ext

  15. NOAA Teams Up with Department of Energy & Industry to Improve...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NOAA Teams Up with Department of Energy & Industry to Improve Wind Forecasts NOAA Teams Up with ... Addthis The growth of wind-generated power in the United States is creating ...

  16. TS Wind Power Developers | Open Energy Information

    Open Energy Info (EERE)

    TS Wind Power Developers Jump to: navigation, search Name: TS Wind Power Developers Place: Satara, Maharashtra, India Sector: Wind energy Product: Setting up 30MW wind farm in...

  17. Hitec Power Protection | Open Energy Information

    Open Energy Info (EERE)

    search Name: Hitec Power Protection Place: Almelo, Netherlands Zip: 7602 Product: UPS flywheel systems. References: Hitec Power Protection1 This article is a stub. You can help...

  18. Maharashtra State Power Generation Company Limited MAHAGENCO...

    Open Energy Info (EERE)

    search Name: Maharashtra State Power Generation Company Limited (MAHAGENCO) Place: Mumbai, Maharashtra, India Zip: 400051 Product: Power generating firm planning to set up a...

  19. Volunteers - Sign Up

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Volunteers - Sign Up About Science Bowl Curriculum and Activities How to Build a Motor The Great Marble Drop How to Build a Turbine How to Build a Tower Classroom...

  20. Transformer failure and common-mode loss of instrument power at Nine Mile Point Unit 2 on August 13, 1991

    SciTech Connect (OSTI)

    Not Available

    1991-10-01

    On August 13, 1991, at Nine Mile Point Unit 2 nuclear power plant, located near Scriba, New York, on Lake Ontario, the main transformer experienced an internal failure that resulted in degraded voltage which caused the simultaneous loss of five uninterruptible power supplies, which in turn caused the loss of several nonsafety systems, including reactor control rod position indication, some reactor power and water indication, control room annunciators, the plant communications system, the plant process computer, and lighting at some locations. The reactor was subsequently brought to a safe shutdown. Following this event, the US Nuclear Regulatory Commission dispatched an Incident Investigation Team to the site to determine what happened, to identify the probable causes, and to make appropriate findings and conclusions. This report describes the incident, the methodology used by the team in its investigation, and presents and the team's findings and conclusions. 59 figs., 14 tabs.

  1. GMP Cow Power

    Broader source: Energy.gov [DOE]

    GMP purchases the renewable energy credits for up to $0.04 per kWh with full subscription of the GMP voluntary Cow Power tariff. Attributes associated with production in excess of voluntary...

  2. Power Assure | Open Energy Information

    Open Energy Info (EERE)

    Assure Jump to: navigation, search Name: Power Assure Place: Santa Clara, California Zip: 95051 Sector: Efficiency Product: California-based, service start-up focused on energy...

  3. Solar Power | Open Energy Information

    Open Energy Info (EERE)

    Get Involved Help Apps Datasets Community Login | Sign Up Search Gateway Edit History Solar Power Jump to: navigation, search Solar Energy Companies Loading map......

  4. Solar Power | Open Energy Information

    Open Energy Info (EERE)

    Get Involved Help Apps Datasets Community Login | Sign Up Search Gateway Edit History Solar Power (Redirected from Solar energy) Jump to: navigation, search Solar Energy...

  5. Solar Power | Open Energy Information

    Open Energy Info (EERE)

    Get Involved Help Apps Datasets Community Login | Sign Up Search Gateway Edit History Solar Power (Redirected from Solar) Jump to: navigation, search Solar Energy Companies...

  6. Plankton Power | Open Energy Information

    Open Energy Info (EERE)

    Plankton Power Place: Wellfleet, Massachusetts Product: Massachusetts-based algae biofuel start-up company. Coordinates: 40.752775, -100.725684 Show Map Loading map......

  7. Sathyam Power Pvt Ltd | Open Energy Information

    Open Energy Info (EERE)

    Power Pvt Ltd Place: Rajasthan, India Sector: Biomass Product: Plans to set up 27.5MW biomass power plant. References: Sathyam Power Pvt Ltd1 This article is a stub. You can...

  8. EV Everywhere: Innovative Battery Research Powering Up Plug-In...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Technologies Office Energy Storage work Read Vehicle Technologies Office success stories Watch this Energy 101 video to learn how electric vehicles work The EV Everywhere Grand ...

  9. Powering Up the Women's Procurement Program Presenters: Ann Sullivan...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Support Services 5413 Architectural, Engineering & Related Services 5616 Investigation ... to Building and Dwellings 7223 Special Food Services 6116 Other Schools and ...

  10. Power in Collaboration: National Energy Literacy Virtual Meet-Up

    Broader source: Energy.gov [DOE]

    The webinar will be a dynamic virtual conversation of ongoing efforts from across the country in utilizing the Department of Energy's Energy Literacy Framework to address one of our nation's...

  11. Automated remote control of fuel supply section for the coal fired power plant

    SciTech Connect (OSTI)

    Chudin, O.V.; Maidan, B.V.; Tsymbal, A.A.

    1996-05-01

    Approximately 6,000 miles east of Moscow, lays the city of Khabarovsk. This city`s coal-fired Power Plant 3 supplies electricity, heat and hot water to approximately 250,000 customers. Plant 3 has three units with a combined turbine capacity of 540 MW, (3 {times} 180) electrical and 780 (3 {times} 260) Gkal an hour thermal capacity with steam productivity of 2010 (3 {times} 670) tons per hour at 540 C. Coal fired thermal electric power plants rely on the equipment of the fuel supply section. The mechanism of the fuel supply section includes: conveyor belts, hammer crushers, guiding devices, dumping devices, systems for dust neutralizing, iron separators, metal detectors and other devices. As a rule, the fuel path in the power plant has three main directions: from the railroad car unloading terminal to the coal warehouse; from the coal warehouse to the acceptance bunkers of the power units, and the railroad car unloading terminal to the acceptance bunkers of power units. The fuel supply section always has a reserve and is capable of uninterruptible fuel supply during routine maintenance and/or repair work. This flexibility requires a large number of fuel traffic routes, some of which operate simultaneously with the feeding of coal from the warehouse to the acceptance bunkers of the power units, or in cases when rapid filling of the bunkers is needed, two fuel supply routes operate at the same time. The remote control of the fuel handling system at Power Plant 3 is described.

  12. Solar Power

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Solar Power Solar Power Project Opportunities Abound in the Region The WIPP site is receives abundant solar energy with 6-7 kWhsq meter power production potential As the ...

  13. Stationary Power

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering ...

  14. Perovskite Power

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Perovskite Power 1663 Los Alamos science and technology magazine Latest Issue:October 2015 past issues All Issues submit Perovskite Power A breakthrough in the production of...

  15. Brushing up on oil recovery

    SciTech Connect (OSTI)

    Mackey, J.

    1995-12-01

    To be prepared for a range of oil spills, emergency response organizations must have an arsenal of powerful and adaptable equipment. Around the coastal United States, a network of oil spill cooperatives and emergency response organizations stand ready with the technology and the know-how to respond to the first sign of an oil spill. When the telephone rings, they may be required to mop up 200 gallons of oil that leaked off the deck of a ship or to contain and skim 2,000 gallons of oil from a broken hose at a loading terminal. In a few cases each year, they may find themselves responding to a major pollution incident, one that involves hundreds of people and tons of equipment. To clean an oil spill at a New Jersey marine terminal, the local cooperative used the Lundin Oil Recovery Inc. (LORI) skimming system to separate the oil and water and the lift the oil out of the river. The LORI skimming technology is based on sound principles of fluid management - using the natural movement of water instead of trying to fight against it. A natural feeding mechanism delivers oily water through the separation process, and a simple mechanical separation and recovery device - a brush conveyor - removes the pollutants from the water.

  16. Local Burn-Up Effects in the NBSR Fuel Element

    SciTech Connect (OSTI)

    Brown N. R.; Hanson A.; Diamond, D.

    2013-01-31

    This study addresses the over-prediction of local power when the burn-up distribution in each half-element of the NBSR is assumed to be uniform. A single-element model was utilized to quantify the impact of axial and plate-wise burn-up on the power distribution within the NBSR fuel elements for both high-enriched uranium (HEU) and low-enriched uranium (LEU) fuel. To validate this approach, key parameters in the single-element model were compared to parameters from an equilibrium core model, including neutron energy spectrum, power distribution, and integral U-235 vector. The power distribution changes significantly when incorporating local burn-up effects and has lower power peaking relative to the uniform burn-up case. In the uniform burn-up case, the axial relative power peaking is over-predicted by as much as 59% in the HEU single-element and 46% in the LEU single-element with uniform burn-up. In the uniform burn-up case, the plate-wise power peaking is over-predicted by as much as 23% in the HEU single-element and 18% in the LEU single-element. The degree of over-prediction increases as a function of burn-up cycle, with the greatest over-prediction at the end of Cycle 8. The thermal flux peak is always in the mid-plane gap; this causes the local cumulative burn-up near the mid-plane gap to be significantly higher than the fuel element average. Uniform burn-up distribution throughout a half-element also causes a bias in fuel element reactivity worth, due primarily to the neutronic importance of the fissile inventory in the mid-plane gap region.

  17. UPS CNG Truck Fleet Start Up Experience: Alternative Fuel Truck Evaluation Project

    SciTech Connect (OSTI)

    Walkowicz, K.

    2001-08-14

    UPS operates 140 Freightliner Custom Chassis compressed natural gas (CNG)-powered vehicles with Cummins B5.9G engines. Fifteen are participating in the Alternative Fuel Truck Evaluation Project being funded by DOE's Office of Transportation Technologies and the Office of Heavy Vehicle Technologies.

  18. DOE Awards Up to $14.6 Million to Support Development of Advanced Water

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Power Technologies | Department of Energy Up to $14.6 Million to Support Development of Advanced Water Power Technologies DOE Awards Up to $14.6 Million to Support Development of Advanced Water Power Technologies September 15, 2009 - 12:00am Addthis WASHINGTON, DC - U.S. Department of Energy Secretary Steven Chu today announced that 22 advanced water power projects will receive up to $14.6 million in funding to advance the commercial viability, market acceptance, and environmental

  19. Secretary Chu Announces up to $62 Million for Concentrating Solar...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Secretary Chu Announces up to 62 Million for Concentrating Solar Power Research and Development May 7, 2010 - 12:00am Addthis Washington, DC - U.S. Department of Energy Secretary ...

  20. Power Right. Power Smart. Efficient Computer Power Supplies and...

    Energy Savers [EERE]

    They reduce power consumption, helping your electric utility meet peak power demands. And they improve overall power quality. Also, by converting more AC power into DC power, less ...

  1. Water Power

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Stationary Power/Energy Conversion Efficiency/Water Power Water PowerTara Camacho-Lopez2016-04-18T19:53:50+00:00 Enabling a successful water power industry. Hydropower Optimization Developing tools for optimizing the U.S. hydropower fleet's performance with minimal environmental impact. Technology Development Improving the power performance and reliability of marine hydrokinetic technologies. Market Acceleration & Deployment Addressing barriers to development, deployment, and evaluation of

  2. Hema Sri Power Projects Ltd HSPPL | Open Energy Information

    Open Energy Info (EERE)

    Hyderabad, Andhra Pradesh, India Sector: Biomass Product: Setting up biomass and waste-to-energy power projects. References: Hema Sri Power Projects Ltd. (HSPPL)1 This article...

  3. BurstPower Technologies Inc | Open Energy Information

    Open Energy Info (EERE)

    BurstPower Technologies Inc is a venture-backed start-up dedicated to developing and manufacturing ultracapacitors for the wireless communications and power quality...

  4. Prayag Green Solar Power PGSP | Open Energy Information

    Open Energy Info (EERE)

    Prayag Green Solar Power PGSP Jump to: navigation, search Name: Prayag Green Solar Power (PGSP) Place: Uttar Pradesh, India Product: Setting up PV project in Uttar Pradesh....

  5. Pelamis Wave Power Ocean Power Delivery Ltd | Open Energy Information

    Open Energy Info (EERE)

    Sector: Ocean Product: Scotland-based company specialising in the use of ocean power for electricity generation via its Pelamis convertor, which has been demonstrated up to 750kW....

  6. Webel Micro Power JV | Open Energy Information

    Open Energy Info (EERE)

    Name: Webel & Micro Power JV Place: Kolkata, West Bengal, India Zip: 700091 Product: A joint venture set up by Webel SL Energy Systems and Micro Power Trading in August 2007....

  7. first power

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    first power - Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel Cycle Defense Waste Management Programs Advanced Nuclear

  8. Power supply

    DOE Patents [OSTI]

    Yakymyshyn, Christopher Paul; Hamilton, Pamela Jane; Brubaker, Michael Allen

    2007-12-04

    A modular, low weight impedance dropping power supply with battery backup is disclosed that can be connected to a high voltage AC source and provide electrical power at a lower voltage. The design can be scaled over a wide range of input voltages and over a wide range of output voltages and delivered power.

  9. Synergetic Power Systems | Open Energy Information

    Open Energy Info (EERE)

    Sector: Buildings, Solar Product: Start-up planning to install parabolic concentrated solar collector systems on large flat-roofed buildings to power their HVAC systems, and...

  10. NSL Power Ltd | Open Energy Information

    Open Energy Info (EERE)

    set up to develop, generate and transmit electricity by setting up power plants based on renewable energies, hydel energy and thermal energy. Coordinates: 17.6726, 77.5971...

  11. Georgia Power- Energy Efficiency Home Improvement Rebates

    Broader source: Energy.gov [DOE]

    Georgia Power offers up to $2,575 in rebates to customers who choose to improve home performance with whole building BPI certified efficiency measures or up to $700 for individual improvements from...

  12. Structural power flow measurement

    SciTech Connect (OSTI)

    Falter, K.J.; Keltie, R.F.

    1988-12-01

    Previous investigations of structural power flow through beam-like structures resulted in some unexplained anomalies in the calculated data. In order to develop structural power flow measurement as a viable technique for machine tool design, the causes of these anomalies needed to be found. Once found, techniques for eliminating the errors could be developed. Error sources were found in the experimental apparatus itself as well as in the instrumentation. Although flexural waves are the carriers of power in the experimental apparatus, at some frequencies longitudinal waves were excited which were picked up by the accelerometers and altered power measurements. Errors were found in the phase and gain response of the sensors and amplifiers used for measurement. A transfer function correction technique was employed to compensate for these instrumentation errors.

  13. Power Cube Pvt Ltd PCPL | Open Energy Information

    Open Energy Info (EERE)

    Power Cube Pvt Ltd PCPL Jump to: navigation, search Name: Power Cube Pvt. Ltd. (PCPL) Place: Uttar Pradesh, India Sector: Solar Product: Plans to set up solar power projects in...

  14. Water Power

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 - Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel Cycle Defense Waste Management Programs Advanced Nuclear Energy Nuclear

  15. Water Power

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 - Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel Cycle Defense Waste Management Programs Advanced Nuclear Energy Nuclear

  16. Wind Power

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Wind Power As the accompanying map of New Mexico shows, the best wind power generation potential near WIPP is along the Delaware Mountain ridge line of the southern Guadalupe Mountains, about 50-60 miles southwest. The numeric grid values indicate wind potential, with a range from 1 (poor) to 7 (superb). Just inside Texas in the southern Guadalupe Mountains, the Delaware Mountain Wind Power Facility in Culbertson County, Texas currently generates over 30 MW, and could be expanded to a 250 MW

  17. Power LCAT

    SciTech Connect (OSTI)

    Drennen, Thomas

    2012-08-15

    POWER LCAT is a software tool used to compare elements of efficiency, cost, and environmental effects between different sources of energy.

  18. Power LCAT

    ScienceCinema (OSTI)

    Drennen, Thomas

    2014-06-27

    POWER LCAT is a software tool used to compare elements of efficiency, cost, and environmental effects between different sources of energy.

  19. Power system

    DOE Patents [OSTI]

    Hickam, Christopher Dale

    2008-03-18

    A power system includes a prime mover, a transmission, and a fluid coupler having a selectively engageable lockup clutch. The fluid coupler may be drivingly connected between the prime mover and the transmission. Additionally, the power system may include a motor/generator drivingly connected to at least one of the prime mover and the transmission. The power-system may also include power-system controls configured to execute a control method. The control method may include selecting one of a plurality of modes of operation of the power system. Additionally, the control method may include controlling the operating state of the lockup clutch dependent upon the mode of operation selected. The control method may also include controlling the operating state of the motor/generator dependent upon the mode of operation selected.

  20. Switching power supply

    DOE Patents [OSTI]

    Mihalka, A.M.

    1984-06-05

    The invention is a repratable capacitor charging, switching power supply. A ferrite transformer steps up a dc input. The transformer primary is in a full bridge configuration utilizing power MOSFETs as the bridge switches. The transformer secondary is fed into a high voltage, full wave rectifier whose output is connected directly to the energy storage capacitor. The transformer is designed to provide adequate leakage inductance to limit capacitor current. The MOSFETs are switched to the variable frequency from 20 to 50 kHz to charge a capacitor from 0.6 kV. The peak current in a transformer primary and secondary is controlled by increasing the pulse width as the capacitor charges. A digital ripple counter counts pulses and after a preselected desired number is reached an up-counter is clocked.

  1. Missouri School District Charges Up

    Broader source: Energy.gov [DOE]

    Missouri's Lee's Summit R-7 school district's distribution fleet was tired. Many of the vehicles had racked up more than 300,000 miles and made frequent trips to the shop to repair the 20 plus-year-old parts.

  2. Sign Up for GC Updates

    Broader source: Energy.gov [DOE]

    The Office of the General Counsel maintains listservs and RSS feeds to keep the public up to date about recent actions and legal guidance. Please subscribe to these resources by following the...

  3. Sign Up For Email Updates

    Broader source: Energy.gov [DOE]

    Be the first to know of the latest developments from the Energy.gov team -- from videos to infographics to live Q&A’s -- by signing up for email updates.

  4. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    About this site This Web site is the official Web site of the Southwestern Power Administration. It is part of a Federal computer system used to accomplish Federal functions and is monitored for security purposes to ensure it remains available to all users and to protect information in the system. By accessing this Web site, you are expressly consenting to these monitoring activities. Accessibility Southwestern is committed to providing the most up-to-date, relevant information to its

  5. Wind Power Outlook 2004

    SciTech Connect (OSTI)

    anon.

    2004-01-01

    The brochure, expected to be updated annually, provides the American Wind Energy Association's (AWAE's) up-to-date assessment of the wind industry. It provides a summary of the state of wind power in the U.S., including the challenges and opportunities facing the industry. It provides summary information on the growth of the industry, policy-related factors such as the federal wind energy production tax credit status, comparisons with natural gas, and public views on wind energy.

  6. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Changing Utility Industry Prompts Realignment of Resources With the onset of energy markets, increased regulation, clean energy trends, and efforts to modernize the transmission grid, the utility industry is being challenged to keep up. According to Southwestern Power Administration (Southwestern) Administrator Chris Turner, Southwestern, too, has found itself responding to meet the challenges of a shifting business environment. Organizational Realignment "Our people are our greatest

  7. Power line detection system

    DOE Patents [OSTI]

    Latorre, V.R.; Watwood, D.B.

    1994-09-27

    A short-range, radio frequency (RF) transmitting-receiving system that provides both visual and audio warnings to the pilot of a helicopter or light aircraft of an up-coming power transmission line complex. Small, milliwatt-level narrowband transmitters, powered by the transmission line itself, are installed on top of selected transmission line support towers or within existing warning balls, and provide a continuous RF signal to approaching aircraft. The on-board receiver can be either a separate unit or a portion of the existing avionics, and can also share an existing antenna with another airborne system. Upon receipt of a warning signal, the receiver will trigger a visual and an audio alarm to alert the pilot to the potential power line hazard. 4 figs.

  8. Power line detection system

    DOE Patents [OSTI]

    Latorre, Victor R.; Watwood, Donald B.

    1994-01-01

    A short-range, radio frequency (RF) transmitting-receiving system that provides both visual and audio warnings to the pilot of a helicopter or light aircraft of an up-coming power transmission line complex. Small, milliwatt-level narrowband transmitters, powered by the transmission line itself, are installed on top of selected transmission line support towers or within existing warning balls, and provide a continuous RF signal to approaching aircraft. The on-board receiver can be either a separate unit or a portion of the existing avionics, and can also share an existing antenna with another airborne system. Upon receipt of a warning signal, the receiver will trigger a visual and an audio alarm to alert the pilot to the potential power line hazard.

  9. solar power

    National Nuclear Security Administration (NNSA)

    9%2A en Solar power purchase for DOE laboratories http:nnsa.energy.govmediaroompressreleasessolarpower

  10. Water Power

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Water Power DOE Wind & Waterpower Technologies Office Director, Jose Zayas, addresses crowd at Waterpower Week [photo courtesy of the National Hydro Association] Permalink Gallery Sandia Labs participates in DOE's annual Waterpower Week News, News & Events, Renewable Energy, Uncategorized, Water Power Sandia Labs participates in DOE's annual Waterpower Week During the last week of April, Sandia National Laboratories participated in the National Hydropower Association Waterpower Week in

  11. Power combiner

    DOE Patents [OSTI]

    Arnold, Mobius; Ives, Robert Lawrence

    2006-09-05

    A power combiner for the combining of symmetric and asymmetric traveling wave energy comprises a feed waveguide having an input port and a launching port, a reflector for reflecting launched wave energy, and a final waveguide for the collection and transport of launched wave energy. The power combiner has a launching port for symmetrical waves which comprises a cylindrical section coaxial to the feed waveguide, and a launching port for asymmetric waves which comprises a sawtooth rotated about a central axis.

  12. 2009 News | Concentrating Solar Power | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9 News Below are news stories related to Concentrating Solar Power. RSS Learn about RSS. October 21, 2009 Solar Technology Acceleration Center is Powering Up Members of the Solar Technology Acceleration Center (SolarTAC) and supporters convened in Aurora, Colo., today, to mark a milestone in "Powering Up" one of the world's largest solar test and demonstration facilities. Since announcing the initial launch of SolarTAC one year ago, the site infrastructure development has progressed to

  13. Diesel prices up this week

    U.S. Energy Information Administration (EIA) Indexed Site

    Diesel prices up this week The U.S. average retail price for on-highway diesel fuel rose sharply to $4.10 a gallon on Monday. That's up 8.2 cents from a week ago and 17.7 cents from two weeks ago, based on the weekly price survey by the U.S. Energy Information Administration. Prices rose by 3 cents from last week in the New England region and by 10 cents in the West Coast states bringing the highest average prices at 4.27 a gallon in both regions. Prices were lowest in the Rocky Mountain States

  14. Setting Up Your User Environment

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Setting Up Your User Environment Setting Up Your User Environment PDSF Defined Environment When new users are added to the PDSF machines, the login shell is set according to the user's request. You can choose between csh, tcsh, or bash. You can change your startup shell by logging into NIM. Paths and environment variables are controlled by startup files (also known as dot files). On PDSF the startup files are symbolic links to read-only files that NERSC controls (if they are not, see the

  15. Power applications of high-temperature superconductivity: Variable speed motors, current switches, and energy storage for end use

    SciTech Connect (OSTI)

    Hawsey, R.A. [Oak Ridge National Lab., TN (United States); Banerjee, B.B.; Grant, P.M. [Electric Power Research Inst., Palo Alto, CA (United States)

    1996-08-01

    The objective of this project is to conduct joint research and development activities related to certain electric power applications of high-temperature superconductivity (HTS). The new superconductors may allow development of an energy-efficient switch to control current to variable speed motors, superconducting magnetic energy storage (SMES) systems, and other power conversion equipment. Motor types that were considered include induction, permanent magnet, and superconducting ac motors. Because it is impractical to experimentally alter certain key design elements in radial-gap motors, experiments were conducted on an axial field superconducting motor prototype using 4 NbTi magnets. Superconducting magnetic energy storage technology with 0.25--5 kWh stored energy was studied as a viable solution to short duration voltage sag problems on the customer side of the electric meter. The technical performance characteristics of the device wee assembled, along with competing technologies such as active power line conditioners with storage, battery-based uninterruptible power supplies, and supercapacitors, and the market potential for SMES was defined. Four reports were prepared summarizing the results of the project.

  16. Power inverters

    DOE Patents [OSTI]

    Miller, David H.; Korich, Mark D.; Smith, Gregory S.

    2011-11-15

    Power inverters include a frame and a power module. The frame has a sidewall including an opening and defining a fluid passageway. The power module is coupled to the frame over the opening and includes a substrate, die, and an encasement. The substrate includes a first side, a second side, a center, an outer periphery, and an outer edge, and the first side of the substrate comprises a first outer layer including a metal material. The die are positioned in the substrate center and are coupled to the substrate first side. The encasement is molded over the outer periphery on the substrate first side, the substrate second side, and the substrate outer edge and around the die. The encasement, coupled to the substrate, forms a seal with the metal material. The second side of the substrate is positioned to directly contact a fluid flowing through the fluid passageway.

  17. Cleco Power- Power Miser New Home Program

    Broader source: Energy.gov [DOE]

    Louisiana's Cleco Power offers energy efficiency incentives to eligible customers. Cleco Power offers a rate discount for residential customers building homes that meet the Power Miser Program...

  18. NREL's Energy Systems Integration Facility Garners LEED® Platinum...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    power to run the data center facility (IT equipment, lighting, HVAC, uninterruptible power supply systems, etc.) to the total power drawn by all IT equipment. "ESIF is a ...

  19. Fusion Power

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Power www.pppl.gov FACT SHEET FUSION POWER Check us out on YouTube. http://www.youtube.com/ppplab Find us on Facebook. http://www.facebook.com/PPPLab Follow us on Twitter. @PPPLab Access our RSS feed @PPPLab Deuterium Electron Proton Hydrogen Tritium Neutron For centuries, the way in which the sun and stars produce their energy remained a mystery to man. During the twentieth century, scientists discovered that they produce their energy by the fusion process. E=mc 2 , Albert Einstein's familiar

  20. DOE Seeks to Invest up to $60 Million for Advanced Concentrating Solar

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Power Technologies | Department of Energy 60 Million for Advanced Concentrating Solar Power Technologies DOE Seeks to Invest up to $60 Million for Advanced Concentrating Solar Power Technologies April 30, 2008 - 11:31am Addthis WASHINGTON - U.S. Under Secretary of Energy Clarence "Bud" Albright today announced the issuance of the Solar Funding Opportunity Announcement (FOA) for up to $60 million in funding over five years (Fiscal Years 2008-2012), which includes $10 million in FY

  1. Star Power

    SciTech Connect (OSTI)

    2014-10-17

    The U.S. Department of Energy's Princeton Plasma Physics Laboratory has released ''Star Power,'' a new informational video that uses dramatic and beautiful images and thought-provoking interviews to highlight the importance of the Laboratory's research into magnetic fusion.

  2. Star Power

    ScienceCinema (OSTI)

    None

    2014-11-18

    The U.S. Department of Energy's Princeton Plasma Physics Laboratory has released ''Star Power,'' a new informational video that uses dramatic and beautiful images and thought-provoking interviews to highlight the importance of the Laboratory's research into magnetic fusion.

  3. PowerPoint Presentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Industry Reliability: Automotive Power Module Perspective Zhenxian Liang R&D Staff Power ... Power Module Packaging * High Reliability Power Module Packaging Packaging ...

  4. Power Systems Development Facility

    SciTech Connect (OSTI)

    2003-07-01

    This report discusses Test Campaign TC12 of the Kellogg Brown & Root, Inc. (KBR) Transport Gasifier train with a Siemens Westinghouse Power Corporation (SW) particle filter system at the Power Systems Development Facility (PSDF) located in Wilsonville, Alabama. The Transport Gasifier is an advanced circulating fluidized-bed reactor designed to operate as either a combustor or a gasifier using a particulate control device (PCD). While operating as a gasifier, either air or oxygen can be used as the oxidant. Test run TC12 began on May 16, 2003, with the startup of the main air compressor and the lighting of the gasifier start-up burner. The Transport Gasifier operated until May 24, 2003, when a scheduled outage occurred to allow maintenance crews to install the fuel cell test unit and modify the gas clean-up system. On June 18, 2003, the test run resumed when operations relit the start-up burner, and testing continued until the scheduled end of the run on July 14, 2003. TC12 had a total of 733 hours using Powder River Basin (PRB) subbituminous coal. Over the course of the entire test run, gasifier temperatures varied between 1,675 and 1,850 F at pressures from 130 to 210 psig.

  5. Power superconducting power transmission cable

    DOE Patents [OSTI]

    Ashworth, Stephen P.

    2003-01-01

    The present invention is for a compact superconducting power transmission cable operating at distribution level voltages. The superconducting cable is a conductor with a number of tapes assembled into a subconductor. These conductors are then mounted co-planarly in an elongated dielectric to produce a 3-phase cable. The arrangement increases the magnetic field parallel to the tapes thereby reducing ac losses.

  6. Power superconducting power transmission cable

    DOE Patents [OSTI]

    Ashworth, Stephen P.

    2003-06-10

    The present invention is for a compact superconducting power transmission cable operating at distribution level voltages. The superconducting cable is a conductor with a number of tapes assembled into a subconductor. These conductors are then mounted co-planarly in an elongated dielectric to produce a 3-phase cable. The arrangement increases the magnetic field parallel to the tapes thereby reducing ac losses.

  7. Power supply

    DOE Patents [OSTI]

    Hart, Edward J.; Leeman, James E.; MacDougall, Hugh R.; Marron, John J.; Smith, Calvin C.

    1976-01-01

    An electric power supply employs a striking means to initiate ferroelectric elements which provide electrical energy output which subsequently initiates an explosive charge which initiates a second ferroelectric current generator to deliver current to the coil of a magnetic field current generator, creating a magnetic field around the coil. Continued detonation effects compression of the magnetic field and subsequent generation and delivery of a large output current to appropriate output loads.

  8. Western Area Power Administration

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ,v*Zy- i , . r ,v * -i S # Af [, (e- . - o -A tl }r- 0 v-" l^~4~S J l ^-)^ I^U^ck iM clti ^ <p< ^^i~oeii ^' Western Area Power Administration Follow-up to Nov. 25, 2008 Transition Meeting Undeveloped Transmission Right-of-Way Western has very little undeveloped transmission right-of-way. There is a 7-mile right- of-way between Folsom, CA and Roseville, CA where Western acquired a 250' wide right-of-way but is only using half of it. Another line could be built parallel to Western's

  9. Advanced, High Power, Next Scale, Wave Energy Conversion Device

    SciTech Connect (OSTI)

    Hart, Philip R.

    2011-09-27

    This presentation from the Water Peer Review highlights one of the program's marine and hyrokinetics device design projects to scale up the current Ocean Power Technology PowerBuoy from 150kW to 500kW.

  10. Kahuku Wind Power Biological Opinion | Department of Energy

    Energy Savers [EERE]

    KITSAP COUNTY POWERS UP WITH ENERGY EFFICIENCY KITSAP COUNTY POWERS UP WITH ENERGY EFFICIENCY KITSAP COUNTY POWERS UP WITH ENERGY EFFICIENCY To establish a market for energy efficiency upgrades in Kitsap County, Washington, the Washington Department of Commerce needed to address barriers including an untrained contractor network, a weak economy that left homeowners hesitant to take on debt, and overlapping utility service territories that made energy efficiency incentives overly complex. To

  11. Loveland Water & Power- Refrigerator Recycling Program

    Broader source: Energy.gov [DOE]

    Loveland Water & Power is providing an incentive for customers to recycle older, working refrigerators. Interested customers can call the utility to arrange a time to pick up the old...

  12. PowerSaver Loans | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Loans PowerSaver loans, which are backed by the Federal Housing Administration (FHA), offer homeowners up to 25,000 to make energy efficiency improvements such as installing...

  13. Combined Heat and Power Loan Program

    Broader source: Energy.gov [DOE]

    CHP technologies are eligible for either a grant, loan or power purchase incentive under the initial round of solicitations for new renewable energy generating equipment  up to five megawatts at ...

  14. Combined Heat and Power Grant Program

    Broader source: Energy.gov [DOE]

    CHP technologies are eligible for either a grant, loan or power purchase incentive under the initial round of solicitations for new renewable energy generating equipment  up to five megawatts at ...

  15. Back-Up/ Peak Shaving Fuel Cell System

    SciTech Connect (OSTI)

    Staudt, Rhonda L.

    2008-05-28

    This Final Report covers the work executed by Plug Power from 8/11/03 10/31/07 statement of work for Topic 2: advancing the state of the art of fuel cell technology with the development of a new generation of commercially viable, stationary, Back-up/Peak-Shaving fuel cell systems, the GenCore II. The Program cost was $7.2 M with the Department of Energy share being $3.6M and Plug Powers share being $3.6 M. The Program started in August of 2003 and was scheduled to end in January of 2006. The actual program end date was October of 2007. A no cost extension was grated. The Department of Energy barriers addressed as part of this program are: Technical Barriers for Distributed Generation Systems: o Durability o Power Electronics o Start up time Technical Barriers for Fuel Cell Components: o Stack Material and Manufacturing Cost o Durability o Thermal and water management Background The next generation GenCore backup fuel cell system to be designed, developed and tested by Plug Power under the program is the first, mass-manufacturable design implementation of Plug Powers GenCore architected platform targeted for battery and small generator replacement applications in the telecommunications, broadband and UPS markets. The next generation GenCore will be a standalone, H2 in-DC-out system. In designing the next generation GenCore specifically for the telecommunications market, Plug Power is teaming with BellSouth Telecommunications, Inc., a leading industry end user. The final next generation GenCore system is expected to represent a market-entry, mass-manufacturable and economically viable design. The technology will incorporate: A cost-reduced, polymer electrolyte membrane (PEM) fuel cell stack tailored to hydrogen fuel use An advanced electrical energy storage system A modular, scalable power conditioning system tailored to market requirements A scaled-down, cost-reduced balance of plant (BOP) Network Equipment Building Standards (NEBS), UL and CE certifications.

  16. Shanghai Wind Power Company SWPC | Open Energy Information

    Open Energy Info (EERE)

    SWPC Jump to: navigation, search Name: Shanghai Wind Power Company (SWPC) Place: Shanghai, Shanghai Municipality, China Sector: Wind energy Product: It is set up for running the...

  17. GI Power Corporation Limited GIPCL | Open Energy Information

    Open Energy Info (EERE)

    New Delhi, Delhi (NCT), India Zip: 110020 Sector: Wind energy Product: Delhi-based start-up wind project developer. References: GI Power Corporation Limited (GIPCL)1 This...

  18. Microsoft PowerPoint - 5-Reindustrialization Meeting May 2014...

    Office of Legacy Management (LM)

    ... & Target Acquisition Optical Systems Night Vision Thermal Weapon Sights Optical Solar Reflectors And Cover Glasses Head Up Display Optics Helmet Mounted Displays HV Power ...

  19. Power optics

    SciTech Connect (OSTI)

    Apollonov, V V

    2014-02-28

    By using the theory we developed in the early 1970s, a broad range of phenomena is considered for an optical surface of a solid body that is exposed to radiation arbitrarily varying in time and producing temperature fields, thermoelastic stresses and thermal deformations on the surface layer. The examination is based on the relations (which are similar to Duhamel's integral formula from the theory of heat conduction) between the quantities characterising the thermal stress state in any nonstationary regimes of energy input into a solid. A peculiar feature of the analysis of the thermal stress state in this case consists in the fact that this relation comprises time as a parameter, which in turn is a consequence of incoherence of the quasi-stationary problem of thermoelasticity. This phenomenon is particularly important for the optics of high-power, high-pulse repetition rate lasers, which are being actively developed. In the review, we have recently published in Laser Physics, the thermal stress state of a solid is analysed. In this state, time is treated as an independent variable used in differentiation. Such an approach greatly reduces the applicability of the method. The review published contains data on the use of capillary porous structures made of various materials with different degrees of the surface development. Moreover, such structures can be efficiently employed to increase the heat exchange at a temperature below the boiling point of the coolant. In the present review we discuss the dependences of the limiting laser intensities on the duration of a pulse or a pulse train, corresponding to the three stages of the state of the reflecting surface and leading to unacceptable elastic deformations of the surface, to the plastic yield of the material accompanied by the formation of residual stresses and to the melting of the surface layer. We also analyse the problem of heat exchange in the surface layer with a liquid metal coolant pumped through it. The theoretical estimates are compared with the experimental data. We discuss the issues related to the technology of fabrication of power optics elements based on materials with a porous structure, of lightweight highly stable large optics based on highly porous materials, multi-layer honeycomb structures and silicon carbide, as well as problems of application of physical and technical fundamentals of power optics in modern cutting-edge technology. (invited paper)

  20. Greening up fossil fuels with carbon sequestration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Greening up fossil fuels with carbon sequestration 1663 Los Alamos science and technology magazine Latest Issue:October 2015 past issues All Issues submit Greening up fossil...

  1. Burbank Water and Power- Residential and Commercial Solar Support Program

    Broader source: Energy.gov [DOE]

    Burbank Water and Power (BWP) offers customers an up-front capacity-based rebate for photovoltaic (PV) systems up to 30 kW. These incentives decline over time as defined capacity goals are met, e...

  2. POWER REACTOR

    DOE Patents [OSTI]

    Zinn, W.H.

    1958-07-01

    A fast nuclear reactor system ls described for producing power and radioactive isotopes. The reactor core is of the heterogeneous, fluid sealed type comprised of vertically arranged elongated tubular fuel elements having vertical coolant passages. The active portion is surrounded by a neutron reflector and a shield. The system includes pumps and heat exchangers for the primary and secondary coolant circuits. The core, primary coolant pump and primary heat exchanger are disposed within an irapenforate tank which is filled with the primary coolant, in this case a liquid metal such as Na or NaK, to completely submerge these elements. The tank is completely surrounded by a thick walled concrete shield. This reactor system utilizes enriched uranium or plutonium as the fissionable material, uranium or thorium as a diluent and thorium or uranium containing less than 0 7% of the U/sup 235/ isotope as a fertile material.

  3. Power oscillator

    DOE Patents [OSTI]

    Gitsevich, Aleksandr

    2001-01-01

    An oscillator includes an amplifier having an input and an output, and an impedance transformation network connected between the input of the amplifier and the output of the amplifier, wherein the impedance transformation network is configured to provide suitable positive feedback from the output of the amplifier to the input of the amplifier to initiate and sustain an oscillating condition, and wherein the impedance transformation network is configured to protect the input of the amplifier from a destructive feedback signal. One example of the oscillator is a single active element device capable of providing over 70 watts of power at over 70% efficiency. Various control circuits may be employed to match the driving frequency of the oscillator to a plurality of tuning states of the lamp.

  4. Science up to 100 tesla

    SciTech Connect (OSTI)

    Campbell, L.J. [Los Alamos National Lab., NM (United States). National High Magnetic Field Lab.

    1995-05-01

    100 Tesla is the highest attainable field that can be held for milli-sec in a non-destructive magnet. The strongest steels turn soft under stresses of 4GPa, which is the magnetic pressure of 100 T. Until there is a breakthrough in materials, magnets having all the low temperature and high pressure trimmings will be limited to about 100 T. Within the field range 1-100 T far more resources are now devoted to producing the highest possible continuous fields (40+5 T) than to producing longer pulsed fields above 50 T. This illustrates that the utility of the field can be more important than the strength of the field to researchers in condensed matter. Discoveries are typically made in new territory, but this can be new combinations of pressure, temperature, and magnetic field, or new probes and new materials. If any activity has kept up with the proliferation of new experiments and new facilities in high magnetic field research it is the listing of experiments that could and should be done in high fields. Part of the reason for the vitality of high field research is that high fields provide a generic environment. Compared to particle accelerators and plasma machines a high field laboratory is a setting for generic science, like synchrotron light sources or neutron scattering centers. Although the latter two installations probes states, while a magnetic field creates a state. Because it is unrealistic to try to list all the science opportunities at high fields, the author list sources for lists in the public domain and gives a few examples.

  5. SunShot Concentrating Solar Power Research

    Broader source: Energy.gov [DOE]

    "This fact sheet summarizes DOE's SunShot Concentrating Solar Power Research and Development program. In 2012, the program's 21 projects were awarded more than $54 million to address the technical barriers for solar fields, receivers, and power plants. By innovating the next generation of CSP technologies, this program will lead to subsequent system integration, engineering scale-up, and eventual commercial production."

  6. Pv-Thermal Solar Power Assembly

    DOE Patents [OSTI]

    Ansley, Jeffrey H.; Botkin, Jonathan D.; Dinwoodie, Thomas L.

    2001-10-02

    A flexible solar power assembly includes a flexible photovoltaic device attached to a flexible thermal solar collector. The solar power assembly can be rolled up for transport and then unrolled for installation on a surface, such as the roof or side wall of a building or other structure, by use of adhesive and/or other types of fasteners.

  7. Power Technologies Energy Data Book - Fourth Edition

    SciTech Connect (OSTI)

    Aabakken, J.

    2006-08-01

    This report, prepared by NREL's Strategic Energy Analysis Center, includes up-to-date information on power technologies, including complete technology profiles. The data book also contains charts on electricity restructuring, power technology forecasts, electricity supply, electricity capability, electricity generation, electricity demand, prices, economic indicators, environmental indicators, and conversion factors.

  8. Presentation title: This can be up to 2 lines

    U.S. Energy Information Administration (EIA) Indexed Site

    Office of Electricity, Coal, Nuclear, and Renewables Analysis December 7, 2015 | Washington, DC Working Group Meeting on Handling Renewable Electricity and Key Model Updates in AEO2016 Highlights for AEO 2016 2 Working Group Meeting on Renewable Electricity in AEO2016 Policy and Assumptions December 7, 2015 * EPA's Clean Power Plan rule is final - Representing this final rule will be a significant model development effort * Updating capital costs - We will conduct follow-up meetings as

  9. PowerPoint Presentation

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... for solar power, hydropower, wind power, fuel cells, biofuels, fracking, hybrid cars, geothermal energy, and the power grid * Educator portal being added this fall * ...

  10. Power management system

    DOE Patents [OSTI]

    Algrain, Marcelo C.; Johnson, Kris W.; Akasam, Sivaprasad; Hoff, Brian D.

    2007-10-02

    A method of managing power resources for an electrical system of a vehicle may include identifying enabled power sources from among a plurality of power sources in electrical communication with the electrical system and calculating a threshold power value for the enabled power sources. A total power load placed on the electrical system by one or more power consumers may be measured. If the total power load exceeds the threshold power value, then a determination may be made as to whether one or more additional power sources is available from among the plurality of power sources. At least one of the one or more additional power sources may be enabled, if available.

  11. Northwest, the Bonneville Power

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    voltage power lines that move large amounts of power from hydroelectric projects and power plants to urban centers hundreds of miles away. To keep the electricity flowing safely...

  12. Water Power Information Resources | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Water Power Information Resources Water Power Information Resources How Hydropower Works How Hydropower Works See a detailed view of the inside of a hydropower energy generation system. Read more Marine and Hydrokinetic Technology Database on OpenEI Marine and Hydrokinetic Technology Database on OpenEI The DOE Marine and Hydrokinetic Technology Database provides up-to-date information on marine and hydrokinetic renewable energy. Read more The following resources about water power technologies

  13. Is there a source of help for setting up real time wind turbine...

    Open Energy Info (EERE)

    Is there a source of help for setting up real time wind turbine data reporting ? Home I'd like our students to be able to see historical data as well as real time power generation...

  14. Sign up to find out what's next for SunShot | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Sign up to find out how the SunShot Initiative is helping prepare the country for a solar-powered future. Enter your email address here: Subscribe After subscribing, you will ...

  15. DOE Selects Projects for Up to $7.3 Million for R&D Clean Technology...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Power Projects September 18, 2008 - 3:43pm Addthis WASHINGTON - The U.S. Department of Energy (DOE) today announced the selection of projects for negotiation of award of up to 7.3...

  16. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  17. Wireless Power Transfer

    SciTech Connect (OSTI)

    2013-07-22

    Wireless Power Transfer is an innovative approach using magnetic resonance coupling of air core transformers designed for today's growing plug-in electric vehicle market. This technology can provide a convenient, safe and flexible means to charge electric vehicles under stationary and dynamic conditions. Plug-in Electric Vehicles (PEV) are burdened by the need for cable and plug charger, galvanic isolation of the on-board electronics, bulk and cost of this charger and the large energy storage system (ESS) packs needed. With a system where you have to physically plug in there are a number of occasions where the owner could very well forget to charge the vehicle. For stationary applications (like charging of a PHEV at home), ORNL's innovative wireless power transfer technology adds a convenience factor compared to actually plugging in which will mean that the vehicle will have a full charge every morning. Electric vehicle charging must be safe, compact and efficient in order to be convenient for customers. By reconfiguring the transformer and altering the resonance frequency, energy is transferred to the battery with lower energy losses and with fewer demands on the primary circuit by the rest of the transformer system. The ORNL discovery shows that sufficient power for the battery can be transferred from the primary to secondary circuits without significant energy losses if the operating frequency is set at 50% to 95% of the resonance frequency of the circuit. The electrical power is then transmitted to the chargeable battery, which is electrically coupled to the secondary circuit through the air core transformer. Some advantages include: Reduced energy losses during transfer of energy to the battery; A charge potential that is relatively unaffected by up to 25% misalignment of vehicle; and Other receiving components draw less power from the primary circuit. These advantages allow wireless power technology applications to expand at the workplace and beyond as the demand for EV rises. For vehicles that operate over a fixed route such as busses and shuttle vehicles, Wireless Power Transfer (WPT) means that a smaller battery pack can be used. In the traditional system, the battery pack is designed to accommodate the needs of the entire route or shift. With WPT the battery can be downsized because it can be charged when the vehicle stops on its route (a rental car shuttle bus, for example, can charge when it waits in the terminal and again when it waits at the rental car place. Thus the battery only needs enough charge to get to the next stop. This decrease in battery size means significant cost savings to electrify the vehicle. This technology enables efficient "opportunity charging stations" for predefined routes and planned stops reducing down time. Charging can occur in minutes. This improvement also eliminates the harmful emissions that occur in garages while buses are at idle during charging. In larger cities, dynamic charging offers an even greater impact utilizing existing infrastructure. As vehicles travel along busy freeways and interstate systems, wireless charging can occur while the vehicle is in motion. With this technology a vehicle essentially has unlimited electric range while using a relatively small battery pack. In-motion charging stations use vehicle sensors to alert the driver. Traveling at normal speeds, sensors establish in-motion charging. WPT transmit pads sequentially energize to the negotiated power level based on vehicle speed and its requested charging energy. Lower power when vehicle speed is slow and much higher power for faster moving vehicles. Vehicle to Infrastructure communications (V2I) coordinates WPT charging level according to on-board battery pack state-of-charge. V2I activates the roadway transmit pads placing them in standby mode and negotiates charging fee based on prevailing grid rate and vehicle energy demand. Dynamic charging would allow electricity to supply a very large fraction of the energy for the transportation sector and reduce greatly petroleum consump

  18. Long pulse EBW start-up experiments in MAST

    SciTech Connect (OSTI)

    Shevchenko, V. F.; Baranov, Y. F.; Bigelow, T.; Caughman, J. B.; Diem, S.; Dukes, C.; Finburg, P.; Hawes, J.; Gurl, C.; Griffiths, J.; Mailloux, J.; Peng, M.; Saveliev, A. N.; Takase, Y.; Tanaka, H.; Taylor, G.

    2015-03-12

    Start-up technique reported here relies on a double mode conversion (MC) for electron Bernstein wave (EBW) excitation. It consists of MC of the ordinary (O) mode, entering the plasma from the low field side of the tokamak, into the extraordinary (X) mode at a mirror-polarizer located at the high field side. The X mode propagates back to the plasma, passes through electron cyclotron resonance (ECR) and experiences a subsequent X to EBW MC near the upper hybrid resonance (UHR). Finally the excited EBW mode is totally absorbed at the Doppler shifted ECR. The absorption of EBW remains high even in cold rarefied plasmas. Furthermore, EBW can generate significant plasma current giving the prospect of a fully solenoid-free plasma start-up. First experiments using this scheme were carried out on MAST [1]. Plasma currents up to 33 kA have been achieved using 28 GHz 100kW 90ms RF pulses. Recently experimental results were extended to longer RF pulses showing further increase of plasma currents generated by RF power alone. A record current of 73kA has been achieved with 450ms RF pulse of similar power. The current drive enhancement was mainly achieved due to RF pulse extension and further optimisation of the start-up scenario.

  19. Long pulse EBW start-up experiments in MAST

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Shevchenko, V. F.; Baranov, Y. F.; Bigelow, T.; Caughman, J. B.; Diem, S.; Dukes, C.; Finburg, P.; Hawes, J.; Gurl, C.; Griffiths, J.; et al

    2015-03-12

    Start-up technique reported here relies on a double mode conversion (MC) for electron Bernstein wave (EBW) excitation. It consists of MC of the ordinary (O) mode, entering the plasma from the low field side of the tokamak, into the extraordinary (X) mode at a mirror-polarizer located at the high field side. The X mode propagates back to the plasma, passes through electron cyclotron resonance (ECR) and experiences a subsequent X to EBW MC near the upper hybrid resonance (UHR). Finally the excited EBW mode is totally absorbed at the Doppler shifted ECR. The absorption of EBW remains high even inmore » cold rarefied plasmas. Furthermore, EBW can generate significant plasma current giving the prospect of a fully solenoid-free plasma start-up. First experiments using this scheme were carried out on MAST [1]. Plasma currents up to 33 kA have been achieved using 28 GHz 100kW 90ms RF pulses. Recently experimental results were extended to longer RF pulses showing further increase of plasma currents generated by RF power alone. A record current of 73kA has been achieved with 450ms RF pulse of similar power. The current drive enhancement was mainly achieved due to RF pulse extension and further optimisation of the start-up scenario.« less

  20. WINDExchange: Buying Wind Power

    Wind Powering America (EERE)

    Buying Wind Power Individuals, communities, businesses, and government entities may decide that buying wind power to supply their energy needs is the right fit. There are several ways to purchase wind power. Green Power Marketing Green power marketing refers to green power being offered by multiple suppliers in a competitive marketplace. In states that have established retail competition, customers may be able to purchase green power from a competitive supplier. Learn more about green power

  1. Concentrating Solar Power

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power ... Sciences Applications National Solar Thermal Test Facility Nuclear Energy ...

  2. Federal Power Act section 202(c) - California, December 2000 | Department

    Energy Savers [EERE]

    Federal On-Site Renewable Power Purchase Agreements Federal On-Site Renewable Power Purchase Agreements Federal On-Site Renewable Power Purchase Agreements On-site renewable power purchase agreements (PPAs) allow federal agencies to fund renewable energy projects with minimal up-front capital costs incurred. With a PPA, a developer installs a renewable energy system on agency property under an agreement that the agency will purchase the power generated by the system. The agency pays for the

  3. Microsoft PowerPoint - 3 Dave Esh

    Office of Environmental Management (EM)

    of Energy 2009.10.27 Bridge Inspection Follow-up Microsoft PowerPoint - 2009.10.27 Bridge Inspection Follow-up PDF icon Microsoft PowerPoint - 2009.10.27 Bridge Inspection Follow-up More Documents & Publications Slide 1 Slide 1 Microsoft Word - Issue FY2009 Q4 Draft 20090910.doc

    Asset Revitalization Initiative Goals, Task Force, and Deliverables Tania Smith, DOE-EM ARI Task Force Leader February 2013 ARI Mission The Asset Revitalization Initiative (ARI) is a U.S. Department of Energy

  4. Power Right. Power Smart. Efficient Computer Power Supplies and Monitors.

    Broader source: Energy.gov [DOE]

    Learn about energy-efficient power supplies that can help you reduce energy consumption and lower your energy costs.

  5. Elimination of direct current distribution systems from new generating stations

    SciTech Connect (OSTI)

    Jancauskas, J.R.

    1996-12-31

    This paper advances the concept that it may be both possible and advantageous to eliminate the traditional direct current distribution system from a new generating station. The latest developments in uninterruptible power supply (UPS) technology are what have made this option technically feasible. A traditional dc distribution system will be compared to an ac distribution system supplied by a UPS to investigate the merits of the proposed approach.

  6. Wave Power Demonstration Project at Reedsport, Oregon

    SciTech Connect (OSTI)

    Mekhiche, Mike; Downie, Bruce

    2013-10-21

    Ocean wave power can be a significant source of large‐scale, renewable energy for the US electrical grid. The Electrical Power Research Institute (EPRI) conservatively estimated that 20% of all US electricity could be generated by wave energy. Ocean Power Technologies, Inc. (OPT), with funding from private sources and the US Navy, developed the PowerBuoy� to generate renewable energy from the readily available power in ocean waves. OPT's PowerBuoy converts the energy in ocean waves to electricity using the rise and fall of waves to move the buoy up and down (mechanical stroking) which drives an electric generator. This electricity is then conditioned and transmitted ashore as high‐voltage power via underwater cable. OPT's wave power generation system includes sophisticated techniques to automatically tune the system for efficient conversion of random wave energy into low cost green electricity, for disconnecting the system in large waves for hardware safety and protection, and for automatically restoring operation when wave conditions normalize. As the first utility scale wave power project in the US, the Wave Power Demonstration Project at Reedsport, OR, will consist of 10 PowerBuoys located 2.5 miles off the coast. This U.S. Department of Energy Grant funding along with funding from PNGC Power, an Oregon‐based electric power cooperative, was utilized for the design completion, fabrication, assembly and factory testing of the first PowerBuoy for the Reedsport project. At this time, the design and fabrication of this first PowerBuoy and factory testing of the power take‐off subsystem are complete; additionally the power take‐off subsystem has been successfully integrated into the spar.

  7. ATOMIC POWER PLANT

    DOE Patents [OSTI]

    Daniels, F.

    1957-11-01

    This patent relates to neutronic reactor power plants and discloses a design of a reactor utilizing a mixture of discrete units of a fissionable material, such as uranium carbide, a neutron moderator material, such as graphite, to carry out the chain reaction. A liquid metal, such as bismuth, is used as the coolant and is placed in the reactor chamber with the fissionable and moderator material so that it is boiled by the heat of the reaction, the boiling liquid and vapors passing up through the interstices between the discrete units. The vapor and flue gases coming off the top of the chamber are passed through heat exchangers, to produce steam, for example, and thence through condensers, the condensed coolant being returned to the chamber by gravity and the non- condensible gases being carried off through a stack at the top of the structure.

  8. Power Services (pbl/about)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    About Power Services > About Power Services Power Services Home Page Other Related Web Sites Power Services Organization Power Services Financial Information Tribal Affairs Office...

  9. Gasoline prices up this week (short version)

    U.S. Energy Information Administration (EIA) Indexed Site

    short version) The U.S. average retail price for regular gasoline rose to 3.78 a gallon on Monday. That's up 3.7 cents from a week ago and up almost 43 cents from 4 weeks ago,...

  10. Gasoline prices up this week (long version)

    U.S. Energy Information Administration (EIA) Indexed Site

    Pump prices were highest in the West Coast region at 3.87 a gallon, up almost 13 cents from a week ago. Prices were lowest in the Rocky Mountain States at 3.27 a gallon, up 13 ...

  11. Aerosol Oxidation Speeds Up in Smoggy Air

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Aerosol Oxidation Speeds Up in Smoggy Air Aerosol Oxidation Speeds Up in Smoggy Air Print Wednesday, 17 February 2016 11:37 Organic aerosols (nanometer-sized liquid or solid ...

  12. FHA PowerSaver | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FHA PowerSaver FHA PowerSaver PowerSaver is a pilot mortgage insurance/ home improvement loan program from the Federal Housing Administration (FHA) that enables homeowners to finance cost-effective, energy-saving improvements as well as solar and renewable energy systems in their homes. PowerSaver enables homeowners to borrow up to $25,000 for terms as long as 20 years to make energy improvements of their choice, based on a list of proven measures developed by FHA and the U.S. Department of

  13. Secretary Chu Announces Up To $55 Million in Funding to Develop Advanced

    Energy Savers [EERE]

    Carbon Capture Technology at Existing Coal-Fired Power Plants | Department of Energy Up To $55 Million in Funding to Develop Advanced Carbon Capture Technology at Existing Coal-Fired Power Plants Secretary Chu Announces Up To $55 Million in Funding to Develop Advanced Carbon Capture Technology at Existing Coal-Fired Power Plants October 13, 2009 - 1:00pm Addthis Washington, DC -- U.S. Energy Secretary Steven Chu announced today that $55 million will be made available to develop advanced

  14. Secretary Chu Announces Up to $55 Million in Funding to Develop Advanced

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Carbon Capture Technology at Existing Coal-Fired Power Plants | Department of Energy Up to $55 Million in Funding to Develop Advanced Carbon Capture Technology at Existing Coal-Fired Power Plants Secretary Chu Announces Up to $55 Million in Funding to Develop Advanced Carbon Capture Technology at Existing Coal-Fired Power Plants October 13, 2009 - 12:00am Addthis Washington, DC - U.S. Energy Secretary Steven Chu announced today that $55 million will be made available to develop advanced

  15. Electric power 2007

    SciTech Connect (OSTI)

    2007-07-01

    Subjects covered include: power industry trends - near term fuel strategies - price/quality/delivery/opportunity; generating fleet optimization and plant optimization; power plant safety and security; coal power plants - upgrades and new capacity; IGCC, advanced combustion and CO{sub 2} capture technologies; gas turbine and combined cycle power plants; nuclear power; renewable power; plant operations and maintenance; power plant components - design and operation; environmental; regulatory issues, strategies and technologies; and advanced energy strategies and technologies. The presentations are in pdf format.

  16. Power Tower System Concentrating Solar Power Basics

    Broader source: Energy.gov [DOE]

    In power tower concentrating solar power systems, a large number of flat, sun-tracking mirrors, known as heliostats, focus sunlight onto a receiver at the top of a tall tower.

  17. Form EIA-923 Mock-Ups

    Gasoline and Diesel Fuel Update (EIA)

    Hours: 2.3 FORM EIA-923 POWER PLANT OPERATIONS REPORT ... purchase received for the use of electricity generation. ... COMPANY SADIE SAFETY CLEAN SALT RIVER PROJECT SAMPSON COAL ...

  18. Marine power - Accomplishments of the 1970s

    SciTech Connect (OSTI)

    Schmitt, W.R.

    1982-08-01

    Considerable optimism prevailed at the decade's beginning that marine energy fluxes would be utilized widely and soon. Potential resources were overestimated and technical difficulties underestimated. Then leaping fuel prices were thought to give a competitive edge to renewable, fuel-free, power technologies. But since most renewable power is of low intensity and requires large conversion systems, costs are innately high and have been very sensitive to the inflation engendered by the 1973 oil embargo, staying well ahead of those of fossil-fueled power. The necessary low-pressure technology has proved difficult to master, and power utilities have been reluctant to invest in variable, undependable supplies. Prospects for power from the oceans were thus at a low ebb near the end of the Seventies. However, persevering efforts helped by more patient expectations have turned the prospects around and up again, and demonstration facilities are under test or construction for temperature-gradient, tidal, wave, and wind power.

  19. WINDExchange: Selling Wind Power

    Wind Powering America (EERE)

    Market Sectors Printable Version Bookmark and Share Utility-Scale Wind Distributed Wind Motivations for Buying Wind Power Buying Wind Power Selling Wind Power Selling Wind Power Owners of wind turbines interconnected directly to the transmission or distribution grid, or that produce more power than the host consumes, can sell wind power as well as other generation attributes. Wind-Generated Electricity Electricity generated by wind turbines can be used to cover on-site energy needs

  20. Long-Haul Truck Idling Burns Up Profits

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Long-Haul Truck Idling Burns Up Profits Long-haul truck drivers perform a vitally important service. In the course of their work, they must take rest periods as required by federal law. Most drivers remain in their trucks, which they keep running to provide power for heating, cooling, and other necessities. Such idling, however, comes at a cost; it is an expensive and polluting way to keep drivers safe and comfortable. Increasingly affordable alternatives to idling not only save money and reduce

  1. Portable Power Projects

    Office of Energy Efficiency and Renewable Energy (EERE)

    DOE's Portable Power, Auxiliary Power Units, and R&D for Off-Road Fuel Cell Applications Research Projects Awarded April 2004

  2. Biomass: Potato Power

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    POTATO POWER Curriculum: Biomass Power (organic chemistry, chemicalcarbon cycles, plants, energy resourcestransformations) Grade Level: Grades 2 to 3 Small groups (3 to 4) Time:...

  3. Concentrating Solar Power

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas ...

  4. PowerPoint Presentation

    Office of Environmental Management (EM)

    Southeastern Federal Power Alliance - September 29, 2015 ... of nuclear, coal, pumped storage hydro, and simple-cycle ... facilities - 2 "Wind Power for Schools" facilities - Jr. ...

  5. Power System Dispatcher (Trainer)

    Broader source: Energy.gov [DOE]

    (See Frequently Asked Questions for more information). Where would I be working? Western Area Power Administration Rocky Mountain Region Power System Operations Transmission Switching (J4100) 5555...

  6. Bonneville Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    agreement (Agreement) between the BC Hydro and Power uthority (BCH) and the Bonneville Power Administration (BP A), jointly the Parties, which BA for accounting purposes is...

  7. BONNEVILLE POWER ADMINISTRATION

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    October 2013 (Revised 060914) United States Department of Energy Bonneville Power Administration 905 N.E. 11th Avenue Portland, OR 97232 Bonneville Power Administration's 2014...

  8. power conversion efficiency

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    power conversion efficiency - Sandia Energy Energy Search Icon Sandia Home Locations ... Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar ...

  9. 10 MWe power cycle

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MWe power cycle - Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy ...

  10. concentrating solar power plant

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    power plant - Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy ...

  11. Electrolytes for power sources

    DOE Patents [OSTI]

    Doddapaneni, Narayan; Ingersoll, David

    1995-01-01

    Electrolytes for power sources, particularly alkaline and acidic power sources, comprising benzene polysulfonic acids and benzene polyphosphonic acids or salts of such acids.

  12. Electrolytes for power sources

    DOE Patents [OSTI]

    Doddapaneni, N.; Ingersoll, D.

    1995-01-03

    Electrolytes are disclosed for power sources, particularly alkaline and acidic power sources, comprising benzene polysulfonic acids and benzene polyphosphonic acids or salts of such acids. 7 figures.

  13. Supervisory Power System Dispatcher

    Broader source: Energy.gov [DOE]

    (See Frequently Asked Questions for more information). Where would I be working? Western Area Power Administration Rocky Mountain Region Power System Operations, J4800 Transmission Scheduling &...

  14. Wind & Water Power Newsletter

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    & Water Power Newsletter - Sandia Energy Energy Search Icon Sandia Home Locations Contact ... Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 ...

  15. BONNEVILLE POWER ADMINISTRATION

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    exit signs, kitchen equipment, network power management, power strips, showerheads, clothes washers, water heaters and ag stock tanks. Check IM for detailed requirements. c....

  16. Power System Dispatcher

    Broader source: Energy.gov [DOE]

    (See Frequently Asked Questions for more information). Where would I be working? Western Area Power Administration Rocky Mountain Region Power System Operations Transmission Switching (J4100) 5555...

  17. Smart Grid Week: Hurricane Season and the Department’s Efforts to Make the Grid More Resilient to Power Outages

    Broader source: Energy.gov [DOE]

    Next up in our Smart Grid Week series -- improving electric grid technologies to adequately prepare for emergencies with power outages.

  18. What We Clean Up & Why

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Environmental Stewardship » Environmental Cleanup » What We Clean Up & Why What We Clean Up & Why We clean up legacy waste sites and contaminated areas for return to the public. Contact Environmental Communication & Public Involvement P.O. Box 1663 MS M996 Los Alamos, NM 87545 (505) 667-0216 Email An active approach to cleanup and environmental restoration One of the Laboratory's main environmental duties is to investigate where hazardous chemical and/or radioactive materials may

  19. Wireless Power Transfer

    ScienceCinema (OSTI)

    None

    2013-11-19

    Wireless Power Transfer is an innovative approach using magnetic resonance coupling of air core transformers designed for today's growing plug-in electric vehicle market. This technology can provide a convenient, safe and flexible means to charge electric vehicles under stationary and dynamic conditions. Plug-in Electric Vehicles (PEV) are burdened by the need for cable and plug charger, galvanic isolation of the on-board electronics, bulk and cost of this charger and the large energy storage system (ESS) packs needed. With a system where you have to physically plug in there are a number of occasions where the owner could very well forget to charge the vehicle. For stationary applications (like charging of a PHEV at home), ORNL's innovative wireless power transfer technology adds a convenience factor compared to actually plugging in which will mean that the vehicle will have a full charge every morning. Electric vehicle charging must be safe, compact and efficient in order to be convenient for customers. By reconfiguring the transformer and altering the resonance frequency, energy is transferred to the battery with lower energy losses and with fewer demands on the primary circuit by the rest of the transformer system. The ORNL discovery shows that sufficient power for the battery can be transferred from the primary to secondary circuits without significant energy losses if the operating frequency is set at 50% to 95% of the resonance frequency of the circuit. The electrical power is then transmitted to the chargeable battery, which is electrically coupled to the secondary circuit through the air core transformer. Some advantages include: Reduced energy losses during transfer of energy to the battery; A charge potential that is relatively unaffected by up to 25% misalignment of vehicle; and Other receiving components draw less power from the primary circuit. These advantages allow wireless power technology applications to expand at the workplace and beyond as the demand for EV rises. For vehicles that operate over a fixed route such as busses and shuttle vehicles, Wireless Power Transfer (WPT) means that a smaller battery pack can be used. In the traditional system, the battery pack is designed to accommodate the needs of the entire route or shift. With WPT the battery can be downsized because it can be charged when the vehicle stops on its route (a rental car shuttle bus, for example, can charge when it waits in the terminal and again when it waits at the rental car place. Thus the battery only needs enough charge to get to the next stop. This decrease in battery size means significant cost savings to electrify the vehicle. This technology enables efficient "opportunity charging stations" for predefined routes and planned stops reducing down time. Charging can occur in minutes. This improvement also eliminates the harmful emissions that occur in garages while buses are at idle during charging. In larger cities, dynamic charging offers an even greater impact utilizing existing infrastructure. As vehicles travel along busy freeways and interstate systems, wireless charging can occur while the vehicle is in motion. With this technology a vehicle essentially has unlimited electric range while using a relatively small battery pack. In-motion charging stations use vehicle sensors to alert the driver. Traveling at normal speeds, sensors establish in-motion charging. WPT transmit pads sequentially energize to the negotiated power level based on vehicle speed and its requested charging energy. Lower power when vehicle speed is slow and much higher power for faster moving vehicles. Vehicle to Infrastructure communications (V2I) coordinates WPT charging level according to on-board battery pack state-of-charge. V2I activates the roadway transmit pads placing them in standby mode and negotiates charging fee based on prevailing grid rate and vehicle energy demand. Dynamic charging would allow electricity to supply a very large fraction of the energy for the transportation sector and reduce greatly petroleum consumption. Previously worrisome traffic delays now provide longer periods of charge while passing over in-motion chargers. Inclement weather such as rain and snow do not affect the charging capability. At ORNL, we are working to develop the robust nature of wireless power technology to provide a convenient, safe and flexible means to charge electric vehicles under stationary and dynamic conditions.

  20. Gasoline price up this week (long version)

    U.S. Energy Information Administration (EIA) Indexed Site

    up this week (long version) The U.S. average retail price for regular gasoline rose to $3.32 a gallon on Monday. That's up 1.2 cents from a week ago, based on the weekly price survey by the U.S. Energy Information Administration. For the first time since early December pump prices were highest in the West Coast at 3.50 a gallon, up 1.2 cents from a week ago. For the fourth week in a row, prices were lowest in the Rocky Mountain States at 2.88 a gallon, up 1.3 cents.

  1. UpWind Solutions | Open Energy Information

    Open Energy Info (EERE)

    Zip: 97504 Sector: Wind energy Product: Oregon-based full service operations and maintenance service provider for utility-scale wind energy projects. References: UpWind...

  2. Aerosol Oxidation Speeds Up in Smoggy Air

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Aerosol Oxidation Speeds Up in Smoggy Air Print Organic aerosols (nanometer-sized liquid or solid particles suspended in air) are important constituents of the troposphere, and ...

  3. Wind Powering America Webinar: Wind Power Economics: Past, Present...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Wind Powering America Webinar: Wind Power Economics: Past, Present, and Future Trends Wind Powering America Webinar: Wind Power Economics: Past, Present, and Future Trends November ...

  4. ENER G Combined Power formerly Combined Power Ltd | Open Energy...

    Open Energy Info (EERE)

    ENER G Combined Power formerly Combined Power Ltd Jump to: navigation, search Name: ENER.G Combined Power (formerly Combined Power Ltd) Place: United Kingdom Product: Specialises...

  5. Assessment of Combined Heat and Power Premium Power Applications...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Combined Heat and Power Premium Power Applications in California, September 2008 Assessment of Combined Heat and Power Premium Power Applications in California, September 2008 This 2008 ...

  6. Indiabulls Power Ltd formerly Sophia Power Company | Open Energy...

    Open Energy Info (EERE)

    Indiabulls Power Ltd formerly Sophia Power Company Jump to: navigation, search Name: Indiabulls Power Ltd. (formerly Sophia Power Company) Place: New Delhi, Delhi (NCT), India Zip:...

  7. Brookfield Renewable Power Corp formerly Brascan Power Corp ...

    Open Energy Info (EERE)

    Brookfield Renewable Power Corp formerly Brascan Power Corp Jump to: navigation, search Name: Brookfield Renewable Power Corp (formerly Brascan Power Corp) Place: Toronto, Ontario,...

  8. Delmarva Power Light Company Delmarva Power | Open Energy Information

    Open Energy Info (EERE)

    Delmarva Power Light Company Delmarva Power Jump to: navigation, search Name: Delmarva Power & Light Company (Delmarva Power) Place: Wilmington, Delaware Zip: 19886 Product:...

  9. High Power Laser Innovation Sparks Geothermal Power Potential...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    High Power Laser Innovation Sparks Geothermal Power Potential High Power Laser Innovation Sparks Geothermal Power Potential May 29, 2015 - 11:02am Addthis The Energy Department's ...

  10. Karnataka Power Corporation Limited and National Thermal Power...

    Open Energy Info (EERE)

    Power Corporation Limited and National Thermal Power Corporation JV Jump to: navigation, search Name: Karnataka Power Corporation Limited and National Thermal Power Corporation JV...

  11. Flex power perspectives of indirect power system control through...

    Open Energy Info (EERE)

    Flex power perspectives of indirect power system control through dynamic power price (Smart Grid Project) Jump to: navigation, search Project Name Flex power perspectives of...

  12. Hydrogen Power Inc formerly Hydrogen Power International and...

    Open Energy Info (EERE)

    Power Inc formerly Hydrogen Power International and Equitex Inc Jump to: navigation, search Name: Hydrogen Power, Inc. (formerly Hydrogen Power International and Equitex Inc.)...

  13. PV/thermal solar power assembly

    DOE Patents [OSTI]

    Ansley, Jeffrey H.; Botkin, Jonathan D.; Dinwoodie, Thomas L.

    2004-01-13

    A flexible solar power assembly (2) includes a flexible photovoltaic device (16) attached to a flexible thermal solar collector (4). The solar power assembly can be rolled up for transport and then unrolled for installation on a surface, such as the roof (20, 25) or side wall of a building or other structure, by use of adhesive and/or other types of fasteners (23).

  14. Gasoline prices up this week (short version)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    short version) The U.S. average retail price for regular gasoline rose to 3.61 a gallon on Monday. That's up 7.3 cents from a week ago and up 25.4 cents from two weeks ago, based...

  15. Gasoline prices up this week (long version)

    U.S. Energy Information Administration (EIA) Indexed Site

    Pump prices were highest in the West Coast region at 3.97 a gallon, up almost 11 cents from a week ago. Prices were lowest in the Rocky Mountain States at 3.41 a gallon, up 13.5 ...

  16. Towards sustainability assessment follow-up

    SciTech Connect (OSTI)

    Morrison-Saunders, Angus; North-West University ; Pope, Jenny; Integral Sustainability; Curtin University ; Bond, Alan; University of East Anglia ; Retief, Francois

    2014-02-15

    This paper conceptualises what sustainability assessment follow-up might entail for three models of sustainability assessment: EIA-driven integrated assessment, objectives-led integrated assessment and the contribution to sustainability model. The first two are characterised by proponent monitoring and evaluation of individual impacts and indicators while the latter takes a holistic view based around focused sustainability criteria relevant to the context. The implications of three sustainability challenges on follow-up are also examined: contested time horizons and value changes, trade-offs, and interdisciplinarity. We conclude that in order to meet these challenges some form of adaptive follow-up is necessary and that the contribution to sustainability approach is the best approach. -- Highlights: • We explore sustainability follow-up for three different sustainability models. • Long-time frames require adaptive follow-up and are a key follow-up challenge. • Other key challenges include interdisciplinarity, and trade-offs. • Sustainability follow-up should be a direction of travel and not an outcome. • Only the follow-up for contribution to sustainability model addresses sustainability challenges sufficiently.

  17. DOE Selects Projects for Up to $7.3 Million for R&D Clean Technology Water

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Power Projects | Department of Energy Up to $7.3 Million for R&D Clean Technology Water Power Projects DOE Selects Projects for Up to $7.3 Million for R&D Clean Technology Water Power Projects September 18, 2008 - 3:43pm Addthis WASHINGTON - The U.S. Department of Energy (DOE) today announced the selection of projects for negotiation of award of up to $7.3 million to 14 research teams, with a cost-shared value of over $18 million, under the DOE's competitive solicitation for Advanced

  18. Amped Up! Volume 1, Issue 3

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... New Powerful Flow Batteries Pacifc Northwest National Labora- tory (PNNL) is also playing a role in grid modernization. PNNL scientists have developed a new zinc-polyio- dide redox ...

  19. Low Standby Power Products

    Broader source: Energy.gov [DOE]

    The Federal Energy Management Program (FEMP) develops acquisition guidance for products with low standby power. Standby power is the level of power consumption that occurs when a device is in the lowest power-consuming mode—typically when the product is switched off or not performing its primary purpose.

  20. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Schedules Skip Navigation Links Excess Energy Hydro Peaking Power Hydro Power and Energy Sold to Sam Rayburn Dam Electric Cooperative (Rayburn) Hydro Power and Energy Sold to Sam Rayburn Municipal Power Agency (Willis) Non-Federal Transmission/Interconnection Facilities Service Contact swparates@swpa.gov Last Updated: January 05, 2016

  1. Power Purchase Agreements

    Office of Energy Efficiency and Renewable Energy (EERE)

    Presentation covers the power purchase agreements taken from the FEMP Alternative Finance Options (AFO) webinar.

  2. Offshore Wind Power USA

    Broader source: Energy.gov [DOE]

    The Offshore Wind Power USA conference provides the latest offshore wind market updates and forecasts.

  3. DOE specification: Flooded-type lead-acid storage batteries

    SciTech Connect (OSTI)

    1996-08-01

    This document contains a ``fill-in-the-blanks`` guide specification for procurement of flooded-type lead-acid storage batteries, for uninterruptible power supply applications.

  4. Newsletter Southern Great Plains

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SGP site, located a third-party provider for the gear and purchased a small supply. ... sensors * Sun trackers * Uninterruptible power supplies * Computer monitors, drives * ...

  5. Los Alamos wins 2008 Pollution Prevention awards

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... In fiscal year 2007, the Laboratory executed efforts at every stage of the EMS life-cycle to continuously improve such integration. The Uninterruptible Power Supply Project The ...

  6. Microsoft Word - DOE-ID-INL-14-009.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... supply (nitrogen for the glovebox and instrument, P10 mix gas (10% methane90%argon) for the instrument detectors and oxygen for the EPMA carbon trap), Uninterruptible Power ...

  7. Small Wind Electric Systems | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    lines extended to a remote location Help uninterruptible power supplies ride through extended utility outages. ... conditioning unit) Wiring Electrical disconnect switch Grounding ...

  8. Energy Savings Potential and Research, Development, & Demonstration...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... 21 2.2.7 Microwave Ovens ... Losses of Data Center Uninterruptible Power Supplies ..... 149 5.12.9 Design ... in generation, transmission and distribution. ...

  9. Reducing Power Factor Cost

    Broader source: Energy.gov [DOE]

    Low power factor is expensive and inefficient. Many utility companies charge an additional fee if your power factor is less than 0.95. Low power factor also reduces your electrical system’s distribution capacity by increasing current flow and causing voltage drops. This fact sheet describes power factor and explains how you can improve your power factor to reduce electric bills and enhance your electrical system’s capacity.

  10. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    FOIA/Privacy Act Submit a FOIA Request DOE FOIA Requester Service Center Electronic Reading Room FOIA Links Power Marketing Administrations' FOIA Links Bonneville Power Administration FOIA Program Department of Energy FOIA Program Southeastern Power Administration FOIA Program Western Area Power Administration FOIA Program Contact FOIA/Privacy Act Officer Southwestern Power Administration One West Third Street Tulsa, Oklahoma 74103-3502 Phone: 918-595-6609 Fax: 918-595-6755 foia@swpa.gov Last

  11. Shillapoo Wildlife Area 2007 Follow-up HEP Report.

    SciTech Connect (OSTI)

    Ashley, Paul R.

    2008-03-01

    In April and May 2007 the Regional HEP Team (RHT) conducted a follow-up HEP analysis on the Egger (612 acres) and Herzog (210 acres) parcels located at the north end of the Shillapoo Wildlife Area. The Egger and Herzog parcels have been managed with Bonneville Power Administration funds since acquired in 1998 and 2001 respectively. Slightly more than 936 habitat units (936.47) or 1.14 HUs per acre was generated as an outcome of the 2007 follow-up HEP surveys. Results included 1.65 black-capped chickadee HUs, 280.57 great blue heron HUs, 581.45 Canada goose HUs, 40 mallard HUs, and 32.80 mink HUs. Introduction A follow-up Habitat Evaluation Procedures (HEP) (USFWS 1980) analysis was conducted by the Columbia Basin Fish and Wildlife Authority's (CBFWA) Regional HEP Team (RHT) during April and May 2007 to document changes in habitat quality and to determine the number of habitat units (HUs) to credit Bonneville Power Administration (BPA) for providing operation and maintenance (O&M) funds since WDFW acquired the parcels. The 2007 follow-up HEP evaluation was limited to Shillapoo Wildlife Area (SWA) parcels purchased with Bonneville Power Administration funds. D. Budd (pers. comm.) reported WDFW purchased the 612 acre Egger Farms parcel on November 2, 1998 for $1,737,0001 and the 210 acre Herzog acquisition on June 21, 2001 for $500,000 with Memorandum of Agreement funds (BPA and WDFW 1996) as partial fulfillment of BPA's wildlife mitigation obligation for construction of Bonneville and John Day Dams (Rasmussen and Wright 1989). Anticipating the eventual acquisition of the Egger and Herzog properties, WDFW conducted HEP surveys on these lands in 1994 to determine the potential number of habitat units to be credited to BPA. As a result, HEP surveys and habitat unit calculations were completed as much as seven years prior to acquiring the sites. The term 'Shillapoo Wildlife Area' will be used to describe only the Herzog and Egger parcels in this document. Details and results of the HEP analysis are included in this report.

  12. Exhibit Set Up | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Publications, Exhibits, & Logos » Exhibit Set Up Exhibit Set Up Follow these step-by step instructions in order to set up your exhibit. 1. The exhibit case. Photo of a man opening an exhibit case. 2. Inside the top of the case, you will find shipping labels, extra bulbs, and contact information. Photo of an open exhibit case. 3. Expand the display frame by pulling the center piece apart gently. Red feet should be at bottom front. Photo of a man unfolding an exhibit display frame. 4. Fully

  13. Gasoline price up this week (long version)

    U.S. Energy Information Administration (EIA) Indexed Site

    long version) The U.S. average retail price for regular gasoline rose to $3.36 a gallon on Monday. That's up 4.2 cents from a week ago, based on the weekly price survey by the U.S. Energy Information Administration. For the second week in a row, pump prices were highest in the West Coast at 3.55 a gallon, up 4.2 cents from a week ago. Prices were lowest in the Rocky Mountain States at 2.98 a gallon, up 10.1 cents marking the greatest regional increase this week.

  14. UPS CNG Truck Fleet Final Report

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    ® ® ® ® ® ® ® Clean Air Natural Gas Vehicle This is a Clean Air Natural Gas Vehicle This is a UPS CNG Truck Fleet UPS CNG Truck Fleet UPS CNG Truck Fleet Final results Final Results Produced for the U.S. Department of Energy (DOE) by the National Renewable Energy Laboratory (NREL), a DOE national laboratory Alternative Fuel Trucks DOE/NREL Truck Evaluation Project By Kevin Chandler, Battelle Kevin Walkowicz, National Renewable Energy Laboratory Nigel Clark, West Virginia University

  15. Protons Pair Up With Neutrons | Jefferson Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Protons Pair Up With Neutrons Embargoed: Not for Release Until 2:00 p.m. Eastern Time Thursday, 29 May Contact: Kandice Carter 757-269-7263 Protons Pair Up With Neutrons NEWPORT NEWS, VA - Research performed at the U.S. Department of Energy's Thomas Jefferson National Accelerator Facility has found that protons are about 20 times more likely to pair up with neutrons than with other protons in the nucleus. The result will be published online by the journal Science, at the Science Express website.

  16. ChemCam sends digital 'thumbs up'

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ChemCam sends digital 'thumbs up' ChemCam sends digital 'thumbs up' Members of the team got a digital thumbs up about the operational readiness of their instrument just hours after the rover landed on Martian soil. August 8, 2012 Researchers from LANL and the French Space Agency examine data from the Mars Science Laboratory Curiosity rover from inside the ChemCam Operations Center at NASA's Jet Propulsion Laboratory on Monday, Aug. 6, 2012, less than a day after the rover landed on Mars. The

  17. Photonic surfaces for designable nonlinear power shaping

    SciTech Connect (OSTI)

    Biswas, Roshni Povinelli, Michelle L.

    2015-02-09

    We propose a method for designing nonlinear input-output power response based on absorptive resonances of nanostructured surfaces. We show that various power transmission trends can be obtained by placing a photonic resonance mode at the appropriate detuning from the laser wavelength. We demonstrate our results in a silicon photonic crystal slab at a laser wavelength of 808 nm. We quantify the overall spectral red shift as a function of laser power. The shift results from absorptive heating and the thermo-optic effect. We then demonstrate devices with increasing, decreasing, and non-monotonic transmission as a function of laser power. The transmission changes are up to 7.5 times larger than in unpatterned silicon. The strong nonlinear transmission is due to a combination of resonantly enhanced absorption, reduced thermal conductivity, and the resonant transmission lineshape. Our results illustrate the possibility of designing different nonlinear power trends within a single materials platform at a given wavelength of interest.

  18. High power fast ramping power supplies

    SciTech Connect (OSTI)

    Marneris,I.; Bajon, E.; Bonati, R.; Sandberg, J.; Roser, T.; Tsoupas, N.

    2009-05-04

    Hundred megawatt level fast ramping power converters to drive proton and heavy ion machines are under research and development at accelerator facilities in the world. This is a leading edge technology. There are several topologies to achieve this power level. Their advantages and related issues will be discussed.

  19. Y-12 apprentices and instructors speak up

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    apprentices and instructors speak up In doing the research into the current Y-12 Apprentice Program, I found a level of enthusiasm that caused me to pause and reflect on the...

  20. "Speak Up" Survey Results - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    in the survey. The goal is to use the results to continuously improve Hanford's safety culture and work environment. Results for the "Speak Up" Survey An Organizational Climate and...

  1. Amped Up! Volume 1, No.1

    Broader source: Energy.gov [DOE]

    EERE’s internal newsletter, Amped Up!, is a bimonthly publication that highlights news within EERE, as well as some of our external successes, lessons learned, and best practices.

  2. Gasoline prices up this week (short version)

    U.S. Energy Information Administration (EIA) Indexed Site

    for regular gasoline rose to 3.75 a gallon on Monday. That's up almost 14 cents from a week ago, based on the weekly price survey by the U.S. Energy Information Administration.

  3. Jack-up rig for marine drilling

    SciTech Connect (OSTI)

    Mueller, S. R.

    1981-05-26

    This invention relates to a mobile drilling platform of the jack -up type equipped with a special system which allows the said drilling platform to work as a drilling derrick and alternatively as a hoisting crane rig for marine service.

  4. Micro-size gas turbines create market opportunities

    SciTech Connect (OSTI)

    Scott, W.G.

    1997-09-01

    Power plants in the 25 to 250 kW-size range will enable utilities, IPPs and ESCOs to provide economic power for a variety of applications. Small, low-cost, highly efficient gas turbines provide the utility industry with a four-generation technology that features numerous benefits and potential applications. These include firm power to isolated communities, commercial centers and industries; peak shaving for utility systems to reduce the incremental cost of additional loads; peak shaving for large commercial and industrial establishments to reduce demand charges, as well as standby, emergency power and uninterruptible power supply (UPS).

  5. Geek-Up[2.24.2011]: Dynamical Fingerprints and Daya Bay | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy 2.24.2011]: Dynamical Fingerprints and Daya Bay Geek-Up[2.24.2011]: Dynamical Fingerprints and Daya Bay February 25, 2011 - 4:37pm Addthis Nuclear power plants like the twin Daya Bay reactors, yield large amounts of electron antineutrinos -- millions of quadrillions of them every second. | Photo Courtesy of Roy Kaltschmidt, Lawrence Berkeley National Laboratory Nuclear power plants like the twin Daya Bay reactors, yield large amounts of electron antineutrinos -- millions of

  6. Cleaning Up Coal | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Cleaning Up Coal Cleaning Up Coal August 13, 2010 - 4:57pm Addthis Pete McGrail, a Laboratory Fellow at Pacific Northwest National Laboratory, is part of a team studying basalts to determine how carbon dioxide can be safely and permanently stored in these massive, deep underground rock formations. | Photo courtesy of Pacific Northwest National Laboratory. Pete McGrail, a Laboratory Fellow at Pacific Northwest National Laboratory, is part of a team studying basalts to determine how carbon dioxide

  7. Program Development Plan and Team up

    SciTech Connect (OSTI)

    Solar Electric Power Association

    2001-12-01

    The final summary report is a comprehensive view of TEAM-UP, with documented data, information, and experiences that SEPA has collected throughout the program, including lessons learned by participating ventures, and sections covering costs and other information on both large and small systems. This report also covers the barriers that TEAM-UP faced to PV commercialization at the beginning of the program, barriers the project was able to remove or reduce, and what barriers remain on the road ahead.

  8. Workplace Charging: Charging Up University Campuses

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Workplace Charging: Charging Up University Campuses Carrie Giles, ICF International Carrie Ryder, ICF International Stephen Lommele, National Renewable Energy Laboratory March 2016 DRAFT REPORT Workplace 2 Workplace Charging: Charging Up University Campuses As leading regional employers, colleges and universities are on the front line of local- and national-level technology trends. To remain competitive, many schools are offering plug-in electric vehicle (PEV) charging to their faculty, staff,

  9. Aerosol Oxidation Speeds Up in Smoggy Air

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Aerosol Oxidation Speeds Up in Smoggy Air Aerosol Oxidation Speeds Up in Smoggy Air Print Wednesday, 17 February 2016 11:37 Organic aerosols (nanometer-sized liquid or solid particles suspended in air) are important constituents of the troposphere, and their chemistry has large-scale impacts on climate, pollution, and health. Accurate predictions of these aerosol impacts require a robust microphysical understanding of all relevant chemical reaction mechanisms and time scales, including those

  10. System-wide emissions implications of increased wind power penetration.

    SciTech Connect (OSTI)

    Valentino, L.; Valenzuela, V.; Botterud, A.; Zhou, Z.; Conzelmann, G.

    2012-01-01

    This paper discusses the environmental effects of incorporating wind energy into the electric power system. We present a detailed emissions analysis based on comprehensive modeling of power system operations with unit commitment and economic dispatch for different wind penetration levels. First, by minimizing cost, the unit commitment model decides which thermal power plants will be utilized based on a wind power forecast, and then, the economic dispatch model dictates the level of production for each unit as a function of the realized wind power generation. Finally, knowing the power production from each power plant, the emissions are calculated. The emissions model incorporates the effects of both cycling and start-ups of thermal power plants in analyzing emissions from an electric power system with increasing levels of wind power. Our results for the power system in the state of Illinois show significant emissions effects from increased cycling and particularly start-ups of thermal power plants. However, we conclude that as the wind power penetration increases, pollutant emissions decrease overall due to the replacement of fossil fuels.

  11. Moving toward Zero Energy Homes: Zero Energy Home Powers Up in North Texas; Building America

    SciTech Connect (OSTI)

    2004-10-01

    This fact sheet describes the first Zero Energy Home built in northern Texas. It describes the energy efficiency features and their advantages, and discusses details of its construction.

  12. Opportunities and Challenges to Scaling-up Wind Power in Vietnam...

    Open Energy Info (EERE)

    AgencyCompany Organization Asian Development Bank Sector Energy Focus Area Renewable Energy, Wind Topics Co-benefits assessment, Market analysis, Pathways analysis, Background...

  13. Microsoft PowerPoint - Customer Follow Up RHWM BP-16 Workshop...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    O N Pre-Decisional. For Discussion Purposes Only. August 5, 2014 2 RHWM Process Workshop Agenda Topic Presenter Intro and Purpose of Workshop, Introductions Peter Stiffler Part 1...

  14. Microsoft PowerPoint - UP 1_rrb pres_final.ppt [Read-Only] [Compatibil...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Components * Major Remedy Components - Pump-and-Treat - MNA - Flow-path control - ... Alternative 4- 25 Years Active Remediation and MNA Pump-and-Treat PT for technetium-99, ...

  15. Microsoft PowerPoint - Slice True-Up 101 pptx.pptx [Read-Only...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ted Barham, Janice Johnson and many others Content Organized and Presented by Craig Larson Slice History A Review of Subscription and RD(Regional Dialogue) Slice distinctions...

  16. Geek-Up[4.29.2011]: Boosting the Efficiency of Wind and Solar Power

    Broader source: Energy.gov [DOE]

    It’s a big month for the National Wind Technology Center.   Earlier this week, the Department of Energy’s National Renewable Energy Laboratory (NREL) commemorated the successful installation and full capacity operation of a 3 megawatt Alstom ECO 100 wind turbine at the center. As part of a long-term collaboration between NREL and Alstom, engineers from the two institutions will perform a series of analyses and tests to evaluate Alstom’s unique drive train configuration technology.   After this initial testing is complete, the joint team will continue research and development on other advanced technologies including controls and offshore wind energy.   Researchers from the Department’s Lawrence Livermore National Laboratory (LLNL) will also be hanging out at the National Wind Technology Center in the coming months. They’re launching a study to improve the efficiency of wind farms.  

  17. Photo of the Week: Power Up! Twenty Steps to Zip a Zipper | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    View more photos from the competition here. | Photo courtesy of Argonne National Laboratory. Sarah Gerrity Sarah Gerrity Former Multimedia Editor, Office of Public Affairs Every ...

  18. Dynamic Power Flow Controller: Compact Dynamic Phase Angle Regulators for Transmission Power Routing

    SciTech Connect (OSTI)

    2012-01-03

    GENI Project: Varentec is developing compact, low-cost transmission power controllers with fractional power rating for controlling power flow on transmission networks. The technology will enhance grid operations through improved use of current assets and by dramatically reducing the number of transmission lines that have to be built to meet increasing contributions of renewable energy sources like wind and solar. The proposed transmission controllers would allow for the dynamic control of voltage and power flow, improving the grid’s ability to dispatch power in real time to the places where it is most needed. The controllers would work as fail-safe devices whereby the grid would be restored to its present operating state in the event of a controller malfunction instead of failing outright. The ability to affordably and dynamically control power flow with adequate fail-safe switchgear could open up new competitive energy markets which are not possible under the current regulatory structure and technology base.

  19. NREL Evaluates UPS Hybrid-Electric Van Performance - News Releases | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NREL Evaluates UPS Hybrid-Electric Van Performance New trucks deliver more than 28% fuel savings December 22, 2009 The U.S. Department of Energy's (DOE) National Renewable Energy Laboratory (NREL) has collected and analyzed fuel economy, maintenance and other vehicle performance data from UPS's first generation hybrid diesel step delivery vans powered by an Eaton Corp. electric hybrid propulsion system. The diesel hybrid delivery vans improved the on-road fuel economy by 28.9 percent resulting

  20. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  1. Green Power Purchase Plan

    Broader source: Energy.gov [DOE]

    Class I renewable energy resources include solar, wind, new sustainable biomass, landfill gas, fuel cells (using renewable or non-renewable fuels), ocean thermal power, wave or tidal power, low...

  2. Vampire Power and Gaming

    Broader source: Energy.gov [DOE]

    There's something out there known as vampire power. Basically, many appliances that continue using power (and thus continue add to your energy bill in some way, shape or form) even when they are turned off.

  3. Underwater power generator

    SciTech Connect (OSTI)

    Bowley, W.W.

    1983-05-10

    Apparatus and method for generating electrical power by disposing a plurality of power producing modules in a substantially constant velocity ocean current and mechanically coupling the output of the modules to drive a single electrical generator is disclosed.

  4. Space Solar Power Program

    SciTech Connect (OSTI)

    Arif, H.; Barbosa, H.; Bardet, C.; Baroud, M.; Behar, A.; Berrier, K.; Berthe, P.; Bertrand, R.; Bibyk, I.; Bisson, J.; Bloch, L.; Bobadilla, G.; Bourque, D.; Bush, L.; Carandang, R.; Chiku, T.; Crosby, N.; De Seixas, M.; De Vries, J.; Doll, S.; Dufour, F.; Eckart, P.; Fahey, M.; Fenot, F.; Foeckersperger, S.; Fontaine, J.E.; Fowler, R.; Frey, H.; Fujio, H.; Gasa, J.M.; Gleave, J.; Godoe, J.; Green, I.; Haeberli, R.; Hanada, T.; Ha

    1992-08-01

    Information pertaining to the Space Solar Power Program is presented on energy analysis; markets; overall development plan; organizational plan; environmental and safety issues; power systems; space transportation; space manufacturing, construction, operations; design examples; and finance.

  5. Power production and ADS

    SciTech Connect (OSTI)

    Raja, Rajendran; /Fermilab

    2010-03-01

    We describe the power production process in Accelerator Driven Sub-critical systems employing Thorium-232 and Uranium-238 as fuel and examine the demands on the power of the accelerator required.

  6. Electric Power Monthly

    Gasoline and Diesel Fuel Update (EIA)

    Electric Power Monthly Data for January 2016 | Release Date: March 25, 2016 | Next ... Revisions made to the March 2016 Electric Power Monthly: March 30, 2016 Tables 2.8.A-B ...

  7. Power System Dispatcher

    Broader source: Energy.gov [DOE]

    (See Frequently Asked Questions for more information). Where would I be working? Western Area Power Administration Sierra Nevada Region Power Systems Operation N4000 114 Parkshore Drive Folsom, CA...

  8. NREL Finds Up to 6-cent per Kilowatt-Hour Extra Value with Concentrated

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Solar Power - News Releases | NREL Finds Up to 6-cent per Kilowatt-Hour Extra Value with Concentrated Solar Power The greater the penetration of renewables in California, the greater the value of CSP with thermal storage capacity June 9, 2014 Concentrating Solar Power (CSP) projects would add additional value of 5 or 6 cents per kilowatt hour to utility-scale solar energy in California where 33 percent renewables will be mandated in six years, a new report by the Energy Department's National

  9. EERE Success Story-Measuring the Impact of Tidal Power Installations...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addthis Related Articles Portland Company to Receive 1.3 Million to Improve Hydro Power Technologies DOE Awards Up to 14.6 Million to Support Development of Advanced Water Power ...

  10. Nuclear Power & Engineering

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Power & Engineering - Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel Cycle Defense Waste Management Programs Advanced

  11. high-power LEDs

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    high-power LEDs - Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel Cycle Defense Waste Management Programs Advanced Nuclear

  12. Green Power Purchasing

    Broader source: Energy.gov [DOE]

    Note: The green power purchasing goal has a target date of 2011. It has not been increased subsequently.

  13. Power Electronics Block Set

    Energy Science and Technology Software Center (OSTI)

    2008-12-31

    The software consists of code that will allow rapid prototyping of advanced power electronics for use in renewable energy systems.

  14. PowerPoint Presentation

    U.S. Energy Information Administration (EIA) Indexed Site

    David Sun, PhD david.sun@power.alstom.com Power Automation & Controls, Alstom Power Session: Intelligent Electric Systems Smart Power Future of Energy Sustainability © ALSTOM 2011. All rights reserved. Information contained in this document is provided without liability for information purposes only and is subject to change without notice. No representation or warranty is given or to be implied as to the completeness of information or fitness for any particular purpose. Reproduction, use or

  15. Concentrating Solar Power

    SciTech Connect (OSTI)

    Not Available

    2008-09-01

    Summarizes the goals and activities of the DOE Solar Energy Technologies Program efforts within its concentrating solar power subprogram.

  16. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 ANNUAL REPORT Southwestern Power Administration Letter to the Secretary. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 About Southwestern. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 Accomplishments . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 Supplementary

  17. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    April 2, 2014 Smith Named as New Deputy Assistant Administrator Smith Named as New Deputy Assistant Administrator Barbara Smith Barbara Smith, a former Liaison Specialist for Southwestern Power Administration (Southwestern), assumed the duties of Deputy Assistant Administrator in the Power Marketing Liaison Office in Washington, D.C., on March 9, 2014. Smith will serve as the primary contact for Southwestern and the Southeastern Power Administration (Southeastern), representing both Power

  18. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    January 29, 2015 Stockton Power Plant Back Online Refurbished Stockton Turbine Southwestern Administrator Chris Turner and Kansas City District Commander COL Andrew Sexton dedicate the new turbine at Stockton Power Plant. After a catastrophic failure and nearly two years of major equipment replacement work, the Stockton Power Plant in Stockton, Missouri, is back online, generating low-cost, renewable hydropower and energy for electric consumers in the marketing region of Southwestern Power

  19. Concentrating Solar Power Projects | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Concentrating Solar Power Projects Concentrating Solar Power Projects Concentrating Solar Power Projects Concentrating Solar Power Projects Concentrating Solar Power Projects Concentrating Solar Power Projects Concentrating Solar Power Projects Concentrating Solar Power Projects Concentrating Solar Power Projects Concentrating Solar Power Projects Concentrating Solar Power Projects Concentrating Solar Power Projects Concentrating Solar Power Projects Concentrating Solar Power Projects

  20. Performance based incentive for Combined Heat and Power Program

    Broader source: Energy.gov [DOE]

    CHP technologies are eligible for either a grant, loan or power purchase incentive under the initial round of solicitations for new renewable energy generating equipment  up to five megawatts at ...

  1. New York Power Authority- Energy Services Programs for Public Entities

    Broader source: Energy.gov [DOE]

    New York Power Authority (NYPA) provides energy efficiency improvements to eligible public sector organizations at no up-front cost. A range of energy efficient upgrades are available through Ene...

  2. Southern Power District- Residential Energy Efficiency Rebate Programs

    Broader source: Energy.gov [DOE]

    Southern Power District (SPD) offers rebates for the purchase and installation of efficient air source heat pumps, water heaters, attic insulation, LED lighting, and HVAC tune-ups. All equipment...

  3. City Water Light and Power- Solar Rewards Program

    Broader source: Energy.gov [DOE]

    City Water, Light and Power  (CWLP) is offering residential and commercial customers a $500 per kilowatt (kW) rebate for installing solar photovoltaic (PV) systems with a maximum rebate of up to $2...

  4. Corona Department of Water & Power- Solar Partnership Rebate Program

    Broader source: Energy.gov [DOE]

    Corona Department of Water & Power is providing rebates for residential and commercial photovoltaic (PV) systems. The rebate amount for 2015 is $0.78 per watt up to $2,340 for residential...

  5. HUD PowerSaver Pilot Loan Program

    SciTech Connect (OSTI)

    Zimring, Mark; Hoffman, Ian

    2010-12-10

    The U.S. Department of Housing and Urban Development (HUD) recently announced the creation of a pilot loan program for home energy improvements. The PowerSaver loan program is a new, energy-focused variant of the Title I Property Improvement Loan Insurance Program (Title I Program) and is planned for introduction in early 2011. The PowerSaver pilot will provide lender insurance for secured and unsecured loans up to $25,000 to single family homeowners. These loans will specifically target residential energy efficiency and renewable energy improvements. HUD estimates the two-year pilot will fund approximately 24,000 loans worth up to $300 million; the program is not capped. The Federal Housing Administration (FHA), HUD's mortgage insurance unit, will provide up to $25 million in grants as incentives to participating lenders. FHA is seeking lenders in communities with existing programs for promoting residential energy upgrades.

  6. DOE Funds 15 New Projects to Develop Solar Power Storage and...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    for up to approximately 67.6 million, will facilitate the development of lower-cost energy storage for concentrating solar power (CSP) technology. These projects support...

  7. NREL: Concentrating Solar Power Research - Power Block R&D

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Power block research at NREL focuses on assessing the potential of advanced power cycles to integrate with concentrating solar power (CSP) systems. This research increases the ...

  8. Frequency up-conversion of 10. 6-micron laser

    SciTech Connect (OSTI)

    Gong, M.; Han, K.

    1990-11-07

    The paper studies the frequency up-conversion process of a 10.6 micron laser in an AgGaS{sub 2} nonlinear crystal, and presents the results of calculating the phase matching angle, the phase matching acceptance angle, and the effective bandwidth of 10.6 micron light. Thus, the frequency conversion of 10.6 micron light to 0.967 micron light is realized. In the nonfocussing mode, the maximum power conversion efficiency is greater than 7%. The eta(theta) and eta(Ip) curves were measured; the optimal phase matching angle is 38 deg 50 min for type II. Multiple factors that affect conversion efficiency are analyzed; the major noise sources of the upconversion system of an infrared detector are also analyzed.

  9. Nuclear Power in Space

    DOE R&D Accomplishments [OSTI]

    1994-01-01

    In the early years of the United States space program, lightweight batteries, fuel cells, and solar modules provided electric power for space missions. As missions became more ambitious and complex, power needs increased and scientists investigated various options to meet these challenging power requirements. One of the options was nuclear energy. By the mid-1950s, research had begun in earnest on ways to use nuclear power in space. These efforts resulted in the first radioisotope thermoelectric generators (RTGs), which are nuclear power generators build specifically for space and special terrestrial uses. These RTGs convert the heat generated from the natural decay of their radioactive fuel into electricity. RTGs have powered many spacecraft used for exploring the outer planets of the solar system and orbiting the sun and Earth. They have also landed on Mars and the moon. They provide the power that enables us to see and learn about even the farthermost objects in our solar system.

  10. Gasoline price up this week (short version)

    U.S. Energy Information Administration (EIA) Indexed Site

    short version) The U.S. average retail price for regular gasoline rose to $3.36 a gallon on Monday. That's up 4.2 cents from a week ago, based on the weekly price survey by the U.S. Energy Information Administration.

  11. New York one-ups the Valdez

    SciTech Connect (OSTI)

    Starr, R.

    1990-07-30

    Mobil Oil has agreed to spend what is expected to be tens of millions of dollars to clean up a vast and hazardous pool of oil that has been seeping under the streets of Brooklyn for more than 40 years. The persistent leak has put more oil under the streets of the area than was spilled by the Exxon Valdez.

  12. Gasoline prices inch up (long version)

    U.S. Energy Information Administration (EIA) Indexed Site

    Pump prices were highest in the West Coast region at 3.88 a gallon, down 1.1 cents from a week ago. Followed by prices in the Midwest at 3.87 a gallon, up 3 cents. Prices were ...

  13. Process Development and Scale up of Advanced Electrolyte Materials...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Scale up of Advanced Electrolyte Materials Process Development and Scale up of Advanced ... More Documents & Publications Process Development and Scale up of Advanced Electrolyte ...

  14. U.S. Renewable Energy Generation Up in First Half of 2013: EIA

    Broader source: Energy.gov [DOE]

    Renewable energy sources generated 14.2% of net U.S. electric power generation during the first six months of 2013, up from 13.6% the same time a year ago, according to data from the U.S. Energy Information Administration (EIA).

  15. Geek-Up[3.25.2011]: Idaho Wind and Chlorosome-Inspired Solar

    Broader source: Energy.gov [DOE]

    Idaho National Laboratory wind power researchers watch the weather in order to improve high-voltage transmission lines and Oak Ridge National Laboratory researches study how chlorosomes function in nature – with hopes to mimic chlorosomes’ efficiency to create biohybrid and bio-inspired solar cells -- all in this week's Geek-Up.

  16. Diagnostic and Prognostic Models for Generator Step-Up Transformers

    SciTech Connect (OSTI)

    Vivek Agarwal; Nancy J. Lybeck; Binh T. Pham

    2014-09-01

    In 2014, the online monitoring (OLM) of active components project under the Light Water Reactor Sustainability program at Idaho National Laboratory (INL) focused on diagnostic and prognostic capabilities for generator step-up transformers. INL worked with subject matter experts from the Electric Power Research Institute (EPRI) to augment and revise the GSU fault signatures previously implemented in the Electric Power Research Institute’s (EPRI’s) Fleet-Wide Prognostic and Health Management (FW-PHM) Suite software. Two prognostic models were identified and implemented for GSUs in the FW-PHM Suite software. INL and EPRI demonstrated the use of prognostic capabilities for GSUs. The complete set of fault signatures developed for GSUs in the Asset Fault Signature Database of the FW-PHM Suite for GSUs is presented in this report. Two prognostic models are described for paper insulation: the Chendong model for degree of polymerization, and an IEEE model that uses a loading profile to calculates life consumption based on hot spot winding temperatures. Both models are life consumption models, which are examples of type II prognostic models. Use of the models in the FW-PHM Suite was successfully demonstrated at the 2014 August Utility Working Group Meeting, Idaho Falls, Idaho, to representatives from different utilities, EPRI, and the Halden Research Project.

  17. DOE to Fund up to $454 Million for Retrofit Ramp-Ups in Energy Efficiency |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy 454 Million for Retrofit Ramp-Ups in Energy Efficiency DOE to Fund up to $454 Million for Retrofit Ramp-Ups in Energy Efficiency September 14, 2009 - 12:00am Addthis WASHINGTON, DC - U.S. Secretary of Energy Steven Chu today announced a new $450 million program designed to catalyze a nationwide energy upgrade that experts estimate could save $100 million annually in utility bills for households and businesses. The Recovery Act's "Retrofit Ramp-Up" program will

  18. Wind Power (pbl/generation)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Generation Hydro Power Wind Power Monthly GSP BPA White Book Dry Year Tools Firstgov Wind Power (Updated June 16, 2014) Project Descriptions Foote Creek I Wind Project (Carbon...

  19. Perfect Power | Open Energy Information

    Open Energy Info (EERE)

    Perfect Power Jump to: navigation, search Name: Perfect Power Place: Phoenix, Arizona Zip: 85028 Sector: Solar Product: Perfect Power operates the world(tm)s largest solar...

  20. Discount Power | Open Energy Information

    Open Energy Info (EERE)

    Power Place: Texas Website: www.discountpowertx.com Twitter: @DiscountPowerTX Facebook: https:www.facebook.compagesDiscount-Power-Texas1381444972140165 Outage Hotline:...

  1. Solartech Power | Open Energy Information

    Open Energy Info (EERE)

    Solartech Power Jump to: navigation, search Name: Solartech Power Place: Cerritos, California Zip: 90703 Sector: Solar Product: Solartech power is a distributer of solar modules....

  2. Eastern Power Customer Services Manager

    Broader source: Energy.gov [DOE]

    This position is located in the Eastern Power Services organization (PSE) of Northwest Requirements Marketing, Power Services, and Bonneville Power Administration (BPA). Northwest (NW) Requirements...

  3. Western Power Customer Services Manager

    Broader source: Energy.gov [DOE]

    This position is located in the Western Power Services organization (PSW) of Northwest Requirements Marketing, Power Services, and Bonneville Power Administration (BPA). Northwest (NW) Requirements...

  4. Power County | Open Energy Information

    Open Energy Info (EERE)

    County Jump to: navigation, search Name Power County Facility Power County Sector Wind energy Facility Type Commercial Scale Wind Facility Status In Service Owner CG Power...

  5. EPA Green Power Leadership Awards

    Broader source: Energy.gov [DOE]

    The U.S. Environmental Protection Agency (EPA) Green Power Leadership Awards recognize exceptional achievement among EPA Green Power Partners and among green power suppliers.

  6. Xtreme Power | Open Energy Information

    Open Energy Info (EERE)

    Zip: 78640 Product: Xtreme Power designs and manufactures power systems using power electronics and efficient storage technologies. Coordinates: 29.98837, -97.877369 Show Map...

  7. Celestial Power | Open Energy Information

    Open Energy Info (EERE)

    ":"","group":"","inlineLabel":"","visitedicon":"" Hide Map References: Celestial Power Web Site1 Celestial Power Company Profile2 Celestial Power was founded by Jim Sylvana...

  8. Scotrenewables Wind Power and Marine Power Ltd | Open Energy...

    Open Energy Info (EERE)

    Wind Power and Marine Power Ltd Jump to: navigation, search Name: Scotrenewables Wind Power and Marine Power Ltd Place: Orkey, Scotland, United Kingdom Zip: KW16 3AW Sector:...

  9. EA-1726: Kahuku Wind Power, LLC Wind Power Generation Facility...

    Office of Environmental Management (EM)

    6: Kahuku Wind Power, LLC Wind Power Generation Facility, O'ahu, HI EA-1726: Kahuku Wind Power, LLC Wind Power Generation Facility, O'ahu, HI May 3, 2010 EA-1726: Final ...

  10. ANL Study Shows Wind Power Decreases Power Sector Emissions ...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ANL Study Shows Wind Power Decreases Power Sector Emissions ANL Study Shows Wind Power Decreases Power Sector Emissions May 1, 2012 - 3:38pm Addthis This is an excerpt from the ...

  11. Top-Up Experience at SPEAR3

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Top-Up Experience at SPEAR3 * SPEAR 3 and the injector * Top-up requirements * Hardware systems and modifications * Safety systems & injected beam tracking * Interlocks & Diagnostics Contents 3GeV Injector BTS 5W, 1.6nA E W N S 3GeV 10nm-rad 500 mA Booster (White Circuit) LINAC/RF Gun 10Hz SPEAR3 Accelerator Complex PX PD/XAS SAXS/PX XAFS NEXAFS PX PX XAS/TXM ARPES Environment XAS Coherent Single bunch/pulse o Rebuild SPEAR into SPEAR3 (1999-2003) o Operated at 100mA for ~6 years (beam

  12. NDRF Introduction & Close-Up

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Event Location Date http://www.fema.gov/recoveryframework/ www.fema.gov/ppd8 http://fema.ideascale.com/ 2 NDRF Introduction & Close-Up Deborah Ingram Assistant Administrator Federal Emergency Management Agency 3 Recovery Phases 4 * Defines roles and responsibilities * Promotes the establishment of post-disaster organizations to manage recovery * Promotes a deliberate and transparent process that provides well-coordinated support to the Community * Offers strong, focused recovery leadership

  13. The Physics of Tokamak Start-Up

    Office of Scientific and Technical Information (OSTI)

    6 PPPL- 4836 The Physics of Tokamak Start-Up December, 2012 D. Mueller Princeton Plasma Physics Laboratory Report Disclaimers Full Legal Disclaimer This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government nor any agency thereof, nor any of their employees, nor any of their contractors, subcontractors or their employees, makes any warranty, express or implied, or assumes any legal liability or responsibility for

  14. Electron-Cloud Build-Up: Summary

    SciTech Connect (OSTI)

    Furman, M.A.

    2007-06-18

    I present a summary of topics relevant to the electron-cloud build-up and dissipation that were presented at the International Workshop on Electron-Cloud Effects 'ECLOUD 07' (Daegu, S. Korea, April 9-12, 2007). This summary is not meant to be a comprehensive review of the talks. Rather, I focus on those developments that I found, in my personal opinion, especially interesting. The contributions, all excellent, are posted in http://chep.knu.ac.kr/ecloud07/.

  15. Aerosol Oxidation Speeds Up in Smoggy Air

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Aerosol Oxidation Speeds Up in Smoggy Air Print Organic aerosols (nanometer-sized liquid or solid particles suspended in air) are important constituents of the troposphere, and their chemistry has large-scale impacts on climate, pollution, and health. Accurate predictions of these aerosol impacts require a robust microphysical understanding of all relevant chemical reaction mechanisms and time scales, including those involving highly reactive free-radical molecules. However, detailed modeling is

  16. Aerosol Oxidation Speeds Up in Smoggy Air

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Aerosol Oxidation Speeds Up in Smoggy Air Print Organic aerosols (nanometer-sized liquid or solid particles suspended in air) are important constituents of the troposphere, and their chemistry has large-scale impacts on climate, pollution, and health. Accurate predictions of these aerosol impacts require a robust microphysical understanding of all relevant chemical reaction mechanisms and time scales, including those involving highly reactive free-radical molecules. However, detailed modeling is

  17. Aerosol Oxidation Speeds Up in Smoggy Air

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Aerosol Oxidation Speeds Up in Smoggy Air Print Organic aerosols (nanometer-sized liquid or solid particles suspended in air) are important constituents of the troposphere, and their chemistry has large-scale impacts on climate, pollution, and health. Accurate predictions of these aerosol impacts require a robust microphysical understanding of all relevant chemical reaction mechanisms and time scales, including those involving highly reactive free-radical molecules. However, detailed modeling is

  18. The commercialization of magnetohydrodynamic electric power plants

    SciTech Connect (OSTI)

    Weinstein, R.E.

    1993-12-31

    The successful development of Magnetohydrodynamics (MHD) will provide an ultra clean, highly efficient alternative to other methods of coal-fired electric Power generation. A development path that could bring coal-fired MHD electric power plants to competitive commercial status is described in this paper. The paper discusses the scale-ups, the timing, and technical hurdles that face this technology as it progresses from its present status of small-scale demonstrations and begins its competition for electric utility acceptance. Coal-fired MHD power has at least four major markets: (1) New utility generation. (2) Utility retrofit/repowering applications. (3) New independent power production (IPP). (4) Large industrial cogeneration application. Of these, the largest market for MHD is expected to be the new electric utility/IPP generation market, those new units required to supply growth in power demand and to replace retired capacity. This market sector is the focus of this discussion. This paper describes the commercial pressures and inertias that motivate the entry of any new technology into the generation supply market. It then shows a development path that could bring coal-fired MHD electric power plants to competitive commercial status in the electric power industry.

  19. Peak power ratio generator

    DOE Patents [OSTI]

    Moyer, R.D.

    A peak power ratio generator is described for measuring, in combination with a conventional power meter, the peak power level of extremely narrow pulses in the gigahertz radio frequency bands. The present invention in a preferred embodiment utilizes a tunnel diode and a back diode combination in a detector circuit as the only high speed elements. The high speed tunnel diode provides a bistable signal and serves as a memory device of the input pulses for the remaining, slower components. A hybrid digital and analog loop maintains the peak power level of a reference channel at a known amount. Thus, by measuring the average power levels of the reference signal and the source signal, the peak power level of the source signal can be determined.

  20. Peak power ratio generator

    DOE Patents [OSTI]

    Moyer, Robert D.

    1985-01-01

    A peak power ratio generator is described for measuring, in combination with a conventional power meter, the peak power level of extremely narrow pulses in the gigahertz radio frequency bands. The present invention in a preferred embodiment utilizes a tunnel diode and a back diode combination in a detector circuit as the only high speed elements. The high speed tunnel diode provides a bistable signal and serves as a memory device of the input pulses for the remaining, slower components. A hybrid digital and analog loop maintains the peak power level of a reference channel at a known amount. Thus, by measuring the average power levels of the reference signal and the source signal, the peak power level of the source signal can be determined.

  1. Water Power Personnel

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Personnel - Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel Cycle Defense Waste Management Programs Advanced Nuclear Energy

  2. Concentrating Solar Power

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4 Concentrating Solar Power Concentrating solar power (CSP) technologies use mirrors to focus and concentrate sunlight onto a receiver, from which a heat transfer fluid carries the intense thermal energy to a power block to generate electricity. A distinguishing feature of CSP is its ability to incorporate simple, efficient, and cost-effective thermal energy storage by virtue of converting sunlight to heat as an intermediate step to generating electricity. In addition to providing dispatchable

  3. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    DOE Order No. RA 6120.2 Repayment Process Under Department of Energy Order No. RA 6120.2, Southwestern conducts power repayment studies each year to determine the amount of revenue required to recover costs assigned to power, including the annual cost of marketing power, the cost of operating and maintaining the generating facilities, and, for the Integrated System and Sam Rayburn, the cost of the original investment in building the facilities, plus interest. Southwestern conducts three such

  4. Electric power annual 1993

    SciTech Connect (OSTI)

    Not Available

    1994-12-08

    This report presents a summary of electric power industry statistics at national, regional, and state levels: generating capability and additions, net generation, fossil-fuel statistics, retail sales and revenue, finanical statistics, environmental statistics, power transactions, demand side management, nonutility power producers. Purpose is to provide industry decisionmakers, government policymakers, analysts, and the public with historical data that may be used in understanding US electricity markets.

  5. Electric Power Monthly

    Gasoline and Diesel Fuel Update (EIA)

    Electric Power Monthly > Electric Power Monthly Back Issues Electric Power Monthly Back Issues Monthly Excel files zipped 2010 January February March April May June July August September October November December 2009 January February March April May June July August September October November December 2008 January February March March Supplement April May June July August September October November December 2007 January February March April May June July August September October November

  6. Power Metering Project

    K-12 Energy Lesson Plans and Activities Web site (EERE)

    There are many devices around campus that use electricity, but it helps to have an understanding of how much power each type of device uses. With this information, you are better able to focus efforts on reducing power consumption. With basic power data collection and analysis, we can begin to answer questions like: how much money does it cost the school to leave all the computers on at night?

  7. Power Towers for Utilities

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Towers for Utilities - Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel Cycle Defense Waste Management Programs Advanced

  8. Interleaved power converter

    DOE Patents [OSTI]

    Zhu, Lizhi

    2007-11-13

    A power converter architecture interleaves full bridge converters to alleviate thermal management problems in high current applications, and may, for example, double the output power capability while reducing parts count and costs. For example, one phase of a three phase inverter is shared between two transformers, which provide power to a rectifier such as a current doubler rectifier to provide two full bridge DC/DC converters with three rather than four high voltage inverter legs.

  9. Concentrating Solar Power

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel Cycle Defense Waste Management Programs Advanced Nuclear Energy Nuclear

  10. Concentrating Solar Power (CSP)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    (CSP) - Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel Cycle Defense Waste Management Programs Advanced Nuclear Energy

  11. PowerPoint Presentation

    Office of Environmental Management (EM)

    water is a critical issue for nuclear power reactors, especially when ground water becomes ... been funded through the NNSA Nuclear Safety Research and Development Working ...

  12. PowerPoint Presentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Residential Variable Capacity Heat Pump Advanced Rooftop Unit Heat Pump Technology Japan Experience Next Generation HP Refrigerants Load Based testing Power Quality...

  13. PowerPoint Presentation

    Energy Savers [EERE]

    PowerCentsDC Program Final Report PowerCentsDC Program Final Report In 2007 the Smart Meter Pilot Program Inc initiated PowerCentsDC to test the reactions and impacts on consumer behavior of smart prices, smart meters, and smart thermostats in the District of Columbia. PDF icon PowerCentsDC Program Final Report More Documents & Publications Guidebook for ARRA Smart Grid Program Metrics and Benefits Interim Report on Customer Acceptance, Retention, and Response to Time-Based Rates from the

  14. SOUTHWESTERN POWER ADMINISTRATION

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ADMINISTRATION CATEGORICAL EXCLUSION (CX) DETERMINATION BRIEF DESCRIPTION OF PROPOSED ACTION: Hydroelectric Power Rate Increase for the Integrated System of Hydropower Projects. ...

  15. Power Marketing Specialist

    Broader source: Energy.gov [DOE]

    (See Frequently Asked Questions for more information). Where would I be working? Western Area Power Administration, Corporate Services Office, Office of the Chief Operating Officer, Technical...

  16. PowerPoint Presentation

    Energy Savers [EERE]

    Spilling of Water DroughtWet Years Completion delays M&I Water Use 2 ... to power over a reasonable period of years." 3 Pay annual costs first: ...

  17. CSTI high capacity power

    SciTech Connect (OSTI)

    Winter, J.M.

    1994-09-01

    The SP-100 program was established in 1983 by DOD, DOE, and NASA as a joint program to develop the technology necessary for space nuclear power systems for military and civil application. During FY86 and 87, the NASA SP-100 Advanced Technology Program was devised to maintain the momentum of promising technology advancement efforts started during Phase I of SP-100 and to strengthen, in key areas, the chances for successful development and growth capability of space nuclear reactor power systems for future space applications. In FY88, the Advanced Technology Program was incorporated into NASA`s new Civil Space Technology Initiative (CSTI). The CSTI Program was established to provide the foundation for technology development in automation and robotics, information, propulsion, and power. The CSTI High Capacity Power Program builds on the technology efforts of the SP-100 program, incorporates the previous NASA SP-100 Advanced Technology project, and provides a bridge to NASA Project Pathfinder. The elements of CSTI High Capacity Power development include Conversion Systems, Thermal Management, Power Management, System Diagnostics, and Environmental Interactions. Technology advancement in all areas, including materials, is required to assure the high reliability and 7 to 10 year lifetime demanded for future space nuclear power systems. The overall program will develop and demonstrate the technology base required to provide a wide range of modular power systems as well as allowing mission independence from solar and orbital attitude requirements. Several recent advancements in CSTI High Capacity power development will be discussed.

  18. PowerPoint Presentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Some new things Power to the People Steering Committee Andy Vogelmann, Greg McFarquhar, John Ogren, Dave Turner, Jennifer Comstock, Graham Feingold, Chuck Long AVP Technical &...

  19. Power Purchase Agreement Webinars

    Broader source: Energy.gov [DOE]

    Provides a listing of past power purchase agreement webinars and associated files. Author: U. S. Department of Energy, Energy Efficiency & Renewable Energy

  20. Solar Power Purchase Agreements

    Broader source: Energy.gov [DOE]

    Provides an overview of solar power purchase agreements including how they work, benefits and challenges and eligibility. Author: United States Environmental Protection Agency (EPA)

  1. Concentrating Solar Power

    SciTech Connect (OSTI)

    Solar Energy Technologies Program

    2010-09-28

    The fact sheet summarizes the goals and activities of the DOE Solar Energy Technologies Program efforts within its concentrating solar power subprogram.

  2. Bonneville Power Administration

    Energy Savers [EERE]

    March 2015 Bonneville Power Administration's Hooper ... circuit 115-kV transmission line that will extend generally ... new land rights acquired for ROW or access road easements. ...

  3. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and terms and conditions and anyall notifications to listed customers of sale of Hydro Power Peaking, Peaking Energy and Supplemental Peaking Energy that have been increased,...

  4. Solar Power International

    Broader source: Energy.gov [DOE]

    Solar Power International in Anaheim, CA, received Vice President Joe Biden on Sept. 16. He announced more than $102 million in new solar funding.

  5. Combined Heat and Power

    Energy Savers [EERE]

    ... Energy and Water from Waste for the Food and Beverage ... Reciprocating Internal Combustion 223 Engine System for ... System for Combined Heat and Power 225 - Low-NOx ...

  6. PowerPoint Presentation

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Systems Program 1 DOE Energy Storage & Power Electronics Research Programs October 8, 2009 Marcelo Schupbach, Ph.D. Chief Technology Officer APEI, Inc. 535 Research Center Blvd. ...

  7. PowerPoint Presentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... Operational Switch to STAD Canister at Power Plants 1. No near-term changes ... critical for the degraded cases defined - Saline water ( 35 Cl > seawater) could provide ...

  8. PowerPoint Presentation

    Energy Savers [EERE]

    Systems Program 1 DOE Energy Storage & Power Electronics Research Programs October 8, 2009 Marcelo Schupbach, Ph.D. Chief Technology Officer APEI, Inc. 535 Research Center Blvd. Fayetteville, AR 72701 Phone: (479)-443-5759 Email: mschupb@apei.net Website: www.apei.net Very High Temperature (400+ °C) High-Power Silicon Carbide (SiC) Power Electronics Converter Energy Storage Systems Program 2 Overview * Broader Impact of SiC-based Power Converter * Phase I Review * Phase II Review * Related

  9. BPA Power Services (PBL)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Executives Hydro Power 2010 Modified Streamflows BPA Fuel Mix Site Map Other Related Web Sites: BPA Energy Efficiency (EE) BPA Transmission Services BPA Environment, Fish, &...

  10. Concentrating Solar Power

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water ...

  11. Current Power Rates

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    links Financial Information Financial Public Processes Asset Management Cost Verification Process Rate Cases Rate Information Current Power Rates Current Transmission Rates...

  12. Previous Power Rates

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    links Financial Information Financial Public Processes Asset Management Cost Verification Process Rate Cases Rate Information Current Power Rates Current Transmission Rates...

  13. BONNEVILLE POWER ADMINISTRATION

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Weatherization Program Support, BPA 2:00 One Utility's Low Income Program - Jeremy Stewart, Tacoma Power 2:30 CAP and Utility Collaboration * UtilityCAP contracts for...

  14. Wind Power Forecasting Data

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Operations Call 2012 Retrospective Reports 2012 Retrospective Reports 2011 Smart Grid Wind Integration Wind Integration Initiatives Wind Power Forecasting Wind Projects Email...

  15. Solar power tower

    SciTech Connect (OSTI)

    None, None

    2009-01-18

    The solar power tower section of the Renewable Energy Technology Characterizations describes the technical and economic status of this emerging renewable energy option for electricity supply.

  16. BONNEVILLE POWER ADMINISTRATION

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    O&M Costs (Column AZ) Present Value of Periodic Capital Replacement Cost (Column BA) Power System Transmission System Coincident Factor (Column BB) Distribution System...

  17. River of Power (1987)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Volume One Film Collection Volume Two 75th Anniversary Hydropower in the Northwest Woody Guthrie Videos Strategic Direction Branding & Logos Power of the River History Book...

  18. Water Power Program: Publications

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2014 Hydropower Market Report Details Bookmark & Share View Related Welcome to the Water Power Program Publication and Product Library. This library will allow you to find...

  19. Power Prepayment Program

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Program Overview Power Prepay Term Sheet Summary Request for Offers Prepayment Framework Business Case Model (Customer Prepay Impact Model) (updated 8202012) Instructions for...

  20. PowerPoint Presentation

    Office of Environmental Management (EM)

    Background - SBIR Program The blanket material systems topic seeks to address the challenges in harnessing fusion power, and developing the fusion fuel cycle technology through an ...

  1. Sandia Energy - Water Power

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News & Events, Partnership, Renewable Energy, Systems Analysis, Systems Engineering, Water Power WEC-Sim Code Development Meeting at the National Renewable Energy Laboratory...

  2. Concentrating Solar Power

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel ... SubTER Carbon Sequestration Program Leadership EnergyWater Nexus EnergyWater History ...

  3. Power Towers for Utilities

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel ... SubTER Carbon Sequestration Program Leadership EnergyWater Nexus EnergyWater History ...

  4. the Bonneville Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Bonneville Power Administration deposited 12, 535,000 to the reclamation fund in the United States Treasury for the ac- count of Columbia Basin Project, Yakima Project...

  5. PowerPoint Presentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Electric Power System Transition to a Modern Grid Distribution ... farms * Higher DC and AC transmission voltages - Reduce line losses * Low loss cables * Cyber ...

  6. Alabama Power- UESC Activities

    Broader source: Energy.gov [DOE]

    Presentation—given at the Fall 2012 Federal Utility Partnership Working Group (FUPWG) meeting—discusses Alabama Power and its utility energy service contract (UESC) projects and activities.

  7. PowerPoint Presentation

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    The two options considered in the early design in Phase II were similar in their heat transfer and power generation components, but different in their kinematic lower...

  8. Pacific Power- wattsmart Business

    Broader source: Energy.gov [DOE]

    Pacific Power's wattsmart Business Program includes incentives and technical assistance for lighting, HVAC and other equipment upgrades that increase energy efficiency and exceed code requirements...

  9. Power Control System

    Energy Science and Technology Software Center (OSTI)

    1995-02-24

    Power Control System (PCS) is used as a real time control software package for Supervisory Control and Data Acquistion (SCADA) in an electric utility control center environment.

  10. PowerPoint Presentation

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Purchase Power Expense SEPA Marketing Expense Interest on the Federal ... cancellation is June 30, 2017 * SEPA Marketing Policy established in the early 1980's * ...

  11. Nevis Power | Open Energy Information

    Open Energy Info (EERE)

    Nevis Power Jump to: navigation, search Name: Nevis Power Place: United Kingdom Product: Subsidiary of Welsh Power Group. References: Nevis Power1 This article is a stub. You can...

  12. Sandia Energy - Conventional Water Power: Technology Development

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Technology Development Home Stationary Power Energy Conversion Efficiency Water Power Conventional Water Power: Technology Development Conventional Water Power: Technology...

  13. Federal On-Site Renewable Power Purchase Agreements | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Project Financing » Federal On-Site Renewable Power Purchase Agreements Federal On-Site Renewable Power Purchase Agreements Federal On-Site Renewable Power Purchase Agreements On-site renewable power purchase agreements (PPAs) allow federal agencies to fund renewable energy projects with minimal up-front capital costs incurred. With a PPA, a developer installs a renewable energy system on agency property under an agreement that the agency will purchase the power generated by the system. The

  14. Concentrating Solar Power Newsletter | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Newsletter Concentrating Solar Power Newsletter The SunShot concentrating solar power (CSP) newsletter highlights the progress made by the SunShot CSP program and its partners over the past quarter. Update your subscriptions, modify your password or e-mail address, or stop subscriptions at any time on your subscriber preferences page. You will need to use your e-mail address to log in. Stay Updated Sign up for our e-newsletter. Submit your email address below. Subscribe SunShot Home About the

  15. Southeastern Power Administration | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Southeastern Power Administration Southeastern Power Administration Southeastern Power Administration View All Maps Addthis

  16. Wind power interconnection into the power system: a review of grid code requirements

    SciTech Connect (OSTI)

    Singh, Bharat; Singh, S.N.

    2009-06-15

    The burgeoning wind sector, and its increasing influence on the operation and control of power systems, has made grid integration a key recent concern. Different countries are taking different approaches in setting up new grid codes to address this issue. (author)

  17. $50 and up underground house book

    SciTech Connect (OSTI)

    Oehler, M.

    1981-01-01

    Earth-sheltered housing can be livable, compatible with nature, and inexpensive. Plans and designs for low-cost houses that are integrated with their environment make up most of this book. The author begins by outlining 23 advantages of underground housing and describing the histories of several unconventional buildings in the $50 to $500 price range. He also suggests where building materials can be bought and scrounged, describes construction techniques, and explains how to cope with building codes. Sketches, floorplans, and photographs illustrate the text. 8 references, 4 tables. (DCK)

  18. NUCLEAR POWER PLANT

    DOE Patents [OSTI]

    Carter, J.C.; Armstrong, R.H.; Janicke, M.J.

    1963-05-14

    A nuclear power plant for use in an airless environment or other environment in which cooling is difficult is described. The power plant includes a boiling mercury reactor, a mercury--vapor turbine in direct cycle therewith, and a radiator for condensing mercury vapor. (AEC)

  19. Electrically powered hand tool

    DOE Patents [OSTI]

    Myers, Kurt S.; Reed, Teddy R.

    2007-01-16

    An electrically powered hand tool is described and which includes a three phase electrical motor having a plurality of poles; an electrical motor drive electrically coupled with the three phase electrical motor; and a source of electrical power which is converted to greater than about 208 volts three-phase and which is electrically coupled with the electrical motor drive.

  20. Power API Prototype

    Energy Science and Technology Software Center (OSTI)

    2014-12-04

    The software serves two purposes. The first purpose of the software is to prototype the Sandia High Performance Computing Power Application Programming Interface Specification effort. The specification can be found at http://powerapi.sandia.gov . Prototypes of the specification were developed in parallel with the development of the specification. Release of the prototype will be instructive to anyone who intends to implement the specification. More specifically, our vendor collaborators will benefit from the availability of the prototype.more » The second is in direct support of the PowerInsight power measurement device, which was co-developed with Penguin Computing. The software provides a cluster wide measurement capability enabled by the PowerInsight device. The software can be used by anyone who purchases a PowerInsight device. The software will allow the user to easily collect power and energy information of a node that is instrumented with PowerInsight. The software can also be used as an example prototype implementation of the High Performance Computing Power Application Programming Interface Specification.« less

  1. E-beam high voltage switching power supply

    DOE Patents [OSTI]

    Shimer, Daniel W.; Lange, Arnold C.

    1996-01-01

    A high-power power supply produces a controllable, constant high voltage put under varying and arcing loads. The power supply includes a voltage regulator, an inductor, an inverter for producing a high frequency square wave current of alternating polarity, an improved inverter voltage clamping circuit, a step up transformer, an output rectifier for producing a dc voltage at the output of each module, and a current sensor for sensing output current. The power supply also provides dynamic response to varying loads by controlling the voltage regulator duty cycle and circuitry is provided for sensing incipient arc currents at the output of the power supply to simultaneously decouple the power supply circuitry from the arcing load. The power supply includes a plurality of discrete switching type dc--dc converter modules.

  2. E-beam high voltage switching power supply

    DOE Patents [OSTI]

    Shimer, D.W.; Lange, A.C.

    1996-10-15

    A high-power power supply produces a controllable, constant high voltage output under varying and arcing loads. The power supply includes a voltage regulator, an inductor, an inverter for producing a high frequency square wave current of alternating polarity, an improved inverter voltage clamping circuit, a step up transformer, an output rectifier for producing a dc voltage at the output of each module, and a current sensor for sensing output current. The power supply also provides dynamic response to varying loads by controlling the voltage regulator duty cycle and circuitry is provided for sensing incipient arc currents at the output of the power supply to simultaneously decouple the power supply circuitry from the arcing load. The power supply includes a plurality of discrete switching type dc--dc converter modules. 5 figs.

  3. Heatpipe space power and propulsion systems

    SciTech Connect (OSTI)

    Houts, M.G.; Poston, D.I.; Ranken, W.A.

    1995-12-01

    Safe, reliable, low-mass space power and propulsion systems could have numerous civilian and military applications. This paper discusses two fission-powered concepts: The Heatpipe Power System (HPS), which provides power only; and the Heatpipe Bimodal System (HBS), which provides both power and thermal propulsion. Both concepts have 10 important features. First, only existing technology and recently tested fuel forms are used. Second, fuel can be removed whenever desired, which greatly facilitates system fabrication and handling. Third, full electrically heated system testing of all modes is possible, with minimal operations required to replace the heaters with fuel and to ready the system for launch. Fourth, the systems are passively subcritical during launch accidents. Fifth, a modular approach is used, and most technical issues can be resolved with inexpensive module tests. Sixth, bonds between dissimilar metals are minimized. Seventh, there are no single-point failures during power mode operation. Eighth, the fuel burnup rate is quite low to help ensure >10-yr system life. Ninth, there are no pumped coolant loops, and the systems can be shut down and restarted without coolant freeze/thaw concerns. Finally, full ground nuclear test is not needed, and development costs will be low. One design for a low-power HPS uses SNAP-10A-style thermoelectric power converters to produce 5 kWe at a system mass of {approximately}500 kg. The unicouple thermoelectric converters have a hot-shoe temperature of 1275 K and reject waste heat at 775 K. This type of thermoelectric converter has been used extensively by the space program and has demonstrated an operational lifetime of decades. A core with a larger number of smaller modules (same overall size) can be used to provide up to 500 kWt to a power conversion subsystem, and a slightly larger core using a higher heatpipe to fuel ratio can provide >1 MWt.

  4. TidGen Power System Commercialization Project

    SciTech Connect (OSTI)

    Sauer, Christopher R.; McEntee, Jarlath

    2013-12-30

    ORPC Maine, LLC, a wholly-owned subsidiary of Ocean Renewable Power Company, LLC (collectively ORPC), submits this Final Technical Report for the TidGen® Power System Commercialization Project (Project), partially funded by the U.S. Department of Energy (DE-EE0003647). The Project was built and operated in compliance with the Federal Energy Regulatory Commission (FERC) pilot project license (P-12711) and other permits and approvals needed for the Project. This report documents the methodologies, activities and results of the various phases of the Project, including design, engineering, procurement, assembly, installation, operation, licensing, environmental monitoring, retrieval, maintenance and repair. The Project represents a significant achievement for the renewable energy portfolio of the U.S. in general, and for the U.S. marine hydrokinetic (MHK) industry in particular. The stated Project goal was to advance, demonstrate and accelerate deployment and commercialization of ORPC’s tidal-current based hydrokinetic power generation system, including the energy extraction and conversion technology, associated power electronics, and interconnection equipment capable of reliably delivering electricity to the domestic power grid. ORPC achieved this goal by designing, building and operating the TidGen® Power System in 2012 and becoming the first federally licensed hydrokinetic tidal energy project to deliver electricity to a power grid under a power purchase agreement in North America. Located in Cobscook Bay between Eastport and Lubec, Maine, the TidGen® Power System was connected to the Bangor Hydro Electric utility grid at an on-shore station in North Lubec on September 13, 2012. ORPC obtained a FERC pilot project license for the Project on February 12, 2012 and the first Maine Department of Environmental Protection General Permit issued for a tidal energy project on January 31, 2012. In addition, ORPC entered into a 20-year agreement with Bangor Hydro Electric Company on January 1, 2013 for up to 5 megawatts at a price of $215/MWh, escalating at 2.0% per year.

  5. Power module assembly

    DOE Patents [OSTI]

    Campbell, Jeremy B.; Newson, Steve

    2011-11-15

    A power module assembly of the type suitable for deployment in a vehicular power inverter, wherein the power inverter has a grounded chassis, is provided. The power module assembly comprises a conductive base layer electrically coupled to the chassis, an insulating layer disposed on the conductive base layer, a first conductive node disposed on the insulating layer, a second conductive node disposed on the insulating layer, wherein the first and second conductive nodes are electrically isolated from each other. The power module assembly also comprises a first capacitor having a first electrode electrically connected to the conductive base layer, and a second electrode electrically connected to the first conductive node, and further comprises a second capacitor having a first electrode electrically connected to the conductive base layer, and a second electrode electrically connected to the second conductive node.

  6. AC power systems handbook

    SciTech Connect (OSTI)

    Whitaker, J.

    1991-01-01

    Transient disturbances are what headaches are made of. Whatever you call them-spikes, surges, are power bumps-they can take your equipment down and leave you with a complicated and expensive repair job. Protection against transient disturbances is a science that demands attention to detail. This book explains how the power distribution system works, what can go wrong with it, and how to protect a facility against abnormalities. system grounding and shielding are covered in detail. Each major method of transient protection is analyzed and its relative merits discussed. The book provides a complete look at the critical elements of the ac power system. Provides a complete look at the ac power system from generation to consumption. Discusses the mechanisms that produce transient disturbances and how to protect against them. Presents diagrams to facilitate system design. Covers new areas, such as the extent of the transient disturbance problem, transient protection options, and stand-by power systems.

  7. Heating up the Galaxy with hidden photons

    SciTech Connect (OSTI)

    Dubovsky, Sergei; Hernández-Chifflet, Guzmán

    2015-12-29

    We elaborate on the dynamics of ionized interstellar medium in the presence of hidden photon dark matter. Our main focus is the ultra-light regime, where the hidden photon mass is smaller than the plasma frequency in the Milky Way. We point out that as a result of the Galactic plasma shielding direct detection of ultra-light photons in this mass range is especially challenging. However, we demonstrate that ultra-light hidden photon dark matter provides a powerful heating source for the ionized interstellar medium. This results in a strong bound on the kinetic mixing between hidden and regular photons all the way down to the hidden photon masses of order 10{sup −20} eV.

  8. TEP Power Partners Project [Tucson Electric Power

    SciTech Connect (OSTI)

    None, None

    2014-02-06

    The Arizona Governor’s Office of Energy Policy, in partnership with Tucson Electric Power (TEP), Tendril, and Next Phase Energy (NPE), formed the TEP Power Partners pilot project to demonstrate how residential customers could access their energy usage data and third party applications using data obtained from an Automatic Meter Reading (AMR) network. The project applied for and was awarded a Smart Grid Data Access grant through the U.S. Department of Energy. The project participants’ goal for Phase I is to actively engage 1,700 residential customers to demonstrate sustained participation, reduction in energy usage (kWh) and cost ($), and measure related aspects of customer satisfaction. This Demonstration report presents a summary of the findings, effectiveness, and customer satisfaction with the 15-month TEP Power Partners pilot project. The objective of the program is to provide residential customers with energy consumption data from AMR metering and empower these participants to better manage their electricity use. The pilot recruitment goals included migrating 700 existing customers from the completed Power Partners Demand Response Load Control Project (DRLC), and enrolling 1,000 new participants. Upon conclusion of the project on November 19, 2013; 1,390 Home Area Networks (HANs) were registered; 797 new participants installed a HAN; Survey respondents’ are satisfied with the program and found value with a variety of specific program components; Survey respondents report feeling greater control over their energy usage and report taking energy savings actions in their homes after participating in the program; On average, 43 % of the participants returned to the web portal monthly and 15% returned weekly; and An impact evaluation was completed by Opinion Dynamics and found average participant savings for the treatment period1 to be 2.3% of their household use during this period.2 In total, the program saved 163 MWh in the treatment period of 2013.

  9. Breaking Up - And Making Up - Are Hard To Do | U.S. DOE Office of

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Breaking Up (Hydrogen) No Longer As Hard To Do Breaking Up (Hydrogen) No Longer As Hard To Do December 29, 2011 - 1:12pm Addthis Researchers at Argonne National Lab have recently developed a process to improve the efficiency of producing hydrogen to run cars such as this prototype, which was developed at the Oakridge National Lab. | Photo courtesy of Oak Ridge National Laboratory. Researchers at Argonne National Lab have recently developed a process to improve the efficiency of producing

  10. PowerPoint Presentation

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    True-up Projections Current Rate Schedules New Rate Schedules were effective October 1, 2015. The Rate Schedules have been approved on an interim basis through September ...

  11. PowerPoint Presentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the need for replacement tanks (up to 100 M per tank) MonitorStatus tank corrosion * Monitor with ultrasonic testing, visual inspections, and corrosion monitoring to...

  12. PowerPoint Presentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PROCESS - PRE-DECISIONAL DRAFT 1 DELIBERATIVE PROCESS - PRE-DECISIONAL DRAFT Ben Harp, Manager WTP Start-Up and Commissioning Integration Hanford Tank Waste Retrieval,...

  13. PowerPoint Presentation

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Protections 8 1. US and Chinese businesses and research teams match up to accelerate invention and commercial success. 2. Industry partners assume central roles in research,...

  14. BPA Power Generation (pbl/main)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Generation Hydro Power Wind Power Monthly GSP BPA White Book Dry Year Tools Firstgov Power Generation Hydro Power Federal Columbia River Power System (FCRPS) Hydro Projects FCRPS...

  15. Electric power annual 1992

    SciTech Connect (OSTI)

    Not Available

    1994-01-06

    The Electric Power Annual presents a summary of electric utility statistics at national, regional and State levels. The objective of the publication is to provide industry decisionmakers, government policymakers, analysts and the general public with historical data that may be used in understanding US electricity markets. The Electric Power Annual is prepared by the Survey Management Division; Office of Coal, Nuclear, Electric and Alternate Fuels; Energy Information Administration (EIA); US Department of Energy. ``The US Electric Power Industry at a Glance`` section presents a profile of the electric power industry ownership and performance, and a review of key statistics for the year. Subsequent sections present data on generating capability, including proposed capability additions; net generation; fossil-fuel statistics; retail sales; revenue; financial statistics; environmental statistics; electric power transactions; demand-side management; and nonutility power producers. In addition, the appendices provide supplemental data on major disturbances and unusual occurrences in US electricity power systems. Each section contains related text and tables and refers the reader to the appropriate publication that contains more detailed data on the subject matter. Monetary values in this publication are expressed in nominal terms.

  16. Dormaier and Chester Butte 2007 Follow-up Habitat Evaluation Procedures Report.

    SciTech Connect (OSTI)

    Ashley, Paul R.

    2008-01-01

    Follow-up habitat evaluation procedures (HEP) analyses were conducted on the Dormaier and Chester Butte wildlife mitigation sites in April 2007 to determine the number of additional habitat units to credit Bonneville Power Administration (BPA) for providing funds to enhance, and maintain the project sites as partial mitigation for habitat losses associated with construction of Grand Coulee Dam. The Dormaier follow-up HEP survey generated 482.92 habitat units (HU) or 1.51 HUs per acre for an increase of 34.92 HUs over baseline credits. Likewise, 2,949.06 HUs (1.45 HUs/acre) were generated from the Chester Butte follow-up HEP analysis for an increase of 1,511.29 habitat units above baseline survey results. Combined, BPA will be credited with an additional 1,546.21 follow-up habitat units from the Dormaier and Chester Butte parcels.

  17. Heat pump with freeze-up prevention

    DOE Patents [OSTI]

    Ecker, Amir L.

    1981-01-01

    What is disclosed is a heat pump apparatus for conditioning a fluid characterized by a fluid handler and path for circulating the fluid in heat exchange relationship with a refrigerant fluid; at least two refrigerant heat exchangers, one for effecting heat exchange with the fluid and a second for effecting heat exchange between refrigerant and a heat exchange fluid and the ambient air; a compressor for efficiently compressing the refrigerant; at least one throttling valve for throttling liquid refrigerant; a refrigerant circuit; refrigerant; a source of heat exchange fluid; heat exchange fluid circulating device and heat exchange fluid circuit for circulating the heat exchange fluid in heat exchange relationship with the refrigerant; and valves or switches for selecting the heat exchangers and direction of flow of the refrigerant therethrough for selecting a particular mode of operation. The heat exchange fluid prevents freeze up of the second heat exchanger by keeping the temperature above the dew point; and, optionally, provides heat for efficient operation.

  18. Thermoelectric power generator for variable thermal power source

    DOE Patents [OSTI]

    Bell, Lon E; Crane, Douglas Todd

    2015-04-14

    Traditional power generation systems using thermoelectric power generators are designed to operate most efficiently for a single operating condition. The present invention provides a power generation system in which the characteristics of the thermoelectrics, the flow of the thermal power, and the operational characteristics of the power generator are monitored and controlled such that higher operation efficiencies and/or higher output powers can be maintained with variably thermal power input. Such a system is particularly beneficial in variable thermal power source systems, such as recovering power from the waste heat generated in the exhaust of combustion engines.

  19. Linking Humans and Systems in Nuclear Power

    SciTech Connect (OSTI)

    Jacques Hugo

    2013-02-01

    Traditional engineering methods do not make provision for the integration of human considerations, while traditional human factors methods do not scale well to the complexity of large-scale nuclear power plant projects. Although the need for up-to-date human factors engineering processes and tools is recognised widely in industry, so far no formal guidance has been developed. This article proposes such a framework.

  20. TWRS privatization phase 1 electrical power system

    SciTech Connect (OSTI)

    Singh, G.

    1997-05-30

    This document includes Conceptual Design Report (CDR) for a new 11 km (7 miles) 230 kV transmission line and a new 40 MVA substation (A6) which will be located east of Grout Facility in 200E Area tank farm. This substation will provide electrical power up to 20 MW each for two private contractor facilities for immobilization and disposal of low activity waste (LAW).

  1. Salazar on private power

    SciTech Connect (OSTI)

    Anderson, J.

    1995-02-01

    The Philipines power market, considered one of the more mature markets in Asia, continues to expand with economic growth. Independent power producers will find opportunities in the next few years as new additions are required. Currently, the government is encouraging private investment and is awaiting feedback from financiers as it considers eliminating its government guarantee. In a recent interview, the Honorable Mariano S. Salazar, secretary of energy, with the Philippines` Department of Energy, discussed the regulatory structure, encouragement of private power and his country`s capital needs.

  2. NREL and Stanford Team up on Peel-and-Stick Solar Cells - News Releases |

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NREL and Stanford Team up on Peel-and-Stick Solar Cells Devices could charge battery-powered products in the future January 10, 2013 It may be possible soon to charge cell phones, change the tint on windows, or power small toys with peel-and-stick versions of solar cells, thanks to a partnership between Stanford University and the U.S. Department of Energy's National Renewable Energy Laboratory (NREL). A scientific paper, "Peel and Stick: Fabricating Thin Film Solar Cells on Universal

  3. OTEC power system development and environmental impacts

    SciTech Connect (OSTI)

    Sather, N.F.

    1980-02-20

    Ocean Thermal Energy Conversion (OTEC) is a proven solar energy technology with enormous potential as a supplier of electric power. However, before this potential can be realized there must be significant reductions in OTEC plant investment costs estimated for state-of-the-art designs. A comprehensive survey of the opportunities for reducing costs of the heat exchangers and other components of the power system of closed-cycle OTEC plants is given. These cost-reducing inventives are strongly dependent on the extent to which the environmental impacts of OTEC plants will have to be controlled. The environmental concerns associated with the deployment of OTEC plants are reviewed, and approaches to alleviating these concerns are described. Finally, the key roles of the OTEC-1 component test facility and the OTEC pilot plant planned for a 1984 start up in providing information about the critical power system development and environmental impact problems are summarized.

  4. Wind Power Reliability: Breaking Down a Barrier

    Broader source: Energy.gov [DOE]

    The steady increase of wind power on the grid presents new challenges for power system operators charged with making sure the grid stays up and running. "We need to ensure that we are going down a path that will lead to better reliability [with wind power]," said Bob Zavadil, an executive vice president at EnerNex Corporation in Knoxville, Tenn., a firm specializing in renewable energy grid interconnection and integration. "If this piece isn't done, there will be problems." EnerNex has spent the last decade perfecting wind turbine and plant models that test a wind plant's influence on the grid and its ability to provide grid support. In its latest effort, the company is using American Recovery and Reinvestment Act funds worth $750,000 to develop documentation and validations of computer wind turbine models.

  5. Low thermal resistance power module assembly

    DOE Patents [OSTI]

    Hassani, Vahab; Vlahinos, Andreas; Bharathan, Desikan

    2007-03-13

    A power module assembly with low thermal resistance and enhanced heat dissipation to a cooling medium. The assembly includes a heat sink or spreader plate with passageways or openings for coolant that extend through the plate from a lower surface to an upper surface. A circuit substrate is provided and positioned on the spreader plate to cover the coolant passageways. The circuit substrate includes a bonding layer configured to extend about the periphery of each of the coolant passageways and is made up of a substantially nonporous material. The bonding layer may be solder material which bonds to the upper surface of the plate to provide a continuous seal around the upper edge of each opening in the plate. The assembly includes power modules mounted on the circuit substrate on a surface opposite the bonding layer. The power modules are positioned over or proximal to the coolant passageways.

  6. High power W-band klystrons

    SciTech Connect (OSTI)

    Caryotakis, George; Scheitrum, Glenn; Jongewaard, Erik; Vlieks, Arnold; Fowkes, Randy [Stanford Linear Accelerator Center, Menlo Park, California 94025 (United States); Li, Jeff [University of California Davis, Davis, California 95616 (United States)

    1999-05-01

    The development of W-band klystrons is discussed. Modeling of the klystron performance predicts 100 kW output power from a single klystron. The permanent magnet focusing and small size of the circuit permit combination of multiple klystrons in a module. A six-klystron module in a single vacuum envelope is expected to produce 500 kW peak power and up to 5 kW average power. The critical issues in the W-band klystron development are the electron beam transport and the fabrication of the klystron circuit. Two microfabrication techniques, EDM and LIGA, are being evaluated to produce the W-band circuit. {copyright} {ital 1999 American Institute of Physics.}

  7. PowerPoint Presentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Federal Columbia River Power System (FCRPS) FY 2013 THIRD QUARTER REVIEW Net Revenues and Reserves July 26, 2013 Projection for FY 2013 Page 2 This information has been made...

  8. Bonneville Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    In reply refer to: PGPO Renata Kurschner Director, Generation Resource Management BC Hydro and Power Authority 691 1 Southpoint Drive, El5 Burnaby, B.C., Canada V3N 4 x 8 Dear...

  9. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    today operates within the Department of Energy under the authority of Section 5 of the ... By law, Southwestern's power is marketed and delivered primarily to public bodies such as ...

  10. Dynamic Power Grid Simulation

    Energy Science and Technology Software Center (OSTI)

    2015-09-14

    GridDyn is a part of power grid simulation toolkit. The code is designed using modern object oriented C++ methods utilizing C++11 and recent Boost libraries to ensure compatibility with multiple operating systems and environments.

  11. PowerPoint Presentation

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    cable & conductor into 2,000 ft coiled tubing World first high power laser hardware (optics package & fiber connector) tested to >5,000 psi Achieving target requires "world...

  12. PowerPoint Presentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    David S. Kosson 1 , Charles W. Powers 1 , Jennifer Salisbury, Craig H. Benson 2 , Kevin G. Brown 1 , ... J. LeBoeuf 1 , Henry S. Mayer 3 , Richard B. Stewart 6 , and Hamp Turner 1 1 ...

  13. Lesson Plan: Power Metering

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Power Metering Project Grades: 9-12 Topic: Energy Basics Owner: ACTS This educational material is brought to you by the U.S. Department of Energy's Office of Energy Efficiency and...

  14. GMP Solar Power

    Broader source: Energy.gov [DOE]

    Green Mountain Power, an investor-owned electric utility operating in Vermont, offers a credit to customers with net-metered photovoltaic (PV) systems. In addition to the benefits of net metering,...

  15. Power Prepay Next Steps:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    on BPA's Power Prepay Program is needed, please e-mail powerprepays@bpa.gov by July 19 th . * The open comment period will last for 15 days, beginning on June 28 th and...

  16. PowerPoint Presentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    * Machine shop * LH lab * Power systems and computer shop * Diagnostics setup lab * Welding shop 5 Year 513-514 2003 Some C-Mod Specific Instrumentation * 360 TF joint...

  17. Dine Power Authority (DPA)

    Energy Savers [EERE]

    D D I N E ' P O W E R A U T H O R I T Y Din Power Authority (DPA) Presentation Prepared for Office of Energy Efficiency and Renewable Energy TRIBAL ENERGY PROGRAM October 20, ...

  18. Water Power Program News

    SciTech Connect (OSTI)

    2012-01-19

    News stories about conventional hydropower and marine and hydrokinetic technologies from the U.S. Department of Energy, the Office of Energy Efficiency and Renewable Energy, the Wind and Water Power Program, and other federal agencies.

  19. PowerOptions RFP

    Broader source: Energy.gov [DOE]

    PowerOptions seeks proposals from qualified and experienced renewable energy project developers interested in providing renewable energy and Renewable Energy Credit (RECs) generated from renewable energy projects located in or deliverable to the ISO-NE.

  20. Wind Power Today

    SciTech Connect (OSTI)

    Not Available

    2006-05-01

    Wind Power Today is an annual publication that provides an overview of the wind energy research conducted by the U.S. Department of Energy Wind and Hydropower Technologies Program.

  1. Wind Power Today

    SciTech Connect (OSTI)

    Not Available

    2007-05-01

    Wind Power Today is an annual publication that provides an overview of the wind energy research conducted by the U.S. Department of Energy Wind and Hydropower Technologies Program.

  2. PowerPoint Presentation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    EN debt. <4 Adjusted Net Revenue is calculated by adding Power Services and Transmission Services Net Revenues. <5 Financial reserves consist of BPA cash, investments in U.S....

  3. Bonneville Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1,NT OF Bonneville Power Administration P.O Box 3621 Portland, Oregon 97208-3621 PUBLIC AFFAIRS March 10, 2010 In reply refer to: DK-7 Tom Jacobs Ex RE: BPA-2010-01030-F Dear Mr....

  4. Kenneth W. Powers

    Broader source: Energy.gov [DOE]

    Kenneth W. Powers, a member of the Senior Executive Service, is the Associate Administrator for Management and Budget.  As Associate Administrator, he is responsible for managing NNSA’s...

  5. Water Power News

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    858936+791+7+343Water Power News en Energy Department Awards 10.5 Million for Next-Generation Marine Energy Systems http:energy.goveerearticlesenergy-department-awards-105-...

  6. Idaho Power- Net Metering

    Broader source: Energy.gov [DOE]

    In July 2013, the PUC issued an order in response to Idaho Power's application to modify its net metering program. The ruling removed a previously existing service capacity cap of 2.9 MW and chan...

  7. GEOTHERMAL POWER GENERATION PLANT

    Broader source: Energy.gov [DOE]

    Project objectives: Drilling a deep geothermal well on the Oregon Institute of Technology campus, Klamath Falls, OR. Constructing a geothermal power plant on the Oregon Institute of Technology campus.

  8. Maine Green Power Program

    Broader source: Energy.gov [DOE]

    Legislation enacted in 2009 directed the Maine Public Utilities Commission (PUC) to develop a program offering green power as an option to residential and small commercial customers in the state....

  9. Reducing Power Factor Cost

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Low Voltage Power Factor Capacitors. 1985. Turner, W.C. Energy Management Handbook. John Wiley and Sons, pp. 337-345. 1982. U. S. Department of Energy. Motor Challenge Sourcebook. ...

  10. PowerPoint Presentation

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Island Bus NaS Battery Energy Storage Project U.S. DOE Peer Review Seattle, WA October 8, 2009 Steve Eckroad Electric Power Research Institute Seckroad@epri.com (704) 595-2717 2 ...

  11. PowerPoint Presentation

    Office of Environmental Management (EM)

    ... CO 8 torr 2 torr *System Evac: ISS (e.g., expansion tanks) SDS Long Term Storage Hot Cells ... system not only for possible power outages, but to also gain a better understanding ...

  12. Green Power Purchasing

    Broader source: Energy.gov [DOE]

    In 2003, Maine's governor established a goal for the state government to buy at least 50% of its electricity from "reasonably priced" renewable power sources, paid for by energy conservation...

  13. Power control system and method

    DOE Patents [OSTI]

    Steigerwald, Robert Louis; Anderson, Todd Alan

    2006-11-07

    A power system includes an energy harvesting device, a battery coupled to the energy harvesting device, and a circuit coupled to the energy harvesting device and the battery. The circuit is adapted to deliver power to a load by providing power generated by the energy harvesting device to the load without delivering excess power to the battery and to supplement the power generated by the energy harvesting device with power from the battery if the power generated by the energy harvesting device is insufficient to fully power the load. A method of operating the power system is also provided.

  14. Power control system and method

    DOE Patents [OSTI]

    Steigerwald, Robert Louis [Burnt Hills, NY; Anderson, Todd Alan [Niskayuna, NY

    2008-02-19

    A power system includes an energy harvesting device, a battery coupled to the energy harvesting device, and a circuit coupled to the energy harvesting device and the battery. The circuit is adapted to deliver power to a load by providing power generated by the energy harvesting device to the load without delivering excess power to the battery and to supplement the power generated by the energy harvesting device with power from the battery if the power generated by the energy harvesting device is insufficient to fully power the load. A method of operating the power system is also provided.

  15. Enabling Wind Power Nationwide

    SciTech Connect (OSTI)

    Jose, Zayas; Michael, Derby; Patrick, Gilman; Ananthan, Shreyas; Lantz, Eric; Cotrell, Jason; Beck, Fredic; Tusing, Richard

    2015-05-01

    Leveraging this experience, the U.S. Department of Energy’s (DOE’s) Wind and Water Power Technologies Office has evaluated the potential for wind power to generate electricity in all 50 states. This report analyzes and quantifies the geographic expansion that could be enabled by accessing higher above ground heights for wind turbines and considers the means by which this new potential could be responsibly developed.

  16. Water Power Technologies

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Water Power Program Energy Department Opens New Round of Funding to Reward New Hydropower Energy Department Opens New Round of Funding to Reward New Hydropower Under an incentive program for hydropower development, the Energy Department opened the application period for the Water Power program's latest round of funding. Applications are due by May 31, 2016. Read more Try the RAPID Hydropower Toolkit Try the RAPID Hydropower Toolkit Use the Regulatory and Permitting Information Desktop (RAPID)

  17. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Monday Tuesday Wednesday Thursday Friday Saturday Sunday Generation Schedules Southwestern provides a current day schedule - online using the links to the left and by telephone at 866-494-1993 - to keep the public informed about estimated generation at the projects from which we schedule power. Note that the number of megawatts to be generated, and consequently, the rate at which water is released at each project, is subject to change as demand for power increases or decreases. In addition, the

  18. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2015 Meeting 2014 Meeting 2013 Meeting 2012 Meeting 2011 Meeting 2010 Meeting 2009 Meeting 2008 Meeting 2007 Meeting 2006 Meeting Hydropower Meeting The Southwestern Regional Hydropower Council and Meeting are held annually among Southwestern, the U.S. Army Corps of Engineers (Corps), and the Southwestern Power Resources Association to assess non-routine work to be performed at the Corps hydropower projects from which Southwestern markets power. Funding for this work averages a little over $20

  19. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Business USA FedBizOpps FedConnect Federal Acquisition Regulation (FAR) System for Award Management (SAM) Items Southwestern Buys Southwestern buys the following types of office equipment, field equipment, and services to support its mission of marketing and delivering Federal hydroelectric power: 15/69/138/161-kV field equipment such as circuit breakers, coupling capacitor potential devices, current transformers, disconnect switches, microprocessor relays, power transformers, surge arresters,

  20. EIA - Electric Power Data

    U.S. Energy Information Administration (EIA) Indexed Site

    Survey-Level Detailed Data Files The electric power data collected by EIA surveys are, for the most part, not proprietary and are available in these files at the level of plants, generators, and companies. Examples of the available data include generation by plant and prime mover for each fuel consumed; retail sales by sector, seller and state; and the quality and volumes of fossil fuels delivered to power plants. Aggregated data tables and graphical displays are available through the

  1. Electric Power Research Institute

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2015 U.S. Energy Information Administration | Electric Power Monthly Appendix C Technical notes This appendix describes how the U. S. Energy Information Administration (EIA) collects, estimates, and reports electric power data in the EPM. Data quality The EPM is prepared by the Office of Electricity, Renewables & Uranium Statistics (ERUS), Energy Information Administration (EIA), U. S. Department of Energy. Quality statistics begin with the collection of the correct data. To assure this,

  2. PowerPoint Presentation

    U.S. Energy Information Administration (EIA) Indexed Site

    C. Kelly Chairman, President and CEO, Xcel Energy April 7, 2008 Xcel Energy's Renewable Energy Strategy Northern States Power Company- Minnesota Public Service Company of Colorado Public Service Company of Colorado Southwestern Public Service Northern States Power Company- Wisconsin Xcel Energy Overview Gas Customers 1.8 M Electric Customers 3.3 M Gas Customers 1.8 M Electric Customers 3.3 M Xcel Energy's Environmental Leadership n No. 1 wind energy provider n Windsource - Largest voluntary

  3. PowerPoint Presentation

    U.S. Energy Information Administration (EIA) Indexed Site

    Addressing the Environmental Impacts of the Power Sector 2011 EIA Energy Conference April 26, 2011 Sam Napolitano U.S. EPA Context * EPA has recently proposed regulations governing air emissions, coal ash handling, and cooling water intakes for power plants. * The regulations address years of uncertainty (in some cases decades) and are designed to address harmful pollution and other impacts under existing law and mandates established by Congress. * Several rules respond to Court direction. * The

  4. Fusion Power Associates Awards

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Fusion Power Associates Awards Fusion Power Associates is "a non-profit, tax-exempt research and educational foundation, providing information on the status of fusion development and other applications of plasma science and fusion research". The Association makes awards in four categories: Distinguished Career Awards, Leadership Awards, Excellence in Fusion Engineering, and Special Awards. Since 1987, Distinguished Career Awards have been presented "to individuals who have made

  5. COAL & POWER SYSTEMS

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    COAL & POWER SYSTEMS STRATEGIC & MULTI-YEAR PROGRAM PLANS U.S. DEPARTMENT OF ENERGY * OFFICE OF FOSSIL ENERGY GREENER, SOONER... THROUGH TECHNOLOGY INTRODUCTION .......... i-1 STRATEGIC PLAN ........ 1-1 PROGRAM PLANS Vision 21 .......................... 2-1 Central Power Systems ...... 3-1 Distributed Generation ..... 4-1 Fuels ................................ 5-1 Carbon Sequestration ....... 6-1 Advanced Research ........... 7-1 TABLE OF CONTENTS STRATEGIC & MULTI-YEAR PROGRAM

  6. Reactive power compensator

    DOE Patents [OSTI]

    El-Sharkawi, Mohamed A.; Venkata, Subrahmanyam S.; Chen, Mingliang; Andexler, George; Huang, Tony

    1992-01-01

    A system and method for determining and providing reactive power compensation for an inductive load. A reactive power compensator (50,50') monitors the voltage and current flowing through each of three distribution lines (52a, 52b, 52c), which are supplying three-phase power to one or more inductive loads. Using signals indicative of the current on each of these lines when the voltage waveform on the line crosses zero, the reactive power compensator determines a reactive power compensator capacitance that must be connected to the lines to maintain a desired VAR level, power factor, or line voltage. Alternatively, an operator can manually select a specific capacitance for connection to each line, or the capacitance can be selected based on a time schedule. The reactive power compensator produces control signals, which are coupled through optical fibers (102/106) to a switch driver (110, 110') to select specific compensation capacitors (112) for connections to each line. The switch driver develops triggering signals that are supplied to a plurality of series-connected solid state switches (350), which control charge current in one direction in respect to ground for each compensation capacitor. During each cycle, current flows from ground to charge the capacitors as the voltage on the line begins to go negative from its positive peak value. The triggering signals are applied to gate the solid state switches into a conducting state when the potential on the lines and on the capacitors reaches a negative peak value, thereby minimizing both the potential difference and across the charge current through the switches when they begin to conduct. Any harmonic distortion on the potential and current carried by the lines is filtered out from the current and potential signals used by the reactive power compensator so that it does not affect the determination of the required reactive compensation.

  7. Reactive Power Compensator.

    DOE Patents [OSTI]

    El-Sharkawi, M.A.; Venkata, S.S.; Chen, M.; Andexler, G.; Huang, T.

    1992-07-28

    A system and method for determining and providing reactive power compensation for an inductive load. A reactive power compensator (50,50') monitors the voltage and current flowing through each of three distribution lines (52a, 52b, 52c), which are supplying three-phase power to one or more inductive loads. Using signals indicative of the current on each of these lines when the voltage waveform on the line crosses zero, the reactive power compensator determines a reactive power compensator capacitance that must be connected to the lines to maintain a desired VAR level, power factor, or line voltage. Alternatively, an operator can manually select a specific capacitance for connection to each line, or the capacitance can be selected based on a time schedule. The reactive power compensator produces control signals, which are coupled through optical fibers (102/106) to a switch driver (110, 110') to select specific compensation capacitors (112) for connections to each line. The switch driver develops triggering signals that are supplied to a plurality of series-connected solid state switches (350), which control charge current in one direction in respect to ground for each compensation capacitor. During each cycle, current flows from ground to charge the capacitors as the voltage on the line begins to go negative from its positive peak value. The triggering signals are applied to gate the solid state switches into a conducting state when the potential on the lines and on the capacitors reaches a negative peak value, thereby minimizing both the potential difference and across the charge current through the switches when they begin to conduct. Any harmonic distortion on the potential and current carried by the lines is filtered out from the current and potential signals used by the reactive power compensator so that it does not affect the determination of the required reactive compensation. 26 figs.

  8. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    September 27, 2012 Turner Named Southwestern Administrator Chris Turner Chris Turner Christopher Turner has been named as the new Administrator of the Southwestern Power Administration (Southwestern) in Tulsa, OK, effective July 29, 2012. Mr. Turner brings to Southwestern 30 years' experience in the electric utility industry, including various leadership positions involving transmission and distribution construction, energy trading, bulk power operations, resource planning, and compliance with

  9. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    December 7, 2012 Southwestern Helps Restore Power After Hurricane Sandy Southwestern Aids Sandy Recovery Line crews from Southwestern repair distribution lines in Tom's River, New Jersey, following Hurricane Sandy. In the aftermath of Hurricane Sandy in early November 2012, Southwestern Power Administration sent several line, substation, and right-of-way brush crews and 30 pieces of heavy equipment to help restore the electrical grid along the coast of New Jersey near where the storm made

  10. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    12, 2014 Southwestern Operates for Drought at Texoma Significantly lower inflow than normal into the Lake Texoma (Denison Dam) watershed has caused Southwestern Power Administration, a not-for-profit administration within the U.S. Department of Energy (Southwestern), to severely limit power generation at Denison to conserve water storage. "From May 2012 through February 2014, Southwestern generated only about 20% of average, which works out to about 1.8 hours a day," explains Fritha

  11. Southwestern Power Administration

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Doug Johnson Named Director of System Protection and Communications Doug Johnson Named Director of System Protection and Communications Doug Johnson Doug Johnson has been selected to serve as Director of the new Division of System Protection and Communications at Southwestern Power Administration (Southwestern), effective July 13, 2014. Johnson, an Electrical Engineer specializing in power system protection, has most recently served as Chief of the System Meter and Protective Relay Maintenance

  12. Special Delivery for Sustainability: Clean Cities Supports UPS...

    Energy Savers [EERE]

    A UPS delivery truck is refueled with compressed natural gas. UPS plans to deploy 1,000 ... UPS purchased 48 LNG heavy-duty vehicles and installed a public LNG station in Las Vegas. ...

  13. Sol-Up USA, LLC | Open Energy Information

    Open Energy Info (EERE)

    Sol-Up USA, LLC Jump to: navigation, search Logo: Sol-Up USA, LLC Name: Sol-Up USA, LLC Address: 3355 West Spring Mountain Road, Suite 3 Place: Las Vegas, NV Zip: 89102 Sector:...

  14. Where to Build in New York City? Team New York Looks Up | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Where to Build in New York City? Team New York Looks Up Where to Build in New York City? Team New York Looks Up July 22, 2011 - 3:27pm Addthis In honor of the U.S. Department of Energy Solar Decathlon -- which challenges 20 collegiate teams to design, build, and operate solar-powered houses that are cost-effective, energy-efficient, and attractive -- we are profiling each of the 20 teams participating in the competition. In honor of the U.S. Department of Energy Solar Decathlon --

  15. Alternative Fuels Data Center: Cities Clean up With Biofuels

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Cities Clean up With Biofuels to someone by E-mail Share Alternative Fuels Data Center: Cities Clean up With Biofuels on Facebook Tweet about Alternative Fuels Data Center: Cities Clean up With Biofuels on Twitter Bookmark Alternative Fuels Data Center: Cities Clean up With Biofuels on Google Bookmark Alternative Fuels Data Center: Cities Clean up With Biofuels on Delicious Rank Alternative Fuels Data Center: Cities Clean up With Biofuels on Digg Find More places to share Alternative Fuels Data

  16. Alternative Fuels Data Center: Phoenix Cleans Up with Natural Gas

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Phoenix Cleans Up with Natural Gas to someone by E-mail Share Alternative Fuels Data Center: Phoenix Cleans Up with Natural Gas on Facebook Tweet about Alternative Fuels Data Center: Phoenix Cleans Up with Natural Gas on Twitter Bookmark Alternative Fuels Data Center: Phoenix Cleans Up with Natural Gas on Google Bookmark Alternative Fuels Data Center: Phoenix Cleans Up with Natural Gas on Delicious Rank Alternative Fuels Data Center: Phoenix Cleans Up with Natural Gas on Digg Find More places to

  17. High Power Laser Innovation Sparks Geothermal Power Potential | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy High Power Laser Innovation Sparks Geothermal Power Potential High Power Laser Innovation Sparks Geothermal Power Potential May 29, 2015 - 11:02am Addthis The Energy Department's project partner Foro Energy lab tests a high power laser tool with a patented technology that could maximize heat recovery from geothermal wells. Source: Foro Energy. The Energy Department's project partner Foro Energy lab tests a high power laser tool with a patented technology that could maximize heat

  18. Assessment of Combined Heat and Power Premium Power Applications in

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    California, September 2008 | Department of Energy Combined Heat and Power Premium Power Applications in California, September 2008 Assessment of Combined Heat and Power Premium Power Applications in California, September 2008 This 2008 report analyzes the economic and environmental performance of combined heat and power (CHP) systems in power interruption intolerant commercial facilities in California.Through a series of three case studies, key trade-offs are analyzed with regard to the

  19. NREL to Help Four Start-ups Ramp up Solar Energy Innovations - News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Releases | NREL to Help Four Start-ups Ramp up Solar Energy Innovations DOE to provide $5.8 million to support early-stage solar technologies through Incubator program at NREL September 1, 2011 Companies with innovative, game-changing ways to lower the cost of solar energy have been awarded $5.8 million to work with the U.S. Department of Energy's National Renewable Energy Laboratory. The SunShot Incubator Program is an expansion of DOE's successful PV Technology Incubator Program, launched

  20. Focus Group Meeting (Topical Wrap-Up) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Wrap-Up) Focus Group Meeting (Topical Wrap-Up) Meeting Date: December 4, 2008 Meeting ... More Documents & Publications Focus Group Meeting (Activities Status) Focus Group Meeting ...