National Library of Energy BETA

Sample records for uf6 mailing list

  1. Request Repository Mailing List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support 1-800-66-NERSC, option 2 or 510-486-8612 Consulting 1-800-66-NERSC, option 3 or 510-486-8611 Home » For Users » Request Repository Mailing List Request Repository Mailing List Use this form to request a

  2. PDSF Mailing Lists

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Lists PDSF Mailing Lists This is voluntary. You have to subscribe to it. This list can be chatty, since major and minor problems are sent to this list. Also multiple status updates will be sent for extended outages. Subscribe: Send email to with subscribe in the subject of the message. Unsubscribe: Send email to with unsubscribe in the subject of the message. Users are subscribed to

  3. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  4. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Subscription Jefferson Lab Home Search Contact JLab Descriptions A - C autocad: No description available briefs: On-Target Briefs cctest-alert: No description available clas_drift_chambers: Hall B Drift Chambers Group clas_offline: Discussion group for CLAS RECSIS group clas_slow_control: CLAS slow control working group clas_strangep: Hall B Strange Particles using CLAS discussion group clas_tof: CLAS Time of Flight Collaboration credit-card: List of JLab Credit Card buyers csc_all:

  5. NGSI: IAEA Verification of UF6 Cylinders

    SciTech Connect (OSTI)

    Curtis, Michael M.


    The International Atomic Energy Agency (IAEA) is often ignorant of the location of declared, uranium hexafluoride (UF6) cylinders following verification, because cylinders are not typically tracked onsite or off. This paper will assess various methods the IAEA uses to verify cylinder gross defects, and how the task could be ameliorated through the use of improved identification and monitoring. The assessment will be restricted to current verification methods together with one that has been applied on a trial basis—short-notice random inspections coupled with mailbox declarations. This paper is part of the NNSA Office of Nonproliferation and International Security’s Next Generation Safeguards Initiative (NGSI) program to investigate the concept of a global monitoring scheme that uniquely identifies and tracks UF6 cylinders.

  6. Integrating UF6 Cylinder RF Tracking With Continuous Load Cell...

    Office of Scientific and Technical Information (OSTI)

    is demonstrating the integration of UF6 cylinder tracking, using RF technology, with continuous load cell monitoring (CLCM) at mock UF6 feed and withdrawal (F&W) stations. ...

  7. Method and apparatus for measuring enrichment of UF6

    DOE Patents [OSTI]

    Hill, Thomas Roy; Ianakiev, Kiril Dimitrov


    A system and method are disclosed for determining the enrichment of .sup.235U in Uranium Hexafluoride (UF6) utilizing synthesized X-rays which are directed at a container test zone containing a sample of UF6. A detector placed behind the container test zone then detects and counts the X-rays which pass through the container and the UF6. In order to determine the portion of the attenuation due to the UF6 gas alone, this count rate may then be compared to a calibration count rate of X-rays passing through a calibration test zone which contains a vacuum, the test zone having experienced substantially similar environmental conditions as the actual test zone. Alternatively, X-rays of two differing energy levels may be alternately directed at the container, where either the container or the UF6 has a high sensitivity to the difference in the energy levels, and the other having a low sensitivity.

  8. Neutron spectrometry for UF6 enrichment verification in storage cylinders

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Mengesha, Wondwosen; Kiff, Scott D.


    Verification of declared UF6 enrichment and mass in storage cylinders is of great interest in nuclear material nonproliferation. Nondestructive assay (NDA) techniques are commonly used for safeguards inspections to ensure accountancy of declared nuclear materials. Common NDA techniques used include gamma-ray spectrometry and both passive and active neutron measurements. In the present study, neutron spectrometry was investigated for verification of UF6 enrichment in 30B storage cylinders based on an unattended and passive measurement approach. MCNP5 and Geant4 simulated neutron spectra, for selected UF6 enrichments and filling profiles, were used in the investigation. The simulated neutron spectra were analyzed using principalmore » component analysis (PCA). The PCA technique is a well-established technique and has a wide area of application including feature analysis, outlier detection, and gamma-ray spectral analysis. Results obtained demonstrate that neutron spectrometry supported by spectral feature analysis has potential for assaying UF6 enrichment in storage cylinders. The results from the present study also showed that difficulties associated with the UF6 filling profile and observed in other unattended passive neutron measurements can possibly be overcome using the approach presented.« less

  9. Two photon spectroscopy of UF6 in the near ultraviolet

    SciTech Connect (OSTI)

    Bernstein, E.R.; Kennedy, P.M.


    The two photon excited fluorescence excitation spectrum of UF6 was observed in the region 410 to 315 nm. The spectrum was virtually indistinguishable from the one photon absorption in this region. No vibronic structure was observed in absorption or dispersed emission. These data indicate a high density of u and g states for UF6 in this energy range and facile photochemical decomposition. Emission intensity was found to be proportional to laser power to the 3.0 to 3.6 power.

  10. Integrating UF6 Cylinder RF Tracking With Continuous Load Cell Monitoring for Verifying Declared UF6 Feed and Withdrawal Operations Verifying Declared UF6 Feed and Withdrawal Operations

    SciTech Connect (OSTI)

    Krichinsky, Alan M; Miller, Paul; Pickett, Chris A; Richardson, Dave; Rowe, Nathan C; Whitaker, J Michael; Younkin, James R


    Oak Ridge National Laboratory is demonstrating the integration of UF6 cylinder tracking, using RF technology, with continuous load cell monitoring (CLCM) at mock UF6 feed and withdrawal (F&W) stations. CLCM and cylinder tracking are two of several continuous-monitoring technologies that show promise in providing integrated safeguards of F&W operations at enrichment plants. Integrating different monitoring technologies allows advanced, automated event processing to screen innocuous events thereby minimizing false alerts to independent inspectors. Traditionally, international inspectors rely on batch verification of material inputs and outputs derived from operator declarations and periodic on-site inspections at uranium enrichment plants or other nuclear processing facilities. Continuously monitoring F&W activities between inspections while providing filtered alerts of significant operational events will substantially increase the amount of valuable information available to inspectors thereby promising to enhance the effectiveness of safeguards and to improve efficiency in conducting on-site inspections especially at large plants for ensuring that all operations are declared.

  11. Onsite Gaseous Centrifuge Enrichment Plant UF6 Cylinder Destructive Analysis

    SciTech Connect (OSTI)

    Anheier, Norman C.; Cannon, Bret D.; Qiao, Hong; Carter, Jennifer C.; McNamara, Bruce K.; O'Hara, Matthew J.; Phillips, Jon R.; Curtis, Michael M.


    The IAEA safeguards approach for gaseous centrifuge enrichment plants (GCEPs) includes measurements of gross, partial, and bias defects in a statistical sampling plan. These safeguard methods consist principally of mass and enrichment nondestructive assay (NDA) verification. Destructive assay (DA) samples are collected from a limited number of cylinders for high precision offsite mass spectrometer analysis. DA is typically used to quantify bias defects in the GCEP material balance. Under current safeguards measures, the operator collects a DA sample from a sample tap following homogenization. The sample is collected in a small UF6 sample bottle, then sealed and shipped under IAEA chain of custody to an offsite analytical laboratory. Current practice is expensive and resource intensive. We propose a new and novel approach for performing onsite gaseous UF6 DA analysis that provides rapid and accurate assessment of enrichment bias defects. DA samples are collected using a custom sampling device attached to a conventional sample tap. A few micrograms of gaseous UF6 is chemically adsorbed onto a sampling coupon in a matter of minutes. The collected DA sample is then analyzed onsite using Laser Ablation Absorption Ratio Spectrometry-Destructive Assay (LAARS-DA). DA results are determined in a matter of minutes at sufficient accuracy to support reliable bias defect conclusions, while greatly reducing DA sample volume, analysis time, and cost.

  12. Advancements of the Hybrid Method UF6 Container Inspection System

    SciTech Connect (OSTI)

    Mace, Emily K.; Orton, Christopher R.; Jordan, David V.; McDonald, Benjamin S.; Smith, Leon E.


    Safeguards inspectors currently visit uranium enrichment plants to verify UF6 cylinder enrichment declarations. Measurements are performed with handheld high-resolution detectors on a limited number of cylinders taken to be representative of the plant’s cylinder inventory. These enrichment assay methods interrogate only a small fraction of the total cylinder volume, and are time-consuming and expensive to execute. Pacific Northwest National Laboratory (PNNL) is developing an automated UF6 cylinder verification station concept based on the combined collection of traditional enrichment-meter data (186 keV photons from 235U) and non-traditional, neutron-induced, high-energy gamma-ray signatures (3-8 MeV) with an array of collimated, medium-resolution scintillators. Previous work at PNNL (2010) demonstrated proof-of-principle that this hybrid method yields accurate, full-volume assay of the cylinder enrichment, reduces systematic errors when compared to several other enrichment assay methods, and provides simplified instrumentation and algorithms suitable for long-term, unattended operations. This system aims to increase the number of inspected cylinders at higher accuracy and with lower cost than when compared to inspectors with hand-held instruments. Several measurement campaigns of 30B cylinder populations and a refined MCNP model will be reported. The MCNP model consists of per-gram basis vectors for the different uranium isotopes and several fill geometries, enabling fast generation of any UF6 enrichment level and multiple configurations. The refined model was used to optimize collimator design and detector configuration for the hybrid method. In addition, a new field prototype based on model results was utilized in a set of field measurements.

  13. A Mock UF6 Feed and Withdrawal System for Testing Safeguards...

    Office of Scientific and Technical Information (OSTI)

    Technical Report: A Mock UF6 Feed and Withdrawal System for Testing Safeguards Monitoring Systems and Strategies Intended for Nuclear Fuel Enrichment and Processing Plants Citation ...

  14. A Mock UF6 Feed and Withdrawal System for Testing Safeguards...

    Office of Scientific and Technical Information (OSTI)

    SciTech Connect Search Results Technical Report: A Mock UF6 Feed and Withdrawal System for Testing Safeguards Monitoring Systems and Strategies Intended for Nuclear Fuel Enrichment ...

  15. Enrichment Assay Methods for a UF6 Cylinder Verification Station

    SciTech Connect (OSTI)

    Smith, Leon E.; Jordan, David V.; Misner, Alex C.; Mace, Emily K.; Orton, Christopher R.


    International Atomic Energy Agency (IAEA) inspectors currently perform periodic inspections at uranium enrichment plants to verify UF6 cylinder enrichment declarations. Measurements are typically performed with handheld high-resolution sensors on a sampling of cylinders taken to be representative of the facility’s entire cylinder inventory. These enrichment assay methods interrogate only a small fraction of the total cylinder volume, and are time-consuming and expensive to execute for inspectors. Pacific Northwest National Laboratory (PNNL) is developing an unattended measurement system capable of automated enrichment measurements over the full volume of Type 30B and Type 48 cylinders. This Integrated Cylinder Verification System (ICVS) could be located at key measurement points to positively identify each cylinder, measure its mass and enrichment, store the collected data in a secure database, and maintain continuity of knowledge on measured cylinders until IAEA inspector arrival. The focus of this paper is the development of nondestructive assay (NDA) methods that combine “traditional” enrichment signatures (e.g. 185-keV emission from U-235) and more-penetrating “non-traditional” signatures (e.g. high-energy neutron-induced gamma rays spawned primarily from U-234 alpha emission) collected by medium-resolution gamma-ray spectrometers (i.e. sodium iodide or lanthanum bromide). The potential of these NDA methods for the automated assay of feed, tail and product cylinders is explored through MCNP modeling and with field measurements on a cylinder population ranging from 0.2% to 5% in U-235 enrichment.

  16. Model for Simulating Dispersion due to Atmospheric Release of UF6

    Energy Science and Technology Software Center (OSTI)


    HGSYSTEMUF6 is a suite of models designed for use in estimating consequences associated with accidental, atmospheric release of Uranium Hexafluoride (UF6) and its reaction products, namely Hydrogen Fluoride (HF), and other non-reactive contaminants which are either negatively, neutrally, or positively buoyant. It is based on HGSYSTEM Version 3.0 of Shell Research LTD., and contains specific algorithms for the treatment of UF6 chemistry and thermodynamics. HGSYSTEMUF6 contains algorithms for the treatment of dense gases, dry andmore » wet deposition, effects due to the presence of buildings (canyon and wake), plume lift-off, and the effects of complex terrain. The models components of the suite include (1) AEROPLUME/RK, used to model near-field dispersion from pressurized two-phase jet releases of UF6 and its reaction products, (2) HEGADAS/UF6 for simulating dense, ground based release of UF6, (3) PGPLUME for simulation of passive, neutrally buoyant plumes (4) UF6Mixer for modeling warm, potentially reactive, ground-level releases of UF6 from buildings, and (5) WAKE, used to model elevated and ground-level releases into building wake cavities of non-reactive plumes that are either neutrally or positively buoyant.« less

  17. HGSYSTEMUF6. Model for Simulating Dispersion due to Atmospheric Release of UF6

    SciTech Connect (OSTI)

    Hanna, G; Chang, J.C.; Zhang, J.X.; Bloom, S.G.; Goode, W.D. Jr; Lombardi, D.A.; Yambert, M.W.


    HGSYSTEMUF6 is a suite of models designed for use in estimating consequences associated with accidental, atmospheric release of Uranium Hexafluoride (UF6) and its reaction products, namely Hydrogen Fluoride (HF), and other non-reactive contaminants which are either negatively, neutrally, or positively buoyant. It is based on HGSYSTEM Version 3.0 of Shell Research LTD., and contains specific algorithms for the treatment of UF6 chemistry and thermodynamics. HGSYSTEMUF6 contains algorithms for the treatment of dense gases, dry and wet deposition, effects due to the presence of buildings (canyon and wake), plume lift-off, and the effects of complex terrain. The models components of the suite include (1) AEROPLUME/RK, used to model near-field dispersion from pressurized two-phase jet releases of UF6 and its reaction products, (2) HEGADAS/UF6 for simulating dense, ground based release of UF6, (3) PGPLUME for simulation of passive, neutrally buoyant plumes (4) UF6Mixer for modeling warm, potentially reactive, ground-level releases of UF6 from buildings, and (5) WAKE, used to model elevated and ground-level releases into building wake cavities of non-reactive plumes that are either neutrally or positively buoyant.

  18. A Mock UF6 Feed and Withdrawal System for Testing Safeguards Monitoring

    Office of Scientific and Technical Information (OSTI)

    Systems and Strategies Intended for Nuclear Fuel Enrichment and Processing Plants (Technical Report) | SciTech Connect SciTech Connect Search Results Technical Report: A Mock UF6 Feed and Withdrawal System for Testing Safeguards Monitoring Systems and Strategies Intended for Nuclear Fuel Enrichment and Processing Plants Citation Details In-Document Search Title: A Mock UF6 Feed and Withdrawal System for Testing Safeguards Monitoring Systems and Strategies Intended for Nuclear Fuel Enrichment

  19. Development of a portal monitor for UF6 cylinder verification

    SciTech Connect (OSTI)

    Smith, Leon E.; Curtis, Michael M.; Shaver, Mark W.; Benz, Jacob M.; Misner, Alex C.; Mace, Emily K.; Jordan, David V.; Noss, Daniel; Ford, Herbert


    International Atomic Energy Agency (IAEA) inspectors currently perform periodic inspections at uranium enrichment plants to verify UF6 cylinder enrichment declarations. Measurements are performed with handheld high-resolution sensors on a sampling of cylinders taken to be representative of the facility’s operations. As additional enrichment plans come online to support the expansion of nuclear power, reducing person-days of inspection will take on greater importance. Pacific Northwest National Laboratory (PNNL) is developing a concept to automate the verification of enrichment plant cylinders to enable 100% product-cylinder verification and potentially, mass-balance calculations on the facility as a whole (by also measuring feed and tails cylinders). The Automated Cylinder Enrichment Verification System (ACEVS) would be located at key measurement points and will positively identify each cylinder, measure its mass and enrichment, store the data along with operator inputs in a secure database, and maintain continuity of knowledge on measured cylinders until IAEA inspector arrival. Given the potential for reduced inspector presence, the operational and manpower-reduction benefits of the portal concept are clear. However, it is necessary to assess whether the cylinder portal concept can meet, or potentially improve upon, today’s U-235 enrichment assay performance. PNNL’s ACEVS concept utilizes sensors that could be operated in an unattended mode: moderated He-3 neutron detectors and large NaI(Tl) scintillators for gamma-ray spectroscopy. The medium-resolution NaI(Tl) scintillators are a sacrifice in energy resolution but do provide high collection efficiency for signatures above 1 MeV. The He-3/NaI sensor combination allows the exploitation of additional, more-penetrating signatures than those currently utilized: Neutrons produced from F-19(μ,n) reactions (spawned primarily from U-234 alpha emission) and high-energy gamma rays (extending up to 10 MeV) induced by neutrons interacting in the steel cylinder. These signatures are indirect measures of U-235 that require a relatively stable U-234/U-235 ratio in the product material in order to be useful. The hypothesis of this work is that the U-234/U-235 ratio is sufficiently constant, for the specific facility where the automated system is installed, to rely on neutron and high-energy gamma-ray signatures for indirect measurement of U-235. Further, these highly penetrating signatures can be combined with a modified form of NaI-based 185-keV enrichment measurements to meet target uncertainties for the verification of product cylinders, with the additional benefits of full-volume assay of the cylinder and 100% product-cylinder verification (as opposed to today’s sampling-based approach). This paper focuses on the enrichment measurement aspects of the ACEVS concept: neutron and high-energy gamma-ray signatures, the radiation sensors designed to collect those signatures, and proof-of-principle cylinder measurements and analysis. Preliminary analysis indicates that an automated cylinder verification approach has the potential to meet target uncertainty values for 30B products cylinders (5%), assuming ore-based enrichment feed and a facility-specific calibration. Also described is the additional work needed to more definitively assess the concept’s viability, particularly through a better understanding of the U-234/U-235 ratio variability in modern enrichment plants.

  20. Conceptual Ideas for New Nondestructive UF6 Cylinder Assay Techniques

    SciTech Connect (OSTI)

    Miller, Karen A.


    Nondestructive assay (NDA) measurements of uranium cylinders play an important role in helping the International Atomic Energy Agency (IAEA) safeguard uranium enrichment plants. Traditionally, these measurements have consisted of a scale or load cell to determine the mass of UF{sub 6} in the cylinder combined with a gamma-ray measurement of the 186 keV peak from {sup 235}U to determine enrichment. More recently, Los Alamos National Laboratory (LANL) and Pacific Northwest National Laboratory (PNNL) have developed systems that exploit the passive neutron signal from UF{sub 6} to determine uranium mass and/or enrichment. These include the Uranium Cylinder Assay System (UCAS), the Passive Neutron Enrichment Meter (PNEM), and the Hybrid Enrichment Verification Array (HEVA). The purpose of this report is to provide the IAEA with new ideas on technologies that may or may not be under active development but could be useful for UF{sub 6} cylinder assay. To begin, we have included two feasibility studies of active interrogation techniques. There is a long history of active interrogation in the field of nuclear safeguards, especially for uranium assay. Both of the active techniques provide a direct measure of {sup 235}U content. The first is an active neutron method based on the existing PNEM design that uses a correlated {sup 252}Cf interrogation source. This technique shows great promise for UF{sub 6} cylinder assay and is based on advanced technology that could be implemented in the field in the near term. The second active technique is nuclear resonance fluorescence (NRF). In the NRF technique, a bremsstrahlung photon beam could be used to illuminate the cylinder, and high-resolution gamma-ray detectors would detect the characteristic de-excitation photons. The results of the feasibility study show that under certain measurement geometries, NRF is impractical for UF6 cylinder assay, but the 'grazing transmission' and 'secant transmission' geometries have more potential for this application and should be assessed quantitatively. The next set of techniques leverage scintillator detectors that are sensitive to both neutron and gamma radiation. The first is the BC-523A capture-gated organic liquid scintillator. The detector response from several different neutron energies has been characterized and is included in the study. The BC-523A has not yet been tested with UF{sub 6} cylinders, but the application appears to be well suited for this technology. The second detector type is a relatively new inorganic scintillator called CLYC. CLYC provides a complementary detection approach to the HEVA and PNEM systems that could be used to determine uranium enrichment in UF{sub 6} cylinders. In this section, the conceptual idea for an integrated CLYC-HEVA/PNEM system is explored that could yield more precision and robustness against systemic uncertainties than any one of the systems by itself. This is followed by a feasibility study on using alpha-particle-induced reaction gamma-rays as a way to estimate {sup 234}U abundance in UF{sub 6}. Until now, there has been no readily available estimate of the strength of these reaction gamma-rays. Thick target yields of the chief reaction gammas are computed and show that they are too weak for practical safeguards applications. In special circumstances where long count times are permissible, the 1,275 keV F({alpha},x{gamma}) is observable. Its strength could help verify an operator declaration provided other knowledge is available (especially the age). The other F({alpha},x{gamma}) lines are concealed by the dominant uranium line spectrum and associated continuum. Finally, the last section provides several ideas for electromagnetic and acoustic nondestructive evaluation (NDE) techniques. These can be used to measure cylinder wall thickness, which is a source of systematic uncertainty for gamma-ray-based NDA techniques; characterize the UF{sub 6} filling profile inside the cylinder, which is a source of systematic uncertainty for neutron-based NDA techniques; locate hidden objects inside the cylinder; and provide a unique identification of cylinders. Acoustic and electromagnetic NDE techniques are complementary to NDA measurements, and may improve the accuracy and continuity of knowledge of UF{sub 6} measurements of interest to the IAEA. As concepts and approaches for enrichment plant safeguards continue to evolve to meet modern challenges, the conceptual ideas explored in this report, along with more traditional techniques, help define the toolkit of technologies available for UF{sub 6} cylinder assay. Whether the application is an unattended cylinder verification station or an on-site inspection, the basic building blocks can be tailored to provide the best solution given competing constraints such as size and weight limitations, required precision, mechanical complexity, cost, stability, robustness, etc.

  1. Neutron spectrometry for ${\\rm UF}_6$ enrichment verification in storage cylinders

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Mengesha, Wondwosen; Kiff, Scott D.


    Verification of declared UF6 enrichment and mass in storage cylinders is of great interest in nuclear material nonproliferation. Nondestructive assay (NDA) techniques are commonly used for safeguards inspections to ensure accountancy of declared nuclear materials. Common NDA techniques used include gamma-ray spectrometry and both passive and active neutron measurements. In the present study, neutron spectrometry was investigated for verification of UF6 enrichment in 30B storage cylinders based on an unattended and passive measurement approach. MCNP5 and Geant4 simulated neutron spectra, for selected UF6 enrichments and filling profiles, were used in the investigation. The simulated neutron spectra were analyzed using principalmorecomponent analysis (PCA). The PCA technique is a well-established technique and has a wide area of application including feature analysis, outlier detection, and gamma-ray spectral analysis. Results obtained demonstrate that neutron spectrometry supported by spectral feature analysis has potential for assaying UF6 enrichment in storage cylinders. The results from the present study also showed that difficulties associated with the UF6 filling profile and observed in other unattended passive neutron measurements can possibly be overcome using the approach presented.less

  2. Adsorptive Films in Support of In-field UF6 Destructive Assay Sample Collection and Analysis

    SciTech Connect (OSTI)

    Barrett, Christopher A.; Martinez, Alonzo; McNamara, Bruce K.; Cannon, Bret D.; Anheier, Norman C.


    International Atom Energy Agency (IAEA) safeguard verification measures in gaseous centrifuge enrichment plants (GCEPs) rely on environmental sampling, non-destructive assay (NDA), and destructive assay (DA) sampling and analysis to determine uranium enrichment. UF6 bias defect measurements are made by DA sampling and analysis to assure that enrichment is consistent with declarations. DA samples are collected from a limited number of cylinders for high precision, offsite mass spectrometer analysis. Samples are typically drawn from a sampling tap into a UF6 sample bottle, then packaged, sealed, and shipped under IAEA chain of custody to an offsite analytical laboratory. Future DA safeguard measures may require improvements in efficiency and effectiveness as GCEP capacities increase and UF6 shipping regulations become increasingly more restrictive. The Pacific Northwest National Laboratory (PNNL) DA sampler concept and Laser Ablation Absorption Ratio Spectrometry (LAARS) assay method are under development to potentially provide DA safeguard tools that increase inspection effectiveness and reduce sample shipping constraints. The PNNL DA sampler concept uses a handheld sampler to collect DA samples for either onsite LAARS assay or offsite laboratory analysis. The DA sampler design will use a small sampling planchet that is coated with an adsorptive film to collect controlled quantities of UF6 gas directly from a cylinder or process sampling tap. Development efforts are currently underway at PNNL to enhance LAARS assay performance to allow high-precision onsite bias defect measurements. In this paper, we report on the experimental investigation to develop adsorptive films for the PNNL DA sampler concept. These films are intended to efficiently capture UF6 and then stabilize the collected DA sample prior to onsite LAARS or offsite laboratory analysis. Several porous material composite films were investigated, including a film designed to maximize the chemical adsorption and binding of gaseous UF6 onto the sampling planchet.

  3. Photoelectron Spectroscopy and Theoretical Studies of UF5 ? and UF6 ?

    SciTech Connect (OSTI)

    Dau, Phuong D.; Su, Jing; Liu, Hong-Tao; Huang, Dao-Ling; Wei, Fan; Li, Jun; Wang, Lai S.


    The UF5 ? and UF6 ? anions are produced using electrospray ionization and investigated by photoelectron spectroscopy and relativistic quantum chemistry. An extensive vibrational progression is observed in the spectra of UF5 ?, indicating significant geometry changes between the anion and neutral ground state. Franck-Condon factor simulations of the observed vibrational progression yield an adiabatic electron detachment energy of 3.82 0.05 eV for UF5 ?. Relativistic quantum calculations using density functional and ab initio theories are performed on UF5 ? and UF6 ? and their neutrals. The ground states of UF5 ? and UF5 are found to have C4v symmetry, but with a large U?F bond length change. The ground state of UF5 ? is a triplet state (3B2) with the two 5f electrons occupying a 5fz3-based 8a1 highest occupied molecular orbital (HOMO) and the 5fxyz-based 2b2 HOMO-1 orbital. The detachment cross section from the 5fxyz orbital is observed to be extremely small and the detachment transition from the 2b2 orbital is more than ten times weaker than that from the 8a1 orbital at the photon energies available. The UF6 ? anion is found to be octahedral, similar to neutral UF6 with the extra electron occupying the 5fxyz-based a2u orbital. Surprisingly, no photoelectron spectrum could be observed for UF6 ? due to the extremely low detachment cross section from the 5fxyz-based HOMO of UF6 ?.

  4. Determination of the 235U Mass and Enrichment within Small UF6 Cylinders via a Neutron Coincidence Well Counting System

    SciTech Connect (OSTI)

    McElroy, Robert Dennis; Croft, Dr. Stephen; Young, Brian M; Venkataraman, Ram


    The construction of three new uranium enrichment facilities in the United States has sparked renewed interest in the development and enhancement of methods to determine the enrichment and fissile mass content of UF6 cylinders. We describe the design and examine the expected performance of a UF6 bottle counter developed for the assay of Type 5A cylinders. The counter, as designed and subsequently constructed, is a tall passive neutron well counter with a clam-shell configuration and graphite end plugs operated in fast neutron mode. Factory performance against expectation is described. The relatively high detection efficiency and effectively 4 detection geometry provide a near-ideal measurement configuration, making the UF6 bottle counter a valuable tool for the evaluation of the neutron coincidence approach to UF6 cylinder assay. The impacts of non-uniform filling, voids, enrichment, and mixed enrichments are examined

  5. Testing the Floor Scale Designated for Pacific Northwest National Laboratory's UF6 Cylinder Portal Monitor

    SciTech Connect (OSTI)

    Curtis, Michael M.; Weier, Dennis R.


    Pacific Northwest National Laboratory (PNNL) obtained a Mettler Toledo floor scale for the purpose of testing it to determine whether it can replace the International Atomic Energy Agency’s (IAEA) cumbersome, hanging load cell. The floor scale is intended for use as a subsystem within PNNL’s nascent UF6 Cylinder Portal Monitor. The particular model was selected for its accuracy, size, and capacity. The intent will be to use it only for 30B cylinders; consequently, testing did not proceed beyond 8,000 lb.

  6. Modified biokinetic model for uranium from analysis of acute exposure to UF6

    SciTech Connect (OSTI)

    Fisher, D.R.; Kathren, R.L.; Swint, M.J. )


    Urinalysis measurements from 31 workers acutely exposed to uranium hexafluoride (UF6) and its hydrolysis product UO2F2 (during the 1986 Gore, Oklahoma UF6-release accident) were used to develop a modified recycling biokinetic model for soluble U compounds. The model is expressed as a five-compartment exponential equation: yu(t) = 0.086e-2.77t + 0.0048e-0.116t + 0.00069e-0.0267t + 0.00017 e-0.00231t + 2.5 x 10(-6) e-0.000187t, where yu(t) is the fractional daily urinary excretion and t is the time after intake, in days. The excretion constants of the five exponential compartments correspond to residence half-times of 0.25, 6, 26, 300, and 3,700 d in the lungs, kidneys, other soft tissues, and in two bone volume compartments, respectively. The modified recycling model was used to estimate intake amounts, the resulting committed effective dose equivalent, maximum kidney concentrations, and dose equivalent to bone surfaces, kidneys, and lungs.

  7. Thermo-mechanical study of bare 48Y UF6 containers exposed to the regulatory fire environment.

    SciTech Connect (OSTI)

    Ammerman, Douglas James; Lopez, Carlos; Morrow, Charles; Korbmacher, Tim; Charette, Marc-Andre


    Most of the regulatory agencies world-wide require that containers used for the transportation of natural UF6 and depleted UF6 must survive a fully-engulfing fire environment for 30 minutes as described in 10CFR71 and in TS-R-1. The primary objective of this project is to examine the thermo-mechanical performance of 48Y transportation cylinders when exposed to the regulatory hypothetical fire environment without the thermal protection that is currently used for shipments in those countries where required. Several studies have been performed in which UF6 cylinders have been analyzed to determine if the thermal protection currently used on UF6 cylinders of type 48Y is necessary for transport. However, none of them could clearly confirm neither the survival nor the failure of the 48Y cylinder when exposed to the regulatory fire environment without the additional thermal protection. A consortium of five companies that move UF6 is interested in determining if 48Y cylinders can be shipped without the thermal protection that is currently used. Sandia National Laboratories has outlined a comprehensive testing and analysis project to determine if these shipping cylinders are capable of withstanding the regulatory thermal environment without additional thermal protection. Sandia-developed coupled physics codes will be used for the analyses that are planned. A series of destructive and non-destructive tests will be performed to acquire the necessary material and behavior information to benchmark the models and to answer the question about the ability of these containers to survive the fire environment. Both the testing and the analysis phases of this project will consider the state of UF6 under thermal and pressure loads as well as the weakening of the steel container due to the thermal load. Experiments with UF6 are also planned to collect temperature- and pressure-dependent thermophysical properties of this material.

  8. Prototype Radiation Detector Positioning System For The Automated Nondestructive Assay Of Uf6 Cylinders

    SciTech Connect (OSTI)

    Hatchell, Brian K.; Valdez, Patrick LJ; Orton, Christopher R.; Mace, Emily K.


    International Atomic Energy Agency (IAEA) inspectors currently perform periodic inspections at uranium enrichment plants to verify UF6 cylinder enrichment declarations. Measurements are typically performed with handheld high-resolution sensors on a sampling of cylinders taken to be representative of the facility’s entire cylinder inventory. These measurements are time-consuming, expensive, and assay only a small fraction of the total cylinder volume. An automated nondestructive assay system capable of providing enrichment measurements over the full volume of the cylinder could improve upon current verification practices in terms of efficiency and assay accuracy. This paper describes an approach denoted the Integrated Cylinder Verification Station (ICVS) that supports 100% cylinder verification, provides volume-averaged cylinder enrichment assay, and reduces inspector manpower needs. To allow field measurements to be collected to validate data collection algorithms, a prototype radiation detector positioning system was constructed. The system was designed to accurately position an array of radiation detectors along the length of a cylinder to measure UF6 enrichment. A number of alternative radiation shields for the detectors were included with the system. A collimated gamma-ray spectrometer module that allows translation of the detectors in the surrounding shielding to adjust the field of view, and a collimating plug in the end to further reduce the low-energy field of view, were also developed. Proof-of-principle measurements of neutron and high-energy gamma-ray signatures, using moderated neutron detectors and large-volume spectrometers in a fixed-geometry, portal-like configuration, supported an early assessment of the viability of the concept. The system has been used successfully on two testing campaigns at an AREVA fuel fabrication plant to scan over 30 product cylinders. This paper will describe the overall design of the detector positioning system and provide an overview of the Integrated Cylinder Verification Station (ICVS) approach.

  9. A Laser-Based Method for On-Site Analysis of UF6 at Enrichment Plants

    SciTech Connect (OSTI)

    Anheier, Norman C.; Cannon, Bret D.; Martinez, Alonzo; Barrett, Christopher A.; Taubman, Matthew S.; Anderson, Kevin K.; Smith, Leon E.


    The International Atomic Energy Agency’s (IAEA’s) long-term research and development plan calls for more cost-effective and efficient safeguard methods to detect and deter misuse of gaseous centrifuge enrichment plants (GCEPs). The IAEA’s current safeguards approaches at GCEPs are based on a combination of routine and random inspections that include environmental sampling and destructive assay (DA) sample collection from UF6 in-process material and selected cylinders. Samples are then shipped offsite for subsequent laboratory analysis. In this paper, a new DA sample collection and onsite analysis approach that could help to meet challenges in transportation and chain of custody for UF6 DA samples is introduced. This approach uses a handheld sampler concept and a Laser Ablation, Laser Absorbance Spectrometry (LAARS) analysis instrument, both currently under development at the Pacific Northwest National Laboratory. A LAARS analysis instrument could be temporarily or permanently deployed in the IAEA control room of the facility, in the IAEA data acquisition cabinet, for example. The handheld PNNL DA sampler design collects and stabilizes a much smaller DA sample mass compared to current sampling methods. The significantly lower uranium mass reduces the sample radioactivity and the stabilization approach diminishes the risk of uranium and hydrogen fluoride release. These attributes enable safe sample handling needed during onsite LAARS assay and may help ease shipping challenges for samples to be processed at the IAEA’s offsite laboratory. The LAARS and DA sampler implementation concepts will be described and preliminary technical viability results presented.

  10. Remote Monitoring and Tracking of UF6 Cylinders Using Long-Range Passive Ultra-wideband (UWB) RFID Tags

    SciTech Connect (OSTI)

    Nekoogar, F; Dowla, F


    An IAEA Technical Meeting on Techniques for IAEA Verification of Enrichment Activities identified 'smart tags' as a technology that should be assessed for tracking and locating UF6 cylinders. Although there is vast commercial industry working on RFID systems, the vulnerabilities of commercial products are only beginning to emerge. Most of the commercially off-the-shelf (COTS) RFID systems operate in very narrow frequency bands, making them vulnerable to detection, jamming and tampering and also presenting difficulties when used around metals (i.e. UF6 cylinders). Commercial passive RFID tags have short range, while active RFID tags that provide long ranges have limited lifetimes. There are also some concerns with the introduction of strong (narrowband) radio frequency signals around radioactive and nuclear materials. Considering the shortcomings of commercial RFID systems, in their current form, they do not offer a promising solution for continuous monitoring and tracking of UF6 cylinders. In this paper, we identify the key challenges faced by commercial RFID systems for monitoring UF6 cylinders, and introduce an ultra-wideband approach for tag/reader communications that addresses most of the identified challenges for IAEA safeguards applications.

  11. A "Proof-of-Concept" Demonstration of RF-Based Technologies for UF6 Cylinder Tracking at Centrifuge Enrichment Plant

    SciTech Connect (OSTI)

    Pickett, Chris A; Younkin, James R; Kovacic, Donald N; Dixon, E. T.; Martinez, B.


    This effort describes how radio-frequency (RF) technology can be integrated into a uranium enrichment facility's nuclear materials accounting and control program to enhance uranium hexafluoride (UF6) cylinder tracking and thus provide benefits to both domestic and international safeguards. Approved industry-standard cylinders are used to handle and store UF6 feed, product, tails, and samples at uranium enrichment plants. In the international arena, the International Atomic Energy Agency (IAEA) relies on time-consuming manual cylinder inventory and tracking techniques to verify operator declarations and to detect potential diversion of UF6. Development of a reliable, automated, and tamper-resistant process for tracking and monitoring UF6 cylinders would greatly reduce the risk of false or misreported cylinder tare weights, diversion of nuclear material, concealment of excess production, utilization of undeclared cylinders, and misrepresentation of the cylinders contents. This paper will describe a "proof-of concept" system that was designed show the feasibility of using RF based technologies to track individual UF6 cylinders throughout their entire life cycle, and thus ensure both increased domestic accountability of materials and a more effective and efficient method for application of IAEA international safeguards at the site level. The proposed system incorporates RF-based identification devices, which provide a mechanism for a reliable, automated, and tamper-resistant tracking network. We explore how securely attached RF tags can be integrated with other safeguards technologies to better detect diversion of cylinders. The tracking system could also provide a foundation for integration of other types of safeguards that would further enhance detection of undeclared activities.

  12. Automated Nondestructive Assay of UF6 Cylinders: Detector Characterization and Initial Measurements

    SciTech Connect (OSTI)

    Mace, Emily K.; Smith, Leon E.


    International Atomic Energy Agency (IAEA) inspectors currently perform periodic inspections at uranium enrichment plants to verify UF6 cylinder enrichment declarations. Measurements are typically performed with handheld high-resolution sensors on a sampling of cylinders assumed to be representative of the facility's entire cylinder inventory. These measurements are time-consuming and assay only a small fraction of the total cylinder volume. An automated nondestructive assay system capable of providing enrichment measurements over the full volume of the cylinder could improve upon current verification practices in terms of manpower and assay accuracy. Pacific Northwest National Laboratory is developing an Integrated Cylinder Verification System (ICVS) intended for this purpose and has developed a field prototype of the nondestructive assay (NDA) components of an ICVS. The nondestructive assay methods would combine the 'traditional' enrichment-meter signature (i.e. 186-keV emission from 235U) as well as 'non-traditional' high-energy photon signatures derived from neutrons produced primarily by 19F({alpha},n) reactions. This paper describes the design, calibration and characterization of the NaI(Tl) and LaBr3(Ce) spectrometers utilized in the field prototype. An overview of a recent field measurement campaign is then provided, supported by example gamma-ray pulse-height spectra collected on cylinders of known enrichment.

  13. Technology Assessment for Proof-of-Concept UF6 Cylinder Unique Identification Task 3.1.2 Report – Survey and Assessment of Technologies

    SciTech Connect (OSTI)

    Wylie, Joann; Hockert, John


    The National Nuclear Security Administration (NNSA) Office of Nonproliferation and International Security’s (NA-24) Next Generation Safeguards Initiative (NGSI) and the nuclear industry have begun to develop approaches to identify and monitor uranium hexafluoride (UF6) cylinders. The NA-24 interest in a global monitoring system for UF6 cylinders relates to its interest in supporting the International Atomic Energy Agency (IAEA) in deterring and detecting diversion of UF6 (e.g., loss of cylinder in transit) and undeclared excess production at conversion and enrichment facilities. The industry interest in a global monitoring system for UF6 cylinders relates to the improvements in operational efficiencies that such a system would provide. This task is part of an effort to survey and assess technologies for a UF6 cylinder to identify candidate technologies for a proof-of-concept demonstration and evaluation for the Cylinder Identification System (CIS).

  14. Hybrid Enrichment Assay Methods for a UF6 Cylinder Verification Station: FY10 Progress Report

    SciTech Connect (OSTI)

    Smith, Leon E.; Jordan, David V.; Orton, Christopher R.; Misner, Alex C.; Mace, Emily K.


    Pacific Northwest National Laboratory (PNNL) is developing the concept of an automated UF6 cylinder verification station that would be located at key measurement points to positively identify each cylinder, measure its mass and enrichment, store the collected data in a secure database, and maintain continuity of knowledge on measured cylinders until the arrival of International Atomic Energy Agency (IAEA) inspectors. At the center of this unattended system is a hybrid enrichment assay technique that combines the traditional enrichment-meter method (based on the 186 keV peak from 235U) with non-traditional neutron-induced high-energy gamma-ray signatures (spawned primarily by 234U alpha emissions and 19F(alpha, neutron) reactions). Previous work by PNNL provided proof-of-principle for the non-traditional signatures to support accurate, full-volume interrogation of the cylinder enrichment, thereby reducing the systematic uncertainties in enrichment assay due to UF6 heterogeneity and providing greater sensitivity to material substitution scenarios. The work described here builds on that preliminary evaluation of the non-traditional signatures, but focuses on a prototype field system utilizing NaI(Tl) and LaBr3(Ce) spectrometers, and enrichment analysis algorithms that integrate the traditional and non-traditional signatures. Results for the assay of Type-30B cylinders ranging from 0.2 to 4.95 wt% 235U, at an AREVA fuel fabrication plant in Richland, WA, are described for the following enrichment analysis methods: 1) traditional enrichment meter signature (186 keV peak) as calculated using a square-wave convolute (SWC) algorithm; 2) non-traditional high-energy gamma-ray signature that provides neutron detection without neutron detectors and 3) hybrid algorithm that merges the traditional and non-traditional signatures. Uncertainties for each method, relative to the declared enrichment for each cylinder, are calculated and compared to the uncertainties from an attended HPGe verification station at AREVA, and the IAEA’s uncertainty target values for feed, tail and product cylinders. A summary of the major findings from the field measurements and subsequent analysis follows: • Traditional enrichment-meter assay using specially collimated NaI spectrometers and a Square-Wave-Convolute algorithm can achieve uncertainties comparable to HPGe and LaBr for product, natural and depleted cylinders. • Non-traditional signatures measured using NaI spectrometers enable interrogation of the entire cylinder volume and accurate measurement of absolute 235U mass in product, natural and depleted cylinders. • A hybrid enrichment assay method can achieve lower uncertainties than either the traditional or non-traditional methods acting independently because there is a low degree of correlation in the systematic errors of the two individual methods (wall thickness variation and 234U/235U variation, respectively). This work has indicated that the hybrid NDA method has the potential to serve as the foundation for an unattended cylinder verification station. When compared to today’s handheld cylinder-verification approach, such a station would have the following advantages: 1) improved enrichment assay accuracy for product, tail and feed cylinders; 2) full-volume assay of absolute 235U mass; 3) assay of minor isotopes (234U and 232U) important to verification of feedstock origin; single instrumentation design for both Type 30B and Type 48 cylinders; and 4) substantial reduction in the inspector manpower associated with cylinder verification.

  15. Summary of Field Measurement on UF6 Cylinders Using Electro-Mechanically Cooled Systems

    SciTech Connect (OSTI)

    McGinnis, Brent R; Smith, Steven E; Solodov, Alexander A; Whitaker, J Michael; Morgan, James B; MayerII, Richard L.; Montgomery, J. Brent


    Measurement of the enrichment of solid state UF6 stored within large metal cylinders is a task commonly performed by plant operators and inspectors. The measurement technologies typically used range from low-resolution, high-efficiency sodium iodide detectors to high-resolution, moderate-efficiency high-purity germanium (HPGe) detectors. The technology used and methods deployed are dependent upon the material being measured, environmental conditions, time constraints, and measurement-precision requirements. Operators and inspectors typically use specially designed, HPGe detectors that are cooled with liquid nitrogen in situations where high-resolution measurements are required. However, the requirement for periodically refilling the system with liquid nitrogen makes remote usage cumbersome and slow. The task of cooling the detector reduces the available time for the inspector to perform other safeguards activities while on site. If the inspector has to reduce the count time for each selected cylinder to ensure that all preselected cylinders are measured during the inspection, the resulting measurement uncertainties may be increased, making it more difficult to detect and verify potential discrepancies in the operator's declarations. However, recent advances in electromechanically cooled HPGe detectors may provide the inspector with an improved verification tool by eliminating the need for liquid nitrogen. This report provides a summary of test results for field measurements performed using electromechanically cooled HPGe detectors on depleted, natural, and low-enriched uranium cylinders. The results of the study provide valuable information to inspectors and operators regarding the capabilities and limitations of electromechanically cooled systems based on true field-measurement conditions.

  16. Signatures and Methods for the Automated Nondestructive Assay of UF6 Cylinders at Uranium Enrichment Plants

    SciTech Connect (OSTI)

    Smith, Leon E.; Mace, Emily K.; Misner, Alex C.; Shaver, Mark W.


    International Atomic Energy Agency (IAEA) inspectors currently perform periodic inspections at uranium enrichment plants to verify UF6 cylinder enrichment declarations. Measurements are typically performed with handheld high-resolution sensors on a sampling of cylinders taken to be representative of the facility’s entire cylinder inventory. These measurements are time-consuming, expensive, and assay only a small fraction of the total cylinder volume. An automated nondestructive assay system capable of providing enrichment measurements over the full volume of the cylinder could improve upon current verification practices in terms of manpower and assay accuracy. Such a station would use sensors that can be operated in an unattended mode at an industrial facility: medium-resolution scintillators for gamma-ray spectroscopy (e.g., NaI(Tl)) and moderated He-3 neutron detectors. This sensor combination allows the exploitation of additional, more-penetrating signatures beyond the traditional 185-keV emission from U-235: neutrons produced from F-19(α,n) reactions (spawned primarily from U 234 alpha emission) and high-energy gamma rays (extending up to 8 MeV) induced by neutrons interacting in the steel cylinder. This paper describes a study of these non-traditional signatures for the purposes of cylinder enrichment verification. The signatures and the radiation sensors designed to collect them are described, as are proof-of-principle cylinder measurements and analyses. Key sources of systematic uncertainty in the non-traditional signatures are discussed, and the potential benefits of utilizing these non-traditional signatures, in concert with an automated form of the traditional 185-keV-based assay, are discussed.


    SciTech Connect (OSTI)

    McDonald, Benjamin S.; Jordan, David V.; Orton, Christopher R.; Mace, Emily K.; Smith, Leon E.; Wittman, Richard S.


    ABSTRACT Pacific Northwest National Laboratory (PNNL) is developing an automated UF6 cylinder verification station concept based on the combined collection of traditional enrichment-meter (186 keV photons from U-235) data and non-traditional, neutron-induced, high-energy gamma-signatures (3-8.5 MeV) with an array of collimated, medium-resolution scintillators. Previous (2010) work at PNNL demonstrated proof-of-principle that this hybrid method yields accurate, full-volume assay of the cylinder enrichment, reduces systematic errors when compared to several other enrichment assay methods, and provides simplified instrumentation and algorithms suitable for long-term unattended operations. We used Monte Carlo modeling with MCNP5 to support system design (e.g., number and configuration of detector arrays, and design of iron/poly collimators for enhanced (n,γ) conversion) and enrichment algorithm development. We developed a first-generation modeling framework in 2010. These tools have since been expanded, refined and benchmarked against field measurements with a prototype system of a 30B cylinder population (0.2 to 4.95 weight % U-235). The MCNP5 model decomposes the radiation transport problem into a linear superposition of “basis spectra” representing contributions from the different uranium isotopes and gamma-ray generation mechanisms (e.g. neutron capture). This scheme accommodates fast generation of “virtual assay signatures” for arbitrary enrichment, material age, and fill variations. Ongoing (FY-2011) refinements to the physics model include accounting for generation of bremsstrahlung photons, arising primarily from the beta decay of Pa-234m, a U-238 daughter. We are using the refined model to optimize collimator design for the hybrid method. The traditional assay method benefits from a high degree of collimation (to isolate each detector’s field-of-view) and relatively small detector area, while the non-traditional method benefits from a wide field-of-view, i.e. less collimation and larger detectors. We implement the enrichment-meter method by applying a square-wave digital filter to a raw spectrum and extracting the 186-keV peak area directly from the convolute spectrum. Ongoing enhancements to this approach include mitigating a systematic peak-area measurement deficit arising from curvature in the spectrum continuum shape. An optimized system prototype based on model results is utilized in a new set of 2011 field measurements, and model and measurement enrichment assay uncertainties are compared.

  18. Automated UF6 Cylinder Enrichment Assay: Status of the Hybrid Enrichment Verification Array (HEVA) Project: POTAS Phase II

    SciTech Connect (OSTI)

    Jordan, David V.; Orton, Christopher R.; Mace, Emily K.; McDonald, Benjamin S.; Kulisek, Jonathan A.; Smith, Leon E.


    Pacific Northwest National Laboratory (PNNL) intends to automate the UF6 cylinder nondestructive assay (NDA) verification currently performed by the International Atomic Energy Agency (IAEA) at enrichment plants. PNNL is proposing the installation of a portal monitor at a key measurement point to positively identify each cylinder, measure its mass and enrichment, store the data along with operator inputs in a secure database, and maintain continuity of knowledge on measured cylinders until inspector arrival. This report summarizes the status of the research and development of an enrichment assay methodology supporting the cylinder verification concept. The enrichment assay approach exploits a hybrid of two passively-detected ionizing-radiation signatures: the traditional enrichment meter signature (186-keV photon peak area) and a non-traditional signature, manifested in the high-energy (3 to 8 MeV) gamma-ray continuum, generated by neutron emission from UF6. PNNL has designed, fabricated, and field-tested several prototype assay sensor packages in an effort to demonstrate proof-of-principle for the hybrid assay approach, quantify the expected assay precision for various categories of cylinder contents, and assess the potential for unsupervised deployment of the technology in a portal-monitor form factor. We refer to recent sensor-package prototypes as the Hybrid Enrichment Verification Array (HEVA). The report provides an overview of the assay signatures and summarizes the results of several HEVA field measurement campaigns on populations of Type 30B UF6 cylinders containing low-enriched uranium (LEU), natural uranium (NU), and depleted uranium (DU). Approaches to performance optimization of the assay technique via radiation transport modeling are briefly described, as are spectroscopic and data-analysis algorithms.

  19. An Operator Perspective from a Facility Evaluation of an RFID-Based UF6 Cylinder Accounting and Tracking System

    SciTech Connect (OSTI)

    Martyn, Rose; Fitzgerald, Peter; Stehle, Nicholas D; Rowe, Nathan C; Younkin, James R


    An operational field test of a Radio-Frequency Identification (RFID) system for tracking and accounting UF6 cylinders was conducted at the Global Nuclear Fuel Americas (GNF) fuel fabrication plant in 2009. The Cylinder Accountability and Tracking System (CATS) was designed and deployed by Oak Ridge National Laboratory (ORNL) and evaluated in cooperation with GNF. The system required that passive RFID be attached to several UF6 30B cylinders as they were received at the site; then the cylinders were tracked as they proceeded to interim storage, to processing in an autoclave, and eventually to disposition from the site. This CATS deployment also provided a direct integration of scale data from the site accountability scales. The integration of this information into the tracking data provided an attribute for additional safeguards for evaluation. The field test provided insight into the advantages and challenges of using RFID at an operating nuclear facility. The RFID system allowed operators to interact with the technology and demonstrated the survivability of the tags and reader equipment in the process environment. This paper will provide the operator perspective on utilizing RFID technology for locating cylinders within the facility, thereby tracking the cylinders for process and for Material Control & Accounting functions. The paper also will present the operator viewpoint on RFID implemented as an independent safeguards system.

  20. Results of Continuous Load Cell Monitoring Field Trial for UF6 Withdrawals at an Operating Industrial Plant

    SciTech Connect (OSTI)

    Krichinsky, Alan M; Bell, Lisa S; Conchewski, Curtis A; Peters, Benjamin R; Pickett, Chris A; Richardson, Dave; Rowe, Nathan C; Younkin, James R


    Continuous load cell monitoring (CLCM) has been implemented and tested for use as a safeguards tool during a 2009 field trial in an operating UF6 transfer facility. The transfer facility is part of the Portsmouth Gaseous Diffusion Plant in Piketon, Ohio, operated by the United States Enrichment Corporation. During the field trial, two process scales for UF{sub 6} cylinders were continuously monitored for a 6-month period as cylinders were being filled. The collected CLCM data were used in testing an event processor serving as a filter for highlighting measurements representing significant operational activities that are important in verifying declared operations. The collection of CLCM data, coupled with rules-based event processing, can provide inspectors with knowledge of a facility's feed and withdrawal activities occurring between site visits. Such process knowledge promises to enhance the effectiveness of safeguards by enabling inspectors to quantitatively compare declared activities directly with process measurements. Selected results of the field trial and event processing will be presented in the context of their value to an independent inspector and a facility operator.


    SciTech Connect (OSTI)

    Pickett, Chris A; Kovacic, Donald N; Morgan, Jim; Younkin, James R; Carrick, Bernie; Ken, Whittle; Johns, R E


    Approved industry-standard cylinders are used globally for storing and transporting uranium hexafluoride (UF{sub 6}) at uranium enrichment plants and processing facilities. To verify that no diversion or undeclared production of nuclear material involving UF{sub 6} cylinders at the facility has occurred, the International Atomic Energy Agency (IAEA) conducts periodic, labor-intensive physical inspections to validate facility records, cylinder identities, and cylinder weights. A reliable cylinder monitoring system that would improve overall inspector effectiveness would be a significant improvement to the current international safeguards inspection regime. Such a system could include real-time unattended monitoring of cylinder movements, situation-specific rules-based event detection algorithms, and the capability to integrate with other types of safeguards technologies. This type of system could provide timely detection of abnormal operational activities that may be used to ensure more appropriate and efficient responses by the IAEA. A system of this type can reduce the reliance on paper records and have the additional benefit of facilitating domestic safeguards at the facilities at which it is installed. A radio-frequency (RF)-based system designed to track uranium hexafluoride (UF{sub 6}) cylinders during processing operations was designed, assembled, and tested at the United States Enrichment Corporation (USEC) facility in Portsmouth, Ohio, to determine the operational feasibility and durability of RF technology. The overall objective of the effort was to validate the robustness of RF technology for potential use as a future international safeguards tool for tracking UF6 cylinders at uranium-processing facilities. The results to date indicate that RF tags represent a feasible technique for tracking UF{sub 6} cylinders in operating facilities. Additional work will be needed to improve the operational robustness of the tags for repeated autoclave processing and to add tamper-indicating and data authentication features to some of the pertinent system components. Future efforts will focus on these needs along with implementing protocols relevant to IAEA safeguards. The work detailed in this report demonstrates the feasibility of constructing RF devices that can survive the operational rigors associated with the transportation, storage, and processing of UF6 cylinders. The system software specially designed for this project is called Cylinder Accounting and Tracking System (CATS). This report details the elements of the CATS rules-based architecture and its use in safeguards-monitoring and asset-tracking applications. Information is also provided on improvements needed to make the technology ready, as well as options for improving the safeguards aspects of the technology. The report also includes feedback from personnel involved in the testing, as well as individuals who could utilize an RF-based system in supporting the performance of their work. The system software was set up to support a Mailbox declaration, where a declaration can be made either before or after cylinder movements take place. When the declaration is made before cylinders move, the operators must enter this information into CATS. If the IAEA then shows up unexpectedly at the facility, they can see how closely the operational condition matches the declaration. If the declaration is made after the cylinders move, this provides greater operational flexibility when schedules are interrupted or are changed, by allowing operators to declare what moves have been completed. The IAEA can then compare where cylinders are with where CATS or the system says they are located. The ability of CATS to automatically generate Mailbox declarations is seen by the authors as a desirable feature. The Mailbox approach is accepted by the IAEA but has not been widely implemented (and never in enrichment facilities). During the course of this project, we have incorporated alternative methods for implementation.

  2. Field Facilities Contacts for Printing and Mail | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

  3. Thermal Reactions of Uranium Metal, UO2, U3O8, UF4, and UO2F2 with NF3 to Produce UF6

    SciTech Connect (OSTI)

    McNamara, Bruce K.; Scheele, Randall D.; Kozelisky, Anne E.; Edwards, Matthew K.


    he objective of this paper is to demonstrate that NF3 fluorinates uranium metal, UO2, UF4, UO3, U3O8, and UO2F22H2O to produce the volatile UF6 at temperatures between 100 and 500?C. Thermogravimetric reaction profiles are described that reflect changes in the uranium oxidation state and discrete chemical speciation. Differences in the onset temperatures for each system indicate that NF3-substrate interactions are important for the temperature at which NF3 reacts: U metal > UO3 > UO2 > UO2F2 > UF4 and in fact may indicate different fluorination mechanisms for these various substrates. These studies demonstrate that NF3 is a potential replacement fluorinating agent in the existing nuclear fuel cycle and in oft-proposed actinide volatility reprocessing.

  4. Read Your E-mail | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read Your E-mail All Argonne employees can read their e-mail through the web. Argonne E-Mail service is a robust, reliable electronic communication solution for supporting day-to-day business activities. Features include e-mail, calendar, task lists, and contact lists. While it is designed to work Microsoft Outlook, it also works with other POP- and IMAP-based clients. All employees can read their e-mail through the web. Use the login link at right to get started. Login to E-mail

  5. Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular MOF-5 Analogues Comprising Commercially Available Organic Molecules Previous Next List R. L. Martin, L.-C. Lin,...

  6. Email Lists

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Email Lists Email Lists When you get a NERSC user account, an email alias is created for you of the form is an email alias that will forward mail to your delivery email address. The NERSC Information Management (NIM) accounting interface will display your delivery address under the Contact Info tab (select My Contact Info from the My Stuff pull-down in the NIM main menu). Please keep your contact information in NIM up-to-date. Announcements of interest to

  7. Electronic Mail Analysis Capability

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    Establishes the pilot program to test the Department of Energy (DOE) Electronic Mail Analysis Capability (EMAC), which will be used to monitor and analyze outgoing and incoming electronic mail (e-mail) from the National Nuclear Security Administration (NNSA) and DOE laboratories that are engaged in nuclear weapons design or work involving special nuclear material. No cancellation.

  8. Mail Services User's Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    This Manual provides detailed information on using the Department of Energy (DOE) mail services. Canceled by DOE G 573.1-1.

  9. mail_paycheck_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)


  10. Mail and Distribution | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  11. By Certified Mail May

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By Certified Mail May 4,2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestLand Transfer Dear Ms. Riehle: Pursuant to the...

  12. By E-Mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By E-Mail May 29, 2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestTank Inventories Dear Ms. Riehle: Pursuant to the...

  13. Mail Services | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  14. Mail Services User's Guide

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    This Guide provides information on using Department of Energy (DOE) mail services in accordance with U.S. Postal Service, General Services Administration (GSA), and DOE regulations. Cancels DOE M 573.1-1. Canceled by DOE N 251.89.

  15. Assessment of UF6 Equation of State

    SciTech Connect (OSTI)

    Brady, P; Chand, K; Warren, D; Vandersall, J


    A common assumption in the mathematical analysis of flows of compressible fluids is to treat the fluid as a perfect gas. This is an approximation, as no real fluid obeys the perfect gas relationships over all temperature and pressure conditions. An assessment of the validity of treating the UF{sub 6} gas flow field within a gas centrifuge with perfect gas relationships has been conducted. The definition of a perfect gas is commonly stated in two parts: (1) the gas obeys the thermal equation of state, p = {rho}RT (thermally perfect), and, (2) the gas specific heats are constant (calorically perfect). Analysis indicates the thermally perfect assumption is valid for all flow conditions within the gas centrifuge, including shock fields. The low operating gas pressure is the primary factor in the suitability of the thermally perfect equation of state for gas centrifuge computations. UF{sub 6} is not calorically perfect, as the specific heats vary as a function of temperature. This effect is insignificant within the bulk of the centrifuge gas field, as gas temperatures vary over a narrow range. The exception is in the vicinity of shock fields, where temperature, pressure, and density gradients are large, and the variation of specific heats with temperature should be included in the technically detailed analyses. Results from a normal shock analysis incorporating variable specific heats is included herein, presented in the conventional form of shock parameters as a function of inlet Mach Number. The error introduced by assuming constant specific heats is small for a nominal UF{sub 6} shock field, such that calorically perfect shock relationships can be used for scaling and initial analyses. The more rigorous imperfect gas analysis should be used for detailed analyses.

  16. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Attendee List Attendee List Last edited: 2016-04-29 11:34:28

  17. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May 16, 2013 Mail discussion Joe Whitford opened the meeting by introducing Al Majors to talk about mail related items. 1) Update on the USPS mail name changes. If approved by the Postal Regulatory Commission the following name changes will go into effective July 28, 2013: a. Express Mail will be called Priority Mail Express b. Express Mail International will be Priority Mail International c. Express Mail Corporate Account will become USPS Express Corporate Account Only the names of these

  18. All Software List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Compilers Programming Models Version Control Tools Programming Libraries Performance and Debugging Tools Grid Software and Services NERSC Software Downloads Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support 1-800-66-NERSC, option 2 or 510-486-8612 Consulting

  19. I/O Library List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ROOT I/O Library List Databases Best Practices Data Analytics Data Transfer Workflow Tools Science Gateways Data Visualization Connecting to NERSC Queues and Scheduling Job Logs & Statistics Application Performance Training & Tutorials Software Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support

  20. Fermilab | Press Room | Subscribe to Press Release mailing list

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sheets and Brochures Fermilab Today symmetry Photo and Video Archive Resources for ... Employees Researchers, Postdocs and Graduate Students Job Seekers Neighbors...

  1. LLNL E-Mail Utilities

    Energy Science and Technology Software Center (OSTI)


    The LLNL E-mail Utilities software library is a Java API that simplifies the creation and delivery of email in Java business applications. It consists of a database-driven template engine, various strategies for composing, queuing, dispatching email and a Java Swing GUI for creating and editing email templates.

  2. Sign Up for E-mail Updates | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Sign Up for E-mail Updates Materials Sciences and Engineering (MSE) Division MSE Home About Staff What's New Research Areas Reports and Activities Science Highlights Principal Investigators' Meetings BES Home What's New Sign Up for E-mail Updates Print Text Size: A A A FeedbackShare Page The Division has a "Dear Colleague" email list, which is used to circulate general information such as funding opportunity announcements and administrative information such as position openings. To

  3. Mail Management Memorandum, July 2, 2010 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and ...

  4. Minutes from the Print and Mail Managers Exchange Forum Teleconference...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail...

  5. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Attendee List Attendee List Here is a list of those in attendance in table order: 1. Ricky Kendall, Ames laboratory 2. Mike Minkoff, ANL 3. Brian Hingerty, ORNL 4. Doug Rotman, LLNL 5. David J. Dean, ORNL 6. Don Spong, ORNL 7. Viktok K. Decyk, UCLA 8. Robert Ryne, LANL 9. Ji Qiang, LANL 10. Sandy Merola, LBNL 11. Doug Olson, LBNL 12. Jim Craw, NERSC/LBNL 13. Greg Butler, NERSC/LBNL 14. Tammy S. Welcome, NERSC/LBNL 15. David H. Bailey, NERSC/LBNL 16. Alex Zunger, NREL 17. Bruce Ross, NOAA 18. Tom

  6. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Attendee List Attendee List ERSUG - Attendees John Allen - NERSC Bas Braams - NYU Jack Byers - LLNL Bruce Curtis - NERSC David Feller - PNL Judith Giarrusso - PPPL Brent Gorda - NERSC Bruce Griffing - NERSC Bill Herrmannsfeldt - SLAC Brian Hingerty - ORNL Barry Howard - NERSC Stephen Jardin - PPPL Morris Jette - NERSC Bruce Kelly - NERSC Rick Kendall - PNL Tom Kitchens - DOE Dale Koelling - DOE Jean-Noel Leboeuf - ORNL Steve Louis - NERSC Maureen McCarthy - PNL Michel McCoy - NERSC William


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    COMPLETE LISTING: DISPOSITION AUTHORITIES FROZEN UNDER THE EPIDEMIOLOGICAL MORATORIUM MARCH 2008 Listed below are all the disposition authorities which are under the moratorium on the destruction of health related records as of March 2008. All records scheduled under these authorities at Department of Energy (DOE) headquarters and field sites should be preserved past their normal retention periods unless an headquarters organization or a field site has obtained permission to remove records

  8. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 21, 2013 Mail Managers discussion Joe Whitford opened the meeting by introducing Tony Nellums to talk about mail related items. 1) Mr. Nellums introduced Derek Milner, Policy Advisor from the GSA Office of Government-wide policy. a. Mr. Milner stated that he is being replaced as primary policy contact by Linda Willoughby ( or (202) 219-1083. b. Initiatives discussed by Mr. Milner included: Upcoming mail reports. The SMART system is online and available now.

  9. Field Facilities Contacts for Printing and Mail

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Print and Mail Contacts Site Printing Contact Mail Contact NNSA, Albuquerque Deborah Miller (505) 845-6049 Thomas H. Clinkenbeard NNSA Service Center PO Box 5400 Albuquerque, NM 87185-5400 (505) 845-4602 ( Argonne National Laboratory Doreen Schoening Argonne National Laboratory U.S. Department of Energy 9700 South Cass Avenue Blvd 340 Lemonmt, IL 60439 (630) 840-6399

  10. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Attendee List Attendee List June 2004 NUG Meeting Participants Name Phone Email Organization Thursday Friday Benjamin A. Allan 925-294-2453 Sandia National Laboratories here Harsh Anand 510-486-5575 LBL grid Michael Banda 510-486-2837 LBNL here David Bernholdt 865-574-3147 ORNL grid Wes Bethel 510-486-7353 LBNL here here Greg Butler 510-486-8691 NERSC here Tina Butler 510-495-2379

  11. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Attendee List Attendee List Participants Registered for NUG Meeting, November 9, 2004 Name Phone Email Organization Number Attending Brandon Allgood 831-212-1802 UCSC 1 Matthew Andrews 510-872-7747 NERSC 1 Alan Aspuru-Guzik 510-642-2154 UC Berkeley 1 Michael Banda 510-495-2837 LBNL 1 David Bernholdt 865-574-3147 ORNL 1 Wes Bethel 510-486-7353 LBNL 1 to 3 Andrew Canning 510-495-2962

  12. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Attendee List Attendee List June 12-13 NUG Meeting Registrants PPPL, On site 24 registered Name Affiliation Location Citizenship Days Monday Dinner? Matthew Andrews Berkeley Lab PPPL USA June 12-13 Yes Elena Belova PPPL PPPL Russian June 12-13 No Joshua Breslau PPPL PPPL U.S. June 12-13 Yes Jonathan Carter Berkeley Lab PPPL United Kingdom June 12-13 Yes Jin Chen PPPL PPPL Chinese June 12-13 No Jim Craw NERSC PPPL USA June 12 Yes Brent Draney NERSC PPPL USA June 12-13 Yes Stephane Ethier PPPL

  13. Trails List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    List Trails List Trail-specific access information and rules. It is your responsibility to understand the rules of a particular trail. Contact Environmental Communication & Public Involvement P.O. Box 1663 MS M996 Los Alamos, NM 87545 (505) 667-0216 Email A | B | C | D | E | F | G | H | I | J | K | L | M | N | O | P | Q | R | S | T | U | V | W | X | Y | Z Ancho Canyon Trail Closed Ancho Springs Trail Access: Open to the public Length: 1.78 miles Elevation change: 1027 feet Connecting trails:

  14. Staff Listing - Office of Regulation and International Engagement, Division

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Natural Gas Regulation, Division of International Engagement | Department of Energy Staff Listing - Office of Regulation and International Engagement, Division of Natural Gas Regulation, Division of International Engagement Staff Listing - Office of Regulation and International Engagement, Division of Natural Gas Regulation, Division of International Engagement Office of Regulation and International Engagement Mailing Address: Office of Regulation and International Engagement Office of

  15. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Attendee List Attendee List Name Phone Email Monday Tuesday Wednesday Joonhee An 510-495-2990 X X X Alan Aspuru-Guzik 510-652-1671 X Polly Baker 317-278-8150 X John Bell 510-486-5391 X Wes Bethel 510-486-7353 X X Mark Brewer 510-666-0263 X Greg Butler 510-486-8691 X X Christopher Cantalupo 510-495-2967 X Jonathan Carter 510-486-7514

  16. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Attendee List Attendee List Attendees at NERSC: Onsite and Remote participation Tech-X, On-site 29 registered (29 for Oct. 7, 25 for Oct. 8) Name Affiliation Location Days Dinner? Katie Antypas NERSC InPerson Oct. 7-8 Yes Travis Austin Tech-X Corp InPerson Oct. 7 No Jon Bashor LBNL InPerson Oct. 7-8 Yes George Bell Tech-X Corp InPerson Oct. 7-8 No Jeff Broughton NERSC InPerson Oct. 7-8 Yes David Bruhwiler Tech-X Corp InPerson Oct. 7-8 No Eric Bylaska PNNL InPerson Oct. 7-8 Yes Scott Campbell

  17. UF6 overfilling prevention at Eurodif production Georges Besse plant

    SciTech Connect (OSTI)

    Reneaud, J.M.


    Risk of overfilling exists on different equipments of Georges BESSE Plant: cylinders, desublimers and intermediate tanks. The preventive measures are composed of technical devices: desublimers weighing, load monitoring alarms, automatic controls ... and procedures, training, safety organization. In thirteen years of operation, some incidents have occurred but none of them has caused any personal injuries. They are related and discussed. The main factors involved in the Sequoyah fuel facility accident on 1/4/1986 have been analyzed and taken into account.

  18. Supplemental Systems for Unattended UF6 Cylinder Monitoring

    SciTech Connect (OSTI)

    Curtis, Michael M.


    Cylinder assay and mass measurements, the mainstay of enrichment plant verification efforts have historically been performed by International Atomic Energy Agency (IAEA) inspectors using portable equipment. For the sake of efficiency, accuracy, and timeliness, such equipment is being supplanted by unattended measurement stations. Ancillary systems must be employed with such stations to ensure that measured parameters are properly recorded, cylinders are positively identified, operations occur according to procedure, and no tampering takes place in the inspectors’ absence. Depending on the facility, it may prove feasible to track cylinders from the measurement vicinity to their storage locations using surveillance. This paper will provide a cursory description of the various subsystems associated with Pacific Northwest National Laboratory’s Integrated Cylinder Verification Station and how inattention to the requirements of such systems could seriously diminish the capability of the integrated whole.

  19. Benefits of an International Database for UF6 Cylinders

    SciTech Connect (OSTI)

    Babcock, R A; Whitaker, J M; Murphy, J; Oakberg, J


    A reasonable expectation regarding the nuclear energy renaissance is that the location of fuel cycle nuclear materials throughout the world will be known. We ask--would an international system for uranium hexafluoride (UF{sub 6}) cylinders provide the effective assurances expected for international fuel supply and of the international fuel centers? This paper introduces the question and discusses the potential benefits of tracking UF{sub 6} cylinders through the development of an international database. The nonproliferation benefits of an international database for UF{sub 6} cylinders being used in the fuel cycle include an enhanced capability to reconcile nuclear material imports and exports. Currently, import and export declarations only require the reporting of total 'rolled up' quantities of nuclear materials contained in all items--not the quantities of materials in individual items like individual UF{sub 6} cylinders. The database could provide supplier countries with more assurance on the location of the UF{sub 6} cylinders they export. Additionally, a comprehensive database on all declared cylinders would be a valuable resource in detecting and recognizing undeclared cylinders. The database could potentially be administered by the IAEA and be accessible to authorized countries around the world. During the nuclear renaissance, the general public, as well as the participants will expect transparency and quality information about movement of nuclear fuel cycle nuclear materials. We will discuss the potential benefits of such a database for the suppliers, inspectorates, and general public.

  20. Materials Data on UF6 (SG:62) by Materials Project

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Kristin Persson


    Computed materials data using density functional theory calculations. These calculations determine the electronic structure of bulk materials by solving approximations to the Schrodinger equation. For more information, see

  1. Enhanced Algorithm for Traceability Measurements in UF6 Flow Pipe

    SciTech Connect (OSTI)

    Copinger, Thomas E; March-Leuba, Jose A; Upadhyaya, Belle R


    The Blend Down Monitoring System (BDMS) is used to continually assess the mixing and downblending of highly enriched uranium (HEU) with low-enriched uranium (LEU). This is accomplished by measuring the enrichment and the fissile mass flow rate of the UF{sub 6} gas located in each process pipe of the system by inducing the fission of the {sup 235}U contained in the gas. Measurements are taken along this process route to trace the HEU content all the way to the product stream, ensuring that HEU was down blended. A problem associated with the current traceability measuring algorithm is that it does not account for the time-varying background that is introduced to the system by the movement of the shutter located at the HEU leg of the process. The current way of dealing with that problem is to discard the data for periods when the HEU shutter is open (50% of overall data) because it correlates with the same timeframe in which the direct contribution to background from the HEU shutter was seen. The advanced algorithm presented in this paper allows for continuous measurement of traceability (100%) by accurately accounting for the varying background during the shutter-movement cycle. This algorithm utilizes advanced processing techniques that identify and discriminate the different sources of background radiation, instead of grouping them into one background group for the whole measurement cycle. By using this additional information, the traceability measurement statistics can achieve a greater number of values, thus improving the overall usefulness of these measurements in the BDMS. The effectiveness of the new algorithm was determined by modeling it in a simulation and ensuring that it retained its integrity through a large number of runs, including various shutter-failure conditions. Each run was performed with varying amounts of background radiation from each individual source and with varying traceability counts. The simulations documented in this paper prove that the algorithm can stand up to various transients introduced into the system, such as failure of shutter movement.

  2. Minutes from the January 10, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 10, 2013 Mail discussion Al Majors opened the meeting by discussing the Mail Management Report and latest update on status. One final report is yet to be submitted, after which close out will be accomplished. Copies will be provided to the Mail Managers once completed. Al introduced Derrick Miliner, Program Manager from the General Services Administration, Office of Government-wide Policy, and acknowledged Mr. Miliner's role in completing the Mail Management Report. Mail Security Plans A

  3. List based prefetch

    DOE Patents [OSTI]

    Boyle, Peter; Christ, Norman; Gara, Alan; Kim; ,Changhoan; Mawhinney, Robert; Ohmacht, Martin; Sugavanam, Krishnan


    A list prefetch engine improves a performance of a parallel computing system. The list prefetch engine receives a current cache miss address. The list prefetch engine evaluates whether the current cache miss address is valid. If the current cache miss address is valid, the list prefetch engine compares the current cache miss address and a list address. A list address represents an address in a list. A list describes an arbitrary sequence of prior cache miss addresses. The prefetch engine prefetches data according to the list, if there is a match between the current cache miss address and the list address.

  4. List based prefetch

    DOE Patents [OSTI]

    Boyle, Peter; Christ, Norman; Gara, Alan; Kim, Changhoan; Mawhinney, Robert; Ohmacht, Martin; Sugavanam, Krishnan


    A list prefetch engine improves a performance of a parallel computing system. The list prefetch engine receives a current cache miss address. The list prefetch engine evaluates whether the current cache miss address is valid. If the current cache miss address is valid, the list prefetch engine compares the current cache miss address and a list address. A list address represents an address in a list. A list describes an arbitrary sequence of prior cache miss addresses. The prefetch engine prefetches data according to the list, if there is a match between the current cache miss address and the list address.

  5. T-618: Debian update for exim4: Mail Transport Agent

    Broader source: [DOE]

    It was discovered that Exim, the default mail transport agent in Debian, uses DKIM data obtain from DNS directly in a format string, potentially allowing malicious mail senders to execute arbitrary code.

  6. CAMD Cleanroom Chemical List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CAMD Cleanroom Chemical List Chemicals on this list are routine use chemicals in the CAMD ... Data Sheets and or Website. All chemical MSDS sheets are the hyperlink "(MSDS)" ...

  7. UF Access List | Stanford Synchrotron Radiation Lightsource

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    UF Access List Palceholder

  8. Acronym master list

    SciTech Connect (OSTI)


    This document is a master list of acronyms and other abbreviations that are used by or could be useful to, the personnel at Los Alamos National Laboratory. Many specialized and well-known abbreviations are not included in this list.

  9. List of Math Libraries

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Libraries List List of Math Libraries Package Platform Version Module Install Date Date Made Default A Fortran interface to the GNU Scientific Library (GSL) edison 1.0.0 fgsl1.0.0 ...

  10. List mode multichannel analyzer

    DOE Patents [OSTI]

    Archer, Daniel E.; Luke, S. John; Mauger, G. Joseph; Riot, Vincent J.; Knapp, David A.


    A digital list mode multichannel analyzer (MCA) built around a programmable FPGA device for onboard data analysis and on-the-fly modification of system detection/operating parameters, and capable of collecting and processing data in very small time bins (<1 millisecond) when used in histogramming mode, or in list mode as a list mode MCA.

  11. Minutes from the January 19, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide FY-2010 Three-Year Plan Dallas Woodruff, Headquarters in formed the group that the Department-wide Printing and Publishing Activities is currently in the concurrence

  12. Minutes from the January 20, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    , 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Department-wide Printing and Publishing Activities Report Three-Year Plan. Dallas Woodruff,

  13. Minutes from the July 21, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    July 21, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Government Printing Office revisions to the Standard Form one (SF!), Twenty-five

  14. Minutes from the June 28, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    June 28, 2012 Mail discussion Al Majors opened the meeting by introducing United Parcel Service (UPS) Representative Shelly Scott. Ms. Scott's contact information is: Shelly Scott 404 402-9827 (cell) Ms. Scott discussed issues relating to various UPS services available to the department. Next Al introduced Michael R. Sanders, President and Chief Executive Officer of Intra-Mail Network, an innovative, information Technology Company that improves the delivery of mail or email

  15. Minutes from the May 26, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    26, 2010 Printing and Mail Managers Exchange Forum Teleconference Seventeen individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the FY 2010, Congressional Joint Committee on Printing Commercial Printing Report "JCP

  16. Minutes from the November 01, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 1, 2012 Mail discussion Al Majors opened the meeting by introducing Derrick Milner, Program Manager from the General Services Administration, Office of Government-wide Policy. Mr. Majors and Mr. Miliner discussed the pending Official Mail Management Report for the FY-2012. The question on where to put data relating to certified and registered mail was addressed. It should be placed under the others section or under first class, standard delivery. Mr. Majors also discussed the pending

  17. Minutes from the November 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 17, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty seven individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide "Three-Year Plan" Dallas Woodruff, Headquarters opened the meeting by thanking everyone for providing their sites Three-Year Plan data to Headquarters in

  18. Minutes from the September 15, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    September 15, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-four individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Upcoming FY 2010 Department-wide Three-Year Plan Dallas Woodruff, Headquarters informed the

  19. Headquarters Program & Staff Office Mailing Addresses | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000

  20. Minutes from the Print and Mail Managers Exchange Forum Teleconferences

    Broader source: [DOE]

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences.  Contact the Office of Administrative Management and Support at (202) 586-4318 with any questions.

  1. Minutes from the May 3, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    http:www.gsa.govmailpolicy (for training options) ... discussion Brainstorming discussion on methodsapproaches to reduce printing expenses: ...

  2. Geothermal publications list for Geopowering the West States

    SciTech Connect (OSTI)


    A list of geothermal publications is provided for each of the states under the ''GeoPowering the West'' program. They are provided to assist the various states in developing their geothermal resources for direct-use and electric power applications. Each state publication list includes the following: (1) General papers on various direct-uses and electric power generation available from the Geo-Heat Center either by mail or on-line at: (2) General Geo-Heat Center Quarterly Bulletin articles related to various geothermal uses--also available either by mail or on-line; (3) Publications from other web sites such as:; NREL, EGI, GEO and others ; and (4) Geothermal Resources Council citations, which are available from their web site:

  3. Fire Hazards Listing

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hazards Listing Fire Hazards Listing Focusing on fire prevention and protection. Contact Fire Management Officer Manuel J. L'Esperance Emergency Management (505) 667-1692 Email Currently reported fire hazards Below are the currently reported fire hazards. The list is updated each day by the close of business. Current fire hazards Hazard Description Date Submitted Status No hazards currently reported. Legend: R=Resolved, P=Pending, NAR=No Action Required

  4. LEDP - New Listings

    Office of Scientific and Technical Information (OSTI)

    ...www.osti.govledp The listing of new equipment available through the LEDP Grant Program. 89726661250046W - TEMPERATURE TRANSMITTER http:www.osti.govledpdetails.jsp?...

  5. Associative list processing unit

    DOE Patents [OSTI]

    Hemmert, Karl Scott; Underwood, Keith D.


    An associative list processing unit and method comprising employing a plurality of prioritized cell blocks and permitting inserts to occur in a single clock cycle if all of the cell blocks are not full. Also, an associative list processing unit and method comprising employing a plurality of prioritized cell blocks and using a tree of prioritized multiplexers descending from the plurality of cell blocks.

  6. Associative list processing unit

    DOE Patents [OSTI]

    Hemmert, Karl Scott; Underwood, Keith D


    An associative list processing unit and method comprising employing a plurality of prioritized cell blocks and permitting inserts to occur in a single clock cycle if all of the cell blocks are not full.

  7. Minutes from the October 26, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Woodruff also said the files are due back to Headquarters no later November 11, 2011, and the report is due to congress by February 10, 2012. Mail Agenda Items...... Fiscal ...

  8. ARM - Topic List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TeachersTopic List Outreach Home Room News Publications Traditional Knowledge Kiosks Barrow, Alaska Tropical Western Pacific Site Tours Contacts Students Study Hall About ARM Global Warming FAQ Just for Fun Meet our Friends Cool Sites Teachers Teachers' Toolbox Lesson Plans Topic List Atmosphere Atmospheric Heat Budget Atmospheric Pressure Composition of the Atmosphere Evolution of the Atmosphere Mesosphere Stratosphere Thermosphere Troposphere Oceans Oceans Sea Surface and Sea Level Weather and

  9. The Future of Electric Vehicles and Arizona State University's MAIL

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  10. Minutes from the March 14, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 14, 2013 Mail discussion Al Majors is on leave today. Ellsworth Howell Jr. and Tony Nellums are sitting for Al. There are no agenda items for the Mail portion. A discussion period for questions, comments, or suggestions was opened without response Printing discussion Discussed suggestions for reducing printing expenses Presidential Executive Order 13589 and reducing hard copy printing in favor of electronic publishing Sec. 5. Printing. Agencies are encouraged to limit the publication and

  11. Mailing Addresses and Information Numbers for Operations, Field, and Site

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Offices | Department of Energy About » Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Name Telephone Number U.S. Department of Energy Ames Site Office 111 TASF, Iowa State University Ames, Iowa 50011 515-294-9557 U.S. Department of Energy Argonne Site Office 9800 S. Cass Avenue Argonne, IL 60439 630-252-2000 U.S. Department of Energy Berkeley Site Office Berkeley

  12. check list for those with one abnormal BeLPT

    Energy Savers [EERE]

    CHECK LIST FOR THOSE WHO HAVE HAD, OR WHO IN THE FUTURE HAVE, ONE ABNORMAL BeLPT _____ Fill out the EE-1 and EE-3 and include a copy of any abnormal BeLPT results that you have; review the EE-7 form. _____ Make a copy of the completed forms (one to keep for yourself). _____ Take the original copy of your forms (or mail them) to your nearest EEOICPA Resource Center. If you have already filed these forms, please do not fill them out again, just skip to the next item, below. _____ After you are

  13. List of Programming Tools

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Programming Tools List List of Programming Tools Package Platform Version Module Install Date Date Made Default 7zip genepool 9.20.1 7zip/9.20.1 2013-01-14 2013-01-14 7zip phoebe 9.20.1 7zip/9.20.1 2013-01-14 2013-06-26 ABINIT cori 7.10.4 abinit/7.10.4 2015-09-24 2015-09-24 ABINIT edison 7.0.5 abinit/7.0.5 2013-03-12 2013-03-12 ABINIT edison 7.10.2 abinit/7.10.2 2015-01-27 ABINIT edison 7.10.4 abinit/7.10.4 2015-07-31 ABINIT edison 7.4.2 abinit/7.4.2 2014-06-26 2014-06-26 ABINIT edison 7.6.4

  14. NETL Focused Standards List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1/6/14 Contact: Janet Lambert Reviewed: 3/5/14 Page 1 of 17 The National Energy Technology Laboratory (NETL) Focused Standards List is primarily derived from standard references contained in the requirements section of NETL's environment, safety, security, and health (ESS&H) and cyber security directives. All standards shall reference the most current edition/version of that standard. 1. DEPARTMENT OF ENERGY (DOE) AND OTHER GOVERNMENT STANDARDS AND REQUIREMENTS a. DOE Directives The

  15. E-mail et Web : pour une navigation sans risque

    ScienceCinema (OSTI)



    Présentation orale en français, support visuel en anglais. À travers des exemples concrets, vous consoliderez vos connaissances et pourrez ainsi réajuster vos habitudes concernant l?utilisation sécurisée de votre boîte e-mail et de votre navigateur Web.

  16. NETL Focused Standards List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4/4/12 Contact: Janet Lambert Reviewed: 4/4/12 Page 1 of 17 This Focused Standards List has been primarily derived from selected standard references contained in NETL issued directives. All standards shall reference the most current edition/ version of that standard. DOE and other Government Standards and Requirements DOE DIRECTIVES Note: The following DOE directives can be found at DOE Policy 141.1, DOE Management of Cultural Resources DOE Order 142.1, Classified

  17. NETL Focused Standards List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6/12 Contact: Janet Lambert Reviewed: 10/4/12 Page 1 of 17 This Focused Standards List has been primarily derived from selected standard references contained in NETL issued directives. All standards shall reference the most current edition/ version of that standard. DOE and other Government Standards and Requirements DOE DIRECTIVES Note: The following DOE directives can be found at DOE Policy 141.1, DOE Management of Cultural Resources DOE Order 142.1, Classified

  18. Approaches to Approved Contractor Lists

    Broader source: [DOE]

    Better Buildings Neighborhood Program Workforce / Business Partners Peer Exchange Call: Approaches to Approved Contractor Lists, Call Slides and Summary, April 25, 2013. This workforce/business partners peer exchange call discussed approaches to approved contractor lists.

  19. V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets May 2, 2013 - 6:00am Addthis...

  20. Minutes from the February 23, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes Printing and Mail Managers Exchange Forum Teleconference February 23, 2012 Participants: Headquarters (5) National Energy Technology Laboratory, PA National Security Complex Y-12 (2) Oak Ridge National Laboratory Y-12 Site Office (2) Hanford Site Office Oak Ridge Association University Oak Ridge Operations Office BWXT Pantex Site Office JanTec Corporation, Richland, Washington Los Alamos National Laboratory Chicago Office Bettis Atomic Power Laboratory National Security Technology C1,

  1. Mail-Order Metal-Organic Frameworks (MOFs) | Center for Gas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SeparationsRelevant to Clean Energy Technologies | Blandine Jerome Mail-Order Metal-Organic Frameworks (MOFs)

  2. High temperature experiments on a 4 tons UF6 container TENERIFE program

    SciTech Connect (OSTI)

    Casselman, C.; Duret, B.; Seiler, J.M.; Ringot, C.; Warniez, P.


    The paper presents an experimental program (called TENERIFE) whose aim is to investigate the behaviour of a cylinder containing UF{sub 6} when exposed to a high temperature fire for model validation. Taking into account the experiments performed in the past, the modelization needs further information in order to be able to predict the behaviour of a real size cylinder when engulfed in a 800{degrees}C fire, as specified in the regulation. The main unknowns are related to (1) the UF{sub 6} behaviour beyond the critical point, (2) the relationship between temperature field and internal pressure and (3) the equivalent conductivity of the solid UF{sub 6}. In order to investigate these phenomena in a representative way it is foreseen to perform experiments with a cylinder of real diameter, but reduced length, containing 4 tons of UF{sub 6}. This cylinder will be placed in an electrically heated furnace. A confinement vessel prevents any dispersion of UF{sub 6}. The heat flux delivered by the furnace will be calibrated by specific tests. The cylinder will be changed for each test.

  3. Preliminary investigation of steel compatibility with potential materials of construction for UF6 cylinder chocks

    SciTech Connect (OSTI)

    Pawel, S.J.; Ziehlke, K.T.; Swindeman, C.J.


    A set of compatibility experiments was performed to assess corrosion susceptibility of mild steel in long term contact with UF{sub 6} cylinder chocking materials and the atmosphere. Chock materials considered included concrete, pressure-treated wood, and creosote-treated wood. Immersion tests (panels partially submerged, 1000 h, 38 C), resistance probe measurements (600 h, ambient), and cyclic polarization tests on steel in leachate solutions generated from each chock material were performed. Results indicate that the long term corrosion susceptibility of mild steel in contact with concrete and the atmosphere is at least the equivalent of -- and under some conditions superior to -- that for steel in contact with pressure-treated or creosote-treated wood. No corrosion-related limitation for concrete chocks for long term support of mild steel UF{sub 6} cylinders was identified.

  4. Status Report on the Passive Neutron Enrichment Meter (PNEM) for UF6 Cylinder Assay

    SciTech Connect (OSTI)

    Miller, Karen A.; Swinhoe, Martyn T.; Menlove, Howard O.; Marlow, Johnna B.


    The Passive Neutron Enrichment Meter (PNEM) is a nondestructive assay (NDA) system being developed at Los Alamos National Laboratory (LANL). It was designed to determine {sup 235}U mass and enrichment of uranium hexafluoride (UF{sub 6}) in product, feed, and tails cylinders (i.e., 30B and 48Y cylinders). These cylinders are found in the nuclear fuel cycle at uranium conversion, enrichment, and fuel fabrication facilities. The PNEM is a {sup 3}He-based neutron detection system that consists of two briefcase-sized detector pods. A photograph of the system during characterization at LANL is shown in Fig. 1. Several signatures are currently being studied to determine the most effective measurement and data reduction technique for unfolding {sup 235}U mass and enrichment. The system collects total neutron and coincidence data for both bare and cadmium-covered detector pods. The measurement concept grew out of the success of the Uranium Cylinder Assay System (UCAS), which is an operator system at Rokkasho Enrichment Plant (REP) that uses total neutron counting to determine {sup 235}U mass in UF{sub 6} cylinders. The PNEM system was designed with higher efficiency than the UCAS in order to add coincidence counting functionality for the enrichment determination. A photograph of the UCAS with a 48Y cylinder at REP is shown in Fig. 2, and the calibration measurement data for 30B product and 48Y feed and tails cylinders is shown in Fig. 3. The data was collected in a low-background environment, meaning there is very little scatter in the data. The PNEM measurement concept was first presented at the 2010 Institute of Nuclear Materials Management (INMM) Annual Meeting. The physics design and uncertainty analysis were presented at the 2010 International Atomic Energy Agency (IAEA) Safeguards Symposium, and the mechanical and electrical designs and characterization measurements were published in the ESARDA Bulletin in 2011.

  5. Results of Continuous Load Cell Monitoring Field Trial for UF6...

    Office of Scientific and Technical Information (OSTI)


  6. Next Generation Safeguards Initiative: Overview and Policy Context of UF6 Cylinder Tracking Program

    SciTech Connect (OSTI)

    Boyer, Brian D; Whitaker, J. Michael; White-Horton, Jessica L.; Durbin, Karyn R.


    Thousands of cylinders containing uranium hexafluoride (UF{sub 6}) move around the world from conversion plants to enrichment plants to fuel fabrication plants, and their contents could be very useful to a country intent on diverting uranium for clandestine use. Each of these large cylinders can contain close to a significant quantity of natural uranium (48Y cylinder) or low-enriched uranium (LEU) (30B cylinder) defined as 75 kg {sup 235}U which can be further clandestinely enriched to produce 1.5 to 2 significant quantities of high enriched uranium (HEU) within weeks or months depending on the scale of the clandestine facility. The National Nuclear Security Administration (NNSA) Next Generation Safeguards Initiative (NGSI) kicked off a 5-year plan in April 2011 to investigate the concept of a unique identification system for UF{sub 6} cylinders and potentially to develop a cylinder tracking system that could be used by facility operators and the International Atomic Energy Agency (IAEA). The goal is to design an integrated solution beneficial to both industry and inspectorates that would improve cylinder operations at the facilities and provide enhanced capabilities to deter and detect both diversion of low-enriched uranium and undeclared enriched uranium production. The 5-year plan consists of six separate incremental tasks: (1) define the problem and establish the requirements for a unique identification (UID) and monitoring system; (2) develop a concept of operations for the identification and monitoring system; (3) determine cylinder monitoring devices and technology; (4) develop a registry database to support proof-of-concept demonstration; (5) integrate that system for the demonstration; and (6) demonstrate proof-of-concept. Throughout NNSA's performance of the tasks outlined in this program, the multi-laboratory team emphasizes that extensive engagement with industry stakeholders, regulatory authorities and inspectorates is essential to its success.

  7. Field Trial of LANL On-Line Advanced Enrichment Monitor for UF6 GCEP

    SciTech Connect (OSTI)

    Ianakiev, Kiril D.; Lombardi, Marcie; MacArthur, Duncan W.; Parker, Robert F.; Smith, Morag K.; Keller, Clifford; Friend, Peter; Dunford, Andrew


    The outline of this presentation is: (1) Technology basis of on-line enrichment monitoring; (2) Timescale of trial; (3) Description of installed equipment; (4) Photographs; (5) Results; (6) Possible further development; and (7) Conclusions. Summary of the good things about the Advanced Enrichment Monitor (AEM) performance is: (1) High accuracy - normally better than 1% relative, (2) Active system as accurate as passive system, (3) Fast and accurate detection of enrichment changes, (4) Physics is well understood, (5) Elegant method for capturing pressure signal, and (6) Data capture is automatic, low cost and fast. A couple of negative things are: (1) Some jumps in measured passive enrichment - of around +2% relative (due to clock errors?); and (2) Data handling and evaluation is off-line, expensive and very slow. Conclusions are: (1) LANL AEM is being tested on E23 plant at Capenhurst; (2) The trial is going very well; (3) AEM could detect production of HEU at potentially much lower cost than existing CEMO; (4) AEM can measure {sup 235}U assay accurately; (5) Active system using X-Ray source would avoid need for pressure measurement; (6) Substantial work lies ahead to go from current prototype to a production instrument.

  8. Ultra-low field NMR for detection and characterization of 235 UF6

    SciTech Connect (OSTI)

    Espy, Michelle A; Magnelind, Per E; Matlashov, Andrei N; Urbaitis, Algis V; Volegov, Petr L


    We have demonstrated the first ultra-low field (ULF) nuclear magnetic resonance measurements of uranium hexafluoride (UF{sub 6}), both depleted and 70% enriched, which is used in the uranium enrichment process. A sensitive non-invasive detection system would have an important role in non-proliferation surveillance. A two-frequency technique was employed to remove the transients induced by rapidly switching off the 50 mT pre-polarization field. A mean transverse relaxation time T{sub 2} of 24 ms was estimated for the un-enriched UF{sub 6} sample measured at a mean temperature of 80 C. Nuclear magnetic resonance at ULF has several advantages including the ability to measure through metal, such as pipes, and simple magnetic field generation hardware. We present here recent data and discuss the potential for non-proliferation monitoring of enrichment and flow velocity.

  9. Accident Conditions versus Regulatory Test for NRC-Approved UF6 Packages

    SciTech Connect (OSTI)



    The Nuclear Regulatory Commission (NRC) approves new package designs for shipping fissile quantities of UF{sub 6}. Currently there are three packages approved by the NRC for domestic shipments of fissile quantities of UF{sub 6}: NCI-21PF-1; UX-30; and ESP30X. For approval by the NRC, packages must be subjected to a sequence of physical tests to simulate transportation accident conditions as described in 10 CFR Part 71. The primary objective of this project was to relate the conditions experienced by these packages in the tests described in 10 CFR Part 71 to conditions potentially encountered in actual accidents and to estimate the probabilities of such accidents. Comparison of the effects of actual accident conditions to 10 CFR Part 71 tests was achieved by means of computer modeling of structural effects on the packages due to impacts with actual surfaces, and thermal effects resulting from test and other fire scenarios. In addition, the likelihood of encountering bodies of water or sufficient rainfall to cause complete or partial immersion during transport over representative truck routes was assessed. Modeled effects, and their associated probabilities, were combined with existing event-tree data, plus accident rates and other characteristics gathered from representative routes, to derive generalized probabilities of encountering accident conditions comparable to the 10 CFR Part 71 conditions. This analysis suggests that the regulatory conditions are unlikely to be exceeded in real accidents, i.e. the likelihood of UF{sub 6} being dispersed as a result of accident impact or fire is small. Moreover, given that an accident has occurred, exposure to water by fire-fighting, heavy rain or submersion in a body of water is even less probable by factors ranging from 0.5 to 8E-6.

  10. Safety equipment list

    SciTech Connect (OSTI)

    Lavender, J.C.; Roe, N.A.


    This analysis assigns preliminary safety class (SC) designations to major systems and structures associated with the Multi-Function Waste Tank Facility (MWTF) project in accordance with the Multi-Function QAPP, W-236A (Hall 1994). Also included are SC assignments for those subsystems and major components of the major systems discussed in this document (see Appendices A and B). Component safety classifications have been completed through inspection (using engineering judgement) for simple systems, and through use of logic models (i.e., fault trees) for complicated systems. This analysis is intended to augment the SC systems list supplied in Chapter 9 of the MWTF Preliminary Safety Analysis Report (WHC 1994). Whereas WHC (1994) only addresses select systems, this analysis addresses the SC ramifications of all MWTF systems and structures as identified in the Title 1 design media. This document provides additional analyses of the system safety classifications assignments, and classifies systems not addressed in WHC (1994). This analysis specifically describes the safety functions) that must be performed by each MWTF system.

  11. IA Experts Listing 2014 | Department of Energy

    Energy Savers [EERE]

    IA Experts Listing 2014 IA Experts Listing 2014 PDF icon IA Experts Listing January 2014 More Documents & Publications Office of International Affairs Organization Chart PI...

  12. PHYSICAL INVENTORY LISTING | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PHYSICAL INVENTORY LISTING PHYSICAL INVENTORY LISTING Form supports nuclear materials control and accountability. PDF icon PHYSICAL INVENTORY LISTING More Documents & Publications ...

  13. TPA Project Manager's Lists - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TPA Project Manager's Lists Tri-Party Agreement The Agreement Announcements List of Approved Changes TPA Project Manager's Lists Modifications for Public Comment Data Management...

  14. Advanced Biofuels Industry Roundtable - List of Participants...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Biofuels Industry Roundtable - List of Participants Advanced Biofuels Industry Roundtable - List of Participants List of Participants from the May 18 Advanced Biofuels Industry ...

  15. EM Capital Asset Project List

    Broader source: [DOE]

    Read the EM Capital Asset Project List, which includes the project's name, site, current critical decision and current total project cost.

  16. Business Opportunities Forum Attendees List

    Office of Environmental Management (EM)

    CEO 6 Bowne, Johnny Energy Solutions Sales Director 7 Brandon, Lisa O. CDM Smith Client ... Forum Attendees List March 8, 2016 111 Smith, James Edgewater Technical Associates ...

  17. Directory Listings | Department of Energy

    Broader source: (indexed) [DOE]

    employees including their telephone number, routing symbol, and location (buildingroom number) A listing of Headquarters staff by organization including their telephone...

  18. supplemental_lists.xls | Department of Energy

    Energy Savers [EERE]

    lists.xls supplemental_lists.xls Office spreadsheet icon supplemental_lists.xls More Documents & Publications updated_supplemental_lists_1g-2g-3f_10-6-2011.xlsx updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx updated_supplemental_lists_1p_2p_3o_04302013

  19. Quality Procedure- Approved Suppliers List

    Broader source: [DOE]

    This procedure establishes the responsibilities, process, and records for developing and maintaining the Approved Suppliers List (ASL) for EM Headquarters Office of Standards and Quality Assurance in accordance with EM-QA-001, Environmental Management Quality Assurance Program.

  20. List of SEP Reporting Metrics

    Broader source: [DOE]

    DOE State Energy Program List of Reporting Metrics, which was produced by the Office of Energy Efficiency and Renewable Energy Weatherization and Intergovernmental Program for SEP and the Energy Efficiency and Conservation Block Grants (EECBG) programs.

  1. Listing of Defense Nuclear Facilities

    Energy Savers [EERE]

    Listing of Defense Nuclear Facilities The facilities listed below are considered DOE defense nuclear facilities for purposes of Section 3161. Kansas City Plant Pinellas Plant Mound Facility Fernald Environmental Management Project Site Pantex Plant Rocky Flats Environmental Technology Site, including the Oxnard Facility Savannah River Site Los Alamos National Laboratory Sandia National Laboratory Lawrence Livermore National Laboratory Oak Ridge National Laboratory Nevada Test Site 1 Y-12 Plant

  2. U-157: Ruby Mail Gem Directory Traversal and Shell Command Injection Vulnerabilities

    Broader source: [DOE]

    Some vulnerabilities have been reported in the Mail gem for Ruby, which can be exploited by malicious people to manipulate certain data and compromise a vulnerable system.


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HQ F 1410.2 (06-93) U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE (Receipt No.) MAIL STATION: DATE: TO: NAME: ROUTING SYMBOL: FROM: DOE Mail Facility, Office of Administration Services 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. ITEM NO. ITEM NO. ITEM NO. SIGN AND RETURN WITHIN 24 HOURS TO AVOID TRACER ACTION TO DOE MAIL FACILITY (Stamp Location) RECEIVED BY: DATE: Printed with soy ink on recycled paper

  4. Documentation of the status of international geothermal power plants and a list by country of selected geothermally active governmental and private sector entities

    SciTech Connect (OSTI)

    Not Available


    This report includes the printouts from the International Geothermal Power Plant Data Base and the Geothermally Active Entity Data Base. Also included are the explanation of the abbreviations used in the power plant data base, maps of geothermal installations by country, and data base questionnaires and mailing lists.

  5. Final Participant List | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Participant List Final Participant List List of the participants in the 2005 Workshop on Manufacturing for the Hydrogen Economy PDF icon mfg_wkshp_particpicants.pdf More Documents & Publications Roadmap on Manufacturing R&D for the Hydrogen Economy Transportation and Stationary Power Integration Workshop Attendees List DOE Fuel Cell Pre-Solicitiation Workshop Participants List

  6. Acquisition Letter Archive listing | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Archive listing Acquisition Letter Archive listing PDF icon Acquisition Letter Archive listing More Documents & Publications Microsoft Word - LibraryofPriorRulemakings.doc Policy Flash Archive Search File Acquisition Letters Remaining In Effect

  7. Energy & Manufacturing Workforce Training Topics List - Version...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    & Manufacturing Workforce Training Topics List - Version 1.7 (02.11.14) Energy & Manufacturing Workforce Training Topics List - Version 1.7 (02.11.14) View this searchable list of ...

  8. PMCDP Training Events Listing | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PMCDP Training Events Listing PMCDP Training Events Listing Calendar listing of all PMCDP Training Events. Advanced Risk Management (FQN 301), SRS May 24, 2016 8:00AM EDT to May ...

  9. Property Representatives Lists - HQ | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Property Representatives Lists - HQ Property Representatives Lists - HQ These are the current lists of Headquarters Property Representatives. If you have any questions please contact: Ellen Hall, Office of Logistics Operations, (301) 903-2613. PDF icon Authorized Property Pass Signers List and Accountable Property Representatives List, Effective April 1, 2016 More Documents & Publications Directory Listings AU Functional Area Points of Contact by Office Directors Headquarters Facilities

  10. Technology Deployment List | Open Energy Information

    Open Energy Info (EERE)

    technologiesmatrix.htmlcat OpenEI Keyword(s): EERE tool, Technology Deployment List Language: English References: Technology Deployment List1 Identify emerging-and...

  11. CNM Scientific Contact List | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CNM Scientific Contact List A list of scientific contacts for the Center for Nanoscale Materials PDF icon CNM Scientific Contact sheet 915...

  12. Category:Lists | Open Energy Information

    Open Energy Info (EERE)

    pages. Subcategories This category has the following 3 subcategories, out of 3 total. L Lists for Companies 11 pages Lists for Incentive Types 64 pages ...

  13. List of Approved Changes - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Changes Tri-Party Agreement The Agreement Announcements List of Approved Changes TPA Project Manager's Lists Modifications for Public Comment Data Management MP-14 WIDS...

  14. hud_doe_supplemental_list_of_eligible_properties_list_2.xls | Department of

    Energy Savers [EERE]

    Energy 2.xls hud_doe_supplemental_list_of_eligible_properties_list_2.xls Office spreadsheet icon hud_doe_supplemental_list_of_eligible_properties_list_2.xls More Documents & Publications hud_doe_supplemental_list_of_eligible_properties_list_2.xls list2_eligible_multifamily_buildings_10-cfr-440-22b4ii.xls hud_list-1_07-01-11.xls

  15. {open_quotes}Media-On-Demand{close_quotes} multimedia electronic mail: A tool for collaboration on the web

    SciTech Connect (OSTI)

    Tsoi, Kei Nam; Rahman, S.M.


    Undoubtedly, multimedia electronic mail has many advantages in exchanging information electronically in a collaborative work. The existing design of e-mail systems architecture is inefficient in exchanging multimedia message which has much larger volume, and requires more bandwidth and storage space than the text-only messages. This paper presents an innovative method for exchanging multimedia mail messages in a heterogeneous environment to support collaborative work over YAW on the Internet. We propose a {open_quotes}Parcel Collection{close_quotes} approach for exchanging multimedia electronic mail messages. This approach for exchanging multimedia electronic mail messages integrates the current WWW technologies with the existing electronic mail systems.

  16. Suspect Counterfeit SME List | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SME List Suspect Counterfeit SME List April 2014 Suspect Counterfeit SME List. PDF icon Suspect Counterfeit SME List - April 2014 More Documents & Publications FAQS Sponsors and Recognized Experts AU Functional Area Points of Contact by Office Directors Project Registration Number Assignments (Active)

  17. List of SME Contacts to Notify of Important Issues, April 2014

    Energy Savers [EERE]

    List of SME Contacts to Notify of Important Issues Anyone identifying names that should be changed are encouraged to provide the update information to Sharon Brown (AU-23) at 202-586-6377. April 2014 Subject Matter Area Name Telephone E-mail Address Office of Aviation Management Ferrin Moore 202-586-6171 Chemical Safety Topical Committee Joe Hopkins 301-903-5619 Chemical Safety Topical Committee Dave Weitzman 301-903-5401

  18. hud_doe_supplemental_list_of_eligible_properties_list_1.xls | Department of

    Energy Savers [EERE]

    Energy 1.xls hud_doe_supplemental_list_of_eligible_properties_list_1.xls Office spreadsheet icon hud_doe_supplemental_list_of_eligible_properties_list_1.xls More Documents & Publications hud_doe_supplemental_list_of_eligible_properties_list_1.xls rd_mfh_low_and_very_low.xls List 2: Eligible Multifamily Buildings 10-CFR-440.22(b)(4)(ii)

  19. Category:Lists for Companies | Open Energy Information

    Open Energy Info (EERE)

    in Buildings Sector List of Companies in Carbon Sector L cont. List of Companies in Efficiency Sector List of Companies in Geothermal Sector List of Companies in Hydrogen...

  20. DOE Employee Concerns Program (ECP) Contact List | Department...

    Energy Savers [EERE]

    DOE Employee Concerns Program (ECP) Contact List DOE Employee Concerns Program (ECP) Contact List DOE Employee Concerns Program (ECP) Contact List PDF icon ECP Contact List May...

  1. Category:Lists for Incentives | Open Energy Information

    Open Energy Info (EERE)

    Incentives List of Doors Incentives List of DuctAir sealing Incentives List of Energy Mgmt. SystemsBuilding Controls Incentives List of Equipment Insulation Incentives...

  2. Registration List - WCI-III

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    WCI-III Registration List Sandro Barlini, INFN - Laboratori Nazionali di Legnaro Wolfgang Bauer, Michigan State Aldo Bonasera, Laboratorio Nazionale del Sud, INFN Alexander Botvina, Institute for Nuclear Research RAS, Moscow Kyrill Bugaev, Lawrence Berkeley National Laboratory Xavier Campi, LPTMS Abdou Chbihi, GANIL Philippe Chomaz, GANIL Marco Cinausero, INFN Laboratori Nazionali di Legnaro Gianluca Colo', Dipartimento di Fisica Romualdo deSouza, Indiana University/IUCF Massimo Di Toro,

  3. Equipment Listing | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Equipment Listing Crystal Preparation and Characterization Resistance Heated Bridgman Crystal Growth Systems Back-Reflection Laue X-ray System Electro-Discharge Machining High and Low speed Diamond Saws Arc Zone Melting Crystal Growth System Lapping Fixtures for Precise Orientation of Crystals (0.1°) Physical Properties Measurement Facilities - Hardness Testing Vickers and Rockwell Hardness Testing Brinell Hardness Instrument Wilson Tukon Micro Hardness Tester Forming and Characterization

  4. Policy Flash Archive Search Listing

    Energy Savers [EERE]

    Policy Flash Archive Search Listing 1 Filename Flash2001-01 Rewrite of Regulations Governing Management and Operating Contracts Flash2001-02 Satellite Broadcast - Training Session on the DEAR Rewrite of Regulations Governing Management and Operating Contracts Flash2001-03 Federal Small Business Developments Flash2001-04 Notice of Proposed Rulemaking: Electronic and Information Technology Accessibility Flash2001-05 Contract Legal Management Requirements Flash2001-06 Notice of Proposed Rulemaking:

  5. Microsoft Word - BPD Priority List

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Priority Data Fields for the Building Performance Database (Updated 2014-12) Below is list of data fields ranked as the the priority fields in data collection for the purposes of BPD. These field names use the the Building Energy Data Exchange Specification 1.0 terms in order to clearly communicate the content of the fields and to facilitate easier data transfer. These fields have been determined to provide enough information to compare building energy performance. Mandatory fields are

  6. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  7. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  8. Legal and policy issues associated with monitoring employee E-mail

    SciTech Connect (OSTI)

    Segura, M.A.; Rither, A.C.


    This paper examines the legal issues involved with employer monitoring of employee e-mail. In addition to identifying pertinent legal issues, the paper provides guidelines that will help the Pacific Northwest National Laboratory (PNNL) establish a program for monitoring outgoing e-mail to insure compliance with company policies, particularly those regarding protection of trade secrets and proprietary information, and to comply with the Department of Energy`s (DOE) procedures for protecting Export Controlled Information (ECI). Electronic communication has allowed companies to enhance efficiency, responsiveness and effectiveness. E-mail allows employees to transmit all types of data to other individuals inside and outside of their companies. The ease with which information can be transmitted by e-mail has placed trade secrets, proprietary information, and other sensitive data at risk from inadvertent disclosure by employees. As employers attempt to protect their interests through measures such as monitoring e-mail, they may expose themselves to liability under federal and state laws for violating employee privacy. Business use of e-mail has proliferated so rapidly that the federal and state legal systems have not been able to adequately address the issues arising out of its use in the workplace.

  9. Site maps and facilities listings

    SciTech Connect (OSTI)

    Not Available


    In September 1989, a Memorandum of Agreement among DOE offices regarding the environmental management of DOE facilities was signed by appropriate Assistant Secretaries and Directors. This Memorandum of Agreement established the criteria for EM line responsibility. It stated that EM would be responsible for all DOE facilities, operations, or sites (1) that have been assigned to DOE for environmental restoration and serve or will serve no future production need; (2) that are used for the storage, treatment, or disposal of hazardous, radioactive, and mixed hazardous waste materials that have been properly characterized, packaged, and labelled, but are not used for production; (3) that have been formally transferred to EM by another DOE office for the purpose of environmental restoration and the eventual return to service as a DOE production facility; or (4) that are used exclusively for long-term storage of DOE waste material and are not actively used for production, with the exception of facilities, operations, or sites under the direction of the DOE Office of Civilian Radioactive Waste Management. As part of the implementation of the Memorandum of Agreement, Field Offices within DOE submitted their listings of facilities, systems, operation, and sites for which EM would have line responsibility. It is intended that EM facility listings will be revised on a yearly basis so that managers at all levels will have a valid reference for the planning, programming, budgeting and execution of EM activities.

  10. DOE Qualified List of Energy Service Companies

    Broader source: [DOE]

    Document contains the latest list of U.S. Department of Energy (DOE) qualified energy service companies (ESCOs).

  11. Critical Materials Workshop Final Participant List

    Broader source: [DOE]

    List of participants who attended the Critical Materials Workshop held on April 3, 2012 in Arlington, VA

  12. List of International Projects for FY 2012 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Services Communication & Engagement International Programs List of International Projects for FY 2012 List of International Projects for FY 2012 List of International ...

  13. 2014 DOE Project Management Workshop Attendees List | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DOE Project Management Workshop Attendees List 2014 DOE Project Management Workshop Attendees List PDF icon 2014 PM Workshop Attendees ListName & Office.pdf More Documents &...

  14. Battery and Electric Drive Awardee List from American Recovery...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Awardee List from American Recovery and Reinvestment Act funding Battery and Electric Drive Awardee List from American Recovery and Reinvestment Act funding This is a list of the ...

  15. Technical Standards Managers Contact List | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Technical Standards Managers Contact List Technical Standards Managers Contact List May 2016 Contact list for Technical Standards Managers in DOE, Field offices and National ...

  16. Evaluation of a RF-Based Approach for Tracking UF6 Cylinders at a Uranium Enrichment Plant

    SciTech Connect (OSTI)

    Pickett, Chris A; Younkin, James R; Kovacic, Donald N; Laughter, Mark D; Hines, Jairus B; Boyer, Brian; Martinez, B.


    Approved industry-standard cylinders are used globally to handle and store uranium hexafluoride (UF{sub 6}) feed, product, tails, and samples at uranium enrichment plants. The International Atomic Energy Agency (IAEA) relies on time-consuming physical inspections to verify operator declarations and detect possible diversion of UF{sub 6}. Development of a reliable, automated, and tamper-resistant system for near real-time tracking and monitoring UF{sub 6} cylinders (as they move within an enrichment facility) would greatly improve the inspector function. This type of system can reduce the risk of false or misreported cylinder tare weights, diversion of nuclear material, concealment of excess production, utilization of undeclared cylinders, and misrepresentation of the cylinders contents. This paper will describe a proof-of-concept approach that was designed to evaluate the feasibility of using radio frequency (RF)-based technologies to track individual UF{sub 6} cylinders throughout a portion of their life cycle, and thus demonstrate the potential for improved domestic accountability of materials, and a more effective and efficient method for application of site-level IAEA safeguards. The evaluation system incorporates RF-based identification devices (RFID) which provide a foundation for establishing a reliable, automated, and near real-time tracking system that can be set up to utilize site-specific, rules-based detection algorithms. This paper will report results from a proof-of-concept demonstration at a real enrichment facility that is specifically designed to evaluate both the feasibility of using RF to track cylinders and the durability of the RF equipment to survive the rigors of operational processing and handling. The paper also discusses methods for securely attaching RF devices and describes how the technology can effectively be layered with other safeguard systems and approaches to build a robust system for detecting cylinder diversion. Additionally, concepts for off-site tracking of cylinders are described.

  17. Completed Sites Listing | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Cleanup Sites » Completed Sites » Completed Sites Listing Completed Sites Listing As of fiscal year 2012, EM (and its predecessor organization UMTRA) completed cleanup and closed 91 sites in 24 states. PDF icon Completed Sites Listing More Documents & Publications EM's Cleanup Mission: 16 Sites in 11 States Remaining EA-1406: Final Environmental Assessment Electronic Docket Room (e-Docket Room) Active Sites Active Sites Additional Information Completed Sites

  18. PowerSaver Approved Lenders List

    Broader source: [DOE]

    This document describes the 2014 approved PowerSaver lender list with contact information for the various states across the United States.

  19. ARM - Firearm Training and Authorization List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AlaskaFirearm Training and Authorization List NSA Related Links Facilities and Instruments Barrow Atqasuk Oliktok Point (AMF3) ES&H Guidance Statement Operations Science Field...

  20. TTO Phone List | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    File TTO Phone List Revised 04-02-14.docx More Documents & Publications Technology Transfer Reporting Form DOE Hoisting and Rigging Technical Advisory Committee - Membership...

  1. Teaming Partner List for BENEFIT FOA Released

    Broader source: [DOE]

    Energy Efficiency and Renewable Energy (EERE) is compiling a Teaming Partner List to facilitate the formation of new project teams for the anticipated Buildings Energy Efficiency Frontiers &...

  2. List of Hydrogen Incentives | Open Energy Information

    Open Energy Info (EERE)

    Incentives Jump to: navigation, search The following contains the list of 61 Hydrogen Incentives. CSV (rows 1 - 61) Incentive Incentive Type Place Applicable Sector Eligible...

  3. CITSS Configurable Item List: COTS Software | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Configurable Item List: COTS Software CITSS Configurable Item List: COTS Software CITSS Configurable Item List: COTS Software PDF icon CITSS Configurable Item List: COTS Software More Documents & Publications CITSS Project Plan CITSS Project Plan Software Configuration Management Plan

  4. Privacy Act Officers Contact List | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Privacy Act Officers Contact List Privacy Act Officers Contact List File Privacy Act Officers Contact List.docx More Documents & Publications Technical Standards Managers Contact List DOE-TSL-2-2002 VPP POINTS OF CONTACT

  5. Rulemaking List for Public List Serve May 2016 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Rulemaking List for Public List Serve May 2016 Rulemaking List for Public List Serve May 2016 PDF icon Acquisition & Financial Assistance Rules Status_May_2016.pdf More Documents & Publications Acquisition & Financial Assistance Rules Status Department of Energy Acquisition Regulation (DEAR) Final Rule for changes to Parts 908, 945, 952, and 970 regarding Government Property Department of Energy Acquisition Regulation (DEAR) Final Rule for Subchapters A, B, and C

  6. Capital Asset Project List.xls

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... by DOE Order 413.3B, Program and Project Management for the Acquisition of Capital Assets. ... Start of Operations or Project Completion Capital Asset Project List 4112016 1 of 1

  7. Systems Analysis Workshop List of Attendees

    Broader source: [DOE]

    List of Attendees from DOE Systems Analysis Workshop held in Washington, D.C. July 28-29, 2004 to discuss and define role of systems analysis in DOE Hydrogen Program.

  8. Firearms Modifications List- June 13, 2012

    Broader source: [DOE]

    This document contains the currently-approved protective force "Firearms Modification List" referred to in Department of Energy Order 473.3, Protection Program Operations. This supersedes any previous versions of this document

  9. Summer of Applied Geophysical Experience Reading List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Geophysical Experience Reading List Summer of Applied Geophysical Experience Reading List A National Science Foundation Research Experiences for Undergraduates program Contacts Institute Director Reinhard Friedel-Los Alamos SAGE Co-Director W. Scott Baldridge-Los Alamos SAGE Co-Director Larry Braile-Purdue University Professional Staff Assistant Georgia Sanchez (505) 665-0855 Keller, R., Khan, M. A., Morgan, P., et al., 1991, A Comparative Study of the Rio Grande and Kenya rifts, Tectonophys.,

  10. DOE - NNSA/NFO -- Acronyms List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    List of Acronyms NNSA/NFO Language Options U.S. DOE/NNSA - Nevada Field Office List of Acronyms used on this website Acronym Definition AEC Atomic Energy Commission AMSI Advanced Monitoring Systems Initiative ARL/SORD Air Resources Laboratory, Special Operations and Research Division BEEF Big Explosives Experimental Facility BN Bechtel Nevada CAB Community Advisory Board CEF Criticality Experiments Facility CEMP Community Environmental Monitoring Program CRADA Cooperative Research and

  11. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    June 19, 2012 By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency U.S. Department of Energy Office of the General Counsel 1000 Independence Ave., SW Washington, D.C. 20585 Re: Regulatory Burden RFI Dear Mr. Cohen: The Association of Home Appliance Manufacturers (AHAM) respectfully submits the following comments to the Department of Energy (DOE) on its Regulatory Burden RFI, 77 Fed. Reg. 28518 (May 15, 2012). AHAM

  12. Extremely High-Frequency Holographic Radar Imaging of Personnel and Mail

    SciTech Connect (OSTI)

    McMakin, Douglas L.; Sheen, David M.; Griffin, Jeffrey W.; Lechelt, Wayne M.


    The awareness of terrorists covertly transporting chemical warfare (CW) and biological warfare (BW) agents into government, military, and civilian facilities to harm the occupants has increased dramatically since the attacks of 9/11. Government and civilian security personnel have a need for innovative surveillance technology that can rapidly detect these lethal agents, even when they are hidden away in sealed containers and concealed either under clothing or in hand-carried items such as mailed packages or handbags. Sensor technology that detects BW and CW agents in mail or sealed containers carried under the clothing are under development. One promising sensor technology presently under development to defeat these threats is active millimeter-wave holographic radar imaging, which can readily image concealed items behind paper, cardboard, and clothing. Feasibility imaging studies at frequencies greater than 40 GHz have been conducted to determine whether simulated biological or chemical agents concealed in mail packages or under clothing could be detected using this extremely high-frequency imaging technique. The results of this imaging study will be presented in this paper.

  13. Record Liaison Officers (RLO) Distribution List | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Record Liaison Officers (RLO) Distribution List Record Liaison Officers (RLO) Distribution List Distribution List of Record Liaison Officers PDF icon Record Liaison Officers (RLO) Distribution List More Documents & Publications Property Representatives Lists - HQ Collateral Duties for Records Liaison Officer (RLO) PROCEDURE FOR PREPARING RECORDS INVENTORY AND DISPOSITION SCHEDULES (RIDS)

  14. DOE Radiation Records Contacts List | Department of Energy

    Energy Savers [EERE]

    Radiation Records Contacts List DOE Radiation Records Contacts List March 2, 2016 DOE radiation records contact list for individuals to obtain records of occupational exposure directly from a DOE site. PDF icon DOE Radiation Records Contacts List More Documents & Publications A Basic Overview of the Energy Employees Occupational Illness Compensation Program DOE-STD-1095-2011 Privacy Act Officers Contact List

  15. Technology Forum Map and List of Awardees' Posters and Exhibits...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Technology Forum Map and List of Awardees' Posters and Exhibits Technology Forum Map and List of Awardees' Posters and Exhibits Technology Forum map and list of exhibits.pdf More...

  16. Tank waste remediation system risk management list

    SciTech Connect (OSTI)

    Collard, L.B.


    The Tank Waste Remedation System (TWRS) Risk Management List and it`s subset of critical risks, the Critical Risk Management List, provide a tool to senior RL and WHC management (Level-1 and -2) to manage programmatic risks that may significantly impact the TWRS program. The programmatic risks include cost, schedule, and performance risks. Performance risk includes technical risk, supportability risk (such as maintainability and availability), and external risk (i.e., beyond program control, for example, changes in regulations). The risk information includes a description, its impacts, as evaluation of the likelihood, consequences and risk value, possible mitigating actions, and responsible RL and WHC managers. The issues that typically form the basis for the risks are presented in a separate table and the affected functions are provided on the management lists.

  17. Public Meeting Attendee List: Sustainable Design Standards for...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Public Meeting Attendee List: Sustainable Design Standards for Federal Buildings Public Meeting Attendee List: Sustainable Design Standards for Federal Buildings This document is ...

  18. List of Topics for Interagency Performance & Risk Assessment...

    Energy Savers [EERE]

    List of Topics for Interagency Performance & Risk Assessment Community of Practice (P&RA CoP) Discussion List of Topics for Interagency Performance & Risk Assessment Community of ...

  19. List of Solar Pool Heating Incentives | Open Energy Information

    Open Energy Info (EERE)

    List of Solar Pool Heating Incentives Jump to: navigation, search The following contains the list of 117 Solar Pool Heating Incentives. CSV (rows 1 - 117) Incentive Incentive Type...

  20. List of Solar Thermal Process Heat Incentives | Open Energy Informatio...

    Open Energy Info (EERE)

    List of Solar Thermal Process Heat Incentives Jump to: navigation, search The following contains the list of 211 Solar Thermal Process Heat Incentives. CSV (rows 1 - 211) Incentive...

  1. Staff Listing - Office of Regulation and International Engagement...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Staff Listing - Office of Regulation and International Engagement, Division of Natural Gas Regulation, Division of International Engagement Staff Listing - Office of Regulation and ...

  2. DOE Fuel Cell Pre-Solicitiation Workshop Participants List |...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DOE Fuel Cell Pre-Solicitiation Workshop Participants List Participants List for DOE Fuel Cell Pre-Solicitiation Workshop - Sheraton Denver West Hotel, 360 Union Boulevard, ...

  3. Listing of Defense Nuclear Facilities | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Listing of Defense Nuclear Facilities PDF icon Attachment 1 - Listing of Defense Nuclear Facilities More Documents & Publications Draft Policy and Planning Guidance for Community ...

  4. DOE Privacy Program Contact Listing as of September 21, 2010...

    Broader source: (indexed) [DOE]

    DOE Privacy Program Contact Listing as of September 21, 2010 DOE Privacy Program Contact Listing as of September 21, 2010 More Documents & Publications Privacy Act Officers Contact...

  5. EV Everywhere Grand Challenge - Battery Workshop attendees list...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    EV Everywhere Grand Challenge - Battery Workshop attendees list Attendance list for the EV Everywhere Grand Challenge: Battery Workshop on July 26, 2012 held at the Doubletree ...

  6. Policy Flash Search Listing (2001-2014) | Department of Energy

    Energy Savers [EERE]

    Policy Flash Search Listing (2001-2014) Policy Flash Search Listing (2001-2014) Use your browser search function and keywords to search for a particular policy flash. PDF icon Policy Flash Listing 2001-2014 More Documents & Publications Department of Energy Acquisition Letter Archive listing Department of Energy (DOE) Acquisition Guide

  7. Fire Safety Committee Membership List | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fire Safety Committee Membership List Fire Safety Committee Membership List List of members representing DOE, NNSA and Contractors on the Fire Safety Committee. PDF icon Fire Safety Committee Membership List More Documents & Publications DOE Hoisting and Rigging Technical Advisory Committee - Membership Roster FAQS Sponsors and Recognized Experts FTCP Members

  8. EECBG SEP Attachment 1 - Process metric list | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SEP Attachment 1 - Process metric list EECBG SEP Attachment 1 - Process metric list Reporting Guidance Process Metric List PDF icon eecbg_10_07b_sep__10_006a_attachment1_process_metric_list.pdf More Documents & Publications EECBG 10-07C/SEP 10-006B Attachment 1: Process Metrics List EECBG Program Notice 10-07A DOE Recovery Act Reporting Requirements for the State Energy Program

  9. EECBG SEP Attachment 1 - Process metric list

    Energy Savers [EERE]

    EECBG 10-07B/SEP 10-006A Attachment 1: Process Metrics List Metric Area Metric Primary or Optional Metric Item(s) to Report On 1. Building Retrofits 1a. Buildings retrofitted, by sector Number of buildings retrofitted Square footage of buildings retrofitted 1b. Energy management systems installed, by sector Number of energy management systems installed Square footage of buildings under management 1c. Building roofs retrofitted, by sector Number of building roofs retrofitted Square footage of

  10. WIPP TRU TeamWorks - Acronym List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Acronym List AK Acceptable Knowledge ANL-E Argonne National Laboratory - East (Analytical Laboratory) BLM Bureau of Land Management C of C Certificate of Compliance CAST Colorado All State Transportation, Inc. CBFO Carlsbad Field Office (DOE) CCA Compliance Certification Application CCP Central Characterization Project CH-TRU Contact-Handled Transuranic (waste) CMR Central Monitoring Room CTAC Carlsbad Field Office Technical Assistance Contractor DOE United States Department of Energy DOE-CBFO

  11. Listed waste determination report. Environmental characterization

    SciTech Connect (OSTI)

    Not Available


    On September 23, 1988, the US Environmental Protection Agency (EPA) published a notice clarifying interim status requirements for the management of radioactive mixed waste thereby subjecting the Idaho National Engineering Laboratory (INEL) and other applicable Department of Energy (DOE) sites to regulation under the Resource Conservation and Recovery Act (RCRA). Therefore, the DOE was required to submit a Part A Permit application for each treatment, storage, and disposal (TSD) unit within the INEL, defining the waste codes and processes to be regulated under RCRA. The September 1990 revised Part A Permit application, that was approved by the State of Idaho identified 101 potential acute and toxic hazardous waste codes (F-, P-, and U- listed wastes according to 40 CFR 261.31 and 40 CFR 261.33) for some TSD units at the Idaho Chemical Processing Plant. Most of these waste were assumed to have been introduced into the High-level Liquid Waste TSD units via laboratory drains connected to the Process Equipment Waste (PEW) evaporator (PEW system). At that time, a detailed and systematic evaluation of hazardous chemical use and disposal practices had not been conducted to determine if F-, P-, or Unlisted waste had been disposed to the PEW system. The purpose of this investigation was to perform a systematic and detailed evaluation of the use and disposal of the 101 F-, P-, and Unlisted chemicals found in the approved September 1990 Part A Permit application. This investigation was aimed at determining which listed wastes, as defined in 40 CFR 261.31 (F-listed) and 261.33 (P & Unlisted) were discharged to the PEW system. Results of this investigation will be used to support revisions to the RCRA Part A Permit application.

  12. DPC List - DOE Directives, Delegations, and Requirements

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    DPC List by Patricia Greeson Headquarters and Associated Field/ Operations Offices and Contractors Directives Point of Contact Email Address Telephone AR Adam Goldstein 202-287-1061 AU Cecelia Kenney 202-586-4399 CF John Wall 202-586-5728 CI Daniel Woomer 202-586-9886 CTA/CNS Bud Danielson 301-903-2954 EA (Enterprise Assessment) Sharon Edge-Harley

  13. File:OperatingPermitCheckList.pdf | Open Energy Information

    Open Energy Info (EERE)

    OperatingPermitCheckList.pdf Jump to: navigation, search File File history File usage File:OperatingPermitCheckList.pdf Size of this preview: 463 599 pixels. Other resolution:...

  14. List of Solar Thermal Electric Incentives | Open Energy Information

    Open Energy Info (EERE)

    List of Solar Thermal Electric Incentives Jump to: navigation, search The following contains the list of 562 Solar Thermal Electric Incentives. CSV (rows 1-500) CSV (rows 501-562)...

  15. RFI Released to Compile Teaming Partner List for Upcoming BENEFIT...

    Energy Savers [EERE]

    RFI Released to Compile Teaming Partner List for Upcoming BENEFIT FOA RFI Released to Compile Teaming Partner List for Upcoming BENEFIT FOA September 29, 2015 - 10:43am Addthis...

  16. Utah Sensitive Species List Webpage | Open Energy Information

    Open Energy Info (EERE)

    Species List Webpage Jump to: navigation, search OpenEI Reference LibraryAdd to library Web Site: Utah Sensitive Species List Webpage Abstract Provides access to Utah Sensitive...

  17. CCC Federal License and Permit List | Open Energy Information

    Open Energy Info (EERE)

    CCC Federal License and Permit List Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- OtherOther: CCC Federal License and Permit ListLegal Abstract...

  18. Minnesota Member Lists the Twin Cities' First Energy Fit Certified...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minnesota Member Lists the Twin Cities' First Energy Fit Certified Home Minnesota Member Lists the Twin Cities' First Energy Fit Certified Home Photo of a small house from the ...

  19. Announcing the "Top 10" List of Green Utility Leaders

    Office of Energy Efficiency and Renewable Energy (EERE)

    Find out if your utility made the National Renewable Energy Laboratory's list of top green power programs.

  20. DOE Employee Concerns Program Contact List | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DOE Employee Concerns Program Contact List DOE Employee Concerns Program Contact List March 21 2016 Employee Concerns Program contact list/information for DOE HQ, field offices and program offices. PDF icon DOE Employee Concerns Program Contact List More Documents & Publications One Year Anniversary, Office of the Ombudsman WBA-15-0001 - In the Matter of Robert J. Schumacher The Role of Ombudsmen in Dispute Resolution


    National Nuclear Security Administration (NNSA)

    B, Page 1 SECTION L ATTACHMENT B LISTING OF KEY PERSONNEL TITLE NAME Note: Addremove extra rows if needed...

  2. Microsoft Word - Appendix G_DistributionList.doc

    Office of Legacy Management (LM)

    Distribution List U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page G-3 Except for individual stakeholders, this distribution list is composed of people representing organizations, which have expressed interest in site activities. When individual turnover occurs in these positions, DOE will revise the list to reflect the current holder of these positions. This type of revision is considered minor and not subject to review. All individuals on this list

  3. Comment Listing Response to Draft REEE Solicitation FINAL | Department of

    Energy Savers [EERE]

    Energy Comment Listing Response to Draft REEE Solicitation FINAL Comment Listing Response to Draft REEE Solicitation FINAL PDF icon Comment ListingResponse_REEE Solicitation_final.pdf More Documents & Publications Draft Advanced Fossil Energy Projects Solicitation Public Comments Draft Advanced Nuclear Energy Solicitation Public Meeting Presentation DOE-LPO_Email-Update_001_Through_11

  4. CompleteProject List.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CompleteProject List.doc&#0; CompleteProject List.doc&#0; PDF icon CompleteProject List.doc&#0; More Documents & Publications Tribal Energy Program February 2012 Award Project Descriptions CX-008525: Categorical Exclusion Determination 2010 Program Review Meeting

  5. Symbiosis Conference Speaker and Attendee List | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Conference Speaker and Attendee List Symbiosis Conference Speaker and Attendee List This list outlines the session topics, speakers, and attendees for the Bioenergy Technologies Office's Symbiosis Conference. PDF icon symbiosis_conference_speaker_agenda.pdf More Documents & Publications Symbiosis Biofeedstock Conference: Expanding Commercialization of Mutualistic Microbes to Increase Feedstock Production Symbiosis Conference: Expanding Commercialization of Mutualistic Microbes to Increase

  6. UMTRA project list of reportable occurrences

    SciTech Connect (OSTI)

    Not Available


    This UMTRA Project List of Reportable occurrences is provided to facilitate efficient categorization of reportable occurrences. These guidelines have been established in compliance with DOE minimum reporting requirements under DOE Order 5000.3B. Occurrences are arranged into nine groups relating to US Department of Energy (DOE) Uranium Mill Tailings Remedial Action (UMTRA) Project operations for active sites. These nine groupings are provided for reference to determined whether an occurrence meets reporting requirement criteria in accordance with the minimum reporting requirements. Event groups and significance categories that cannot or will not occur, and that do not apply to UMTRA Project operations, are omitted. Occurrence categorization shall be as follows: Group 1. Facility Condition; Group 2. Environmental; Group 3. Personnel Safety; Group 4. Personnel Radiation Protection; Group 5. Safeguards and Security; Group 6. Transportation; Group 7. Value Basis Reporting; Group 8. Facility Status; and Group 9. Cross-Category Items.

  7. Computerized Instrumented Residential Audit (CIRA) source listings

    SciTech Connect (OSTI)

    Not Available


    CIRA is a set of computer programs to predict the energy consumption of small buildings. It can also provide an optimized list of improvements which reduce energy use. A 30 page booklet (Pub-425 Revised) explaining CIRA inputs, outputs, and calculation methods is available at no cost through the Technical Information Department, Lawrence Berkeley Laboratory, University of California, Berkeley, CA 94720. It includes an order form for disk copies of the program and for the CIRA Reference Manual. The source code in BASIC contained in this document is provided to help a user adapt the program to a particular application, or to see details of the calculation algorithms. (The engineering basis of the algorithms may be found in the CIRA Reference Manual). The programs are written in Microsoft BASIC-80, and for the version of CIRA normally distributed they are compiled on the Microsoft BASIC-80 compiler version 5.30. They are designed to run with the CP/M operating system, version 2.2.


    National Nuclear Security Administration (NNSA)

    Page 130 PART III - LIST OF DOCUMENTS, EXHIBITS, AND OTHER ATTACHMENTS SECTION J LIST OF APPENDICES - TABLE OF CONTENTS Appendix A Statement of Work Appendix B Award Fee Plan Appendix C Transition Plan Appendix D Sensitive Foreign Nations Control Appendix E Performance Guarantee Agreement(s) Appendix F List of Applicable Directives Appendix G Personnel Appendix Appendix H Key Personnel Appendix I Small Business Subcontracting Plan Appendix J Diversity Plan Guidance Appendix K Program Management

  9. List of Major Information Systems,National Nuclear Security Administration

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ADaPT Networked: | Department of Energy List of Major Information Systems,National Nuclear Security Administration ADaPT Networked: List of Major Information Systems,National Nuclear Security Administration ADaPT Networked: List of Major Information Systems, Defense Line of Business National Nuclear Security Administration ADaPT Networked: Develops and deploys emerging information networking technology to production processes in support of the U.S. nuclear weapons stockpile. National Nuclear

  10. Hanford Advisory Board and Committee Lists - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    HAB and Committee Lists Hanford Advisory Board Convening Report SSAB Guidance Memorandum of Understanding Membership Nomination and Appointment Process Operating Ground Rules Calendars Advice and Responses Full Board Meeting Information Committee Meeting Information Outgoing Board Correspondence Key Board Products and Special Reports HAB Annual Report HAB and Committee Lists Points of Contact Related Links Hanford Advisory Board and Committee Lists Email Email Page | Print Print Page |Text

  11. Speaker List for EE Forum Breakout Sessions | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Speaker List for EE Forum Breakout Sessions Speaker List for EE Forum Breakout Sessions The document contains a full itinerary of the EE Forum Breakout Sessions that includes full lists of speakers and their topics. The document covers Session 1 and Session 2. Each session includes the Buildings & Appliances Track, Codes & Standards Track, Industry Track, and Financing & ESCOs Track. Each session includes three separate forums taking place in either the Boiler Room, Crystal Ballroom,

  12. Teaming Partner List Available for the Innovative Composites Institute FOA

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    | Department of Energy Teaming Partner List Available for the Innovative Composites Institute FOA Teaming Partner List Available for the Innovative Composites Institute FOA March 26, 2014 - 12:34pm Addthis AMO is compiling a Teaming Partner List to facilitate the formation of new project teams for the Funding Opportunity Announcement (FOA) for the Advanced Composites Manufacturing Innovation Institute. This opportunity is focused on low-cost, energy efficient manufacturing and recycling of


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 Occupational Medical Services at Hanford J-2-1 Section J Attachment J-2 LIST OF APPLICABLE DOE DIRECTIVES - LIST B The DOE Directives listed below contain requirements relevant to the scope of work under this contract. In most cases, the requirements applicable to the Contractor are contained in the Contractor Requirement Document attached to the DOE directive. These directives are applicable, in whole or in part, in accordance with Section I Clause entitled "DEAR 970.5204-2 LAWS,

  14. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    of Energy Buying a Car? Find Out What it Will REALLY Cost You Each Year Buying a Car? Find Out What it Will REALLY Cost You Each Year November 9, 2009 - 12:52pm Addthis Allison Casey Senior Communicator, NREL If you're in the market for a new car, you've probably been doing a lot of research. Talking to friends, reading reviews, scoping out other cars on the road, maybe even taking some test drives. You probably have a list of things you want in car, and you should consider all of these

  15. "List of Covered Electric Utilities" under the Public Utility...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    6 Revised "List of Covered Electric Utilities" under the Public Utility Regulatory Policies Act of 1978 (PURPA) - 2006 Revised Under Title I of the Public Utility Regulatory...

  16. Sequoia ranked third in TOP500 list | National Nuclear Security...

    National Nuclear Security Administration (NNSA)

    according to the industry-standard Top500 list. Sequoia, which recently completed its transition to classified computing in support of NNSA's Stockpile Stewardship Program,...


    National Nuclear Security Administration (NNSA)

    B, Page 1 SECTION L ATTACHMENT B LISTING OF KEY PERSONNEL TITLE NAME [Note: Add/remove extra rows if needed]

  18. ORIS: the Oak Ridge Imaging System program listings. [Nuclear...

    Office of Scientific and Technical Information (OSTI)

    program listings. Nuclear medicine imaging with rectilinear scanner and gamma camera Citation Details In-Document Search Title: ORIS: the Oak Ridge Imaging System program...

  19. ORIS: the Oak Ridge Imaging System program listings. [Nuclear...

    Office of Scientific and Technical Information (OSTI)

    program listings. Nuclear medicine imaging with rectilinear scanner and gamma camera Bell, P. R.; Dougherty, J. M. 62 RADIOLOGY AND NUCLEAR MEDICINE; 46 INSTRUMENTATION RELATED...

  20. List of Passive Solar Space Heat Incentives | Open Energy Information

    Open Energy Info (EERE)

    Solar Space Heat Incentives Jump to: navigation, search The following contains the list of 282 Passive Solar Space Heat Incentives. CSV (rows 1 - 282) Incentive Incentive Type...

  1. DOE Fuel Cell Pre-Solicitiation Workshop Participants List

    Broader source: [DOE]

    Participants List for DOE Fuel Cell Pre-Solicitiation Workshop - Sheraton Denver West Hotel, 360 Union Boulevard, Lakewood, CO - March 16-17, 2010

  2. List of Publications from the Energy for Development and Poverty...

    Open Energy Info (EERE)

    Publications from the Energy for Development and Poverty Reduction Website Jump to: navigation, search Tool Summary LAUNCH TOOL Name: List of Publications from the Energy for...

  3. "List of Covered Electric Utilities" under the Public Utility...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    "List of Covered Electric Utilities" under the Public Utility Regulatory Policies Act of 1978 (PURPA) - 2009 Under Title I, Sec. 102(c) of the Public Utility Regulatory Policies ...

  4. New Mexico Air Operating Permit List of Trivial Activities |...

    Open Energy Info (EERE)

    Operating Permit List of Trivial Activities Author New Mexico Environment Department - Air Quality Bureau Published New Mexico Environment Department - Air Quality Bureau, 2008...

  5. Oregon State Endangered Species List | Open Energy Information

    Open Energy Info (EERE)

    to library Web Site: Oregon State Endangered Species List Author Oregon Department of Fish and Wildlife Published State of Oregon, Date Not Provided DOI Not Provided Check for...

  6. Washington State Species of Concern Lists | Open Energy Information

    Open Energy Info (EERE)

    Web Site: Washington State Species of Concern Lists Author Washington Department of Fish & Wildlife Published State of Washington, Date Not Provided DOI Not Provided Check for...

  7. Plutonium Certified Reference Materials Price List | U.S. DOE...

    Office of Science (SC) Website

    NBL Program Office Home About Programs Certified Reference Materials (CRMs) Prices and ... Prices and Certificates Plutonium Certified Reference Materials Price List Print Text ...

  8. BLM - Western BLM Bird Species of Conservation Concern List ...

    Open Energy Info (EERE)

    BLM - Western BLM Bird Species of Conservation Concern List Jump to: navigation, search OpenEI Reference LibraryAdd to library PermittingRegulatory Guidance - Checklist: BLM -...

  9. Part VII: Section J - List of Documents, Exhibits, and Other...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    III SECTION J LIST OF DOCUMENTS, EXHIBITS, AND OTHER ATTACHMENTS TABLE OF CONTENTS ......... 55 Attachment J Performance Evaluation And Measurement Plan ...

  10. About the Oil and Gas Field Code Master List

    U.S. Energy Information Administration (EIA) Indexed Site

    ... Information Administration | About the Oil and Gas Field Code Master List 4 Island Harrison Bay 103 Point Hope 205 For State and Federal offshore areas, the following county ...

  11. California Endangered Species Act Species List | Open Energy...

    Open Energy Info (EERE)

    California Endangered Species Act Species List Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- OtherOther: California Endangered Species Act...

  12. Public Meeting Attendee List: Sustainable Design Standards for Federal Buildings

    Broader source: [DOE]

    This document is an attendee list for the public meeting to discuss sustainable design standards for Federal buildings held on July 28, 2010.

  13. NNSA Computers Lead Global List | National Nuclear Security Administra...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Computers Lead Global List | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering...

  14. Bio Yankuang Hong Kong Listed | Open Energy Information

    Open Energy Info (EERE)

    Yankuang Hong Kong Listed Place: China Product: Joint Venture for the manufacturing, marketing, deployment and participation in the operation of at least 1,300 of Biosphere...

  15. Notice of Availability of a Preliminary List of Standby Power...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and Testing Guidelines, Federal Register, 66 FR 67517, December 31, 2001 Notice of Availability of a Preliminary List of Standby Power Products and Testing Guidelines, Federal ...

  16. LEDSGP/contacts/AFOLU List Serve | Open Energy Information

    Open Energy Info (EERE)

    LEDSGPcontactsAFOLU List Serve < LEDSGP Jump to: navigation, search LEDS AFOLU Working Group @ Global Environment Centre, 2nd Floor, Wisma Hing, 78, Jalan SS272, 47300 Petaling...

  17. LEDS Collaboration in Action Workshop Attendee List | Open Energy...

    Open Energy Info (EERE)

    LEDS Collaboration in Action Workshop Attendee List (Redirected from LEDS Collaboration in Action Workshop Participating Countries) Jump to: navigation, search Low Emission...

  18. DOE/NSF Nuclear Science Advisory Committee2015 Membership List...

    Office of Science (SC) Website

    DOENSF Nuclear Science Advisory Committee 2015 Membership List Nuclear Science Advisory Committee (NSAC) NSAC Home Meetings NSAC Members ChargesReports Charter .pdf file (78KB) ...

  19. Headmark List of Suspect Counterfeit Fasteners 1992 | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PDF icon Headmark List of Suspect Counterfeit Fasteners 1992 More Documents & Publications SuspectCounterfeit Items Awareness Training Manual National Historic Preservation Act ...

  20. BLM Lists 2011 Priority Renewable Energy Projects | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    priority projects for developing onshore renewable energy on national public lands. The priority list includes nine solar projects, five wind projects, and five geothermal ...

  1. combined_supplemental_hud_multifamily_weatherization_list_3-2...

    Broader source: (indexed) [DOE]

    lihtc.xls More Documents & Publications list2eligiblemultifamilybuildings10-cfr-440-22b4ii.xls rdmfhlowandverylow.xls hudlist-1...

  2. Prototype Tests for the Recovery and Conversion of UF6 Chemisorbed in NaF Traps for the Molten Salt Reactor Remediation Project

    SciTech Connect (OSTI)

    Del Cul, G.D.; Icenhour, A.S.; Simmons, D.W.


    The remediation of the Molten Salt Reactor Experiment (MSRE) site includes the removal of about 37 kg of uranium. Of that inventory, about 23 kg have already been removed from the piping system and chemisorbed in 25 NaF traps. This material is being stored in Building 3019. The planned recovery of -11 kg of uranium from the fuel salt will generate another 15 to 19 NaF traps. The remaining 2 to 3 kg of uranium are present in activated charcoal beds, which are also scheduled to be removed from the reactor site. Since all of these materials (NaF traps and the uranium-laden charcoal) are not suitable for long-term storage, they will be converted to a chemical form [uranium oxide], which is suitable for long-term storage. This document describes the process that will be used to recover and convert the uranium in the NaF traps into a stable oxide for long-term storage. Included are a description of the process, equipment, test results, and lessons learned. The process was developed for remote operation in a hot cell. Lessons learned from the prototype testing were incorporated into the process design.

  3. Results from a "Proof-of-Concept" Demonstration of RF-Based Tracking of UF6 Cylinders during a Processing Operation at a Uranium Enrichment Plant

    SciTech Connect (OSTI)

    Pickett, Chris A; Kovacic, Donald N; Whitaker, J Michael; Younkin, James R; Hines, Jairus B; Laughter, Mark D; Morgan, Jim; Carrick, Bernie; Boyer, Brian; Whittle, K.


    Approved industry-standard cylinders are used globally for processing, storing, and transporting uranium hexafluoride (UF{sub 6}) at uranium enrichment plants. To ensure that cylinder movements at enrichment facilities occur as declared, the International Atomic Energy Agency (IAEA) must conduct time-consuming periodic physical inspections to validate facility records, cylinder identity, and containment. By using a robust system design that includes the capability for real-time unattended monitoring (of cylinder movements), site-specific rules-based event detection algorithms, and the capability to integrate with other types of monitoring technologies, one can build a system that will improve overall inspector effectiveness. This type of monitoring system can provide timely detection of safeguard events that could be used to ensure more timely and appropriate responses by the IAEA. It also could reduce reliance on facility records and have the additional benefit of enhancing domestic safeguards at the installed facilities. This paper will discuss the installation and evaluation of a radio-frequency- (RF-) based cylinder tracking system that was installed at a United States Enrichment Corporation Centrifuge Facility. This system was installed primarily to evaluate the feasibility of using RF technology at a site and the operational durability of the components under harsh processing conditions. The installation included a basic system that is designed to support layering with other safeguard system technologies and that applies fundamental rules-based event processing methodologies. This paper will discuss the fundamental elements of the system design, the results from this site installation, and future efforts needed to make this technology ready for IAEA consideration.

  4. Defining the needs for non-destructive assay of UF6 feed, product, and tails at gas centrifuge enrichment plants and possible next steps

    SciTech Connect (OSTI)

    Boyer, Brian D; Swinhoe, Martyn T; Moran, Bruce W; Lebrun, Alain


    Current safeguards approaches used by the IAEA at gas centrifuge enrichment plants (GCEPs) need enhancement in order to detect undeclared LEU production with adequate detection probability using non destructive assay (NDA) techniques. At present inspectors use attended systems, systems needing the presence of an inspector for operation, during inspections to verify the mass and {sup 235}U enrichment of UF{sub 6} bulk material used in the process of enrichment at GCEPS. The inspectors also take destructive assay (DA) samples for analysis off-site which provide accurate, on the order of 0.1 % to 0.5% uncertainty, data on the enrichment of the UF{sub 6} feed, tails, and product. However, DA sample taking is a much more labor intensive and resource intensive exercise for the operator and inspector. Furthermore, the operator must ship the samples off-site to the IAEA laboratory which delays the timeliness of the results and contains the possibility of the loss of the continuity of knowledge of the samples during the storage and transit of the material. Use of the IAEA's inspection sampling algorithm shows that while total sample size is fixed by the total population of potential samples and its intrinsic qualities, the split of the samples into NDA or DA samples is determined by the uncertainties in the NDA measurements. Therefore, the larger the uncertainties in the NDA methods, more of the sample taken must be DA samples. Since the DA sampling is arduous and costly, improvements in NDA methods would reduce the number of DA samples needed. Furthermore, if methods of on-site analysis of the samples could be developed that have uncertainties in the 1-2% range, a lot of the problems inherent in DA sampling could be removed. The use of an unattended system that could give an overview of the entire process giving complementary data on the enrichment process as well as accurate measures of enrichment and weights of the UF{sub 6} feed, tails, and product would be a major step in enhancing the ability of NDA beyond present attended systems. The possibility of monitoring the feed, tails, and product header pipes in such a way as to gain safeguards relevant flow and enrichment information without compromising the intellectual property of the operator including proprietary equipment and operational parameters would be a huge step forward. This paper contains an analysis of possible improvements in unattended and attended NDA systems including such process monitoring and possible on-site analysis of DA samples that could reduce the uncertainty of the inspector measurements reducing the difference between the operator's and inspector's measurements providing more effective and efficient IAEA GeEPs safeguards.

  5. A more accurate and penetrating method to measure the enrichment and mass of UF6 storage containers using passive neutron self-interrogation

    SciTech Connect (OSTI)

    Menlove, Howard O; Swinhoe, Martyn T; Miller, Karen A


    This paper describes an unattended mode neutron measurement that can provide the enrichment of the uranium in UF{sub 6} cylinders. The new passive neutron measurement provides better penetration into the uranium mass than prior gamma-ray enrichment measurement methods. The Passive Neutron Enrichment Monitor (PNEM) provides a new measurement technique that uses passive neutron totals and coincidence counting together with neutron self-interrogation to measure the enrichment in the cylinders. The measurement uses the neutron rates from two detector pods. One of the pods has a bare polyethylene surface next to the cylinder and the other polyethylene surface is covered with Cd to prevent thermal neutrons from returning to the cylinder. The primary neutron source from the enriched UF{sub 6} is the alpha-particle decay from the {sub 234}U that interacts with the fluorine to produce random neutrons. The singles neutron counting rate is dominated by the {sub 234}U neutrons with a minor contribution from the induced fissions in the {sub 235}U. However, the doubles counting rate comes primarily from the induced fissions (i.e., multiplication) in the {sub 235}U in enriched uranium. The PNEM concept makes use of the passive neutrons that are initially produced from the {sub 234}U reactions that track the {sub 235}U enrichment during the enrichment process. The induced fission reactions from the thermal-neutron albedo are all from the {sub 235}U and provide a measurement of the {sub 235}U. The Cd ratio has the desirable feature that all of the thermal-neutron-induced fissions in {sub 235}U are independent of the original neutron source. Thus, the ratio is independent of the uranium age, purity, and prior reactor history.

  6. Upcoming H2USA Workshop: Hydrogen Fueling Station Component Listings

    Broader source: [DOE]

    H2USA will host an online workshop about hydrogen fueling station component listings on April 22 from 2 to 3:30 p.m. Eastern Daylight Time. This workshop will focus on the need for components for hydrogen fueling stations to be listed by Nationally Recognized Testing Laboratories (NRTLs).

  7. DOE employee listed among area’s rising leaders

    Broader source: [DOE]

    Earlier this year, the Greater Knoxville Business Journal compiled a list of East Tennessee’s top rising business and community leaders under the age of 40. The 2014 listing featured Heather Cloar, a contacting officer with the Energy Department in Oak Ridge.

  8. Oil and Gas Field Code Master List - Energy Information Administration

    U.S. Energy Information Administration (EIA) Indexed Site

    Oil and Gas Field Code Master List With Data for 2015 | Release Date: February 24, 2016 | Next Release Date: February 2017 Previous Issues Year: 2015 2014 2013 2012 2011 2010 2009 2008 2007 2006 2005 2004 2003 2002 2001 2000 1998 1997 1996 1995 Go Comprehensive listing of U.S. oil and gas field names. Oil and Gas Field Code Master List 2015 Definition of a Field A field is defined as "an area consisting of a single reservoir or multiple reservoirs all grouped on, or related to, the same

  9. Creating a word list for technical and clerical personnel

    SciTech Connect (OSTI)

    Hammond, J S


    The Savannah River Plant and Laboratory employ more than 16,000 people. When the separate Publications Divisions of the Plant and Laboratory were combined it was determined that a single source of information for using terms was needed, and that the source would take the form of a word list. The Word List was issued to more than 5000 employees onsite. In addition, the Word List is being added to the site computer network as a reference document and as an online spelling checker where more than 2000 employees will have access to it through their personal computers.

  10. Site Office Contracting Officer E-mail address Ames Site Office Jackie York

    National Nuclear Security Administration (NNSA)

    Site Office Contracting Officer E-mail address Ames Site Office Jackie York Argonne Site Office Jacquelyn York Brookhaven Site Office Evelyn Landini Jennifer Hartmann Idaho Site Office Paul Allen Kansas City Site Office Ralph Tennant Lawrence Livermore Site Office Homer Williamson Los Alamos Site Office Barbara Romero Robert M. Poole

  11. Microsoft Word - WD Proposed Plan D5 R8 MASTER 10-29-14 _final with reply mail_ rev 1

    Energy Savers [EERE]

    WD-PLN-0034, Rev. 8 1 DOE/PPPO/03-0312&D5 Aerial photo of the Portsmouth Gaseous Diffusion Plant showing the three large process buildings (center of photo) and other support facilities, facing southwest PUBLIC COMMENT PERIOD NOVEMBER 12, 2014 TO JANUARY 10, 2015 HOW YOU CAN PARTICIPATE Read this Proposed Plan and review related documents in the Administrative Record. Comment on this Proposed Plan by mail, email, or fax to: Ms. Kristi Wiehle Department of Energy P.O. Box 370 Piketon, Ohio

  12. "List of Covered Electric Utilities" under the Public Utility...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8 "List of Covered Electric Utilities" under the Public Utility Regulatory Policies Act of 1978 (PURPA) - 2008 Under Title I of the Public Utility Regulatory Policies Act of 1978...

  13. List of Solar Energy Incentives | Open Energy Information

    Open Energy Info (EERE)

    Incentives Jump to: navigation, search The following contains the list of 1794 Solar Energy Incentives. CSV (rows 1-500) CSV (rows 501-1000) CSV (rows 1001-1500) CSV (rows...

  14. List of Solar Space Heat Incentives | Open Energy Information

    Open Energy Info (EERE)

    Heat Incentives Jump to: navigation, search The following contains the list of 512 Solar Space Heat Incentives. CSV (rows 1-500) CSV (rows 501-512) Incentive Incentive Type...

  15. List of Companies in Biofuels Sector | Open Energy Information

    Open Energy Info (EERE)

    List of Companies in Biofuels Sector Jump to: navigation, search BiomassImage.JPG Companies in the Biofuels sector: Add a Company Download CSV (rows 1-256) Map of Biofuels...

  16. Title 40 CFR 261 Identification and Listing of Hazardous Waste...

    Open Energy Info (EERE)

    1 Identification and Listing of Hazardous Waste Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- Federal RegulationFederal Regulation: Title 40...

  17. Capital Asset Project List_rev1.xls

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... by DOE Order 413.3B, Program and Project Management for the Acquisition of Capital Assets. ... Start of Operations or Project Completion Capital Asset Project List 1152016 1 of 1

  18. List of Water Heaters Incentives | Open Energy Information

    Open Energy Info (EERE)

    Heaters Incentives Jump to: navigation, search The following contains the list of 975 Water Heaters Incentives. CSV (rows 1-500) CSV (rows 501-975) Incentive Incentive Type Place...

  19. OpenEI API listing | OpenEI Community

    Open Energy Info (EERE)

    strategy conversation just this week, and we spoke somewhat indirectly about a list of energy APIs on OpenEI. We have the Energy Hackathon Resource page, but I want to draw energy...

  20. Widget:EiJoinList | Open Energy Information

    Open Energy Info (EERE)

    EiJoinList Jump to: navigation, search Description This widget creates a join form on a page. Visitors can fill in the short form and the request will be sent to openei.orgapp...

  1. Workshop on Biofuels Projections in AEO Attendance List

    Gasoline and Diesel Fuel Update (EIA)

    Attendance List 1 March 2013 Workshop on Biofuels Projections in AEO Attendee list In person attendees Mia Adelberg Abengoa Bioenergy Michael Bredehoeft EIA Tom Capehart USDA Terry Carter Biofuels Center of North Carolina Adam Christensen Johns Hopkins University Michael Cole EIA John Conti EIA Lauren Cooper Center for Climate and Energy Solutions Mindi Farber-DeAnda EIA Denise Gerber Fiberight Steve Gerber Fiberight Ryan Graf Policy Navigation Group David L. Greene Oak Ridge National Laboratory

  2. HUD Multifamily Property Listings Eligible for Weatherization Assistance |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy HUD Multifamily Property Listings Eligible for Weatherization Assistance HUD Multifamily Property Listings Eligible for Weatherization Assistance February 23, 2016 - 4:29pm Addthis Housing and Urban Development (HUD) multifamily properties eligible for weatherization assistance. On January 25, 2010, the Department of Energy (DOE) implemented rule 71-CFR-3847 for its Weatherization Assistance Program (WAP). Under the rule, if a public housing, assisted multi-family or Low

  3. Fuel Cell Product Certification/Listing Lessons Learned | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Product Certification/Listing Lessons Learned Fuel Cell Product Certification/Listing Lessons Learned Slides from the U.S. Department of Energy Hydrogen Component and System Qualification Workshop held November 4, 2010 in Livermore, CA. PDF icon csqw_radley.pdf More Documents & Publications Component and System Qualification Workshop Proceedings The Fuel Cell Mobile Light Project - A DOE Market Transformation Activity CSA International Certification Discussion Hydrogen Technology

  4. Top 500 List Recognizes Fastest Supercomputers | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    00 List Recognizes Fastest Supercomputers Top 500 List Recognizes Fastest Supercomputers June 30, 2014 - 5:25pm Addthis Titan 1 of 4 Titan Oak Ridge National Laboratory's Titan has a theoretical peak performance of more than 27 petaflops, or more than 27 quadrillion calculations per second. This enables researchers across the scientific arena, from materials to climate change to astrophysics, to acquire unparalleled accuracy in their simulations and achieve research breakthroughs more rapidly

  5. Oil and gas field code master list, 1993

    SciTech Connect (OSTI)

    Not Available


    This document contains data collected through October 1993 and provides standardized field name spellings and codes for all identified oil and/or gas fields in the United States. Other Federal and State government agencies, as well as industry, use the EIA Oil and Gas Field Code Master List as the standard for field identification. A machine-readable version of the Oil and Gas Field Code Master List is available from the National Technical Information Service.

  6. POLICY GUIDANCE MEMORANDUM #13 Reemployment Priority List Selections |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy 3 Reemployment Priority List Selections POLICY GUIDANCE MEMORANDUM #13 Reemployment Priority List Selections The Department's RPL is designed to provide priority consideration to employees who have lost their jobs through reduction in force, or who have fully recovered from a compensable injury after more than 1 year. Employees may only receive priority consideration for positions that they are well-qualified for and that are in the local commuting area from which

  7. updated_supplemental_lists_1e-2e_20110803.xls | Department of Energy

    Energy Savers [EERE]

    e-2e_20110803.xls updated_supplemental_lists_1e-2e_20110803.xls Office spreadsheet icon updated_supplemental_lists_1e-2e_20110803.xls More Documents & Publications updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx updated_supplemental_lists_1p_2p_3o_04302013.xlsx supplemental_lists.xls

  8. Oil and gas field code master list 1997

    SciTech Connect (OSTI)


    The Oil and Gas Field Code Master List 1997 is the sixteenth annual listing of all identified oil and gas fields in the US. It is updated with field information collected through October 1997. The purpose of this publication is to provide unique, standardized codes for identification of domestic fields. Use of these field codes fosters consistency of field identification by government and industry. As a result of their widespread adoption they have in effect become a national standard. The use of field names and codes listed in this publication is required on survey forms and other reports regarding field-specific data collected by EIA. There are 58,366 field records in this year`s FCML, 437 more than last year. The FCML includes: field records for each State and county in which a field resides; field records for each offshore area block in the Gulf of Mexico in which a field resides; field records for each alias field name (definition of alias is listed); fields crossing State boundaries that may be assigned different names by the respective State naming authorities. This report also contains an Invalid Field Record List of 4 records that have been removed from the FCML since last year`s report. These records were found to be either technically incorrect or to represent field names which were never recognized by State naming authorities.

  9. ORISE Contract, SECTION J - List of Documents, Exhibits, and Other Attachments

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PART III LIST OF DOCUMENTS, EXHIBITS, AND OTHER ATTACHMENTS SECTION J - LIST OF ATTACHMENTS J.1 LIST OF DOCUMENTS, EXHIBITS, AND OTHER ATTACHMENTS (MAY 1997)...................................................................................................................... 3 ATTACHMENT A - REPORTING REQUIREMENTS............................................. 5 ATTACHMENT B - GOVERNMENT FURNISHED AND ACQUIRED PROPERTY

  10. List 1: Eligible Multifamily Buildings 10-CFR-440.22(b)(4)(i)

    Broader source: [DOE]

    HUD list of multifamily housing units eligible for weatherization that have three or more years remaining on HUD housing contracts.  As of December 2014. List 1 consists of three sub-lists:

  11. DOE-STD-1104-2014 Master Acronym List | Department of Energy

    Energy Savers [EERE]

    Master Acronym List DOE-STD-1104-2014 Master Acronym List February 4, 2015 DOE-STD-1104 Master Acronyms List. This document provides a Master Acronyms List of terms used in DOE-STD-1104. PDF icon DOE-STD-1104-2014 Master Acronym List More Documents & Publications DOE-STD-1104-2014 Training Requirements Crosswalk of DOE-STD-1104-2014 Master Acronym List for DOE-STD-3009-2014

  12. Oil and Gas Field Code Master List 1990

    SciTech Connect (OSTI)

    Not Available


    This is the ninth annual edition of the Energy Information Administration's (EIA) Oil and Gas Field Code Master List. It reflects data collected through October 1990 and provides standardized field name spellings and codes for all identified oil and/or gas fields in the United States. There are 54,963 field records in this year's Oil and Gas Field Code Master List (FCML). This amounts to 467 more than in last year's report. As it is maintained by EIA, the Master List includes: Field records for each state and county in which a field resides; field records for each offshore area block in the Gulf of Mexico in which a field resides;field records for each alias field name; fields crossing state boundaries that may be assigned different names by the respective state naming authorities.

  13. Oil and gas field code master list 1994

    SciTech Connect (OSTI)

    Not Available


    This is the thirteenth annual edition of the Energy Information Administration`s (EIA) Oil and Gas Field Code Master List. It reflects data collected through October 1994 and provides standardized field name spellings and codes for all identified oil and/or gas fields in the United States. The master field name spellings and codes are to be used by respondents when filing the following Department of Energy (DOE) forms: Form EIA-23, {open_quotes}Annual Survey of Domestic Oil and Gas Reserves,{close_quotes} filed by oil and gas well operators (field codes are required from larger operators only); Forms FERC 8 and EIA-191, {open_quotes}Underground Gas Storage Report,{close_quotes} filed by natural gas producers and distributors who operate underground natural gas storage facilities. Other Federal and State government agencies, as well as industry, use the EIA Oil and Gas Field Code Master List as the standard for field identification. A machine-readable version of the Oil and Gas Field Code Master List is available from the National Technical Information Service, 5285 Port Royal Road, Springfield, Virginia 22161, (703) 487-4650. In order for the Master List to be useful, it must be accurate and remain current. To accomplish this, EIA constantly reviews and revises this list. The EIA welcomes all comments, corrections, and additions to the Master List. All such information should be given to the EIA Field Code Coordinator at (214) 953-1858. EIA gratefully acknowledges the assistance provides by numerous State organizations and trade associations in verifying the existence of fields and their official nomenclature.

  14. WPN 11-9: Updated Guidance on Eligible Multifamily Property Listings...

    Energy Savers [EERE]

    9: Updated Guidance on Eligible Multifamily Property Listings for Use in the Weatherization Assistance Program WPN 11-9: Updated Guidance on Eligible Multifamily Property Listings...

  15. DOE TRANSCOM Technical Support Services DE-EM0002903 SECTION J - LIST OF ATTACHMENTS

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 GOVERNMENT FURNISHED PROPERTY AND INFORMATION LIST * Government Furnished Property and Information List is subject to change prior to period of performance.

  16. DOE technical standards list: Department of Energy standards index

    SciTech Connect (OSTI)


    This technical standards list (TSL) was prepared for use by personnel involved in the selection and use of US DOE technical standards and other government and non-government standards. This TSL provides listings of current DOE technical standards, non-government standards that have been adopted by DOE, other government documents in which DOE has a recorded interest, and cancelled DOE technical standards. Standards are indexed by type in the appendices to this document. Definitions of and general guidance for the use of standards are also provided.

  17. Part III - List of Documents, Exhibits, and Other Attachments

    National Nuclear Security Administration (NNSA)

    Updated 9/30/15 to Mod 0588 Contract No. DE-AC04-94AL85000 Modification No. M202 Section J - Page 1 Part III - List of Documents, Exhibits, and Other Attachments Section J LIST OF ATTACHMENTS Document Appendix A - Personnel Appendix (Revised RAs 1-12 and Mods M0541, M0558) Appendix B - Statement of Work (Revised M244, M264) Appendix C - Special Bank Account Agreement (Revised M248, M271, M461, M497, M508) Appendix D - Key Personnel (Revised M216, M224, M227, M229, M233, M252, M257, M272, M275,

  18. Green your Back to School Shopping List! | Department of Energy

    Energy Savers [EERE]

    your Back to School Shopping List! Green your Back to School Shopping List! August 23, 2013 - 10:06am Addthis Save energy and money while buying school supplies this year. | Photo courtesy of ©iStockphoto/Ls9907 Save energy and money while buying school supplies this year. | Photo courtesy of ©iStockphoto/Ls9907 Agatha Wein Communications Specialist, State Energy Program How can I participate? You can save energy and money this fall by simply reducing, reusing, and recycling school supplies.

  19. Implementation plan for HANDI 2000 TWRS master equipment list

    SciTech Connect (OSTI)



    This document presents the implementation plan for an additional deliverable of the HANDI 2000 Project. The PassPort Equipment Data module processes include those portions of the COTS PassPort system required to support tracking and management of the Master Equipment List for Lockheed Martin Hanford Company (LMHC) and custom software created to work with the COTS products.

  20. Computerized Instrumented Residential Audit, version 1. 0: source listings

    SciTech Connect (OSTI)

    Not Available


    CIRA is a set of computer programs to predict the energy consumption of small buildings. It can also provide an optimized list of improvements which reduce energy use. The source code in BASIC is provided to help a user adapt the program to a particular application, or to see details of the calculation algorithms. (LEW)

  1. Oil and Gas field code master list 1995

    SciTech Connect (OSTI)


    This is the fourteenth annual edition of the Energy Information Administration`s (EIA) Oil and Gas Field Code Master List. It reflects data collected through October 1995 and provides standardized field name spellings and codes for all identified oil and/or gas fields in the US. The Field Code Index, a listing of all field names and the States in which they occur, ordered by field code, has been removed from this year`s publications to reduce printing and postage costs. Complete copies (including the Field Code Index) will be available on the EIA CD-ROM and the EIA World-Wide Web Site. Future editions of the complete Master List will be available on CD-ROM and other electronic media. There are 57,400 field records in this year`s Oil and Gas Field Code Master List. As it is maintained by EIA, the Master List includes the following: field records for each State and county in which a field resides; field records for each offshore area block in the Gulf of Mexico in which a field resides; field records for each alias field name (see definition of alias below); and fields crossing State boundaries that may be assigned different names by the respective State naming authorities. Taking into consideration the double-counting of fields under such circumstances, EIA identifies 46,312 distinct fields in the US as of October 1995. This count includes fields that no longer produce oil or gas, and 383 fields used in whole or in part for oil or gas Storage. 11 figs., 6 tabs.

  2. combined_supplemental_hud_multifamily_weatherization_list_3-2_lihtc.xls |

    Energy Savers [EERE]

    Department of Energy combined_supplemental_hud_multifamily_weatherization_list_3-2_lihtc.xls combined_supplemental_hud_multifamily_weatherization_list_3-2_lihtc.xls Office spreadsheet icon combined_supplemental_hud_multifamily_weatherization_list_3-2_lihtc.xls More Documents & Publications list2_eligible_multifamily_buildings_10-cfr-440-22b4ii.xls rd_mfh_low_and_very_low.xls hud_list-1

  3. updated_supplemental_lists_1o_2o_3n_091812.xlsx | Department of Energy

    Energy Savers [EERE]

    o_2o_3n_091812.xlsx updated_supplemental_lists_1o_2o_3n_091812.xlsx File updated_supplemental_lists_1o_2o_3n_091812.xlsx More Documents & Publications updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx updated_supplemental_lists_1m-2m-3l-04-05-2012.xlsx updated_supplemental_lists_1p_2p_3o_04302013

  4. updated_supplemental_lists_1p_2p_3o_04302013.xlsx | Department of Energy

    Energy Savers [EERE]

    p_2p_3o_04302013.xlsx updated_supplemental_lists_1p_2p_3o_04302013.xlsx File updated_supplemental_lists_1p_2p_3o_04302013.xlsx More Documents & Publications updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx updated_supplemental_lists_1m-2m-3l-04-05-2012.xlsx updated_supplemental_lists_1j-2j-3i_12-22-2011

  5. hud_list-1_07-01-11.xls | Department of Energy

    Energy Savers [EERE]

    1_07-01-11.xls hud_list-1_07-01-11.xls Office spreadsheet icon hud_list-1_07-01-11.xls More Documents & Publications hud_list-1_07-01-11.xls list2_eligible_multifamily_buildings_10-cfr-440-22b4ii.xls List 2: Eligible Multifamily Buildings 10-CFR-440.22(b)(4)(ii)

  6. hud_list-2_07-01-11.xls | Department of Energy

    Energy Savers [EERE]

    2_07-01-11.xls hud_list-2_07-01-11.xls Office spreadsheet icon hud_list-2_07-01-11.xls More Documents & Publications hud_list-2_07-01-11.xls supplemental_lists_1d-2d-3c_06-24-2011.xls updated_supplemental_lists_1j-2j-3i_12-22-2011.xlsx

  7. DOE technical standards list: Department of Energy standards index

    SciTech Connect (OSTI)


    This Department of Energy (DOE) technical standards list (TSL) has been prepared by the Office of Nuclear Safety Policy and Standards (EH-31) on the basis of currently available technical information. Periodic updates of this TSL will be issued as additional information is received on standardization documents being issued, adopted, or canceled by DOE. This document was prepared for use by personnel involved in the selection and use of DOE technical standards and other Government and non-Government standards. This TSL provides listings of current DOE technical standards, non-Government standards that have been adopted by DOE, other standards-related documents in which DOE has a recorded interest, and canceled DOE technical standards. Information on new DOE technical standards projects, technical standards released for coordination, recently published DOE technical standards, and activities of non-Government standards bodies that may be of interest to DOE is published monthly in Standards Actions.

  8. Attachment 2 … List of Major Information Systems

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Exhibit 1 - List of Major Information Systems Defense Line of Business National Nuclear Security Administration ADaPT Networked: Develops and deploys emerging information networking technology to production processes in support of the U.S. nuclear weapons stockpile. National Nuclear Security Administration ADaPT Network Infrastructure: Develops and deploys emerging information networking technology to production processes in support of the U.S. nuclear weapons stockpile. Advanced Simulation and

  9. National Nuclear Security Administration Supplemental Listing of Directives

    National Nuclear Security Administration (NNSA)

    National Nuclear Security Administration Supplemental Listing of Directives Affecting Nuclear Safety Requirements Last Updated 06/2014 U.S. DEPARTMENT OF ENERGY National Nuclear Security Administration Office of the Chief of Defense Nuclear Safety AVAILABLE ONLINE AT: link to NNSA Policies/Supplemental Directives Updated 6/10/14 This Page Intentionally Blank. Concurrence on Exemptions or Exceptions Page 1 ADDITIONAL DIRECTIVES (LATEST VERSION) REQUIRING CENTRAL TECHNICAL


    National Nuclear Security Administration (NNSA)

    N, Page 1 SECTION J APPENDIX N LIST OF APPLICABLE DIRECTIVES 09/17/2014 Directive Directive Title 10 CFR 824, Current Rule Procedural Rules for the Assessment of Civil Penalties for Classified Information Security Violations 10 CFR 830 - Current Rule Nuclear Safety Management 10 CFR 851 - Current Rule Worker Safety and Health Program ANSI B30.11 Monorails and Underhung Hoists ANSI N323A Radiation Protection Instrumentation Test and Calibration Portable Survey Instrumentation, 1997 ANSI N43.2

  11. 309 Facility deactivation and decommisioning Criteria Completion Check Lists

    SciTech Connect (OSTI)

    Cornwell, B.C.


    To facilitate and track completion of the 309 Facility turnover criteria completion an Applicability Matrix and Criteria Completion Check Lists were prepared. The applicability matrix documents the required turnover criteria for a given area in the facility or scope of work. The applicable criteria is selected for 16 different areas. For each area a completion checklist is provided to document completion of a requirement by WHC and the Environmental Restoration Contractor.

  12. EV Everywhere Grand Challenge - Battery Workshop attendees list |

    Broader source: (indexed) [DOE]

    Department of Energy Attendance list for the EV Everywhere Grand Challenge: Battery Workshop on July 26, 2012 held at the Doubletree OHare, Chicago, IL. PDF icon companies_in_attendance_b.pdf More Documents & Publications EV Everywhere Grand Challenge - Electric Drive (Power Electronics and Electric Machines) Workshop EV Everywhere Grand Challenge Overview EV Everywhere Grand Challenge Introduction for Electric Drive Workshop


    National Nuclear Security Administration (NNSA)

    .I APPENDIXN DE-NA0000622 LIST OF APPLICABLE DIRECTIVES 09/17/2014 Directive Directive Title 10 CFR 824, Current Rule Procedural Rules for the Assessment of Civil Penalties for Classified Information Security Violations 1 O CFR 830 - Current Rule Nuclear Safety Management 1 O CFR 851 - Current Rule Worker Safety and Health Program ANSI B30.11 Monorails and Underhung Hoists ANSI N323A Radiation Protection Instrumentation Test and Calibration Portable Survey Instrumentation, 1997 ANSI N43.2

  14. Draft SPD Supplemental EIS Master Reference List | National Nuclear

    National Nuclear Security Administration (NNSA)

    Security Administration Draft SPD Supplemental EIS Master Reference List References for Chapters 1 - 5 References for Appendix A References for Appendix B References for Appendix C References for Appendix D References for Appendix E References for Appendix F References for Appendix G References for Appendix H References for Appendix I References for Appendix J References for Summary Learn More SPD SEIS References for Appendix J SPD SEIS Summary References SPD SEIS References for Chapters 1 -

  15. A Prescription for List-Mode Data Processing Conventions

    SciTech Connect (OSTI)

    Beddingfield, David H.; Swinhoe, Martyn Thomas; Huszti, Jozsef; Newell, Matthew R.


    There are a variety of algorithmic approaches available to process list-mode pulse streams to produce multiplicity histograms for subsequent analysis. In the development of the INCC v6.0 code to include the processing of this data format, we have noted inconsistencies in the “processed time” between the various approaches. The processed time, tp, is the time interval over which the recorded pulses are analyzed to construct multiplicity histograms. This is the time interval that is used to convert measured counts into count rates. The observed inconsistencies in tp impact the reported count rate information and the determination of the error-values associated with the derived singles, doubles, and triples counting rates. This issue is particularly important in low count-rate environments. In this report we will present a prescription for the processing of list-mode counting data that produces values that are both correct and consistent with traditional shift-register technologies. It is our objective to define conventions for list mode data processing to ensure that the results are physically valid and numerically aligned with the results from shift-register electronics.

  16. Automatic generation of stop word lists for information retrieval and analysis

    DOE Patents [OSTI]

    Rose, Stuart J


    Methods and systems for automatically generating lists of stop words for information retrieval and analysis. Generation of the stop words can include providing a corpus of documents and a plurality of keywords. From the corpus of documents, a term list of all terms is constructed and both a keyword adjacency frequency and a keyword frequency are determined. If a ratio of the keyword adjacency frequency to the keyword frequency for a particular term on the term list is less than a predetermined value, then that term is excluded from the term list. The resulting term list is truncated based on predetermined criteria to form a stop word list.

  17. MailedForm.pptx

    National Nuclear Security Administration (NNSA)

    Businesses using high-activity radioactive sources (Cesium-137, Cobalt-60, Americium-241, ... to: Kristina Hatcher, U.S. Department of Energy, 1000 Independence Ave., S.W., ...

  18. DOE technical standards list. Department of Energy standards index

    SciTech Connect (OSTI)


    This document was prepared for use by personnel involved in the selection and use of DOE technical standards and other Government and non-Government standards. This TSL provides listing of current DOE technical standards, non-Government standards that have been adopted by DOE, other Government documents in which DOE has a recorded interest, and canceled DOE technical standards. Information on new DOE technical standards projects, technical standards released for coordination, recently published DOE technical standards, and activities of non-Government standards bodies that may be of interest to DOE is published monthly in Standards Actions.

  19. TPA PM List of 09-30-15.xlsx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    OPERABLE UNITS PROJECT MANAGERS LIST AS OF SEPTEMBER 30, 2015 Prepared By MSA TPA Integration TSD NO. Description Ecology PM DOE PM Assistant Manager Status Lead Regulatory Agency D-1-2 1301-N Liquid Waste Disposal Facility Menard, N. French, M.S. Corey, R. J. Final Ecology Lead D-1-2 1325-N Liquid Waste Disposal Facility Menard, N. French, M.S. Corey, R. J. Final Ecology Lead D-2-10 216-A-37-1 Crib Menard, N. Cline, M.W. Corey, R. J. Interim Ecology Lead D-2-11 Integrated Disposal Facility

  20. Hanford Site Chronic Beryllium Disease Prevention Program (CBDPP) Contact List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Chronic Beryllium Disease Prevention Program (CBDPP) Contact List Page 1 of 2 Updated 12/09/15 Primary and Alternate Membership Organization Primary Office Number Cell Number Alternate Office Number Cell Number BAG Fisher, Mark N/A 539-5588 VACANT N/A CHPRC/HAMTC Spier, Tracy 373-1993 440-9118 Hollis, Chris 373-9973 (509) 701-1025 CHPRC Bean, Tonya 376-6503 (303) 709-3047 Robinson, Roby Seydel, Scott (509) 699-9307 373-4860 (509) 699-9307 430-0184 CWB&CTC Park, Rick 372-9941 492-6589 Legard,

  1. Attachment P … Listing of SWMUs and AOCs

    Office of Environmental Management (EM)

    LISTING OF SWMUS AND AOCS Los Alamos National Laboratory Hazardous Waste Permit February2014 Table K-1 SWMUs and AOCs Requiring Corrective Action Attachment K Page 2 Los Alamos National Laboratory Hazardous Waste Permit February 2014 Table K-1 SWMUs and AOCs Requiring Corrective Action SWMU/AOC Unit # Unit Type TA-0 SWMU 00-001 Sediment traps in Mortandad Canyon SWMU 00-011(a) Former Mortar impact area SWMU 00-011(c) Mortar impact area SWMU 00-011(d) Mortar impact area SWMU 00-011(e) Mortar

  2. Part III - List of Documents, Exhibits, and Other Attachments

    National Nuclear Security Administration (NNSA)

    25 Page 2 of 2 Prime Contract Section J, Appendix G, List of Applicable Directives, is modified as follows: The following Directives are added: NUMBER DATE TITLE NNSA SD 452.2 11/17/14 Nuclear Explosive Safety Evaluation Processes DOE O 452.1E 01/26/15 Nuclear Explosive and Weapon Surety Program DOE O 452.2E 01/26/15 Nuclear Explosive Safety DOE O 474.2 Change 3 05/15/15 Nuclear Material Control and Accountability The following Directives are deleted: NUMBER DATE TITLE DOE M 452.2-2 04/14/09

  3. Part III - List of Documents, Exhibits, and Other Attachments

    National Nuclear Security Administration (NNSA)

    15 Page 2 of 2 Prime Contract Section J, Appendix G, List of Applicable Directives, is modified as follows: The following Directives are added: NUMBER DATE TITLE DOE O 458.1 Change 3 01/15/13 Radiation Protection of the Public and the Environment DOE O 470.5 06/02/14 Insider Threat DOE O 475.2B 10/03/14 Identifying Classified Information NNSA SD 1027 Change Notice 1 05/13/14 Guidance of Using Release Fraction and Modern Dosimetric Information Consistently with DOE STD 1027-92 The following

  4. Booklet, DOE Subject Area Indicators and Key Word List for RD...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Booklet, DOE Subject Area Indicators and Key Word List for RD and FRD - October 2005 Booklet, DOE Subject Area Indicators and Key Word List for RD and FRD - October 2005 October ...

  5. DOE Refers Two ENERGY STAR Models to EPA for Potential De-Listing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Two ENERGY STAR Models to EPA for Potential De-Listing DOE Refers Two ENERGY STAR Models to EPA for Potential De-Listing January 11, 2012 - 11:00am Addthis U.S. Department of...

  6. File:Temporary storage plan review check list.pdf | Open Energy...

    Open Energy Info (EERE)

    Temporary storage plan review check list.pdf Jump to: navigation, search File File history File usage File:Temporary storage plan review check list.pdf Size of this preview: 463 ...

  7. Participant List for the 2010-2025 Scenario Analysis for Hydrogen...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Participant List for the 2010-2025 Scenario Analysis for Hydrogen Fuel Cell Vehicles and Infrastructure Meeting on January 31, 2007 Participant List for the 2010-2025 Scenario ...

  8. Attendees list from the U.S. Department of Energy's High Throughput...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Attendees list from the U.S. Department of Energy's High Throughput Screening of Hydrogen Storage Materials Workshop on June 26, 2007 Attendees list from the U.S. Department of ...

  9. hud_list-1_07-01-11.xls | Department of Energy

    Broader source: (indexed) [DOE]

    list-107-01-11.xls More Documents & Publications hudlist-107-01-11.xls list2eligiblemultifamilybuildings10-cfr-440-22b4ii.xls rdmfhlowandverylow...

  10. 2015 U.S. Department of Energy National Cleanup Workshop Registration List

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    | Department of Energy 5 U.S. Department of Energy National Cleanup Workshop Registration List 2015 U.S. Department of Energy National Cleanup Workshop Registration List List of registered attendees to the 2015 U.S. Department of Energy National Cleanup Workshop. PDF icon 2015 U.S. Department of Energy National Cleanup Workshop Registration List More Documents & Publications Business Opportunity Forum Attendees EM Major Contracts Awarded Since 2006 Contractor Earned Value Management

  11. TPA PM List of 09-30-15.xlsx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Project Manager's List As of September 30, 2015 Prepared by MSA TPA Integration Milestone EPA PM Ecology PM DOE PM Assistant Manager Lead Regulatory Agency (See Footnote) Type Milestone Title M-015-00 Cameron, C.E. Menard, N. Cline, M.W. Corey, R. J. EPA//Ecology Dual Lead M Complete The RI/FS (Or RFI/CMS) Process For All Non-Tank Farm OUs M-015-110A Cameron, C.E. Goswami D. Cline, M.W. Corey, R. J. Ecology Lead I Submit RCRA FI/CMS & RI/FS Work Plan for 200-DV-1 OU M-015-110B Cameron, C.E.

  12. Explanation of Publication List V7[1][1][2]

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MI-648497 *This work performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Laboratory under Contract DE-AC52-07NA27344. Explanation o f L ist o f NIF & P S D irectorate R elated P ublications The list c ontains only r efereed j ournal a rticles t hat h ave a t l east o ne a uthor w ho i s a N IF & P S D irectorate T eam M ember. T eam M embers i nclude D irectorate s taff p lus collaborators who a re o n a l ist m aintained by the NIF User Office.

  13. Energy & Manufacturing Workforce Training Topics List - Version 1.7

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    (02.11.14) | Department of Energy & Manufacturing Workforce Training Topics List - Version 1.7 (02.11.14) Energy & Manufacturing Workforce Training Topics List - Version 1.7 (02.11.14) View this searchable list of the training programs in the areas of energy and/or manufacturing. Information provided in this list includes: the subjects being taught, grantee, project title, and state. In some cases the list also shows the certificates provided by the courses. File Energy and

  14. supplemental_lists_1d-2d-3c_06-24-2011.xls | Department of Energy

    Energy Savers [EERE]

    lists_1d-2d-3c_06-24-2011.xls supplemental_lists_1d-2d-3c_06-24-2011.xls Office spreadsheet icon supplemental_lists_1d-2d-3c_06-24-2011.xls More Documents & Publications hud_list-2_07-01-11.xls hud_list-2_07-01-11.xls updated_supplemental_lists_1g-2g-3f_10-6-2011

  15. Safety equipment list for the light duty utility arm system

    SciTech Connect (OSTI)

    Barnes, G.A.


    The initial issue (Revision 0) of this Safety Equipment List (SEL) for the Light Duty Utility Arm (LDUA) requires an explanation for both its existence and its being what it is. All LDUA documentation leading up to creation of this SEL, and the SEL itself, is predicated on the LDUA only being approved for use in waste tanks designated as Facility Group 3, i.e., it is not approved for use in Facility Group 1 or 2 waste tanks. Facility Group 3 tanks are those in which a spontaneous or induced hydrogen gas release would be small, localized, and would not exceed 25% of the LFL when mixed with the remaining air volume in the dome space; exceeding these parameters is considered unlikely. Thus, from a NFPA flammable gas environment perspective the waste tank interior is not classified as a hazardous location. Furthermore, a hazards identification and evaluation (HNF-SD-WM-HIE-010, REV 0) performed for the LDUA system concluded that the consequences of actual LDUA system postulated accidents in Flammable Gas Facility Group 3 waste tanks would have either NO IMPACT or LOW IMPACT on the offsite public and onsite worker. Therefore, from a flammable gas perspective, there is not a rationale for classifying any of SSCs associated with the LDUA as either Safety Class (SC) or Safety Significant (SS) SSCs, which, by default, categorizes them as General Service (GS) SSCs. It follows then, based on current PHMC procedures (HNF-PRO-704 and HNF-IP-0842, Vol IV, Section 5.2) for SEL creation and content, and from a flammable gas perspective, that an SEL is NOT REQ@D HOWEVER!!! There is both a precedent and a prudency to capture all SSCS, which although GS, contribute to a Defense-In-Depth (DID) approach to the design and use of equipment in potentially flammable gas environments. This Revision 0 of the LDUA SEL has been created to capture these SSCs and they are designated as GS-DID in this document. The specific reasons for doing this are listed.

  16. EECBG 10-07C/SEP 10-006B Attachment 1: Process Metrics List |

    Energy Savers [EERE]

    Department of Energy 10-07C/SEP 10-006B Attachment 1: Process Metrics List EECBG 10-07C/SEP 10-006B Attachment 1: Process Metrics List PDF icon eecbg_sep_reporting_guidance_attachment_06242011.pdf More Documents & Publications EECBG SEP Attachment 1 - Process metric list EECBG Program Notice 10-07A DOE Recovery Act Reporting Requirements for the State Energy Program

  17. Attendees list from the U.S. Department of Energy's High Throughput

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Screening of Hydrogen Storage Materials Workshop on June 26, 2007 | Department of Energy Attendees list from the U.S. Department of Energy's High Throughput Screening of Hydrogen Storage Materials Workshop on June 26, 2007 Attendees list from the U.S. Department of Energy's High Throughput Screening of Hydrogen Storage Materials Workshop on June 26, 2007 Attendees list from the U.S. Department of Energy's Hydrogen Storage Meeting held June 26, 2007 in Bethesda, Maryland. PDF icon

  18. STIP Community Listing | OSTI, US Dept of Energy, Office of Scientific and

    Office of Scientific and Technical Information (OSTI)

    Technical Information STIP Community Listing This page lists various groups and group members within the STIP community. Note: An alphabetical list can be downloaded as an MS-Excel compatible file. Or, you can also view this page in print mode. STI Managers Location Name Contact Ames Laboratory Beth Pieper Program Coordinator, Office of Sponsored Research Administration (515) 294-6486 Argonne National Laboratory Yvette Woell Manager, Argonne Research Library (630) 252-4275

  19. Building America List of FY14 by Technology Type | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    List of FY14 by Technology Type Building America List of FY14 by Technology Type This table lists U.S. Department of Energy Building America projects for FY14 by technology type. PDF icon building_america_fy14projects_technology.pdf More Documents & Publications Building America FY14 Research Projects by Research Team Building America FY14 Projects by Building

  20. DE-SOL-0002555 WIPP Solicitation J-23 PART III - LIST OF DOCUMENTS...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)


  1. RFI Released to Compile Teaming Partner List for Upcoming BENEFIT FOA

    Broader source: [DOE]

    Energy Efficiency and Renewable Energy (EERE) is compiling a Teaming Partner List to facilitate the formation of new project teams for the anticipated Buildings Energy Efficiency Frontiers &...

  2. NE-23 List of California Sites Hattie Carwell. SAN/NSQA Division

    Office of Legacy Management (LM)

    SANNSQA Division Attached for your information is the list Of Callfornia sites we identified in our search of Manhattdn Engineer District records for the Formerly Utilized Sites ...

  3. Microsoft Word - Attachment J-6 List of Applicable DOE Directives and COntractor Requirements Documents.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    J-6-1 ATTACHMENT J.6 LIST OF APPLICABLE DOE DIRECTIVES AND CONTRACTOR REQUIREMENTS DOCUMENTS (LIST B) The following is a list of applicable DOE Directives and Orders appended to this Contract as prescribed in Section I, Clause I.3. This list is not all inclusive. Document Number Title CRD O 150.1 Continuity Programs CRD O 205.1b, Chg.3 DOE Cyber Program CRD O 206.1 DOE Privacy Program CRD O 243.1B, Admin. Chg 1. Records Management Program CRD O 414.1D, Admin Chg 1. Quality Assurance CRD O

  4. Domestic Price List | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    NBL Program Office Home About Programs Certified Reference Materials (CRMs) Prices and ... Prices and Certificates Domestic Price List Print Text Size: A A A FeedbackShare Page ...

  5. Uranium Certified Reference Materials Price List | U.S. DOE Office...

    Office of Science (SC) Website

    NBL Program Office Home About Programs Certified Reference Materials (CRMs) Prices and ... Prices and Certificates Uranium Certified Reference Materials Price List Print Text Size: ...

  6. International Price List | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    NBL Program Office Home About Programs Certified Reference Materials (CRMs) Prices and ... Prices and Certificates International Price List Print Text Size: A A A FeedbackShare Page ...

  7. Uranium and Thorium Ores Price List | U.S. DOE Office of Science...

    Office of Science (SC) Website

    NBL Program Office Home About Programs Certified Reference Materials (CRMs) Prices and ... Prices and Certificates Uranium and Thorium Ores Price List Print Text Size: A A A ...

  8. List of Topics for Interagency Performance & Risk Assessment Community of

    Energy Savers [EERE]

    Practice (P&RA CoP) Discussion | Department of Energy List of Topics for Interagency Performance & Risk Assessment Community of Practice (P&RA CoP) Discussion List of Topics for Interagency Performance & Risk Assessment Community of Practice (P&RA CoP) Discussion List of Topics for Interagency Performance & Risk Assessment Community of Practice (P&RA CoP) Discussion PDF icon List of Topics - February 24, 2016 More Documents & Publications Status Updates on the

  9. Question of the Week: What Energy-Saving Improvements are on Your To-Do List?

    Broader source: [DOE]

    For most people, improving the efficiency of their home is a process. So tell us what energy-saving improvements are on your to-do list?

  10. Copy of FINAL SG Demo Project List 11 13 09-External.xls | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of FINAL SG Demo Project List 11 13 09-External.xls More Documents & Publications Smart Grid Regional and Energy Storage Demonstration Projects: Awards Energy Storage Activities...


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)


  12. Guidance document publications list - Office of Environmental Policy and Assistance RCRA/CERCLA Division (EH-413)

    SciTech Connect (OSTI)


    This document provides a listing of Guidance Documents from the RCRA/CERCLA Division for August 1995. Documents are listed under the following categories: RCRA Guidance Manuals; RCRA Information Briefs; CERCLA Guidance Manuals; CERCLA Regulatory Bulletins; RCRA/CERCLA Guidance Manuals; TSCA Guidance Manuals; TSCA Information Briefs; and, Cross Cut Manuals.

  13. Listing of awardee names: Active awards as of October 5, 1994

    SciTech Connect (OSTI)

    Not Available


    This is a listing of awarded active contracts for all US DOE facilities and projects. The information contained in the list includes the awardee name and division responsible for the work, BIN, completion date, a one line description of the work, the vendor ID, city, state, congressional district, the value of the contract and the amount of funds expended to date.

  14. update4_supplemental_lists_1c_2c_2c3b_041411updated_051711.xls | Department

    Energy Savers [EERE]

    of Energy update4_supplemental_lists_1c_2c_2c3b_041411updated_051711.xls update4_supplemental_lists_1c_2c_2c3b_041411updated_051711.xls Office spreadsheet icon update4_supplemental_lists_1c_2c_2c3b_041411updated_051711.xls More Documents & Publications List 2: Eligible Multifamily Buildings 10-CFR-440.22(b)(4)(ii) updated_supplemental_lists_1h-2h-3g- 11-4-2011.xlsx updated_supplemental_lists_1j-2j-3i_12-22-2011.xlsx


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)


  16. EM Makes Progress on GAO High-Risk List | Department of Energy

    Office of Environmental Management (EM)

    Makes Progress on GAO High-Risk List EM Makes Progress on GAO High-Risk List February 14, 2013 - 12:00pm Addthis WASHINGTON, D.C. - The U.S. Government Accountability Office (GAO) has removed EM capital asset projects of $750 million or less from its high-risk list because of the nuclear cleanup program's progress in completing that work. "This is good news for EM because it marks an important step in our contract and project management improvement strategy," Senior Advisor for

  17. "List of Covered Electric Utilities" under the Public Utility

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Regulatory Policies Act of 1978 (PURPA) - 2008 | Department of Energy 8 "List of Covered Electric Utilities" under the Public Utility Regulatory Policies Act of 1978 (PURPA) - 2008 Under Title I of the Public Utility Regulatory Policies Act of 1978 (PURPA), the U.S. Department of Energy (DOE) is required to publish a list identifying each electric utility. PDF icon "List of Covered Electric Utilities" under the Public Utility Regulatory Policies Act of 1978 (PURPA) More

  18. [Placeholder for opening paragraph/description of PM Group and a list of members]

    Energy Savers [EERE]

    March 20, 2015 VIA E-MAIL Ms. Brenda Edwards U.S. Department of Energy Building Technologies Program Mailstop EE-5B 1000 Independence Avenue, SW Washington, DC 20585-0121 RE: American Gas Association Requests Opportunity to Speak at March 27 Public Meeting (Docket No. EERE-2014-BT-STD-0031/RIN 1904-AD20) Pursuant to the Department of Energy's (DOE) Notice of Proposed Rulemaking and Announcement of Public Meeting regarding Energy Conservation Standards for Residential Furnaces, 80 Fed. Reg. 13120

  19. Microsoft Word - Contact List Template 11-5-14- ali notes.doc

    National Nuclear Security Administration (NNSA)

    Operations E-Mail: Unclassified Fax: 301-903-1998 NMMSS Points-of-Contact for Assistance Name Topic Phone Email Address Karen Antizzo IAEA Reporting General Data Submission Custom Report Requests (301) 903-0872 John Ballard DOE/NNSA Reconciliation Training (301) 903-0092 Elaine Beacom International Reporting (Import/Export) (301) 903-1328 Carl Berger Special Requests and

  20. Department of Energy listing of awardee names active awards as of January 6, 1994

    SciTech Connect (OSTI)

    Not Available


    The awards are listed according to awardee name, bin, completion date, description of work, division, vendor ID, city, state, congressional district, contract value, obligations to date, and P/S.

  1. NMAC 19.33.6 List of Endangered and Threatened Species | Open...

    Open Energy Info (EERE)

    Abstract This regulation provides a list of threatened and endangered species in New Mexico. Published NA Year Signed or Took Effect 2000 Legal Citation NMAC 19.33.6 DOI Not...

  2. Energy Efficiency Can Be at the Top of Your Shopping List | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    list, too. Plug-in hybrid - Electric cars with some serious potential, the lithium ion battery-powered go-getters should be available next year or in 2011, including ones from...

  3. Program listing for heat-pump seasonal-performance model (SPM). [CNHSPM

    SciTech Connect (OSTI)

    Not Available


    The computer program CNHSPM is listed which predicts heat pump seasonal energy consumption (including defrost, cyclic degradation, and supplementary heat) using steady state rating point performance and binned weather data. (LEW)

  4. U.A.C. R315-2: General Requirements - Identification and Listing...

    Open Energy Info (EERE)

    U.A.C. R315-2: General Requirements - Identification and Listing of Hazardous Waste Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document-...

  5. Looking for a way to find utilites per zip code (a list?) | OpenEI...

    Open Energy Info (EERE)

    you head of time. Submitted by Caniemeyer on 1 July, 2013 - 13:55 1 answer Points: 0 Hello- Yes, there is indeed a dataset that lists utilities by zip-code. It can be found on...

  6. List of Attendees at the Controlled Hydrogen Fleet and Infrastructure Demonstation and Pre-Solicitation Meeting

    Broader source: [DOE]

    This list of attendees represents those that attended the Controlled Hydrogen Fleet and Infrastructure Demonstation and Pre-Solicitation Meeting pre-solicitation meeting in Detroit, Michigan, on March 19, 2003.

  7. Fact #651: November 29, 2010 Hybrid Vehicles Dominate EPA's Top Ten Fuel Sippers List for 2011

    Broader source: [DOE]

    Each year, the Environmental Protection Agency (EPA) produces a list of the top ten most fuel efficient vehicles for the model year. In past years, it was the small, lightweight vehicles that...

  8. Minnesota Member Lists the Twin Cities’ First Energy Fit Certified Home

    Broader source: [DOE]

    A home purchased and upgraded by Better Buildings Residential Network member the Center for Energy and Environment (CEE) made headlines as the first “Energy Fit” certified home listed on the...

  9. A Growing List | U.S. DOE Office of Science (SC)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    A Growing List High Energy Physics (HEP) HEP Home About Research Facilities Science Highlights Benefits of HEP Medicine Homeland Security Industry Computing Sciences Workforce Development A Growing List Accelerators for Americas Future External link Funding Opportunities Advisory Committees Community Resources Contact Information High Energy Physics U.S. Department of Energy SC-25/Germantown Building 1000 Independence Ave., SW Washington, DC 20585 P: (301) 903-3624 F: (301) 903-2597 E: Email Us

  10. Booklet, DOE Subject Area Indicators and Key Word List for RD and FRD -

    Energy Savers [EERE]

    October 2005 | Department of Energy Booklet, DOE Subject Area Indicators and Key Word List for RD and FRD - October 2005 Booklet, DOE Subject Area Indicators and Key Word List for RD and FRD - October 2005 October 2005 The purpose of this booklet is to assist individuals of Government agencies who generate or review classified documents to recognize the presence of nuclear information that is potentially classified as Restricted Data (RD) or Formerly Restricted Data (FRD). This book is

  11. Today in Energy - Browse by Tag List - U.S. Energy Information

    Gasoline and Diesel Fuel Update (EIA)

    Administration (EIA) Browse by Tag List Tag List | Tag Cloud 2011 Briefs 2012 Briefs 2013 Briefs AEO2011 (Annual Energy Outlook 2011) AEO2012 (Annual Energy Outlook 2012) AEO2013 (Annual Energy Outlook 2013) AEO2014 (Annual Energy Outlook 2014) AEO2015 (Annual Energy Outlook 2015) Africa age of generators series Alaska alternative fuel vehicle alternative transportation fuel animation appliance appliance standards Arkansas Australia Bakken barge Barnett baseload capacity Belgium biofuels

  12. Laser Incident Lessons Learned and Action List (Technical Report) | SciTech

    Office of Scientific and Technical Information (OSTI)

    Connect Laser Incident Lessons Learned and Action List Citation Details In-Document Search Title: Laser Incident Lessons Learned and Action List × You are accessing a document from the Department of Energy's (DOE) SciTech Connect. This site is a product of DOE's Office of Scientific and Technical Information (OSTI) and is provided as a public service. Visit OSTI to utilize additional information resources in energy science and technology. A paper copy of this document is also available for

  13. Two NREL Scientists Named to Highly Cited Researcher List - News Releases |

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NREL Two NREL Scientists Named to Highly Cited Researcher List Federal Labs Consortium recognizes NREL Education Programs Manager August 6, 2014 Photos of Art Nozik (left) and Keith Emery (right) Two scientists at the Energy Department's National Renewable Energy Laboratory, Art Nozik (left) and Keith Emery (right) were selected from a group of about 200 researchers globally in each of their fields-chemistry and engineering, respectively-for inclusion in the Highly Cited Researchers list.

  14. NAMII in the Top Ten Innovations to Watch List | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NAMII in the Top Ten Innovations to Watch List NAMII in the Top Ten Innovations to Watch List October 10, 2013 - 12:04pm Addthis A 3D printer at NAMII's facility in Youngstown, Ohio. Photo credit: National Additive Manufacturing Innovation Institute. A 3D printer at NAMII's facility in Youngstown, Ohio. Photo credit: National Additive Manufacturing Innovation Institute. Additive manufacturing is making a big impression and the National Additive Manufacturing Innovation Institute (NAMII) is right

  15. "List of Covered Electric Utilities" under the Public Utility

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Regulatory Policies Act of 1978 (PURPA) - 2006 Revised | Department of Energy 6 Revised "List of Covered Electric Utilities" under the Public Utility Regulatory Policies Act of 1978 (PURPA) - 2006 Revised Under Title I of the Public Utility Regulatory Policies Act of 1978 (PURPA), the U.S. Department of Energy (DOE) is required to publish a list identifying each electric utility.

  16. "List of Covered Electric Utilities" under the Public Utility Regulatory

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Policies Act of 1978 (PURPA) - 2009 | Department of Energy 9 "List of Covered Electric Utilities" under the Public Utility Regulatory Policies Act of 1978 (PURPA) - 2009 Under Title I, Sec. 102(c) of the Public Utility Regulatory Policies Act of 1978 (PURPA), the U.S. Department of Energy (DOE) is required to publish a list identifying each electric utility

  17. NE-23 List of California Sites Hattie Carwell. SAN/NSQA Division

    Office of Legacy Management (LM)

    Hattie Carwell. SAN/NSQA Division Attached for your information is the list Of Callfornia sites we identified in our search of Manhattdn Engineer District records for the Formerly Utilized Sites Remedial Action Program (FUSRAP). None of the facilities listed qualified for FUSRAP. The only site in California that was included in FUSRAP was Gilman Hall on the University of California-Berkeley Campus. All California sites that are in our Surplus Facilities Management Program are under San Francisco

  18. NE-23 List of California Sites NE-23 Hattie Car-well, SAN/NSQA Division

    Office of Legacy Management (LM)

    NE-23 Hattie Car-well, SAN/NSQA Division Attached for your information is the list of California sites we identified in our search of Manhattdn Engineer District records for the Formerly Utilized Sites Remedial Action Program (FUSRAP). None of the facilities listed qualified"fbr'FUSRAP:'~- The only site in California,that was included in FUSRAP was Gilman Hall on the University of California-Berkeley Campus. All California sites that are in our Surplus Facilities Management Prcgram are

  19. updated_supplemental_lists_1g-2g-3f_10-6-2011.xlsx | Department of Energy

    Energy Savers [EERE]

    g-2g-3f_10-6-2011.xlsx updated_supplemental_lists_1g-2g-3f_10-6-2011.xlsx File updated_supplemental_lists_1g-2g-3f_10-6-2011.xlsx More Documents & Publications updated_supplemental_lists_1i-2i-3h_12-06-2011.xlsx updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx updated_supplemental_lists_1m-2m-3l-04-05-2012

  20. updated_supplemental_lists_1h-2h-3g- 11-4-2011.xlsx | Department of Energy

    Energy Savers [EERE]

    h-2h-3g- 11-4-2011.xlsx updated_supplemental_lists_1h-2h-3g- 11-4-2011.xlsx File updated_supplemental_lists_1h-2h-3g- 11-4-2011.xlsx More Documents & Publications updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx updated_supplemental_lists_1p_2p_3o_04302013.xlsx updated_supplemental_lists_1j-2j-3i_12-22

  1. updated_supplemental_lists_1i-2i-3h_12-06-2011.xlsx | Department of Energy

    Energy Savers [EERE]

    i-2i-3h_12-06-2011.xlsx updated_supplemental_lists_1i-2i-3h_12-06-2011.xlsx File updated_supplemental_lists_1i-2i-3h_12-06-2011.xlsx More Documents & Publications updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx updated_supplemental_lists_1p_2p_3o_04302013.xlsx updated_supplemental_lists_1g-2g-3f_10-6

  2. updated_supplemental_lists_1j-2j-3i_12-22-2011.xlsx | Department of Energy

    Energy Savers [EERE]

    j-2j-3i_12-22-2011.xlsx updated_supplemental_lists_1j-2j-3i_12-22-2011.xlsx File updated_supplemental_lists_1j-2j-3i_12-22-2011.xlsx More Documents & Publications updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx updated_supplemental_lists_1p_2p_3o_04302013.xlsx updated_supplemental_lists_1m-2m-3l-04-05-2012

  3. updated_supplemental_lists_1k-2k-3j-_1-10-2012.xlsx | Department of Energy

    Energy Savers [EERE]

    k-2k-3j-_1-10-2012.xlsx updated_supplemental_lists_1k-2k-3j-_1-10-2012.xlsx File updated_supplemental_lists_1k-2k-3j-_1-10-2012.xlsx More Documents & Publications updated_supplemental_lists_1l-2l-3k-_02-10-2012.xlsx updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx updated_supplemental_lists_1j-2j-3i_12-22-2011

  4. updated_supplemental_lists_1l-2l-3k-_02-10-2012.xlsx | Department of Energy

    Energy Savers [EERE]

    l-2l-3k-_02-10-2012.xlsx updated_supplemental_lists_1l-2l-3k-_02-10-2012.xlsx File updated_supplemental_lists_1l-2l-3k-_02-10-2012.xlsx More Documents & Publications updated_supplemental_lists_1k-2k-3j-_1-10-2012.xlsx updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx updated_supplemental_lists_1m-2m-3l-04-05-2012

  5. updated_supplemental_lists_1m-2m-3l-04-05-2012.xlsx | Department of Energy

    Energy Savers [EERE]

    m-2m-3l-04-05-2012.xlsx updated_supplemental_lists_1m-2m-3l-04-05-2012.xlsx File updated_supplemental_lists_1m-2m-3l-04-05-2012.xlsx More Documents & Publications updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx updated_supplemental_lists_1p_2p_3o_04302013.xlsx updated_supplemental_lists_1j-2j-3i_12-22

  6. updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx | Department of Energy

    Energy Savers [EERE]

    n-2n-3m_07-06-2012.xlsx updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx File updated_supplemental_lists_1n-2n-3m_07-06-2012.xlsx More Documents & Publications updated_supplemental_lists_1m-2m-3l-04-05-2012.xlsx updated_supplemental_lists_1p_2p_3o_04302013.xlsx updated_supplemental_lists_1i-2i-3h_12-06

  7. State companies dominate OGJ100 list of non-U. S. oil producers

    SciTech Connect (OSTI)

    Not Available


    State owned oil and gas companies dominate the OGJ100 list of non-U.S. producers. Because many of them report only operating information, companies on the worldwide list cannot be ranked by assets or revenues. The list, therefore, is organized regionally, based on location of companies' corporate headquarters. The leading nongovernment company in both reserves and production is Royal Dutch/Shell. It ranks sixth in the world in liquids production and 11th in liquids reserves, as it has for the past 2 years. British Petroleum is the next largest nongovernment company. BP ranks 11th in liquids production and 16th in liquids reserves. Elf Aquitaine, 55.8% government-controlled, ranked 17th in liquids production. AGIP was 20th in liquids production. Kuwait Petroleum returned to the list of top 20 producers, ranking 12th, as it restored production shut in by facilities damage sustained during the Persian Gulf crisis. New to the top 20 reserves list is Petroleo Brasileiro, which moved to 20th position. The top 20 companies in the OGJ100 held reserves estimated at 869.3 billion bbl in 1992 vs. 869.5 billion bbl in 1991 and 854.2 billion bbl in 1990.

  8. Storing files in a parallel computing system using list-based index to identify replica files

    DOE Patents [OSTI]

    Faibish, Sorin; Bent, John M.; Tzelnic, Percy; Zhang, Zhenhua; Grider, Gary


    Improved techniques are provided for storing files in a parallel computing system using a list-based index to identify file replicas. A file and at least one replica of the file are stored in one or more storage nodes of the parallel computing system. An index for the file comprises at least one list comprising a pointer to a storage location of the file and a storage location of the at least one replica of the file. The file comprises one or more of a complete file and one or more sub-files. The index may also comprise a checksum value for one or more of the file and the replica(s) of the file. The checksum value can be evaluated to validate the file and/or the file replica(s). A query can be processed using the list.

  9. Method and apparatus of parallel computing with simultaneously operating stream prefetching and list prefetching engines

    DOE Patents [OSTI]

    Boyle, Peter A.; Christ, Norman H.; Gara, Alan; Mawhinney, Robert D.; Ohmacht, Martin; Sugavanam, Krishnan


    A prefetch system improves a performance of a parallel computing system. The parallel computing system includes a plurality of computing nodes. A computing node includes at least one processor and at least one memory device. The prefetch system includes at least one stream prefetch engine and at least one list prefetch engine. The prefetch system operates those engines simultaneously. After the at least one processor issues a command, the prefetch system passes the command to a stream prefetch engine and a list prefetch engine. The prefetch system operates the stream prefetch engine and the list prefetch engine to prefetch data to be needed in subsequent clock cycles in the processor in response to the passed command.


    Office of Scientific and Technical Information (OSTI)

    RECSIVEP ev Tin JUN 11157^; NUREG-0668 MASTER* TITLE LIST PUBLICLY AVAILABLE DOCUMENTS THREE MILE ISLAND UNIT 2 DOCKET 50-320 Cumulated to May 21,1979 Office of Administration U. S. Nuclear Regulatory Commission NUREG-0668 TITLE LIST PUBLICLY AVAILABLE DOCUMENTS THREE MILE ISLAND UNIT 2 DOCKET 50-320 Cumulated to M a y 2 1 , 1979 Division of Technical Information and Document Control Office of Administration U. S. Nuclear Regulatory Commission Washington, D.C. 20555 . CONTENTS Page Preface. v

  11. Condensed listing of surface boreholes at the Waste Isolation Pilot Plant Project through 31 December 1995

    SciTech Connect (OSTI)

    Hill, L.R.; Aguilar, R.; Mercer, J.W.; Newman, G.


    This report contains a condensed listing of Waste Isolation Pilot Plant (WIPP) project surface boreholes drilled for the purpose of site selection and characterization through 31 December 1995. The US Department of Energy (DOE) sponsored the drilling activities, which were conducted primarily by Sandia National Laboratories. The listing provides physical attributes such as location (township, range, section, and state-plane coordinates), elevation, and total borehole depth, as well as the purpose for the borehole, drilling dates, and information about extracted cores. The report also presents the hole status (plugged, testing, monitoring, etc.) and includes salient findings and references. Maps with borehole locations and times-of-drilling charts are included.

  12. DOE TRANSCOM Technical Support Services DE-EM0002903 SECTION J - LIST OF ATTACHMENTS

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 LIST OF DELIVERABLES All deliverables shall be provided to DOE in an editable electronic format (i.e., rather than PDF) in addition to hardcopy. Omission of any deliverable from the List of Deliverables does not affect the obligation of the Contractor to comply with such requirement. Report Reference Due Date Approval or Information Approving Official Update on Transition Activities C.05 Within 7 days of NTP for Contract Transition DOE Approval CO Updated TCC Desk Guides C.6.1.2 Within 60 days

  13. From: Sells_List_Server%DOELNC@DOE.GOV Subject: YELLOW/Caution: Unattended Laboratory Heating Equipment

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Wed, 08 Jan 2003 14:50:55 -0500 From: Sells_List_Server%DOELNC@DOE.GOV Subject: YELLOW/Caution: Unattended Laboratory Heating Equipment Sender: ListServer@HQLNC.DOE.GOV Title: Yellow Alert- Unattended Laboratory Heating Equipment Date: 1/2/03 Identifier: LL-2002-LLNL-30 Lessons Learned Summary: Two recent events at an LLNL facility illustrate once again that small electrical heating sources should be monitored while in use. Discussion of Activities: In the first LLNL incident, plastic bottles of

  14. Hanford Advisory Board FY2014 Work Plan - "A" List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hanford Advisory Board FY2014 Work Plan - "A" List These are the priority topics that the Board is expected to take action on in FY2014, as agreed to by the TPA and the Board. The timing of these topics drives the need for committee meetings. Their status may change to "topics of interest" if they are delayed or deferred, and if there is agreement to do so among the EIC and Agency Liaisons. 8/30/2013 v.6 Page 1 of 11 Priority Topics - "A" List Policy Level Issues

  15. Acronym List

    Broader source: [DOE]

    ACL  Alternate concentration limit AEC  U.S. Atomic Energy Commission BLM  U.S. Bureau of Land ManagementBLRA  Baseline Risk AssessmentBMT  Boundary MonumentCDPHE  Colorado Department of Public...

  16. Participant List

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Thomas Lograsso Ames Laboratory Henry Lomasney Sandia Solar Technology Stephen ... Meyer Gas Technology Institute 2 Eric Miller Department of EnergyFuel Cell ...

  17. Registration List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Resources Vladimir Goncharov Vanderbilt University Ben Collins University of Michigan Scott Applequist NOAA - National Climate Data Center Shawfeng Dong University of...

  18. Profiles List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Anderson-Cook, Christine Computational Physics and Applied Mathematics Information Science ... Bennett, Katrina Computational Physics and Applied Mathematics Computer and Computational ...

  19. Registration List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    postdoc Cinna Julie Wu UC Berkeley Mathematics Dept Clayton Bagwell NERSC David Turner ... postdoc Cinna Julie Wu UC Berkeley Mathematics Dept David Turner LBL Dilworth ...

  20. Trails List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Allowed: hiking, walking, running, biking, horseback riding, photography Bicycles must stay on established trails. Bicycles yield to pedestrians and horses. Anniversary Trail...

  1. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1. Ricky Kendall, Ames laboratory 2. Mike Minkoff, ANL 3. Brian Hingerty, ORNL 4. Doug Rotman, LLNL 5. David J. Dean, ORNL 6. Don Spong, ORNL 7. Viktok K. Decyk, UCLA 8. Robert...

  2. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Samtaney PPPL, Princeton University OSF Oct. 2-3 Yes Yukiko Sekine DOE OSF Oct. 2-3 No John Shalf NERSC OSF Oct. 2-3 No Horst Simon LBNL OSF Oct. 2-3 Yes David Skinner NERSC OSF...

  3. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    OSF Sep 17 Yes Richard Saykally Department of Chemistry, UC Berkeley OSF Sep 17-20 No John Shalf LBNL OSF Sep 17 No Horst Simon LBNL OSF Sep 17 Yes David Skinner LBLNERSC OSF...

  4. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    No Yukiko Sekine DOE InPerson No No No Yes Yes John Shalf NERSC InPerson No No No Yes No John Spring UCB InPerson Yes No No No No Mike Stewart NERSC InPerson Yes No No No No...

  5. Attendee List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    viagrid x Swisdak, Marc University of Maryland inperson x x Taylor, John ANL inperson x Turner, David NERSC inperson x x...

  6. Job Listing

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    17 031007 Firefighter/CIC/EMT $33.13 Engineer/CIC/EMT $19.76 Engineer/CIC/EMT $35.99 Chiefs Aide/CIC/EMT $19.76 Chiefs Aide/CIC/EMT $35.99 Lieutenant/CIC/EMT $20.99 Lieutenant/CIC/EMT $38.21 Captain/CIC/EMT $22.23 Captain/CIC/EMT $40.44 Assistant Chief/CIC/EMT $25.42 Assistant Chief/CIC/EMT $46.18 FP Tech/CIC/EMT $21.13 031019 FP Tech/CIC/EMT $38.47 031049 FP Captain/CIC/EMT $23.60 FP Captain/CIC/EMT $42.91 56-HOUR EMT & HAZ $1.11 10-HOUR EMT & HAZ $2.00 031047 Firefighter/CIC/EMT/HAZ

  7. Email List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Expand Finance & Rates Involvement & Outreach Expand Involvement & Outreach Doing Business Expand Doing Business Skip navigation links Initiatives Columbia River Treaty Non...

  8. Participant List

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Megan Brewster U.S. DOE, Advanced Manufacturing Office Joseph Broz SRI International Klaus Brun Southwest Research Institute Dan Carder West Virginia University Mark Carroll Idaho ...

  9. Theoretical hot methane line lists up to T = 2000 K for astrophysical applications

    SciTech Connect (OSTI)

    Rey, M.; Tyuterev, Vl. G.; Nikitin, A. V.


    The paper describes the construction of complete sets of hot methane lines based on accurate ab initio potential and dipole moment surfaces and extensive first-principle calculations. Four line lists spanning the [0-5000] cm{sup 1} infrared region were built at T = 500, 1000, 1500, and 2000 K. For each of these four temperatures, we have constructed two versions of line lists: a version for high-resolution applications containing strong and medium lines and a full version appropriate for low-resolution opacity calculations. A comparison with available empirical databases is discussed in detail for both cold and hot bands giving a very good agreement for line positions, typically <0.1-0.5 cm{sup 1} and ?5% for intensities of strong lines. Together with numerical tests using various basis sets, this confirms the computational convergence of our results for the most important lines, which is the major issue for theoretical spectra predictions. We showed that transitions with lower state energies up to 14,000 cm{sup 1} could give significant contributions to the methane opacity and have to be systematically taken into account. Our list at 2000 K calculated up to J = 50 contains 11.5 billion transitions for I > 10{sup 29} cm mol{sup 1}. These new lists are expected to be quantitatively accurate with respect to the precision of available and currently planned observations of astrophysical objects with improved spectral resolution.

  10. Title list of documents made publicly available, March 1--31, 1995: Volume 17, No. 3

    SciTech Connect (OSTI)


    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index. The docketed information contained in the Title List includes the information formerly issued through the Department of Energy publication Power Reactor Docket Information, last published in January 1979. NRC documents that are publicly available may be examined without charge at the NRC Public Document Room (PDR). Duplicate copies may be obtained for a fee. Standing orders for certain categories of documents are also available. Clients may search for and order desired titles through the PDR computerized Bibliographic Retrieval System, which is accessible both at the PDR and remotely. The PDR is staffed by professional technical librarians, who provide reference assistance to users. See NOTES at the end of the preface for information about reaching the PDR. Microfiche of the docketed information listed in the Title List is available for sale on a subscription basis from the National Technical Information Service (NTIS).

  11. Title list of documents made publicly available, March 1-31, 1996

    SciTech Connect (OSTI)


    This document is the March 1996 listing of publicly available documents published by the NRC. The documents include: (1) docketed material associated with civilian nuclear power plants and other uses of radioactive material, and (2) nondocketed material received and generated by the NRC in its role as a regulatory agency.

  12. Listing of United States companies that supply goods and services for geothermal explorers, developers and producers internationally

    SciTech Connect (OSTI)

    Not Available


    This List is composed solely of US companies with major offices within the United States. All of the companies listed are involved in selling geothermally related goods and services internationally, or have the proven capability to do so. Each specific listing includes the company name, the name or title of the key contact person, address, telephone and if available a facsimile machine or telex number.


    National Nuclear Security Administration (NNSA)

    III - LIST OF DOCUMENTS, EXHIBITS, AND OTHER ATTACHMENTS SECTION J LIST OF APPENDICES - TABLE OF CONTENTS Appendix A Statement of Work Appendix B Award Fee Plan Appendix C Transition Plan Appendix D Sensitive Foreign Nations Control Appendix E Performance Guarantee Agreement(s) Appendix F National Work Breakdown Structure Appendix G Personnel Appendix Appendix H Key Personnel Appendix I Small Business Subcontracting Plan Appendix J Diversity Plan Guidance Appendix K List of Applicable Directives


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    22 PART III - LIST OF DOCUMENTS, EXHIBITS AND OTHER ATTACHMENTS SECTION J ATTACHMENT E: PERFORMANCE GUARANTEE AGREEMENT (Performance Guarantee Agreements dated, August 17, 2012 is hereby incorporated

  15. WPN 11-9: Updated Guidance on Eligible Multifamily Property Listings for Use in the Weatherization Assistance Program

    Broader source: [DOE]

    To notify interested parties of supplemental listings of properties that have been determined to meet certain criteria under the Weatherization Assistance Program (WAP).

  16. Title III list of lists: Consolidated list of chemicals subject to the Emergency Planning and Community Right-to-Know Act (EPCRA) and section 112(r) of the Clean Air Act, as amended. Title III of the Superfund Amendments and Reauthorization Act of 1986, and Title III of the Clean Air Act Amendments of 1990

    SciTech Connect (OSTI)

    Not Available


    The consolidated chemical list includes chemicals subject to reporting requirements under Title III of the Superfund Amendments and Reauthorization Act of 1986 (SARA), also known as the Emergency Planning and Community Right-to-Know Act (EPCRA), and chemicals listed under section 112(r) of Title III the Clean Air Act (CAA) Amendments of 1990. This consolidated list has been prepared to help firms handling chemicals determine whether they need to submit reports under sections 302, 304, or 313 of SARA Title III (EPCRA) and, for a specific chemical, what reports may need to be submitted. Separate lists are also provided of Resource Conservation and Recovery Act (RCRA) waste streams and unlisted hazardous wastes, and of radionuclides reportable under the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA). These lists should be used as reference tool, not as a definitive source of compliance information. The chemicals on the consolidated list are ordered by Chemical Abstract Service (CAS) registry number. Categories of chemicals, which do not have CAS registry numbers, but which are cited under CERCLA, EPCRA section 313, and the CAA, are placed at the end of the list. More than one chemical name may be listed for one CAS number, because the same chemical may appear on different lists under different names.

  17. BPA-2014-00787-FOIA Correspondence

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List of approximately 3500 members, to include the mailings regarding the 2012 Fish Accord MOA with the Kalispell Tribe. 2) The press release inviting public comment on...

  18. Title list of documents made publicly available, February 1-28, 1998

    SciTech Connect (OSTI)

    Morris, E.B.


    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the U.S. Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) non-docketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index. The docketed information contained in the Title List includes the information formerly issued through the Department of Energy publication Power Reactor Docket Information, last published in January 1979.

  19. Title list of documents made publicly available, January 1-31, 1998

    SciTech Connect (OSTI)


    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index. The docketed information in the Title List includes the information formerly issued through the Department of Energy publication Power Reactor Docket Information, last published in January 1979. NRC documents that are publicly available may be examined without charge at the NRC Public Document Room (PDR). Duplicate copies in paper, microfiche, or (selectively) diskette, may be obtained for a fee.

  20. DOE technical standards list: Directory of points of contact for the DOE Technical Standards Program

    SciTech Connect (OSTI)


    This Department of Energy (DOE) technical standards list (TSL) has been prepared by the Office of Nuclear Safety Policy and Standards (EH-31). This TSL is approved for use by all DOE Components (i.e., all DOE Headquarters and field organizations, management and operating contractors, and laboratories). This TSL supplements DOE manuals, directives, orders, and standards. It provides basic and fundamental information for DOE Component personnel involved in identifying standardization documents. It also provides listings of points of contact within DOE and identifies links to points of contact within the Department of Defense (DoD) for coordination of standardization activities. This TSL will be updated to reflect changes in organizations, addresses, and responsibilities as necessary.

  1. 17th Edition of TOP500 List of World's Fastest SupercomputersReseased

    SciTech Connect (OSTI)

    Strohmaier, Erich; Meuer, Hans W.; Dongarra, Jack J.; Simon,Horst D.


    17th Edition of TOP500 List of World's Fastest Supercomputers Released MANNHEIM, GERMANY; KNOXVILLE, TENN.; BERKELEY, CALIF. In what has become a much-anticipated event in the world of high-performance computing, the 17th edition of the TOP500 list of the world's fastest supercomputers was released today (June 21). The latest edition of the twice-yearly ranking finds IBM as the leader in the field, with 40 percent in terms of installed systems and 43 percent in terms of total performance of all the installed systems. In second place in terms of installed systems is Sun Microsystems with 16 percent, while Cray Inc. retained second place in terms of performance (13 percent). SGI Inc. was third both with respect to systems with 63 (12.6 percent) and performance (10.2 percent).

  2. Hanford low-level vitrification melter testing -- Master list of data submittals

    SciTech Connect (OSTI)

    Hendrickson, D.W.


    The Westinghouse Hanford Company (WHC) is conducting a two-phased effort to evaluate melter system technologies for vitrification of liquid low-level radioactive waste (LLW) streams. The evaluation effort includes demonstration testing of selected glass melter technologies and technical reports regarding the applicability of the glass melter technologies to the vitrification of Hanford LLW tank waste. The scope of this document is to identify and list vendor document submittals in technology demonstration support of the Hanford Low-Level Waste Vitrification melter testing program. The scope of this document is limited to those documents responsive to the Statement of Work, accepted and issued by the LLW Vitrification Program. The purpose of such a list is to maintain configuration control of vendor supplied data and to enable ready access to, and application of, vendor supplied data in the evaluation of melter technologies for the vitrification of Hanford low-level tank wastes.

  3. All Other Editions Are Obsolete U.S. Department of Energy Shuttle Bus Passenger List

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    511.1 (02-94) All Other Editions Are Obsolete U.S. Department of Energy Shuttle Bus Passenger List Date: Time: Bus Number: Driver's Signature: The U.S. Department of Energy (DOE) Shuttle operates Express between the Germantown Building and the Washington Office (Forrestal Building). ICC regulations prohibits en-route stops. The information being collected below is for the purpose of identifying individuals utilizing DOE Shuttle service. It is not retrievable by a personal identifier and is,

  4. Domestic Price List | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Domestic Price List NBL Program Office NBL PO Home About Programs Certified Reference Materials (CRMs) Prices and Certificates Ordering Information NEPA Documents News Safety Data Sheets (SDS) for NBL Program Office Certified Reference Materials (CRM) Contact Information NBL Program Office U.S. Department of Energy Building 201 9800 South Cass Avenue Argonne, IL 60439-4899 P: (630) 252-2442 (NBL PO) P: (630) 252-2767 (CRM sales) F: (630) 252-6256 E: Email Us Prices and Certificates Domestic

  5. Title list of documents made publicly available, August 1-31, 1995

    SciTech Connect (OSTI)


    This document is the August 1995 listing of publicly available documents that are issued by the Nuclear Regulatory Commission. The compilation is broken down into docketed and undocketed items, and each of these categories is further broken down into narrower categories. In general, the docketed items pertain to specific NRC licensees, while the undocketed items are of general interest to all licensees of a particular group.

  6. New FedBizOpps Feature-Small Business Central Event Listing for Outreach and Training

    Broader source: [DOE]

    The Interagency Task Force on Small Business Contracting recommended that agencies post all new outreach and training events on FedBizOpps in order to make it easier and less burdensome for small businesses to learn about and transact business with the federal government. The subject new Small Business Central Event Listing provides a dynamic "calendar" for allowing small business users to search for business development, matchmaking and training opportunities by various criteria, including agency, date, location and small business category.

  7. International Price List | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    International Price List NBL Program Office NBL PO Home About Programs Certified Reference Materials (CRMs) Prices and Certificates Ordering Information NEPA Documents News Safety Data Sheets (SDS) for NBL Program Office Certified Reference Materials (CRM) Contact Information NBL Program Office U.S. Department of Energy Building 201 9800 South Cass Avenue Argonne, IL 60439-4899 P: (630) 252-2442 (NBL PO) P: (630) 252-2767 (CRM sales) F: (630) 252-6256 E: Email Us Prices and Certificates

  8. Plutonium Certified Reference Materials Price List | U.S. DOE Office of

    Office of Science (SC) Website

    Science (SC) Plutonium Certified Reference Materials Price List NBL Program Office NBL PO Home About Programs Certified Reference Materials (CRMs) Prices and Certificates Ordering Information NEPA Documents News Safety Data Sheets (SDS) for NBL Program Office Certified Reference Materials (CRM) Contact Information NBL Program Office U.S. Department of Energy Building 201 9800 South Cass Avenue Argonne, IL 60439-4899 P: (630) 252-2442 (NBL PO) P: (630) 252-2767 (CRM sales) F: (630) 252-6256

  9. LOS ALAMOS, N.M., Dec. 15, 2014-The Los Alamos National Laboratory Fellows list

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Laboratory Fellows for 2014 December 15, 2014 Honorees span sciences in physics, astrophysics, chemistry LOS ALAMOS, N.M., Dec. 15, 2014-The Los Alamos National Laboratory Fellows list expands by five this week as a new group of high achievers is named. The honorees this year are Christopher L. Fryer, Herbert O. Funsten, John C. Gordon, Jaqueline L. Kiplinger and David S. Moore. "The sustained scientific excellence demonstrated by the work of Chris, Herb, John, Jaqueline and David

  10. DOE TRANSCOM Technical Support Services DE-EM0002903 SECTION J - LIST OF ATTACHMENTS

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 ACRONYM LIST Acronym Description TRANSCOM Transportation Tracking and Communications System 8(a) Section 8(a) of the Small Business Act ADR Alternative Dispute Resolution CBFO Carlsbad Field Office CCR Central Contractor Registration CFR Code of Federal Regulations CLIN Contract Line Item Number CO Contracting Officer COR Contracting Officer Representative CPARS Contractor Performance Assessment Reporting System DEAR Department of Energy Acquisition Regulation DOE Department of Energy DPLH

  11. User 'To Do' List after Beam Time is Assigned | Linac Coherent Light Source

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    'To Do' List after Beam Time is Assigned □ Contact the Guest House to make reservations □ Review Checklists, Check-In Procedures & Advance Requirements for Foreign Nationals □ Review Safety of Scheduled Experiments & Complete Training □ Complete User Agreements □ Establish or Confirm User Financial Accounts □ Order Chemicals, Gases, Cryogenics □ Coordinate Equipiment Modifications □ Establish or Confirm Computer Accounts, Set up & Access Electronic Logbooks (eLog) □

  12. A lock-free priority queue design based on multi-dimensional linked lists

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Dechev, Damian; Zhang, Deli


    The throughput of concurrent priority queues is pivotal to multiprocessor applications such as discrete event simulation, best-first search and task scheduling. Existing lock-free priority queues are mostly based on skiplists, which probabilistically create shortcuts in an ordered list for fast insertion of elements. The use of skiplists eliminates the need of global rebalancing in balanced search trees and ensures logarithmic sequential search time on average, but the worst-case performance is linear with respect to the input size. In this paper, we propose a quiescently consistent lock-free priority queue based on a multi-dimensional list that guarantees worst-case search time of O(logN)more » for key universe of size N. The novel multi-dimensional list (MDList) is composed of nodes that contain multiple links to child nodes arranged by their dimensionality. The insertion operation works by first injectively mapping the scalar key to a high-dimensional vector, then uniquely locating the target position by using the vector as coordinates. Nodes in MDList are ordered by their coordinate prefixes and the ordering property of the data structure is readily maintained during insertion without rebalancing nor randomization. Furthermore, in our experimental evaluation using a micro-benchmark, our priority queue achieves an average of 50% speedup over the state of the art approaches under high concurrency.« less

  13. State-owned companies dominate list of largest non-U. S. producers

    SciTech Connect (OSTI)

    Beck, R.J.; Williamson, M.


    Because state-owned oil and gas companies dominate Oil and Gas Journal's list of largest non-US producers, data aren't fully comparable with those of the OGJ300. Many state companies report only production and reserves, with little or no financial data. Companies on the OGJ100, therefore, cannot be ranked by assets or revenues. Instead, they are listed by regions, based on location of corporate headquarters. There was no change in makeup of the top 20 holders of crude oil reserves. These companies' reserves totaled 872.3 billion bbl in 1993. The top 20 non-US companies now control 87.3 % of total world crude oil reserves, according to OGJ estimates. This is up marginally from 87.2 % of total world oil reserves in 1992. The top 20 had 87.7 % of total world reserves in 1991 and 85.5 % in 1990. The table lists company name, total assets, revenues, net income, capital and exploratory expenditures, worldwide oil production, gas production, oil and gas reserves worldwide.

  14. A lock-free priority queue design based on multi-dimensional linked lists

    SciTech Connect (OSTI)

    Dechev, Damian; Zhang, Deli


    The throughput of concurrent priority queues is pivotal to multiprocessor applications such as discrete event simulation, best-first search and task scheduling. Existing lock-free priority queues are mostly based on skiplists, which probabilistically create shortcuts in an ordered list for fast insertion of elements. The use of skiplists eliminates the need of global rebalancing in balanced search trees and ensures logarithmic sequential search time on average, but the worst-case performance is linear with respect to the input size. In this paper, we propose a quiescently consistent lock-free priority queue based on a multi-dimensional list that guarantees worst-case search time of O(logN) for key universe of size N. The novel multi-dimensional list (MDList) is composed of nodes that contain multiple links to child nodes arranged by their dimensionality. The insertion operation works by first injectively mapping the scalar key to a high-dimensional vector, then uniquely locating the target position by using the vector as coordinates. Nodes in MDList are ordered by their coordinate prefixes and the ordering property of the data structure is readily maintained during insertion without rebalancing nor randomization. Furthermore, in our experimental evaluation using a micro-benchmark, our priority queue achieves an average of 50% speedup over the state of the art approaches under high concurrency.

  15. IN-SPIRE: Creating a Visualization from Microsoft Outlook

    ScienceCinema (OSTI)



    IN-SPIRE can harvest text from Microsoft Outlook e-mail messages via a simple drag-and-drop mechanism. This is great for mailing lists or systems that send search results via e-mail.

  16. Title list of documents made publicly available, January 1, 1997--January 31, 1997

    SciTech Connect (OSTI)


    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) non-docketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  17. TPA PM List by TSD as of 09-30-15.xlsx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TREATMENT, STORAGE AND DISPOSAL UNITS PROJECT MANAGERS LIST AS OF SEPTEMBER 30, 2015 Prepared By MSA TPA Site Wide Integration TSD NO. Description Ecology PM DOE PM Assistant Manager Status Lead Regulatory Agency D-1-2 1301-N Liquid Waste Disposal Facility Menard, N. French, M.S. Corey, R. J. Final Ecology Lead D-1-2 1325-N Liquid Waste Disposal Facility Menard, N. French, M.S. Corey, R. J. Final Ecology Lead D-2-10 216-A-37-1 Crib Menard, N. Cline, M.W. Corey, R. J. Interim Ecology Lead D-2-11


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 NMED COMMENTS ITEM 3 REVISE VOLATILE ORGANIC COMPOUND (VOC) TARGET ANALYTE LIST OTHER CHANGES TO VOC MONITORING PROGRAM Page 1 of 21 VOC 3*1: PMR Section 3, Topic 1, Table 1 Recalculated Waste Matrix Code Group Weighting Factors based on the 2004 Compliance Recertification Contact Handled (CH) Transuranic (TRU) Waste Inventory (m 3 ) The new weighting factors appear to be based on CH TRU waste only and do not include remote handled (RH) TRU waste. There was no discussion in the PMR addressing

  19. A transputer-based list mode parallel system for digital radiography with 2D silicon detectors

    SciTech Connect (OSTI)

    Conti, M.; Russo, P.; Scarlatella, A. . Dipt. di Scienze Fisiche and INFN); Del Guerra, A. . Dipt. di Fisica and INFN); Mazzeo, A.; Mazzocca, N.; Russo, S. . Dipt. di Informatica e Sistemistica)


    The authors believe that a dedicated parallel computer system can represent an effective and flexible approach to the problem of list mode acquisition and reconstruction of digital radiographic images obtained with a double-sided silicon microstrip detector. They present a Transputer-based implementation of a parallel system for the data acquisition and image reconstruction from a silicon crystal with 200[mu]m read-out pitch. They are currently developing a prototype of the system connected to a detector with a 10mm[sup 2] sensitive area.

  20. Title list of documents made publicly available, April 1--30 1997, Vol. 19, No. 4

    SciTech Connect (OSTI)

    Morris, E.B.


    This report describes the information received and published by the U.S. Nuclear Regulatory Commission (NRC). This information includes: (1) material associated with civilian nuclear power plants and other uses of radioactive materials and (2) material received and published by NRC pertinent to its role as a regulatory agency. In this report, 7 items of the first type are included, and 25 regulatory type items are listed. The report is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  1. Title list of documents made publicly available, March 1--31, 1998. Volume 20, Number 3

    SciTech Connect (OSTI)


    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a personal author index, a corporate source index, and a report number index.

  2. Uranium Certified Reference Materials Price List | U.S. DOE Office of

    Office of Science (SC) Website

    Science (SC) Uranium Certified Reference Materials Price List NBL Program Office NBL PO Home About Programs Certified Reference Materials (CRMs) Prices and Certificates Ordering Information NEPA Documents News Safety Data Sheets (SDS) for NBL Program Office Certified Reference Materials (CRM) Contact Information NBL Program Office U.S. Department of Energy Building 201 9800 South Cass Avenue Argonne, IL 60439-4899 P: (630) 252-2442 (NBL PO) P: (630) 252-2767 (CRM sales) F: (630) 252-6256 E:

  3. Uranium and Thorium Ores Price List | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    and Thorium Ores Price List NBL Program Office NBL PO Home About Programs Certified Reference Materials (CRMs) Prices and Certificates Ordering Information NEPA Documents News Safety Data Sheets (SDS) for NBL Program Office Certified Reference Materials (CRM) Contact Information NBL Program Office U.S. Department of Energy Building 201 9800 South Cass Avenue Argonne, IL 60439-4899 P: (630) 252-2442 (NBL PO) P: (630) 252-2767 (CRM sales) F: (630) 252-6256 E: Email Us Prices and Certificates

  4. Title list of documents made publicly available. Volume 16, Number 5

    SciTech Connect (OSTI)

    Not Available


    The Title List of Documents Made Publicly Available contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  5. Title list of documents made publicly available: February 1--29, 1996. Volume 18, Number 2

    SciTech Connect (OSTI)


    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  6. Title list of documents made publicly available. Volume 17, No. 5

    SciTech Connect (OSTI)


    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (3) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  7. Title list of documents made publicly available. Volume 17, No. 7

    SciTech Connect (OSTI)


    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  8. Title list of documents made publicly available, May 1-31, 1996

    SciTech Connect (OSTI)

    Morris, E.B.


    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the U.S. Nuclear Regulatory Commission (NRC). This information includes (1) docketed, material associated with civilian nuclear power plants and other uses of radioactive materials and (2) non-docketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index and a Report Number Index.

  9. Listing of DOE/FE Authorizations Issued in 2013 | Department of Energy

    Energy Savers [EERE]

    3 Listing of DOE/FE Authorizations Issued in 2013 The following chart contains all Orders issued by the Office of Natural Gas Regulatory Activities in 2013 thru December 19. The orders include all new or renewed authority to Import and Export Natural Gas and/or Liquefied Natural Gas, as well as all procedural orders; i.e., vacates, name changes. To download applications, click here and select the "View (blankets), PDF (exports)" tab. The Orders are in PDF format and Require the Acrobat

  10. Listing of DOE/FE Authorizations Issued in 2014 | Department of Energy

    Energy Savers [EERE]

    4 Listing of DOE/FE Authorizations Issued in 2014 The following chart contains all Orders issued by the Office of Natural Gas Regulatory Activities in 2014 thru December 31st. The orders include all new or renewed authority to Import and Export Natural Gas and/or Liquefied Natural Gas, as well as all procedural orders; i.e., vacates, name changes. To download applications, click here and select the "View (blankets), PDF (exports)" tab. The Orders are in PDF format and Require the

  11. Project W-320, 241-C-106 waste retrieval spare parts list

    SciTech Connect (OSTI)

    Hays, W.H.


    Spare parts for equipment installed in the tank dome space or pump or valve pits should not be inventoried onsite due to the extensive, time-consuming work package planning, personnel/equipment mobilization, and funding requirements that are prerequisites to any repair or replacement. These issues provide adequate time to procure parts from offsite sources. All parts listed in this inventory can either be stocked in the DynCorp Tri-Cities Services, Inc., 2101-M Warehouse, or are available from the vendor/manufacturer.

  12. Title list of documents made publicly available: October 1--31, 1994. Volume 16, Number 10

    SciTech Connect (OSTI)

    Not Available


    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  13. Title list of documents made publicly available, September 1-30, 1997

    SciTech Connect (OSTI)


    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the U.S. Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  14. DOE TRANSCOM Technical Support Services DE-EM0002903 SECTION J - LIST OF ATTACHMENTS

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 LIST OF APPLICABLE DOE DIRECTIVES The Contractor shall comply with the requirements of the DOE Directives identified below. DOE directives may be found at Regulation and Number Regulation Title DOE O 150.1 Continuity Programs DOE O 200.1A Information Technology Management DOE O 203.1 Limited Personal use of Government Office Equipment including Information Technology DOE O 205.1B Chg 2 Department of Energy Cyber Security Program DOE O 206.1 Department of Energy

  15. Hanford Advisory Board FY2014 Work Plan - "A" List - Facilitat

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    "A" List - Facilitator notes on midyear status for TWC-lead topics (updated 4/30/14) These are the priority topics that the Board is expected to take action on in FY2014, as agreed to by the TPA and the Board. The timing of these topics drives the need for committee meetings. Their status may change to "topics of interest" if they are delayed or deferred, and if there is agreement to do so among the EIC and Agency Liaisons. Adopted by Consensus, September 6, 2013 Page 1 of

  16. Hanford Advisory Board FY2014 Work Plan - "A" List - RAP ISSUE MANAGERS

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    RAP ISSUE MANAGERS (updated 11/13/13) These are the priority topics that the Board is expected to take action on in FY2014, as agreed to by the TPA and the Board. The timing of these topics drives the need for committee meetings. Their status may change to "topics of interest" if they are delayed or deferred, and if there is agreement to do so among the EIC and Agency Liaisons. Adopted by Consensus, September 6, 2013 Page 1 of 12 Priority Topics - "A" List Policy Level Issues

  17. Title list of documents made pulicly available, March 1-31, 1997

    SciTech Connect (OSTI)

    Morris, E.B.


    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the U.S. Nuclear Regulatory Commission (NRC). This information includes: (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) non-docketed material received and published by NRC pertinent to its role as a regulatory agency. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  18. Title list of documents made publicly available, April 1-30, 1995. Volume 17, No. 4

    SciTech Connect (OSTI)


    This document is NUREG-0540, Volume 17, Number 4. The Title List of Documents Made Publicly Available is a monthly publication, It contains descriptions of the information received and generated by the US NRC. This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials, and (2) nondocketed material received and generated by the NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which the NRC maintains its regulatory records. This series of documents is indexed by a personal author index, a corporate source index, and a report number index.

  19. Title list of documents made publicly available: May 1--31, 1997. Volume 19, Number 5

    SciTech Connect (OSTI)


    The Title List of Documents Made Publicly Available is a monthly publication. It describes the information received and published by the US Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) non-docketed material received and published by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  20. Title list of documents made publicly available, December 1--31, 1993, Volume 15, No. 12

    SciTech Connect (OSTI)


    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the U.S. Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index, and a Report Number Index.

  1. DOE technical standards list: Directory of DOE and contractor personnel involved in non-government standards activities

    SciTech Connect (OSTI)


    The body of this document contains a listing of DOE employees and DOE contractors who have submitted form DOE F 1300.2, Record of Non-Government Standards Activity, which is attached to the end of this document. Additional names were added from rosters supplied by non-Government standards bodies. The committees or governing bodies in which the person participates is listed after each name. An asterisk preceding the committee notation indicates that the person has identified himself or herself as the DOE representative on that committee. Appendices to this document are also provided to sort the information by the parent employment organization, by non-Government standards activity, and by the proper names of the non-Government standards organizations and committees. DOE employees and contractors listed in this technical standards list are those recorded as of May 1, 1999.

  2. Fact #779: May 13, 2013 EPA's Top Ten Rated Vehicles List for Model Year 2013 is All Electric

    Broader source: [DOE]

    The 2013 model year marks the first time when the Environmental Protection Agency's (EPA's) top ten most fuel efficient vehicles list is comprised entirely of electric vehicles. Electric vehicles...


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)



    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 PART III - LIST OF DOCUMENTS, EXHIBITS AND OTHER ATTACHMENTS SECTION J ATTACHMENT F: GUIDANCE FOR PREPARATION OF DIVERSITY PLAN DE-SOL-0002555 WIPP Solicitation J-24 PART III - LIST OF DOCUMENTS, EXHIBITS AND OTHER ATTACHMENTS SECTION J ATTACHMENT F GUIDANCE FOR PREPARATION OF DIVERSITY PLAN (See Contract Clause entitled "Diversity Plan") This Guidance is to assist the Contractor in understanding the information being sought by the Department for each of the Diversity elements and

  5. Title list of documents made publicly available, November 1-30, 1995

    SciTech Connect (OSTI)


    The Title List of Documents Made Publicly Available is a monthly publication. It contains descriptions of the information received and generated by the U.S. Nuclear Regulatory Commission (NRC). This information includes (1) docketed material associated with civilian nuclear power plants and other uses of radioactive materials and (2) nondocketed material received and generated by NRC pertinent to its role as a regulatory agency. As used here, docketed does not refer to Court dockets; it refers to the system by which NRC maintains its regulatory records. This series of documents is indexed by a Personal Author Index, a Corporate Source Index and a Report Number Index. The docketed information contained in the Title List includes the information formerly issued through the Department of Energy publication Power Reactor Docker Information, last published in January 1979. NRC documents that are publicly available may be examined without charge at the NRC Public Document Room (PDR). Duplicate copies may be obtained for a fee. Standing orders for certain categories of documents are also available. Clients may search for and order desired titles through the PDR computerized Bibliographic Retrieval System, which is accessible both at the PDR and remotely. The PDR is staffed by professional technical librarians, who provide reference assistance to users.

  6. Email Updates about the Small Business Vouchers Pilot | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Email Updates about the Small Business Vouchers Pilot Subscribe Please enter and submit your e-mail address to receive periodic updates about the Small Business Vouchers Pilot. E-mail Address: Subscribe Unsubscribe Please enter and submit your e-mail address to unsubscribe from the mailing list for the Small Business Vouchers Pilot. E-mail Address: Unsubscribe

  7. Development of an ideal observer that incorporates nuisance parameters and processes list-mode data

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    MacGahan, Christopher Jonathan; Kupinski, Matthew Alan; Hilton, Nathan R.; Brubaker, Erik M.; Johnson, William C.


    Observer models were developed to process data in list-mode format in order to perform binary discrimination tasks for use in an arms-control-treaty context. Data used in this study was generated using GEANT4 Monte Carlo simulations for photons using custom models of plutonium inspection objects and a radiation imaging system. We evaluated observer model performance and then presented using the area under the receiver operating characteristic curve. Lastly, we studied the ideal observer under both signal-known-exactly conditions and in the presence of unknowns such as object orientation and absolute count-rate variability; when these additional sources of randomness were present, their incorporationmore » into the observer yielded superior performance.« less

  8. Flora of the Mayacmas Mountains. [Listing of 679 species in the Geysers Geothermal Resource area

    SciTech Connect (OSTI)

    Neilson, J.A.


    This flora describes the plants that occur within the Mayacmas Mountain Range of northern California. It is the result of ten years of environmental assessment by the author in the Geysers Geothermal Resource area, located in the center of the Mayacmas Range. The flora includes notes on plant communities and ecology of the area, as well as habitat and collection data for most of the 679 species covered. Altogether 74 families, 299 genera and 679 species are included in the flora. The work is divided into eight subdivisions: trees; shrubs; ferns and fern allies; aquatic plants; tules, sedges, and rushes; lilies and related plants; dicot herbs; and grasses. Within each subdivision, family, genera and species are listed alphabetically. Keys are provided at the beginning of each subdivision. A unique combination of physical, environmental and geologic factors have resulted in a rich and diverse flora in the Mayacmas. Maps have been provided indicating known locations for species of rare or limited occurrence.

  9. Test report of evaluation of primary exhaust ventilation flowmeters for double shell hydrogen watch list tanks

    SciTech Connect (OSTI)

    Willingham, W.E., Westinghouse Hanford


    This document reports the results of testing four different flowmeters for use in the primary exhaust ventilation ducts of Double Shell Tanks on the hydrogen watch list that do not already have this capability. This currently includes tanks 241-AW-101,241-AN- 103, 241-AN-104, 241-AN-105 and 241-SY-103. The anticipated airflow velocity in these tanks range from 0.25 m/s(50 ft/min) to 1/78 m/s (350 ft/min). Past experiences at Hanford have forced the evaluation and selection of instruments to be used at the low flow and relatively high humidity conditions found in these tanks. Based on the results of this test, a flow meter has been chosen for installation in the primary exhaust ventilation ducts of the above mentioned waste tanks.

  10. Safeguards summary event list (SSEL), January 1, 1990--December 31, 1995

    SciTech Connect (OSTI)


    The Safeguards Summary Event List (SSEL), Vol. 2, Rev. 4, provides brief summaries of several hundred safeguards-related events involving nuclear material or facilities regulated by the U.S. Nuclear Regulatory Commission (NRC) which occurred and were reported from January 1, 1990, rough December 31, 1995. Because of public interest, the Miscellaneous category includes a few events which involve either source material, byproduct material, or natural uranium which are exempt from safeguards requirements. Events are described under the categories of Bomb-related, Intrusion, Missing and/or Allegedly Stolen, Transportation-related, Tampering/Vandalism, Arson, Firearms, Radiological Sabotage, Nonradiological Sabotage, and Miscellaneous. The information contained in the event descriptions is derived primarily from official NRC reporting channels.

  11. Safeguards Summary Event List (SSEL), January 1, 1990--December 31, 1996, Vol. 2, Rev. 5

    SciTech Connect (OSTI)


    The Safeguards Summary Event List (SSEL), Vol. 2, Rev. 5, provides brief summaries of several hundred safeguards-related events involving nuclear material or facilities regulated by the US Nuclear Regulatory Commission (NRC) which occurred and were reported from January 1, 1990, through December 31, 1996. Because of public interest, the Miscellaneous category includes a few events which involve either source material, byproduct material, or natural uranium which are exempt from safeguards requirements. Events are described under the categories of Bomb-related, Intrusion, Missing and/or Allegedly Stolen, Transportation-related, Tampering/Vandalism, Arson, Firearms, Radiological Sabotage, Nonradiological Sabotage, and Miscellaneous. The information contained in the event descriptions is derived primarily from official NRC reporting channels.

  12. DOE Technical Standards List. Directory of DOE and contractor personnel involved in non-government standards activities

    SciTech Connect (OSTI)


    This is a periodic report on the level of agency participation in non-Government standards activities. This technical standards list is intended to assist US Department of Energy (DOE) management and other personnel involved in the DOE technical Standards Program by identifying those participating individuals. The body of this document contains a listing of DOE employees and DOE contractors who have submitted a Record of Non-Government Standards Activity. Additional names were added from rosters supplied by non-Government standards bodies. Appendices to this document are provided to list the information by parent employment organization, by non-Government standards activity, and by the proper names of the non-Government standards organizations and committees.

  13. DOE technical standards list: Directory of DOE and contractor personnel involved in non-government standards activities

    SciTech Connect (OSTI)


    The body of this document contains a listing of DOE employees and DOE contractors who have submitted form DOE F 1300.2, Record of Non-Government Standards Activity, which is attached to the end of this document and to DOE Order 1300.2A. Additional names were added from rosters supplied by non-Government standards bodies. The committees or governing bodies in which the person participates is listed after each name. An asterisk preceding the committee notation indicates that the person has identified himself or herself as the DOE representative on that committee. Appendices to this document are also provided to sort the information by the parent employment organization, by non-Government standards activity, and by the proper names of the non-Government standards organizations and committees. DOE employees and contractors listed in this TSL are those recorded as of July 1, 1996.

  14. Oak Ridge Site Specific Advisory Board Contacts

    Broader source: [DOE]

    Lists Oak Ridge Site Specific Advisory Board contact information including mailing address, phone numbers, and contact email addresses.

  15. From: Sells_List_Server%DOELNC@DOE.GOV Subject: YELLOW/Caution: Hazards from Modifying Finished Products

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    07 Jan 2003 15:55:12 -0500 From: Sells_List_Server%DOELNC@DOE.GOV Subject: YELLOW/Caution: Hazards from Modifying Finished Products Sender: ListServer@HQLNC.DOE.GOV Title: Yellow Alert- Hazards from Modifying Finished Products Date: 1/2/2003 Identifier: LL-2002-LLNL-31 Lessons Learned Summary: It is important to identify any hazards involved with the modification of a "finished" commercial product. Discussion of Activities: Finished products do not require a label for material hazards

  16. Prioritized List of Research Needs to support MRWFD Case Study Flowsheet Advancement

    SciTech Connect (OSTI)

    Law, Jack Douglas; Soelberg, Nicholas Ray


    In FY-13, a case study evaluation was performed of full recycle technologies for both the processing of light-water reactor (LWR) used nuclear fuels as well as fast reactor (FR) fuel in the full recycle option. This effort focused on the identification of the case study processes and the initial preparation of material balance flowsheets for the identified technologies. In identifying the case study flowsheets, it was decided that two cases would be developed: one which identifies the flowsheet as currently developed and another near-term target flowsheet which identifies the flowsheet as envisioned within two years, pending the results of ongoing research. The case study focus is on homogeneous aqueous recycle of the U/TRU resulting from the processing of LWR fuel as feed for metal fuel fabrication. The metal fuel is utilized in a sodium cooled fast reactor and the used fast reactor fuel processed using electrochemical separations. The recovered U/TRU from electrochemical separations is recycled to fuel fabrication and the fast reactor. Waste streams from the aqueous and electrochemical processing are treated and prepared for disposition. Off-gas from the separations and waste processing are also treated. As part of the FY-13 effort, preliminary process unknowns and research needs to advance the near-term target flowsheets were identified. In FY-14, these research needs were updated, expanded and prioritized. This report again updates the prioritized list of research needs based upon results to date in FY-15. The research needs are listed for each of the main portions of the flowsheet: 1) Aqueous headend, 2) Headend tritium pretreatment off-gas, 3) Aqueous U/Pu/Np recovery, 4) Aqueous TRU product solidification, 5) Aqueous actinide/lanthanide separation, 6) Aqueous off-gas treatment, 7) Aqueous HLW management, 8) Treatment of aqueous process wastes, 9) E-chem actinide separations, 10) E-chem off-gas, 11) E-chem HLW management. The identified research needs were prioritized within each of these areas. No effort was made to perform an overall prioritization. This information will be used by the MRWFD Campaign leadership in research planning for FY-16. Additionally, this information will be incorporated into the next version of the Case Study Report scheduled to be issued September 2015.

  17. Title III List of Lists: Consolidated list of chemicals subject to the Emergency Planning and Community Right-to-Know Act (EPCRA) and Section 112(r) of the Clean Air Act, as amended. Title III of the Superfund Amendments and Reauthorization Act of 1986, and Title III of the Clean Air Act Amendments of 1990

    SciTech Connect (OSTI)


    This consolidated chemical list includes chemicals subject to reporting requirements under Title III of the Superfund Amendments and Reauthorization Act of 1986 (SARA), also known as the Emergency Planning and Community Right-to-Know Act (EPCRA) and chemicals listed under Section 112(r) of Title III of the Clean Air Act (CAA) Amendments of 1990. This consolidated list has been prepared to help firms handling chemicals determine whether they need to submit reports under sections 302, 304, or 314 or SARA Title III (EPCRA) and, for a specific chemical, what reports may need to be submitted. It also will also help firms determine whether they will be subject to accident prevention regulations under CAA section 112(r).

  18. Treatability studies of actual listed waste sludges from the Oak Ridge Reservation (ORR)

    SciTech Connect (OSTI)

    Jantzen, C.M.; Peeler, D.K.; Gilliam, T.M.; Bleier, A.; Spence, R.D.


    Oak Ridge National Laboratory (ORNL) and Savannah River Technology Center (SRTC) are investigating vitrification for various low-level and mixed wastes on the Oak Ridge Reservation (ORR). Treatability studies have included surrogate waste formulations at the laboratory-, pilot-, and field-scales and actual waste testing at the laboratory- and pilot-scales. The initial waste to be processing through SRTC`s Transportable Vitrification System (TVS) is the K-1407-B and K-1407-C (B/C) Pond sludge waste which is a RCRA F-listed waste. The B/C ponds at the ORR K-25 site were used as holding and settling ponds for various waste water treatment streams. Laboratory-, pilot-, and field- scale ``proof-of-principle`` demonstrations are providing needed operating parameters for the planned field-scale demonstration with actual B/C Pond sludge waste at ORR. This report discusses the applied systems approach to optimize glass compositions for this particular waste stream through laboratory-, pilot-, and field-scale studies with surrogate and actual B/C waste. These glass compositions will maximize glass durability and waste loading while optimizing melt properties which affect melter operation, such as melt viscosity and melter refractory corrosion. Maximum waste loadings minimize storage volume of the final waste form translating into considerable cost savings.

  19. Experimental Unevaluated Nuclear Data List (XUNDL) from the National Nuclear Data Center (NNDC)

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    XUNDL was established in 1998. While it contains compiled nuclear structure data in the "ENSDF" format, the difference is that the ENSDF collection holds evaluated data, while XUNDL holds experimental data that have not yet been evaluated. The manual for one of the evaluated collections defines evaluation as "the process of analyzing experimentally measured cross-section data, combining them with the predictions of nuclear model calculations, and attempting to extract the true value of a cross section." (Document ENDF-102) The XUNDL data are the experimental data before these calculations and comparisons are done. In general, the information in a given XUNDL dataset comes from a single journal article or from a set of closely related articles by one group of authors. The bulk of the compilations are carried out by the Nuclear Data Group at McMaster University. As of February 2008, the XUNDL database contained more than 2500 datasets for 1484 nuclides. The data can be searched through specialized interfaces or browsed. There is also a special list of hypernucleus datasets available. (Specialized Interface)

  20. Sign me up to receive news and event updates

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Sign me up to receive news and event updates Find out what's happening @ the Bradbury Science Museum by joining our mailing list. Your Name Your Email Additional Comments Reset Submit News & Events Events Calendar Events Mailing List Lecture Videos Newsletter Archive All Issues


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)


  2. Thermal springs list for the United States; National Oceanic and Atmospheric Administration Key to Geophysical Records Documentation No. 12

    SciTech Connect (OSTI)

    Berry, G.W.; Grim, P.J.; Ikelman, J.A.


    The compilation has 1702 thermal spring locations in 23 of the 50 States, arranged alphabetically by State (Postal Service abbreviation) and degrees of latitude and longitude within the State. It shows spring name, surface temperature in degrees Fahrenheit and degrees Celsius; USGS Professional Paper 492 number, USGS Circular 790 number, NOAA number, north to south on each degree of latitude and longitude of the listed. USGS 1:250,000-scale (AMS) map; and the USGS topographic map coverage, 1:63360- or 1:62500-scale (15-minute) or 1:24000-scale (7.5-minute) quadrangle also included is an alphabetized list showing only the spring name and the State in which it is located. Unnamed springs are omitted. The list includes natural surface hydrothermal features: springs, pools, mud pots, mud volcanoes, geysers, fumaroles, and steam vents at temperature of 20{sup 0}C (68[sup 0}F) or greater. It does not include wells or mines, except at sites where they supplement or replace natural vents presently or recently active, or, in some places, where orifices are not distinguishable as natural or artificial. The listed springs are located on the USGS 1:250,000 (AMS) topographic maps. (MHR)

  3. Participant List for the 2010-2025 Scenario Analysis for Hydrogen Fuel Cell Vehicles and Infrastructure Meeting on January 31, 2007

    Broader source: [DOE]

    This list describes the participants at the 2010-2025 Scenario Analysis for Hydrogen Fuel Cell Vehicles and Infrastructure meeting on January 31, 2007.

  4. Notice of Availability of a Preliminary List of Standby Power Products and Testing Guidelines, Federal Register, 66 FR 67517, December 31, 2001

    Broader source: [DOE]

    Document displays the notice of availability of a preliminary list of standby power products and testing guidelines, which was published in the Federal Register on December 31, 2001.

  5. Field Guide

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

    Ecologist for a Day Field Guide Program supported by: ©2011, Savannah


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)



    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    PART III - LIST OF DOCUMENTS, EXHIBITS AND OTHER ATTACHMENTS SECTION J ATTACHMENT A LAWS, REGULATIONS, AND DIRECTIVES (DEC 2000) (a) In performing work under this contract, the Contractor shall comply with the requirements of applicable Federal, State, and local laws and regulations (including DOE regulations), unless relief has been granted in writing by the appropriate regulatory agency. (b) In performing work under this contract, the Contractor shall comply with the requirements of those


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 PART III - LIST OF DOCUMENTS, EXHIBITS AND OTHER ATTACHMENTS SECTION J ATTACHMENT C: DRAFT PERFORMANCE EVALUATION AND MEASUREMENT PLAN (PEMP) DE-EM-0001971 WIPP M&O J-9 Draft PERFORMANCE EVALUATION AND MEASUREMENT PLAN (PEMP) OCTOBER 1 (2012) through SEPTEMBER 30, (2013) Contract No. DE- EM0001971 SECTION J ATTACHMENT C I. INTRODUCTION This Performance Evaluation and Measurement Plan (PEMP) provides a standard process for development, administration, and coordination of all phases of the


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6 PART III - LIST OF DOCUMENTS, EXHIBITS AND OTHER ATTACHMENTS SECTION J ATTACHMENT G: SUMMARY OF CONTRACT DELIVERABLES DE-SOL-0002555 WIPP Solicitation J-27 SUMMARY OF CONTRACT DELIVERABLES Deliverable Reference Deliverable DOE Action Deliverable Due Date 1 1. C.3.1.5 Ten Year Site Plan Approval Within 6 months of written notice to proceed, updated annually 2. C.3.1.5 Maintenance Plan (including Nuclear Maintenance Management Plan) Approval Within 6 months of written notice to proceed, updated


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4 PART III - LIST OF DOCUMENTS, EXHIBITS AND OTHER ATTACHMENTS SECTION J ATTACHMENT I: FY2011 ANNUAL PERFORMANCE AGREEMENT WITH THE ASSISTANT SECRETARY Office of Environmental Management Performance Agreement with the Assistant Secretary Overview The Office of Environmental Management (EM) is working to complete the safe cleanup of the environmental legacy brought about from five decades of nuclear weapons development and government-sponsored nuclear energy research. For FY 2011, EM's

  11. Microsoft PowerPoint - NRC Nuclear Export Controls Implementing the NSG Trigger List_Gary Langlie [Compatibility Mode]

    National Nuclear Security Administration (NNSA)

    U.S. NRC Nuclear Export Controls: Implementing the NSG Trigger List Gary R. Langlie Licensing Officer Office of International Programs May 11-14, 2015 NRC's Mission 2 License and regulate the Nation's civilian use of byproduct, source, and special nuclear materials to ensure adequate protection of public health and safety, promote the common defense and security, and protect the environment. Legal Basis * Atomic Energy Act of 1954, as amended * Nuclear Non-Proliferation Act of 1978 * Treaties,

  12. List of currently classified documents relative to Hanford Production Facilities Operations originated on the Hanford Site between 1961 and 1972

    SciTech Connect (OSTI)

    Not Available


    The United States Department of Energy (DOE) has declared that all Hanford plutonium production- and operations-related information generated between 1944 and 1972 is declassified. Any documents found and deemed useful for meeting Hanford Environmental Dose Reconstruction (HEDR) objectives may be declassified with or without deletions in accordance with DOE guidance by Authorized Derivative Declassifiers. The September 1992, letter report, Declassifications Requested by the Technical Steering Panel of Hanford Documents Produced 1944--1960, (PNWD-2024 HEDR UC-707), provides an important milestone toward achieving a complete listing of documents that may be useful to the HEDR Project. The attached listing of approximately 7,000 currently classified Hanford-originated documents relative to Hanford Production Facilities Operations between 1961 and 1972 fulfills TSP Directive 89-3. This list does not include such titles as the Irradiation Processing Department, Chemical Processing Department, and Hanford Laboratory Operations monthly reports generated after 1960 which have been previously declassified with minor deletions and made publicly available. Also Kaiser Engineers Hanford (KEH) Document Control determined that no KEH documents generated between January 1, 1961 and December 31, 1972 are currently classified. Titles which address work for others have not been included because Hanford Site contractors currently having custodial responsibility for these documents do not have the authority to determine whether other than their own staff have on file an appropriate need-to-know. Furthermore, these documents do not normally contain information relative to Hanford Site operations.

  13. Widget:MailChimp | Open Energy Information

    Open Energy Info (EERE)

    source History View New Pages Recent Changes All Special Pages Semantic SearchQuerying Get Involved Help Apps Datasets Community Login | Sign Up Search Widget Edit History...


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    (865) 574-2105 (Alternate) Miller, Ruth Oak Ridge Nat'l Laboratory ... Ashley, Tom CWI, Idaho Cleanup Project (208) 360-3552 McGary, ...

  15. Mail Management Memorandum, July 2, 2010

    Energy Savers [EERE]

  16. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    New reporting due date will be October 31 of each year starting in FY-2014. On-line ... Change to Schedule 5-1. Requirement is to now enter numbers rounded to the nearest dollar ...


    Energy Savers [EERE]

    HSS/UNION MEETING TO ADDRESS TRAINING INTEGRATED EXECUTIVE SUMMARY AND FINAL ACTION LIST HSS and the labor unions who participated in the initial 2007 HSS Focus Group meetings agreed to a path forward in which various unions combined to form core working groups to address union identified issues by topical area. The following is a synthesis of actions/activities identified in the April 30 HSS/Union meeting to address training issues with focus in the areas of the development of DOE-wide HAMMER

  18. Pool daily fuel scheduling. Volume 3: Program listings. Final report, February 1981. [START; MASTER; THCC; HYDR; PSTO; NFLA; LMTF

    SciTech Connect (OSTI)

    Pang, C.K.; Mikolinnas, T.A.


    The results and efforts of research and development of methods for daily fuel scheduling performed under EPRI Project RP 1048-5 by Power Technologies, Inc. (PTI) are reported in three volumes: Technical Manual; Programming Manual and Program Listing. Daily fuel scheduling involves the scheduling and dispatching of generating facilities to meet all system loads and operating requirements for periods ranging from a day to a week. Daily fuel scheduling and computer requirements are defined. The scheduling problem is formulated as a mixed-integer linear programming (MILP) optimization problem in which the total system operating cost is minimized. A potentially practical scheduling procedure, based on a combination of search and MILP approaches, was proposed; these two approaches were investigated, coded in FORTRAN and tested individually. Tests using the New York Power Pool system show that the search approach may produce potential savings for fuel scheduling approaches. Additional efforts are needed to make the MILP approach practical. Finally, a number of special scheduling problems have been identified and recommended for future work. This volume of the report (Volume 3) gives the FORTRAN listings of the programs, which had been developed during the course of this project. In the programs, there may be certain statements and functions which could be specific to the PRIME computer system. Comments on them are provided.

  19. Guidebook to excellence: A directory of federal facilities and other resources for mathematics and science education improvement. [Contains acronym list

    SciTech Connect (OSTI)

    Shipman, T.


    The Guidebook to Excellence is a State-by-State directory of Federal facilities and other resources for improving mathematics and science education. This directory, the first of its kind, is being published to assist educators, parents, and students across the country in attaining the National Education Goals, particularly Goal No. 4: By the year 2000, US students will be first in the world in science and mathematics achievement. Some of the larger research facilities in this directory, such as those of NASA, EPA and the Departments of Energy, Commerce, and the Interior, provide a wide range of education programs, and some offer students and teachers hands on experience with state-of-the-art research in world class facilities. Other sites, such as those of the Department of Transportation or Agriculture may be quite small, but can provide assistance in a single field of research or workforce expertise. Also listed are individuals responsible for State or regional coordination of major programs, such as the US Department of Education's Eisenhower Mathematics and Science Education Program, or the National Science Foundation's Statewide Systemic Initiative Program. In addition, each State listing includes facilities or coordinators providing regional assistance from neighboring States.

  20. Search for: All records | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    ... assembled a mock UF6 F&W system using water in lieu of UF6 to test the feasibility of ... It examined the gap in supplies and uses to meet domestic needs and extrapolated them in ...