Powered by Deep Web Technologies
Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

Real-time curvature and optical spectroscopy monitoring of magnetron-sputtered \\{WTi\\} alloy thin films  

Science Journals Connector (OSTI)

Abstract \\{WTi\\} thin films are known as potential adhesion promoters and diffusion barriers. \\{WTi\\} thin films were deposited by magnetron sputtering from an alloyed target (W:Ti ~ 70:30 at.%). Real-time surface differential reflectance (SDR) spectroscopy and wafer-curvature measurements were performed during deposition to study the growth and the film continuity threshold. SDR measurements during \\{WTi\\} deposition allow the determination of the change in reflectivity of p-polarized light (at Si substrate Brewster's angle) between \\{WTi\\} film and Si substrate in order to monitor layer growth. The comparison between experimental and simulated \\{WTi\\} SDR signals assuming a homogeneous and continuous layer growth shows that film continuity is ensured beyond a thickness of 4.5 ± 0.2 nm. Real-time wafer-curvature measurements allow the determination of the intrinsic stress development in the film. Two regimes are noticed during the growth up to the development of a compressive steady state stress. The early stages of growth are rather complicated and divided into sub-regimes with similar boundaries revealed by both in situ techniques. Deposition of an interfacial continuous layer different from \\{WTi\\} bulk is suggested by both in situ techniques below a thickness of 4.5 nm.

A. Le Priol; L. Simonot; G. Abadias; P. Guérin; P.-O. Renault; E. Le Bourhis

2013-01-01T23:59:59.000Z

2

WTI crude oil Futures in portfolio diversification: The time-to-maturity effect  

Science Journals Connector (OSTI)

The aim of the paper is to analyze the diversification effect brought by crude oil Futures contracts, the most liquid commodity Futures, into a portfolio of stocks. The studies that have documented the very low- and essentially negative-correlations between commodities and equities typically rely on normally distributed returns, which is not the case for crude oil Futures and stocks indexes. Moreover, the particular time-to-maturity chosen for the Future contract used as an investment vehicle is an important matter that needs to be addressed, in presence of forward curves switching between backwardation and contango shapes. Our goal in this paper is twofold: (a) we introduce copula functions to have a better representation of the dependence structure of oil Futures with equity indexes; (b) using this copula representation, we are able to analyze in a precise manner the “maturity effect” in the choice of crude oil Future contract with respect to its diversification benefits. Our finding is that, in the case of distant maturities Futures, e.g., 18 months, the negative correlation effect is more pronounced whether stock prices increase or decrease. This property has the merit to avoid the hurdles of a frequent roll over while being quite desirable in the current trendless equity markets. Empirical evidence is exhibited on a database comprising the NYMEX WTI crude oil Futures and S&P 500 index over a 15 year-time period.

Hélyette Geman; Cécile Kharoubi

2008-01-01T23:59:59.000Z

3

Is WTI crude oil market becoming weakly efficient over time?: New evidence from multiscale analysis based on detrended fluctuation analysis  

Science Journals Connector (OSTI)

This paper extends the work in Tabak and Cajueiro [Are the crude oil markets becoming weakly efficient over time, Energy Economics 29 (2007) 28–36] and Alvarez-Ramirez et al. [Short-term predictability of crude oil markets: a detrended fluctuation analysis approach, Energy Economics 30 (2008) 2645–2656]. In this paper, we test for the efficiency of WTI crude oil market through observing the dynamic of local Hurst exponents employing the method of rolling window based on multiscale detrended fluctuation analysis. Empirical results show that short-term, medium-term and long-term behaviors were generally turning into efficient behavior over time. However, in this way, the results also show that the market did not evolve along stable conditions for long times. Multiscale analysis is also implemented based on multifractal detrended fluctuation analysis. We found that the small fluctuations of WTI crude oil market were persistent; however, the large fluctuations had high instability, both in the short- and long-terms. Our discussion is also extended by incorporating arguments from the crude oil market structure for explaining the different correlation dynamics.

Yudong Wang; Li Liu

2010-01-01T23:59:59.000Z

4

Development of WTI and turbidity estimation model using SMA — application to Kushiro Mire, eastern Hokkaido, Japan  

Science Journals Connector (OSTI)

A new water-turbidity index (WTI) based on multispectral images was developed and tested at Kushiro Mire, eastern Hokkaido, Japan. An algorithm for turbidity estimation was developed and applied to Landsat TM images to monitor the turbid water on the mire surface during the snow-melting season. We used spectral mixture analysis (SMA) to produce a turbidity estimation model. The SMA “unmixes” a mixed pixel determining the fractions due to each spectral end member. In this study, we used four end members (1, alder; 2, reed; 3, high-concentration turbid water (485 ppm); 4, low-concentration turbid water (10 ppm) measured in the test site. The WTI was determined by the following equation: WTI=amax/(amax+amin), where amax is abundance of high-concentration turbid water and amin is abundance of low-concentration turbid water. The end-member spectra of alder and reed were measured in the laboratory using specimens collected at the test site. The spectrum of turbid water was measured at the test sites. The relative abundance of each end member was estimated based on this spectral information using SMA. The same formula was applied to Landsat TM images. Then we applied the WTI equation to the end-member images to obtain a WTI map. In the mire wetland region, turbid water spreads under alder trees and reed grasses. To verify our turbidity estimation method based on WTI under these conditions, we constructed a small experimental wetland consisting of mixed stands of alder and reed. WTI was calculated from the mixed spectrum of this “artificial wetland” and the regression curve for the relation between WTI and the actual turbidity was determined (R2=.91). Finally, this regression equation was used to derive a turbidity map from the WTI image.

Satoshi Kameyama; Yoshiki Yamagata; Futoshi Nakamura; Masami Kaneko

2001-01-01T23:59:59.000Z

5

Comparison of \\{WTi\\} and WTi(N) as diffusion barriers for Al and Cu metallization on Si with respect to thermal stability and diffusion behavior of Ti  

Science Journals Connector (OSTI)

Abstract The thermal stability of \\{WTi\\} and WTi(N) as diffusion barriers for Al and Cu metallization on Si (1 0 0) was investigated by time of flight secondary ion mass spectrometry (ToF-SIMS) depth profiling, X-ray diffraction (XRD), electron microscopy (SEM and TEM) and X-ray photoelectron spectroscopy (XPS). For both, Al and Cu, Ti diffusion out of \\{WTi\\} into the metal was proved to occur at elevated temperatures (400 °C for Al and 600 °C for Cu) which further results in barrier film failure. Nitrogen incorporation into \\{WTi\\} leads to an elimination of the Ti diffusion and consequently to a better thermal stability of the barrier film. It is shown that besides crystal structure, Ti diffusion into the metallization is an essential factor of the barrier failure mechanism. The failure temperature for Al is lower than for Cu.

M. Fugger; M. Plappert; C. Schäffer; O. Humbel; H. Hutter; H. Danninger; M. Nowottnick

2014-01-01T23:59:59.000Z

6

Epidemic spreading in time-varying community networks  

SciTech Connect (OSTI)

The spreading processes of many infectious diseases have comparable time scale as the network evolution. Here, we present a simple networks model with time-varying community structure, and investigate susceptible-infected-susceptible epidemic spreading processes in this model. By both theoretic analysis and numerical simulations, we show that the efficiency of epidemic spreading in this model depends intensively on the mobility rate q of the individuals among communities. We also find that there exists a mobility rate threshold q{sub c}. The epidemic will survive when q?>?q{sub c} and die when q?spreading in complex networks with community structure.

Ren, Guangming, E-mail: wangxy@dlut.edu.cn, E-mail: ren-guang-ming@163.com [School of Electronic and Information, Guangdong Polytechnic Normal University, Guangzhou 510665 (China) [School of Electronic and Information, Guangdong Polytechnic Normal University, Guangzhou 510665 (China); Faculty of Electronic Information and Electrical Engineering, Dalian University of Technology, Dalian 116024 (China); Wang, Xingyuan, E-mail: wangxy@dlut.edu.cn, E-mail: ren-guang-ming@163.com [Faculty of Electronic Information and Electrical Engineering, Dalian University of Technology, Dalian 116024 (China)] [Faculty of Electronic Information and Electrical Engineering, Dalian University of Technology, Dalian 116024 (China)

2014-06-15T23:59:59.000Z

7

Exploring the WTI crude oil price bubble process using the Markov regime switching model  

Science Journals Connector (OSTI)

Abstract The sharp volatility of West Texas Intermediate (WTI) crude oil price in the past decade triggers us to investigate the price bubbles and their evolving process. Empirical results indicate that the fundamental price of WTI crude oil appears relatively more stable than that of the market-trading price, which verifies the existence of oil price bubbles during the sample period. Besides, by allowing the WTI crude oil price bubble process to switch between two states (regimes) according to a first-order Markov chain, we are able to statistically discriminate upheaval from stable states in the crude oil price bubble process; and in most of time, the stable state dominates the WTI crude oil price bubbles while the upheaval state usually proves short-lived and accompanies unexpected market events.

Yue-Jun Zhang; Jing Wang

2014-01-01T23:59:59.000Z

8

A technical look at the WTI incinerator  

SciTech Connect (OSTI)

EPA has granted Waste Technologies Industries (WTI) temporary authorization to burn hazardous waste in its new incinerator in East Liverpool, Ohio. The approval is based on preliminary data showing that the incinerator was able to meet EPA`s emission standards for dioxins and furans in tests run this summer. WTI is allowed to continue burning waste pending final evaluation of its March 1993 performance tests. The action marks yet another hurdle cleared by WTI in its 11-year effort to construct and operate a commercial hazardous waste incinerator. The facility`s long-standing predicament as a target for environmental and public interest groups has made it the subject of numerous lawsuits and many legal reviews. In this article, however, we focus on the technical aspects of the system. The WTI incinerator is described in {open_quotes}Performance Testing of a Rotary Kiln Incinerator,{close_quotes} a paper by Alfred Sigg of Von Roll, Incorporated (Norcross, Georgia). The paper was presented at the 1993 Incineration Conference, which was held in Knoxville, Tennessee on May 3-7, 1993. 1 fig., 2 tabs.

NONE

1993-11-01T23:59:59.000Z

9

Picosecond laser ablation of nano-sized WTi thin film  

Science Journals Connector (OSTI)

Interaction of an Nd:YAG laser, operating at 532 nm wavelength and pulse duration of 40 ps, with tungsten-titanium (WTi) thin film (thickness, 190 nm)...2...were found to be sufficient for modification of the WTi

S. Petrovi?; B. Gakovi?; D. Peruško; T. Desai; D. Batani; M. ?ekada…

2009-08-01T23:59:59.000Z

10

Thermal diffusion in Au?WTi?Pd metallization on silicon  

Science Journals Connector (OSTI)

This paper presents the results of investigation of thermal diffusion in Au?Wti?Pd metallization on (111) n-Si. Thin films were deposited by dc sputtering to the thickness of 50 (Pd), 100–200 (WTi) and 70–200 nm (Au). After deposition the samples were subjected to thermal treatments vacuum 1 × 10?5 mbar, at temperatures up to 600°C. Characterization included RBS, AES, XRD and SEM structural analysis and sheet resistivity measurements. During annealing up to 450°C diffusion occurs only at the Pd?Si interface, at 500°C other components interdiffuse at isolated areas of the samples and at 600°C there is total interdiffusion on components. Thermal degradation oftthe \\{WTi\\} diffusion barrier is enhanced by the growth of Pd2Si phase, during which silicon is released from the substrate and mechanical stress is introduced. Better diffusion barrier properties were obtained when \\{WTi\\} films were deposited in nitrogen or oxygen atmosphere.

M Milosavljevi?; N Bibi?; M Stojanovi?; J Turkovi?; I.H Wilson

1990-01-01T23:59:59.000Z

11

Distillate Supply/Demand Balance Reflected in Spreads  

Gasoline and Diesel Fuel Update (EIA)

4 4 Notes: The price spike that initiated the flood of distillate imports last winter can be easily seen in this chart. The distillate supply/demand balance influences the spread between spot distillate and spot crude oil prices. For example, when stocks are higher than normal, the spread will be lower than usual. This spread is the price incentive that encourages or discourages changes in supply. The January/February 2000 price spike was shorter than the one last winter, largely due to the timing. Since last winter's price spike occurred early in the season, it took some time before prices receded substantially. Currently, the distillate fuel refining spread (the difference between the spot heating oil price and the WTI price) is more "typical". But as was

12

Discrete Time Approximation and Monte-Carlo Simulation of Backward Stochastic Differential Equations  

E-Print Network [OSTI]

, ~Z ti-1 )(ti - ti-1) - ~Zti-1 · (Wti - Wti-1 ) , together with the final data ~Y tn = g(X tn-time approximation (Y , Z) : Y tn = g X tn , Z ti-1 = (ti - ti-1)-1 E Y ti (Wti - Wti-1 )|Fti-1 Y ti-1 = E Y ti, involved in the above discretization scheme, reduce to the regression of Y ti and Y ti (Wti - Wti-1

Université Pierre-et-Marie-Curie, Paris 6

13

Revealing asymmetries in the loss function of WTI oil futures market  

Science Journals Connector (OSTI)

This paper examines behavioural aspects of the West Texas Intermediate (WTI) oil 1-month futures from 1995 to ... regarding preferences. Even without observing fundamentals of WTI oil futures we can assess whethe...

E. C. Mamatzakis

2014-09-01T23:59:59.000Z

14

Structure–Diffusion Relationship of Magnetron-Sputtered WTi Barriers Used in Indium Interconnections  

Science Journals Connector (OSTI)

Tungsten-titanium (WTi) thin films are known as potential adhesion ... and diffusion barriers. The barrier efficiency of WTi thin films against indium (In) diffusion...in situ...annealing. Specific multilayered s...

A. Le Priol; E. Le Bourhis; P.-O. Renault; P. Muller…

2014-03-01T23:59:59.000Z

15

Economically rational expectations theory: evidence from the WTI oil price survey data  

E-Print Network [OSTI]

Economically rational expectations theory: evidence from the WTI oil price survey data Georges PRAT are not conclusive regarding this hypothesis. Moosa and Al- Loughani (1994) find that futures prices on the WTI of whether or not expectations are rational unsolved. Using private WTI oil price expectations revealed

Paris-Sud XI, Université de

16

WTI Crude Oil Price: Base Case and 95% Confidence Interval  

Gasoline and Diesel Fuel Update (EIA)

7 7 Notes: Spot WTI prices broke $35 and even $36 per barrel in November as anticipated boosts to world supply from OPEC and other sources failed to find much realization in actual stocks data. The idea that stocks are still languishing at below-normal levels is particularly persuasive when one views current levels (for key consuming regions) relative to "normal" values which account for the long-term trend in OECD stocks. We believe that monthly average WTI prices will stay around $30 per barrel for the first part of 2001. This is a noticeable upward shift in our projected average prices from even a month ago. The shift reflects greater emphasis on the lack of stock builds and less emphasis on the assumption that supply from OPEC and non-OPEC suppliers may be exceeding demand by 1-2

17

Minimum variance hedging with bivariate regime-switching model for WTI crude oil  

Science Journals Connector (OSTI)

This paper proposes a four-regime bivariate Markov regime-switching model to estimate the daily time-varying minimum variance hedge ratios for West Texas Intermediate (WTI) crude oil, and evaluates its in- and out-of-sample hedging performances with two-regime model, CC-GARCH, TVC-GARCH, and OLS models. Empirical results reveal that the four-regime Markov switching model outperforms the other models for both in- and out-of-sample hedging performance. Based on Hansen’s SPA test (2005), the four-regime model significantly outperforms the other models for only in-sample hedging.

Jui-Cheng Hung; Yi-Hsien Wang; Matthew C. Chang; Kuang-Hsun Shih; Hsiu-Hsueh Kao

2011-01-01T23:59:59.000Z

18

Discrete Time Approximation and Monte-Carlo Simulation of Backward Stochastic Differential Equations  

E-Print Network [OSTI]

, ~Z ti-1 )(ti - ti-1) - ~Zti-1 · (Wti - Wti-1 ) , together with the final data ~Y tn = g(X tn-time approximation (Y , Z) : Y tn = g X tn , Z ti-1 = (ti - ti-1)-1 E Y ti (Wti - Wti-1 )|Fti-1 Y ti-1 = E Y ti expectations, involved in the above discretization scheme, reduce to the regression of Y ti and Y ti (Wti

Touzi, Nizar

19

WTI Crude Oil Price: Base Case and 95% Confidence Interval  

Gasoline and Diesel Fuel Update (EIA)

9 9 Notes: Spot WTI prices broke $35 and even $36 per barrel in November as anticipated boosts to world supply from OPEC and other sources did not show up in actual stocks data. The recent decline in prices seems to be more the result of an unraveling of speculative pressures than a change in underlying fundamentals. Prices had been running higher than supply/demand fundamentals would have indicated throughout the fall months as a result of rising Mideast tensions, concern over the adequacy of distillate supplies, and expectations of Iraqi supply interruptions. But Mideast tensions seemed to ease in December and the market appeared to perceive a quick return of Iraqi crude oil supplies at full capacity. Pledges by Saudi Arabia/OPEC to offset a longer term Iraqi

20

WTI Crude Oil Price: Base Case and 95% Confidence Interval  

Gasoline and Diesel Fuel Update (EIA)

6 6 Notes: Spot WTI crude oil prices broke $35 and even $36 per barrel in November as anticipated boosts to world supply from OPEC and other sources did not show up in actual stocks data. The recent decline in prices seems to be more the result of an unraveling of speculative pressures than a change in underlying fundamentals. Prices had been running higher than supply/demand fundamentals would have indicated throughout the fall months as a result of rising Mideast tensions, concern over the adequacy of distillate supplies, and expectations of Iraqi supply interruptions. But Mideast tensions seemed to ease in December and the market appeared to perceive a quick return of Iraqi crude oil supplies at full capacity. Pledges by Saudi Arabia/OPEC to offset a longer term Iraqi

Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

Can GARCH-class models capture long memory in WTI crude oil markets?  

Science Journals Connector (OSTI)

This paper investigates the issue whether GARCH-type models can well capture the long memory widely existed in the volatility of WTI crude oil returns. In this frame, we model the volatility of spot and futures returns employing several GARCH-class models. Then, using two non-parametric methods, detrended fluctuation analysis (DFA) and rescaled range analysis (R/S), we compare the long memory properties of conditional volatility series obtained from GARCH-class models to that of actual volatility series. Our results show that GARCH-class models can well capture the long memory properties for the time scale larger than a year. However, for the time scale smaller than a year, the GARCH-class models are misspecified.

Yudong Wang; Chongfeng Wu; Yu Wei

2011-01-01T23:59:59.000Z

22

Evaluation of the composition and morphology of a WTi/Si system processed by a picosecond laser  

Science Journals Connector (OSTI)

In this work we studied the influence of laser radiation on the composition, structure and morphology of WTi thin films deposited on n-type (100...2...were found to be sufficient for modification of the WTi/silic...

Suzana Petrovi?; D. Peruško; I. Radovi?-Bogdanovi?…

2012-06-01T23:59:59.000Z

23

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incineration facility (East Liverpool, Ohio). Volume 2. Introduction  

SciTech Connect (OSTI)

Contents: Overview; Facility Background; Risk Assessment History at WTI; Peer Review Comments and Key Assumptions; and References.

NONE

1997-05-01T23:59:59.000Z

24

Wear behaviour of tool steels with added (WTi)C particles  

Science Journals Connector (OSTI)

The volume fraction of hard second phase particles in tool steels is limited by the formation of large interconnected carbides on solidification that embrittle the alloy. In this work, a novel carbide master alloy, FeWTiC, which contains (WTi)C particles, was used to increase the volume fraction of carbide in an H21 hot work die steel (0.3%C, 9%W, 3%Cr). Additions of up to 5 vol.% (WTi)C were successfully made to the vacuum melted steel, producing a homogeneous distribution of (WTi)C throughout the microstructure. TEM and fracture testing confirmed that a good bond existed between the (WTi)C and martensitic matrix. Wear testing was undertaken using pure sliding against an M2 tool steel counterface, in a block on ring configuration, in the load range of 54–254 N and a sliding speed of 0.98 m/s. At 54 N, an increase in volume fraction of (WTi)C gave a reduction in wear coefficient, associated with predominantly oxidational wear, with associated ploughing of the tool steel surface by oxide particles. At higher loads the addition of (WTi)C did not result in reduced wear rates. In addition to oxidational wear, delamination occurred, frequently initiated at the matrix/M6C particle interface. Fracture of the (WTi)C became more common as the load increased. A 1% (WTi)C marginally reduced the depth of deformation compared to the H21, but further additions had little additional effect. Detailed TEM indicated the complex interaction between oxide formation and surface deformation of the tool steel. The relationship between wear mechanism and microstructure is discussed.

A.J. Leonard; W.M. Rainforth

2003-01-01T23:59:59.000Z

25

Composition and structure modification of a WTi/Si system by short laser pulses  

Science Journals Connector (OSTI)

Picosecond (40 ps) pulsed Nd:YAG laser irradiation of a WTi thin film on silicon with a wavelength...2...was performed in air. This led to significant changes of the chemical composition and morphology on the sur...

S. Petrovi?; B. Gakovi?; D. Peruško; B. Radak; T. Desai; J. Kova?…

2010-03-01T23:59:59.000Z

26

Chemical and structural modifications of laser treated WTi surfaces at different ambient conditions  

Science Journals Connector (OSTI)

In this work we have studied the influence of laser modification on the composition and structure of tungsten titanium (WTi) thin films, deposited on n...-type (100) silicon wafers. After deposition, the samples ...

S. Petrovi?; D. Peruško; D. Milovanovi?; Z. Siketi?; M. Jakši?…

2011-11-01T23:59:59.000Z

27

Auto-correlated behavior of WTI crude oil volatilities: A multiscale perspective  

Science Journals Connector (OSTI)

In this paper, we investigate the long-range auto-correlated behavior of WTI crude oil volatility series employing multifractal detrended fluctuation analysis. Our findings show that the for small time scales, the auto-correlations of volatilities were multifractal while for large time scales, the auto-correlations were nearly monofractal. Based on multiscale analysis, we also investigate the dynamics of auto-correlations for different intervals of time scales and find that several shocks could make significant effects on the auto-correlated behaviors for small time scales. Analyzing the dynamics of multifractality degrees of auto-correlations for small time scales, we find that the stronger auto-correlations were always related to the lower degrees of multifractality. At last, we have discussions on the determination factors of price behavior, the predictive implications of scaling behavior in volatilities for oil markets and the reasons why long-range auto-correlations of volatility were always strong for both small time scales and large time scales. Our results are very important theoretically and practically.

Yudong Wang; Yu Wei; Chongfeng Wu

2010-01-01T23:59:59.000Z

28

Influence of target structure on film stress in WTi sputtering  

SciTech Connect (OSTI)

In this report, the effect of sputtering target microstructure on the deposited film stress was investigated. By controlling the metallurgical process, two types of W-10wt%Ti target constituents, namely single-phase and multiple-phase WTi, were prepared. The former one was composed of W-rich ({beta}Ti,W) phase only, the latter one was with W, W-rich ({beta}Ti,W) and Ti-rich ({beta}Ti,W) phases. The stress of the films deposited on 12.7 cm diameter silicon oxide wafers from the single-phase target tends to be more compressive than that from the multiple-phase target. By increasing wafer temperature, the compressive stress was linearly decreased. In addition, the level of film stress was also affected by the film thickness and other sputtering parameters. To understand the causes for the differences in film stress between the multiple-phase and single-phase derived films, an evaluation of the film structure using a field-emission scanning electron microscope (FE-SEM) and mechanical testing using a nano-indentation instrument were performed. Finer domains with denser laminar structure were observed on the films deposited from the single-phase target. However, no significant difference in mechanical properties was found between these two from the nano-indentation measurements. It is envisioned that the more uniform solid solution between the W and Ti in the films obtained by sputtering the single-phase targets generates a higher compressive stress when deposited on the silicon oxide wafers resulting in a higher compressive stress.

Lo, C.F.; Wang, H.; Gilman, P. [Materials Research Corp., Orangeburg, NY (United States)

1998-12-31T23:59:59.000Z

29

Influence of a d.c. substrate bias on the resistivity, composition, crystallite size and microstrain of \\{WTi\\} and WTi-N films  

Science Journals Connector (OSTI)

The influence of a d.c. substrate bias on the properties of \\{WTi\\} and WTi-N films deposited by r.f. magnetron sputtering has been studied. The bias voltage was varied from 0 to ?200 V. The \\{WTi\\} films structure is b.c.c. W with the presence of the h.c.p. Ti phase at low bias (0 to ?50 V). For the WTi-N films, the structure is f.c.c. TiN at low bias and b.c.c. W + f.c.c. TiN at high bias (?100 V to ?200 V). Both films exhibit the columnar morphology. The titanium fraction in the films is lower than in the target and decreases when the bias increases owing to a titanium preferential resputtering caused by the ion bombardment of the substrate. The same behaviour is found for the film resistivity which diminishes when the bias is increased whereas the crystallite size increases. The microstrains have a more complex variation with the bias.

H. Ramarotafika; G. Lemperiere

1995-01-01T23:59:59.000Z

30

Microsoft PowerPoint - uncertainty_wti_2011_2012.ppt [Compatibility Mode]  

Gasoline and Diesel Fuel Update (EIA)

1 1 - December 2012 January 2011 December 2012 Historical WTI price and 95% NYMEX Confidence Interval, January 2011 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 1 2010 2010 2011 2011 2012 2012 2013 2013 Historical WTI price and 95% NYMEX Confidence Interval, February 2011 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 2 2010 2010 2011 2011 2012 2012 2013 2013 Historical WTI price and 95% NYMEX Confidence Interval, March 2011 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 3 2010 2010 2011 2011 2012 2012 2013 2013 Historical WTI price and 95% NYMEX Confidence Interval, April 2011 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 4 2010 2010 2011 2011 2012 2012 2013 2013 Historical WTI price and 95% NYMEX Confidence Interval, May 2011 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 5

31

Microsoft PowerPoint - uncertainty_wti_2009_2010.ppt [Compatibility Mode]  

Gasoline and Diesel Fuel Update (EIA)

09 09 - December 2010 January 2009 December 2010 Historical WTI price and 95% NYMEX Confidence Interval, January 2009 $180 $200 $120 $140 $160 $80 $100 $120 $20 $40 $60 $0 $20 Jan Jul Jan Jul Jan Jul Jan Jul 1 2008 2008 2009 2009 2010 2010 2011 2011 Historical WTI price and 95% NYMEX Confidence Interval, February 2009 $180 $200 $120 $140 $160 $80 $100 $120 $20 $40 $60 $0 $20 Jan Jul Jan Jul Jan Jul Jan Jul 2 2008 2008 2009 2009 2010 2010 2011 2011 Historical WTI price and 95% NYMEX Confidence Interval, March 2009 $180 $200 $120 $140 $160 $80 $100 $120 $20 $40 $60 $0 $20 Jan Jul Jan Jul Jan Jul Jan Jul 3 2008 2008 2009 2009 2010 2010 2011 2011 Historical WTI price and 95% NYMEX Confidence Interval, April 2009 $180 $200 $120 $140 $160 $80 $100 $120 $20 $40 $60 $0 $20 Jan Jul Jan Jul Jan Jul Jan Jul 4 2008 2008 2009 2009 2010 2010 2011 2011 Historical WTI price and 95% NYMEX

32

Microsoft PowerPoint - uncertainty_past_wti.ppt [Compatibility Mode]  

Gasoline and Diesel Fuel Update (EIA)

3 3 - January 2014 January 2013 January 2014 Historical WTI price and 95% NYMEX Confidence Interval, January 2013 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 1 2012 2012 2013 2013 2014 2014 2015 2015 Historical WTI price and 95% NYMEX Confidence Interval, February 2013 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 2 2012 2012 2013 2013 2014 2014 2015 2015 Historical WTI price and 95% NYMEX Confidence Interval, March 2013 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 3 2012 2012 2013 2013 2014 2014 2015 2015 Historical WTI price and 95% NYMEX Confidence Interval, April 2013 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 4 2012 2012 2013 2013 2014 2014 2015 2015 Historical WTI price and 95% NYMEX Confidence Interval, May 2013 $250 $150 $200 $100 $150 $50 $0 Jan Jul Jan Jul Jan Jul Jan Jul 5 2012

33

Testing the weak-form efficiency of the WTI crude oil futures market  

Science Journals Connector (OSTI)

Abstract The weak-form efficiency of energy futures markets has long been studied and empirical evidence suggests controversial conclusions. In this work, nonparametric methods are adopted to estimate the Hurst indexes of the WTI crude oil futures prices (1983–2012) and a strict statistical test in the spirit of bootstrapping is put forward to verify the weak-form market efficiency hypothesis. The results show that the crude oil futures market is efficient when the whole period is considered. When the whole series is divided into three sub-series separated by the outbreaks of the Gulf War and the Iraq War, it is found that the Gulf War reduced the efficiency of the market. If the sample is split into two sub-series based on the signing date of the North American Free Trade Agreement, the market is found to be inefficient in the sub-periods during which the Gulf War broke out. The same analysis on short-time series in moving windows shows that the market is inefficient only when some turbulent events occur, such as the oil price crash in 1985, the Gulf war, and the oil price crash in 2008.

Zhi-Qiang Jiang; Wen-Jie Xie; Wei-Xing Zhou

2014-01-01T23:59:59.000Z

34

Causality and volatility spillovers among petroleum prices of WTI, gasoline and heating oil in different locations  

Science Journals Connector (OSTI)

This paper examines the time series properties of daily spot and futures prices for three petroleum types traded at five commodity centers within and outside the United States. Examining five combinations of the spot and futures prices by petroleum type and trading center, the cointegration tests of each of these five groups suggest that spot and futures contracts offer little room for long-run commodity portfolio diversification. In the West Texas Intermediate (WTI) crude-oil group, the VEC model indicates that the New York Mercantile Exchange (NYMEX) 1-month futures price has the upper hand in terms of directional causality and volatility spillovers. In the NYMEX gasoline system, there are bi-directional causality relationships among all the gasoline spot and futures prices, but the spot price produces the greatest spillover. In the NYMEX heating oil system, information transmission and predictability among the spot, 1- and 3-month futures are found to be particularly strong and significant. In the international gasoline spot market, contrary to the world crude-oil market, there is no apparent world gasoline spot leader for the gasoline spot prices.

Shawkat Hammoudeh; Huimin Li; Bang Jeon

2003-01-01T23:59:59.000Z

35

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incinerator facility (east Liverpool, Ohio)  

SciTech Connect (OSTI)

The report constitutes a comprehensive site-specific risk assessment for the WTI incineration facility located in East Liverpool, OH. Volume I is a description of the components and methodologies used in the risk assessment and provides a summary of the major results from the three components of the assessment.

NONE

1995-11-01T23:59:59.000Z

36

Effects of the pulse duration in laser modification of nano-sized WTi film on Si  

Science Journals Connector (OSTI)

A study of morphological and composition changes of the WTi/Si system induced by nanosecond and picosecond laser pulses is presented. A 190 nm thick WTi film was deposited on a silicon substrate of n-type (100). The pulsed laser systems used were: nanosecond TEA CO2 laser (emission, 10.6 µm; pulse FWHM; pulse duration 120 ns) and picosecond Nd:YAG laser (emission, 532 nm; pulse FWHM; pulse duration 40 ps). During experiments the used fluences (?) had similar values, ?1 = 20 J  cm ? 2 in case of the TEA CO2 laser and ?2 = 16 J cm ? 2 for the Nd:YAG laser. The laser-induced morphological and composition modifications showed a dependence on pulse duration. Generally, the following morphological changes were observed: (i) ablation/exfoliation of the WTi thin film, (ii) appearance of hydrodynamic features such as resolidified material, and (iii) formation of nano-sized grains and globules. Overall morphological modifications were more pronounced after the picosecond laser action. The surface composition analysis showed a quite different distribution of sample components depending on the pulse duration. Formation of the silicon dioxide (SiO2) was recorded only in the case of irradiation of the WTi/Si system by picosecond laser pulses.

Suzana Petrovi?; D Peruško; D Milovanovi?; J Kova?; M ?ekada; P Panjan; B Gakovi?; M Trtica

2010-01-01T23:59:59.000Z

37

Speculative trading and oil price dynamic: A study of the WTI market  

Science Journals Connector (OSTI)

The aim of this paper is to study the oil price dynamic in West Texas Intermediate (WTI) market in the US. By using statistical and econometric tools, we first attempt to identify the long term relationship between WTI spot prices and the prices of futures contracts on the New York Mercantile Exchange (NYMEX). Subsequently we model the short term dynamic between these two prices and this analysis points up several breaks. On this basis, a short term Markov Switching Vectorial Error Correction model (MS-VECM) with two distinct states (standard state and crisis state) has been estimated. Finally we introduce the volumes of transactions observed on the NYMEX for the WTI contracts and we estimate the influence of the non-commercial players. We conclude that the hypothesis of an influence of non-commercial players on the probability for being in the crisis state cannot be rejected. In addition, we show that the rise in liquidity of the first financial contracts, as measured by the volume of open interest, is a key element to understand the dynamics in market prices.

Emmanuel Hache; Frédéric Lantz

2013-01-01T23:59:59.000Z

38

Structure-stress-resistivity relationship in WTi alloy ultra-thin and thin films prepared by magnetron sputtering  

Science Journals Connector (OSTI)

WTi thin films were prepared from an alloyed target (W:Ti ? 70:30?at. %) by magnetron sputtering. Body-centered cubic W x T i 1 ? x solid solutions with a { 110 } fiber texture and columnar grains have been produced with 0.75 WTi thin films is about 60 ? 200 ? ? ? ? cm depending on the film thickness and microstructure (sputtering conditions). For both ultra-thin (9.5?nm) and thin (180?nm) films a stress transition from compressive to tensile is observed as the working pressure increases. The process-structure-property relations of the WTi ultra-thin and thin films are discussed in relation with the state of the art.

P.-O. Renault

2013-01-01T23:59:59.000Z

39

Estimating ocean wave directional spreading from an Eulerian surface elevation time history  

Science Journals Connector (OSTI)

...an Eulerian surface elevation time history T. A. A. Adcock * P. H. Taylor...st-peters.oxon.org ). Department of Engineering Science, University of Oxford...information available is the time history of free surface elevation at a single...

2009-01-01T23:59:59.000Z

40

Modeling dynamic conditional correlations in WTI oil forward and futures returns  

Science Journals Connector (OSTI)

This paper estimates the dynamic conditional correlations in the daily returns on West Texas Intermediate (WTI) oil forward and futures prices from 3 January 1985 to 16 January 2004, using recently developed multivariate conditional volatility models. We find that the dynamic conditional correlations can vary dramatically, being negative in four of ten cases and being close to zero in another five cases. Only in the case of the dynamic volatilities of the three-month and six-month futures returns is the range of variation relatively narrow, namely (0.832, 0.996).

Alessandro Lanza; Matteo Manera; Michael McAleer

2006-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

Spark Spread  

Gasoline and Diesel Fuel Update (EIA)

Spark Spread Spark Spread Figure 1 Source: U.S. Energy Information Administration, based on SNL Energy. The spark spread is a common metric for estimating the profitability of natural gas-fired electric generators. The spark spread is the difference between the price received by a generator for electricity produced and the cost of the natural gas needed to produce that electricity. It is typically calculated using daily spot prices for natural gas and power at various regional trading points. The chart above shows spark spreads during 2012, calculated for four locations around the United States. Spark spreads tend to be fairly volatile, more so than crack spreads in petroleum markets, largely because of the volatility of wholesale electric power prices, which vary widely

42

Treatment of \\{WTi\\} Contacts on silicon with low energy argon ions  

Science Journals Connector (OSTI)

Thin layers of \\{WTi\\} were deposited by ion sputtering on p- and n-type Si(111) substrates. The initial target composition is 90: 10 W: Ti, the thicknesses of the layers were 200 and 350 nm, and the layers were grown at a rate of 10 nm min?1. After deposition, the contacts were bombarded by backsputtering with Ar+ ions at 3.5 keV. The as-deposited layers from a surface barrier on both substrates (0.62 V on n-Si and 0.66 V on p-Si). During ion bombardment, to doses from 0.5 × 1018 to 5 × 1018 ions cm?2, the barrier is reduced until the contacts become non-rectifying. The main effect during bombardment is sputtering and development of topography (scanning electron microscopy analysis), but there is also a shallow mixing at the interface (as shown by Rutherford backscattering and X-ray analyses). During annealing at 800 °C, pronounced metal-silicon interdiffusion is observed in bombarded specimens and not in unbombarded specimens. So-formed silicides renew the rectifying properties of \\{WTi\\} contacts, with an effective barrier height of 0.66–0.69 V on n-Si.

M. Milosavljevi?; N. Bibi?; I.H. Wilson; D. Peruško

1988-01-01T23:59:59.000Z

43

Report on the technical workshop on WTI incinerator risk issues. Held in Washington, DC on December 8-9, 1993  

SciTech Connect (OSTI)

The report includes information and materials from a peer review workshop organized by EPA's Risk Assessment Forum (RAF) for the Office of Solid Waste and Emergency Response and Region 5. The meeting was held in Washington, DC, at the Holiday Inn Capitol on December 8-9, 1993. The subject of the peer review was a draft project plan prepared by EPA Region 5 for assessing risk at an incinerator operated by Waste Technologies Industries (WTI) in East Liverpool, Ohio. The peer review panel was convened to evaluate the project plan as the scientific foundation for a risk assessment, which will be used in setting final permit conditions for the WTI facility.

Not Available

1993-12-01T23:59:59.000Z

44

The effect of the financial sector on the evolution of oil prices: Analysis of the contribution of the futures market to the price discovery process in the WTI spot market  

Science Journals Connector (OSTI)

The aim of this article is to empirically measure the contribution of the futures market to the price discovery process in the spot market for benchmark crude oils, specifically that for West Texas Intermediate (WTI). For this purpose, we test the hypothesis that the recent evolution of the financial markets has affected the future oil market so as to increase its contribution to the price discovery process of the spot market. We modeled the relation between WTI spot and future prices as a cointegration relation. By using the Kalman filter technique, it was possible to obtain a time-varying measure of the contribution of future markets to the price discovery mechanism. The results show that in the case of WTI, the contribution of the futures market has been increasing, especially between 2003 and 2008 and then again after the start of 2009, evidencing the growing importance of factors particular to the financial markets in determining oil prices in recent years. During 2009, the spot prices adjusted to agents' future expectations rather than to the current supply and demand conditions.

Renan Silvério; Alexandre Szklo

2012-01-01T23:59:59.000Z

45

WTI Crude Oil Prices Are Expected To Remain Relatively High Through At  

Gasoline and Diesel Fuel Update (EIA)

5 5 Notes: As we just saw, one of the primary factors impacting gasoline price is the crude oil price. This graph shows monthly average spot West Texas Intermediate crude oil prices. Spot WTI crude oil prices broke $36 per barrel in November briefly as anticipated boosts to world supply from OPEC and other sources did not show up in actual stocks data. Crude oil prices are expected to be about $30 per barrel for the rest of this year, but note the uncertainty bands on this projection. They give an indication of how difficult it is to know what these prices are going to do. Also, EIA does not forecast volatility. This relatively flat forecast could be correct on average, with wide swings around the base line. With the EIA forecast for crude prices staying high this year,

46

Surface modification of a \\{WTi\\} thin film on Si substrate by nanosecond laser pulses  

Science Journals Connector (OSTI)

Interaction of a nanosecond transversely excited atmospheric (TEA) CO2 laser, operating at 10.6 ?m, with tungsten–titanium thin film (190 nm) deposited on silicon of n-type (1 0 0) orientation, was studied. Multi-pulse irradiation was performed in air atmosphere with laser energy densities in the range 24–49 J/cm2. The energy absorbed from the laser beam was mainly converted to thermal energy, which generated a series of effects. The following morphological changes were observed: (i) partial ablation/exfoliation of the \\{WTi\\} thin film, (ii) partial modification of the silicon substrate with formation of polygonal grains, (iii) appearance of hydrodynamic features including nano-globules. Torch-like plumes started appearing in front of the target after several laser pulses.

S. Petrovi?; B. Gakovi?; D. Peruško; M. Trtica; B. Radak; P. Panjan; Š. Miljani?

2008-01-01T23:59:59.000Z

47

Hybrid spread spectrum radio system  

DOE Patents [OSTI]

Systems and methods are described for hybrid spread spectrum radio systems. A method, includes receiving a hybrid spread spectrum signal including: fast frequency hopping demodulating and direct sequence demodulating a direct sequence spread spectrum signal, wherein multiple frequency hops occur within a single data-bit time and each bit is represented by chip transmissions at multiple frequencies.

Smith, Stephen F. (London, TN) [London, TN; Dress, William B. (Camas, WA) [Camas, WA

2010-02-09T23:59:59.000Z

48

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incinerator facility (east Liverpool, Ohio). Volume 3. Characterization of the nature and magnitude of emissions. Draft report  

SciTech Connect (OSTI)

This report constitutes a comprehensive site-specific risk assessment for the WTI incineration facility located in East Liverpool, OH. Volume III of the report describes the methods used to estimate both stack and fugitive emission rates from the facility.

NONE

1995-11-01T23:59:59.000Z

49

Steady State Crustal Spreading  

Science Journals Connector (OSTI)

... form at the axis of a mid-ocean ridge and ride down the continuously foundering "conveyor belt" toward the abyssal plains2. As soon, as vulcanism ceases, wave erosion begins ... ascended mantle material spreading from the axis of a ridge, the sinking rate of a parcel of oceanic crust may be only a function of time after extrusion. In that ...

PETER R. VOGT; NED A. OSTENSO

1967-08-19T23:59:59.000Z

50

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incinerator facility (east Liverpool, Ohio). Volume 1. Executive summary. Draft report  

SciTech Connect (OSTI)

This report constitutes a comprehensive site-specific risk assessment for the WTI incineration facility located in East Liverpool, OH. Volume I is a description of the components and methodologies used in the risk assessment and provides a summary of the major results from the three components of the assessment.

NONE

1995-11-01T23:59:59.000Z

51

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incinerator facility (east Liverpool, Ohio). Volume 4. Atmospheric dispersion and deposition modeling of emissions. Draft report  

SciTech Connect (OSTI)

The report constitutes a comprehensive site-specific risk assessment for the WTI incineration facility located in East Liverpool, OH. Volume IV describes the air dispersion model used to estimate air concentrations and particle deposition, as well as the results of the modeling exercise.

NONE

1995-11-01T23:59:59.000Z

52

Multi-start iterated local search for the periodic vehicle routing problem with time windows and time spread constraints on services  

Science Journals Connector (OSTI)

In the field of high-value shipment transportation, companies are faced to the malevolence problem. The risk of ambush increases with the predictability of vehicle routes. This paper addresses a very hard periodic vehicle routing problem with time windows, ... Keywords: Iterated local search, Periodic vehicle routing, Security constraints, Time window

Julien Michallet; Christian Prins; Lionel Amodeo; Farouk Yalaoui; Grégoire Vitry

2014-01-01T23:59:59.000Z

53

Report on the US EPA technical workshop on WTI incinerator risk assessment issues. Held in Washington, DC on January 11, 1996  

SciTech Connect (OSTI)

This report presents information and materials from a peer review workshop organized by EPA`s Risk Assessment Forum for Region 5 and the Office of Solid Waste and Emergency Response. The subject of the peer review was a draft document prepared by Region 5 assessing risk at an incinerator operated by Waste Technologies Industries (WTI) in East Liverpool, Ohio. This report summarizes the discussions that took place at the peer review workshop. The report opens with an overview of the workshop and a history of EPA`s WTI incinerator risk assessment activities (section 1), then presents the chairperson`s summary (section 2) and the five work group chairs` summaries (section 3). The body of the report ends with highlights of the peer reviewers` preliminary comments and of the comments offered by workshop observers (section 4).

NONE

1996-05-01T23:59:59.000Z

54

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incineration facility (East Liverpool, Ohio). Volume 6. Screening ecological risk assessment  

SciTech Connect (OSTI)

The Screening Ecological Risk Assessment (SERA) includes an evaluation of available biotic information from the site vicinity to provide a preliminary description of potential ecological receptors (e.g., rare, threatened and endangered species; migratory birds; and important game species), and important ecological habitats (e.g., wetland areas). A conceptual site model is developed that describe show stressors associated with the WTI facility might affect the ecological components in the surrounding environment through the development and evaluation of specific ecological endpoints. Finally, an estimate of the potential for current and/or future adverse impacts to the biotic component of the environment is provided, based on the integration of potential exposures of ecological receptors to WTI emissions and toxicological threshold values.

NONE

1997-05-01T23:59:59.000Z

55

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incinerator facility (east Liverpool, Ohio). Volume 7. Accident analysis: Selection and assessment of potential release scenarios. Draft report  

SciTech Connect (OSTI)

This report constitutes a comprehensive site-specific risk assessment for the WTI incineration facility located in East Liverpool, OH. The Accident Analysis is an evaluation of the likelihood of occurrence and resulting consequences from several general classes of accidents that could potentially occur during operation of the facility. The Accident Analysis also evaluates the effectiveness of existing mitigation measures in reducing off-site impacts. Volume VII describes in detail the methods used to conduct the Accident Analysis and reports the results of evaluations of likelihood and consequence for the selected accident scenarios.

NONE

1995-11-01T23:59:59.000Z

56

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incinerator facility (east Liverpool, Ohio). Volume 6. Screening ecological risk assessment (SERA). Draft report  

SciTech Connect (OSTI)

This report constitutes a comprehensive site-specific risk assessment for the WTI incineration facility located in East Liverpool, OH. The Screening Ecological Risk Assessment (SERA) is an analysis of the potential significance of risks to ecological receptors (e.g., plants, fish, wildlife) from exposure to facility emissions. The SERA was performed using conservative assumptions and approaches to determine if a further, more refined analysis is warranted. Volume VI describes in detail the methods used in the SERA and reports the results of the SERA in terms of site-specific risks to ecological receptors.

NONE

1995-11-01T23:59:59.000Z

57

Dynamics of Information Spreading in Online Social Networks  

E-Print Network [OSTI]

Online social networks (OSNs) are changing the way information spreads throughout the Internet. A deep understanding of information spreading in OSNs leads to both social and commercial benefits. In this paper, dynamics of information spreading (e.g., how fast and widely the information spreads against time) in OSNs are characterized, and a general and accurate model based on Interactive Markov Chains (IMCs) and mean-field theory is established. This model shows tight relations between network topology and information spreading in OSNs, e.g., the information spreading ability is positively related to the heterogeneity of degree distributions whereas negatively related to the degree-degree correlations in general. Further, the model is extended to feature the time-varying user behavior and the ever-changing information popularity. By leveraging the mean-field theory, the model is able to characterize the complicated information spreading process (e.g., the dynamic patterns of information spreading) with six pa...

Zhang, Sai; Chen, Xi; Liu, Xue

2014-01-01T23:59:59.000Z

58

Quantitative Spreading Kinetics of a Three Molecular Layer Liquid Patch  

Science Journals Connector (OSTI)

Quantitative Spreading Kinetics of a Three Molecular Layer Liquid Patch ... The late stage kinetics of the spreading of a smectic nanodrop on a solid surface was investigated by direct and real time imaging of a three molecular layer patch using the SEEC microscopy. ... (15) At some stage of the spreading kinetics, the structure reduces to a single bilayer patch lying on the surface monolayer. ...

Olivier Noel; Jean-Luc Buraud; Laurent Berger; Dominique Ausserre?

2010-03-19T23:59:59.000Z

59

Characterization of Ti diffusion in PVD deposited WTi/AlCu metallization on monocrystalline Si by means of secondary ion mass spectroscopy  

Science Journals Connector (OSTI)

The diffusion behavior of Titanium in Al0.5Cu/W18Ti (at.%) metallization stacks on monocrystalline Silicon has been investigated. The metallization system was prepared by in situ sputtering deposition. It is demonstrated that \\{WTi\\} is not stable as a diffusion barrier between Al0.5Cu and Si in temperature ranges between 623 K and 673 K due to Ti depletion. The Ti diffusion in Al0.5Cu is characterized by diffusion profiles prepared by secondary ion mass spectroscopy after annealing. The activation energy derived from this data is 2.28 eV for Ti diffusion into Al0.5Cu. The causal chain of detecting this behavior is described application-oriented.

M. Plappert; O. Humbel; A. Koprowski; M. Nowottnick

2012-01-01T23:59:59.000Z

60

Hybrid spread spectrum radio system  

DOE Patents [OSTI]

Systems and methods are described for hybrid spread spectrum radio systems. A method includes modulating a signal by utilizing a subset of bits from a pseudo-random code generator to control an amplification circuit that provides a gain to the signal. Another method includes: modulating a signal by utilizing a subset of bits from a pseudo-random code generator to control a fast hopping frequency synthesizer; and fast frequency hopping the signal with the fast hopping frequency synthesizer, wherein multiple frequency hops occur within a single data-bit time.

Smith, Stephen F. (London, TN); Dress, William B. (Camas, WA)

2010-02-02T23:59:59.000Z

Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

EIND510 Usability Engineering C:\\NWARD Dell Laptop\\WTI_MSU\\Teaching\\EIND510 Usability Engineering\\EIND510\\EIND510 Fall 2011\\EIND510 syllabus Fall 2011.docx 1  

E-Print Network [OSTI]

of usability engineering across a range of product, service and system domains. #12;EIND510 ­ Usability usability analyses on products or services as part of a team-based usability engineering projectEIND510 ­ Usability Engineering C:\\NWARD Dell Laptop\\WTI_MSU\\Teaching\\EIND510 Usability Engineering

Dyer, Bill

62

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incinerator facility (east Liverpool, Ohio). Volume 5. Human health risk assessment (HHRA): Evaluation of potential risks from multipathway exposure to emissions. Draft report  

SciTech Connect (OSTI)

The Human Health Risk Assessment (HHRA) portion of the WTI Risk Assessment involves the integration of information about the facility with site-specific data for the surrounding region and population to characterize the potential human health risks due to emissions from the facility. The estimation of human health risks is comprised of the following general steps: (1) identification of substances of potential concern; (2) estimation of the nature and magnitude of chemical releases from the WTI facility; (3) prediction of the atmospheric transport of the emitted contaminants; (4) determination of the types of adverse effects associated with exposure to the substances of potential concern (referred to as hazard identification), and the relationship between the level of exposure and the severity of any health effect (referred to as dose-response assessment); (5) estimation of the magnitude of exposure (referred to as exposure assessment); and (6) characterization of the health risks associated with exposure (referred to as risk characterization).

NONE

1995-11-01T23:59:59.000Z

63

Real-Time thermal Ward-Takahashi Identity for vectorial current in QED and QCD  

E-Print Network [OSTI]

It is shown that, by means of canonical operator approach, the Ward-Takahashi identity (WTI) at finite temperature $T$ and finite chemical potential $\\mu$ for complete vectorial vertex and complete fermion propagator can be simply proven, rigorously for Quantum Electrodynamics (QED) and approximately for Quantum Chromodynamics (QCD) where the ghost effect in the fermion sector is neglected. The WTI shown in the real-time thermal matrix form will give definite thermal constraints on the imaginary part of inverse complete Feynman propagator including self-energy for fermion and will play important role in relevant physical processes. When the above inverse propagator is assumed to be real, the thermal WTI will essentially be reduced to its form at $T=\\mu=0$ thus one can use it in the latter's form. At this point, a practical example is indicated.

Zhou Bang-Rong

2005-12-05T23:59:59.000Z

64

Physical Market Conditions, Paper Market Activity,  

Gasoline and Diesel Fuel Update (EIA)

12 12 Physical Market Conditions, Paper Market Activity, and the WTI-Brent Spread Bahattin BĂĽyĂĽkĹźahin Thomas K. Lee James T. Moser Michel A. Robe* Abstract We document that, starting in the Fall of 2008, the benchmark West Texas Intermediate (WTI) crude oil has periodically traded at unheard of discounts to the corresponding Brent benchmark. We further document that this discount is not reflected in spreads between Brent and other benchmarks that are directly comparable to WTI. Drawing on extant models linking inventory conditions to the futures term structure, we test empirically several conjectures about how time and quality spreads (prompt vs. first-deferred WTI; prompt Brent vs. WTI)

65

Mobile Conductance and Gossip-based Information Spreading in Mobile Networks  

E-Print Network [OSTI]

Mobile Conductance and Gossip-based Information Spreading in Mobile Networks Huazi Zhang, Zhaoyang framework for information spreading in mobile networks based on a new performance metric, mobile conductance, which allows us to separate the details of mobility models from the study of mobile spreading time. We

Dai, Huaiyu

66

R.H. Shumway and D.S. Stoffer Time Series Analysis and Its Applications  

E-Print Network [OSTI]

.1) and below: Write wti instead of wit, and write cov(wti, wtj) instead of cov(wit, wjt) for consistency. · p

67

BROWNIAN MOTION INDEXED BY A TIME SCALE DAVID GROW AND SUMAN SANYAL  

E-Print Network [OSTI]

on the proba- bility space (C0[0, ), P) and the increments Wti - Wti-1 are normally distributed with mean zero

Sanyal, Suman

68

Discrete-time approximation of doubly reflected BSDEs Jean-Franois Chassagneux  

E-Print Network [OSTI]

} such that and define (Y , ÂŻZ) by the backward induction: ÂŻZ ti = (ti+1 - ti)-1 E (Wti+1 - Wti )(Y ti+1 ) | Fti

Paris-Sud XI, Université de

69

Spreading dynamics in complex networks  

Science Journals Connector (OSTI)

Searching for influential spreaders in complex networks is an issue of great significance for applications across various domains, ranging from epidemic control, innovation diffusion, viral marketing, and social movement to idea propagation. In this paper, we first display some of the most important theoretical models that describe spreading processes, and then discuss the problem of locating both the individual and multiple influential spreaders respectively. Recent approaches in these two topics are presented. For the identification of privileged single spreaders, we summarize several widely used centralities, such as degree, betweenness centrality, PageRank, k-shell, etc. We investigate the empirical diffusion data in a large scale online social community—LiveJournal. With this extensive dataset, we find that various measures can convey very distinct information of nodes. Of all the users in the LiveJournal social network, only a small fraction of them are involved in spreading. For the spreading processes in LiveJournal, while degree can locate nodes participating in information diffusion with higher probability, k-shell is more effective in finding nodes with a large influence. Our results should provide useful information for designing efficient spreading strategies in reality.

Sen Pei; Hernán A Makse

2013-01-01T23:59:59.000Z

70

Equatorial spread {ital F} effects on an HF path: Doppler spread, spatial coherence, and frequency coherence  

SciTech Connect (OSTI)

In August 1990 we participated in the Equatorial Ionospheric Studies sounding rocket campaign near Kwajalein Atoll in the equatorial Pacific region. The campaign included measurements of plasma density using rocket probes and coherent and incoherent scatter radar. During the campaign we fielded high-frequency ionospheric sounders over a bistatic path between Maloelap Atoll and Bikini Atoll in the Marshall Islands. The distance between the transmitters and receivers was 700 km; the ionospheric-reflection region was at 10.18; {degree}N, 168.40;{degree}E, near the magnetic equator. We made three types of measurements: Doppler spread and spatial coherence for a single-frequency CW path; frequency coherence of multiple CW paths; and Doppler spread and time-delay spread for a 60-kHz bandwidth path. We obtained such data over a period of 2 weeks for approximately 2 hours each evening; during this period spread {ital F} was common. Fifty percent of the evenings showed Doppler spread of greater than 6 Hz at the {minus}10 dB level (relative to the peak signal power) and greater than 15 Hz at the {minus}30 dB level. Forty percent of the evenings showed spatial coherence distance of less than 180 m in the direction normal to the bistatic path; 40{percent} of the evenings showed spatial coherence of less than 75 m in the direction parallel to the path. Seventy-five percent of the evenings showed coherence bandwidths of less than 1.5 kHz. {copyright} 1999 American Geophysical Union

Fitzgerald, T.J.; Argo, P.E.; Carlos, R.C. [Los Alamos National Laboratory, Los Alamos, New Mexico (United States)] [Los Alamos National Laboratory, Los Alamos, New Mexico (United States)

1999-01-01T23:59:59.000Z

71

Georgia Nonprofit Spreads the Word About Energy Efficiency | Department of  

Broader source: Energy.gov (indexed) [DOE]

Georgia Nonprofit Spreads the Word About Energy Efficiency Georgia Nonprofit Spreads the Word About Energy Efficiency Georgia Nonprofit Spreads the Word About Energy Efficiency January 12, 2010 - 3:25pm Addthis Eric Barendsen Energy Technology Program Specialist, Office of Energy Efficiency and Renewable Energy At a time of strapped budgets, service organizations that find ways to save money through energy efficiency will more easily meet their fundraising goals. CHRIS Kids, an Atlanta-based nonprofit that provides housing to disadvantaged young people, is taking that idea to the next level. By upgrading its buildings with the latest in high-efficiency technologies, the group will reap the rewards of increased energy savings and, at the same time, teach the next generation about energy-efficiency technologies and behaviors.

72

Gradual Spread of Market-Led Industrialization  

E-Print Network [OSTI]

Gradual Spread of Market-Led Industrialization Jeffrey D. Sachs and Xiaokai Yang CID Working Paper Paper no. 11 Gradual Spread of Market-Led Industrialization Jeffrey D. Sachs and Xiaokai Yang* Abstract the network effects of industrialization, though this function is not perfect. Hence, market led

73

3:2:1 Crack Spread  

Gasoline and Diesel Fuel Update (EIA)

:2:1 Crack Spread :2:1 Crack Spread Figure 1 Source: U.S. Energy Information Administration, based on Thomson Reuters. A crack spread measures the difference between the purchase price of crude oil and the selling price of finished products, such as gasoline and distillate fuel, that a refinery produces from the crude oil. Crack spreads are an indicator of the short-term profit margin of oil refineries because they compare the cost of the crude oil inputs to the wholesale, or spot, prices of the outputs (although they do not include other variable costs or any fixed costs). The 3:2:1 crack spread approximates the product yield at a typical U.S. refinery: for every three barrels of crude oil the refinery processes, it makes two barrels of gasoline and one barrel of distillate

74

Damage spreading in the Ising model  

Science Journals Connector (OSTI)

We present two interesting results regarding damage spreading in ferromagnetic Ising models. First, we show that a damage spreading transition can occur in an Ising chain that evolves in contact with a thermal reservoir. Damage heals at low temperature and spreads at high T. The dynamic rules for the system’s evolution for which such a transition is observed are as legitimate as the conventional rules (Glauber, Metropolis, heat bath). Our second result is that such transitions are not always in the directed percolation universality class.

Haye Hinrichsen and Eytan Domany

1997-07-01T23:59:59.000Z

75

Fire spread in concealed foamed plastic insulation  

Science Journals Connector (OSTI)

A test program, jointly sponsored by the Society of the Plastics Industry of Canada and the National Research Council, examined the contribution of plastic foams to fire spread in buildings. The conditions und...

Dr. W. Taylor

1983-08-01T23:59:59.000Z

76

A note on the effects of nonuniform spreading velocity of submarine slumps and slides on the near-eld tsunami amplitudes  

E-Print Network [OSTI]

A note on the effects of nonuniform spreading velocity of submarine slumps and slides on the near Accepted 9 February 2002 Abstract The effects of variable speeds of spreading of submarine slides slides and slumps must consider time variations in the spreading velocities, when these velocities

Southern California, University of

77

Relationships between HIV spread and evolution examined  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

3 » 3 » November » Relationships between HIV spread and evolution examined Relationships between HIV spread and evolution examined Thomas Leitner of LANL and collaborators are investigating the development of HIV from the point of contraction onwards. November 14, 2013 Scanning electron micrograph of HIV-1 budding (in green) from cultured lymphocytes. The image has been colored to highlight important features. Photo credit: C. Goldsmith, Centers for Disease Control and Prevention. Scanning electron micrograph of HIV-1 budding (in green) from cultured lymphocytes. The image has been colored to highlight important features. Photo credit: C. Goldsmith, Centers for Disease Control and Prevention. They are examining the relationships between the spread of the virus in a

78

Naturally Occurring Mutations in the WTI Gene  

Science Journals Connector (OSTI)

Dominant oncogenes, like myc or ras, confer a gain of func-tion to transformed cells.1,2 Gain-of-function mutations result in abnormal, positive signals for cell proliferation. In general, however, genetic altera...

Max J. Coppes M.D.; Ph.D.…

1995-01-01T23:59:59.000Z

79

Modeling the spread of bird flu and predicting outbreak diversity  

Science Journals Connector (OSTI)

Avian influenza, commonly known as bird flu, is an epidemic caused by H5N1 virus that primarily affects birds like chickens, wild water birds, etc. On rare occasions, these can infect other species including pigs and humans. In the span of less than a year, the lethal strain of bird flu is spreading very fast across the globe mainly in South East Asia, parts of Central Asia, Africa and Europe. In order to study the patterns of spread of epidemic, we made an investigation of outbreaks of the epidemic in one week, that is from February 13–18, 2006, when the deadly virus surfaced in India. We have designed a statistical transmission model of bird flu taking into account the factors that affect the epidemic transmission such as source of infection, social and natural factors and various control measures are suggested. For modeling the general intensity coefficient f ( r ) , we have implemented the recent ideas given in the article Fitting the Bill, Nature [R. Howlett, Fitting the bill, Nature 439 (2006) 402], which describes the geographical spread of epidemics due to transportation of poultry products. Our aim is to study the spread of avian influenza, both in time and space, to gain a better understanding of transmission mechanism. Our model yields satisfactory results as evidenced by the simulations and may be used for the prediction of future situations of epidemic for longer periods. We utilize real data at these various scales and our model allows one to generalize our predictions and make better suggestions for the control of this epidemic.

Ranjit Kumar Upadhyay; Nitu Kumari; V. Sree Hari Rao

2008-01-01T23:59:59.000Z

80

Spread of Detonation in High Explosives  

Science Journals Connector (OSTI)

... In a note1 on the spread of detonation in a mass of high explosive from the point of initiation, Weibull demonstrates that, ... initiation, Weibull demonstrates that, in a cylindrical cartridge of compressed T.N.T., detonation is propagated with a uniform and constant speed in all directions from the detonator. ...

DUGALD MITCHELL; STEWART PATERSON

1947-09-27T23:59:59.000Z

Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

Environmental performance indicators of organic spreading machines  

E-Print Network [OSTI]

industrial and agronomical databases but the LCA agricultural machinery database is not well adapted-03150 Montoldre, France 2 Chambre d'Agriculture de Bretagne, Station des Cormiers, F-35140 Saint Aubin impacts generated by organic product spreading is obtained from Life Cycle Assessment (LCA). LCA uses

Paris-Sud XI, Université de

82

Modeling of LNG Pool Spreading and Vaporization  

E-Print Network [OSTI]

.............................................................................. 20 CHAPTER III PREVIOUS EXPERIMENTS ON LNG POOL SPREADING .............. 22 3.1. Summary of Experiments on liquefied gases ................................................... 22 CHAPTER IV CURRENT STATE OF THE ART... of liquefied gases into bunds .................................................................... 23 Table 7: Experimental setup for bund experiments.......................................................... 23 Table 8: Spills of liquefied gases onto water...

Basha, Omar 1988-

2012-11-20T23:59:59.000Z

83

Discrete time approximation of decoupled Forward-Backward SDE with jumps  

E-Print Network [OSTI]

+ T n h X ti , ÂŻY ti , ÂŻZ ti where ÂŻY tn := g(X tn ) and Wi+1 := Wti+1 - Wti . In the no-jump case

Elie, Romuald

84

Energy Tax Credits: Secretary Chu is Spreading the Word, and You Should,  

Broader source: Energy.gov (indexed) [DOE]

Secretary Chu is Spreading the Word, and You Secretary Chu is Spreading the Word, and You Should, Too! Energy Tax Credits: Secretary Chu is Spreading the Word, and You Should, Too! March 29, 2010 - 7:30am Addthis Allison Casey Senior Communicator, NREL As we've mentioned many times on the Energy Savers blog, you can receive up to $1,500 in tax credits for home energy efficiency improvements like adding insulation, installing energy efficient windows, or replacing water heaters. If you're a regular reader, you know that we write about tax credits a lot. Our reasons are simple: we don't want you to forget that these credits are available, and we hope you'll help spread the word by sharing this info with your friends and family. (There are even some handy links at the bottom for you to send this article to your favorite social media

85

Energy Tax Credits: Secretary Chu is Spreading the Word, and You Should,  

Broader source: Energy.gov (indexed) [DOE]

Energy Tax Credits: Secretary Chu is Spreading the Word, and You Energy Tax Credits: Secretary Chu is Spreading the Word, and You Should, Too! Energy Tax Credits: Secretary Chu is Spreading the Word, and You Should, Too! March 29, 2010 - 7:30am Addthis Allison Casey Senior Communicator, NREL As we've mentioned many times on the Energy Savers blog, you can receive up to $1,500 in tax credits for home energy efficiency improvements like adding insulation, installing energy efficient windows, or replacing water heaters. If you're a regular reader, you know that we write about tax credits a lot. Our reasons are simple: we don't want you to forget that these credits are available, and we hope you'll help spread the word by sharing this info with your friends and family. (There are even some handy links at the bottom for you to send this article to your favorite social media

86

Prevent the Spread of Zoonotic Diseases  

E-Print Network [OSTI]

Take Precautions when Handling and Caring for Animals During routine care of animals, take the following precautions against spread- ing germs that cause diseases. Wear personal protective clothing and equipment Personal protective clothing, boots..., and equipment can reduce the risk of exposing other animals or people to contagious diseases. Wear boots and a set of protective clothing that you wear only when ? handling and caring for animals. Examples are hat ? coveralls ? long-sleeved shirt (cotton...

Pena, Josefa

2008-11-10T23:59:59.000Z

87

How Do You Spread the Word About Saving Energy? | Department...  

Broader source: Energy.gov (indexed) [DOE]

Do You Spread the Word About Saving Energy? How Do You Spread the Word About Saving Energy? May 25, 2012 - 2:03pm Addthis Earlier this week, Drew talked about how you can follow...

88

Performance degradation of OFDM systems due to Doppler spreading  

E-Print Network [OSTI]

on Jakes’ model for the Doppler effects, and an exponentialand S. Kaiser, “The effects of Doppler spreads in OFDM (A)In particular, the effect of Doppler spreading destroys the

Wang, T J; Proakis, J G; Masry, E; Zeidler, James R

2006-01-01T23:59:59.000Z

89

Alternative Fuels Data Center: EV Charging Stations Spread Through Philly  

Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

EV Charging Stations EV Charging Stations Spread Through Philly to someone by E-mail Share Alternative Fuels Data Center: EV Charging Stations Spread Through Philly on Facebook Tweet about Alternative Fuels Data Center: EV Charging Stations Spread Through Philly on Twitter Bookmark Alternative Fuels Data Center: EV Charging Stations Spread Through Philly on Google Bookmark Alternative Fuels Data Center: EV Charging Stations Spread Through Philly on Delicious Rank Alternative Fuels Data Center: EV Charging Stations Spread Through Philly on Digg Find More places to share Alternative Fuels Data Center: EV Charging Stations Spread Through Philly on AddThis.com... March 3, 2012 EV Charging Stations Spread Through Philly W atch how Philadelphia fuels electric vehicles with a growing network of

90

Information Spreading on Almost Torus Networks Antonia Maria Masucci 1  

E-Print Network [OSTI]

in the spread of a viral message and the authors of [6, 7, 8] have identified some conditions for successful

91

Measurements of spatial and frequency coherence of an equatorial hf path during spread-F  

SciTech Connect (OSTI)

In August 1990, the authors set up an hf path on the equatorial path between Maloelap Atoll and Bikini Atoll. This path, which had a range of 702 km, reflected in the ionosphere approximately 100 km north of the Altair radar location on Kwajalein. Transmitters at Maloelap broadcasted four cw tones within bandwidth of either 4 kHz, 9 kHz, or 70 kHz to be used to determine frequency coherence and also a phase-coded pseudo random sequence with a bandwidth of 60 kHz (channel probe) to be used to determine time delay spread. A spatial array of antennas was deployed at Bikini to measure spatial and frequency coherence using the cw broadcasts. The system was run in the post-sunset time period over two weeks during which almost every night showed significant degradation due to spread F resulting in rapid fading, decreased spatial and frequency coherence, and increased time delay spread. Doppler spreads of greater than 20 Hz were not uncommon, and the spatial correlation distances and frequency coherence bandwidths became so small (50 meters and 1 kHz respectively) that the experiment had to be readjusted. Measurements taken by the Altair incoherent scatter radar and the CUPRI 50 MHz coherent scatter radar indicate that although the bistatic hf channel is affected by the large scale plume structures, most of the [open quotes]damage[close quotes] is done by the bottomside spread F.

Fitzgerald, T.J.; Argo, P.E.; Carlos, R.C.

1993-01-01T23:59:59.000Z

92

Measurements of spatial and frequency coherence of an equatorial hf path during spread-F  

SciTech Connect (OSTI)

In August 1990, the authors set up an hf path on the equatorial path between Maloelap Atoll and Bikini Atoll. This path, which had a range of 702 km, reflected in the ionosphere approximately 100 km north of the Altair radar location on Kwajalein. Transmitters at Maloelap broadcasted four cw tones within bandwidth of either 4 kHz, 9 kHz, or 70 kHz to be used to determine frequency coherence and also a phase-coded pseudo random sequence with a bandwidth of 60 kHz (channel probe) to be used to determine time delay spread. A spatial array of antennas was deployed at Bikini to measure spatial and frequency coherence using the cw broadcasts. The system was run in the post-sunset time period over two weeks during which almost every night showed significant degradation due to spread F resulting in rapid fading, decreased spatial and frequency coherence, and increased time delay spread. Doppler spreads of greater than 20 Hz were not uncommon, and the spatial correlation distances and frequency coherence bandwidths became so small (50 meters and 1 kHz respectively) that the experiment had to be readjusted. Measurements taken by the Altair incoherent scatter radar and the CUPRI 50 MHz coherent scatter radar indicate that although the bistatic hf channel is affected by the large scale plume structures, most of the {open_quotes}damage{close_quotes} is done by the bottomside spread F.

Fitzgerald, T.J.; Argo, P.E.; Carlos, R.C.

1993-07-01T23:59:59.000Z

93

Increasing jet entrainment, mixing and spreading  

DOE Patents [OSTI]

A free jet of air is disturbed at a frequency that substantially matches natural turbulences in the free jet to increase the entrainment, mixing, and spreading of air by the free jet, for example in a room or other enclosure. The disturbances are created by pulsing the flow of air that creates the free jet at the desired frequency. Such pulsing of the flow of air can be accomplished by sequentially occluding and opening a duct that confines and directs the flow of air, such as by rotating a disk on an axis transverse to the flow of air in the duct. 11 figs.

Farrington, R.B.

1994-08-16T23:59:59.000Z

94

Menace and Management: Power in the Human-Monkey Social Worlds of Delhi and Shimla  

E-Print Network [OSTI]

time. According to the WTI report, the monkey facilities at86 All of this, claims the WTI report, was jeopardized by

Solomon, Daniel Allen

2013-01-01T23:59:59.000Z

95

Execution timesand execution jitter analysis of real-time tasks under fixed-priority pre-emptive scheduling  

E-Print Network [OSTI]

an (absolute) activation jitter AJi, a sporadic task i [16] with a worst-case (or minimum) period WTi, and an elastic task i [6] with a worst-case period WTi and a best-case (or maximum) period BTi, where WTi

Bril, Reinder J.

96

Investigation of Pool Spreading and Vaporization Behavior in Medium-Scale LNG Tests  

Science Journals Connector (OSTI)

Abstract A failure of a Liquefied Natural Gas (LNG) tanker can occur due to collision or loading/unloading operation resulting in spillage of LNG on water. Upon release, a spreading liquid can form a pool with rapid vaporization leading to the formation of a flammable vapor cloud. Safety analysis for the protection of public and property involves the determination of consequences of such accidental releases. To address this complex pool spreading and vaporization phenomenon of LNG, an investigation is performed based on the experimental tests that were conducted by the Mary Kay O’Connor Process Safety Center (MKOPSC) in 2007. The 2007 tests are a part of medium-scale experiments carried out at the Brayton Fire Training Field (BFTF), College Station. The dataset represents a semi-continuous spill on water, where LNG is released on a confined area of water for a specified duration of time. The pool spreading and vaporization behavior are validated using empirical models, which involved determination of pool spreading parameters and vaporization rates with respect to time. Knowledge of the pool diameter, pool height and spreading rate are found to be important in calculating the vaporization rates of the liquid pool. The paper also presents a method to determine the vaporization mass flux of LNG using water temperature data that is recorded in the experiment. The vaporization rates are observed to be high initially and tend to decrease once the pool stopped spreading. The results of the analysis indicated that a vaporization mass flux that is varying with time is required for accurate determination of the vaporization rate. Based on the data analysis, sources of uncertainties in the experimental data were identified to arise from ice formation and vapor blocking.

Nirupama Gopalaswami; R. Mentzer; M. Sam Mannan

2014-01-01T23:59:59.000Z

97

A spreading episode at the southern end of the San Andreas fault system  

Science Journals Connector (OSTI)

... is between the Cerro Prieto and Imperial faults; the grey region denotes the Cerro Prieto geothermal field, with the arrows giving the expected direction of spreading. The star on the ... levelling data indicate up to 0.25 m of subsidence in the vicinity of the geothermal field10. The gravity measurements show significant positive gravity changes for the period of time ...

Paul G. Silver; J. N. Valette-Silver

1987-04-09T23:59:59.000Z

98

Getter sputtering system for high-throughput fabrication of composition spreads  

SciTech Connect (OSTI)

We describe a sputtering system that can deposit composition spreads in an effectively UHV environment but which does not require the high-throughput paradigm to be compromised by a long pump down each time a target is changed. The system deploys four magnetron sputter guns in a cryoshroud (getter sputtering) which allows elements such as Ti and Zr to be deposited with minimal contamination by oxygen or other reactive background gases. The system also relies on custom substrate heaters to give rapid heating and cool down. The effectiveness of the gettering technique is evaluated, and example results obtained for catalytic activity of a pseudoternary composition spread are presented.

Gregoire, John M.; Dover, R. B. van; Jin Jing; Di Salvo, Francis J.; Abruna, Hector D. [Department of Physics, Cornell University, Ithaca, New York 14853 (United States) and Cornell Fuel Cell Institute, Cornell University, Ithaca, New York 14853 (United States); Department of Materials Science and Engineering, Cornell University, Ithaca, New York 14853 (United States) and Cornell Fuel Cell Institute, Cornell University, Ithaca, New York 14853 (United States); Department of Chemistry and Chemical Biology, Cornell University, Ithaca, New York 14853 (United States) and Cornell Fuel Cell Institute, Cornell University, Ithaca, New York 14853 (United States)

2007-07-15T23:59:59.000Z

99

Golden Spread Panhandle Wind Ranch | Open Energy Information  

Open Energy Info (EERE)

Spread Panhandle Wind Ranch Spread Panhandle Wind Ranch Jump to: navigation, search Name Golden Spread Panhandle Wind Ranch Facility Golden Spread Panhandle Wind Ranch Sector Wind energy Facility Type Commercial Scale Wind Facility Status In Service Owner Golden Spread Electric Cooperative Developer Cielo Energy Purchaser Golden Spread Electric Cooperative Location Wildarado TX Coordinates 35.22770741°, -102.2323751° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":35.22770741,"lon":-102.2323751,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

100

Fuzzy decision support system for spread mooring system selection  

Science Journals Connector (OSTI)

Spread mooring systems are associated with high level uncertainties and risks during tanker loading/unloading operations. In addition, the design of such complex systems consists of many subjective and imprecise parameters. Therefore, in the present ... Keywords: AHP, Decision making, Fuzzy multiple attribute decision making, Fuzzy set theory, Spread mooring system, TOPSIS

Ayhan Mentes; Ismail Hakki Helvacioglu

2012-02-01T23:59:59.000Z

Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

Towards Understanding Global Spread of Disease from Everyday Interpersonal Interactions  

E-Print Network [OSTI]

spread of disease. We consider the important task of predicting the prevalence of flu- like illness into the mechanisms of dis- ease spread and significantly improve predictabil- ity of future flu outbreaks. Our media--places em- phasis on predicting which specific individuals will become afflicted with flu

Kautz, Henry

102

Modeling daily flow patterns individuals to characterize disease spread  

SciTech Connect (OSTI)

The effect of an individual's travels throughout a day on the spread of disease is examined using a deterministic SIR model. We determine which spatial and demographic characteristics most contribute to the disease spread and whether the progression of the disease can be slowed by appropriate vaccination of people belonging to a specific location-type.

Smallwood, J. (Jeanine); Hyman, J. M. (James M.); Mirchandani, Pitu B.

2002-11-17T23:59:59.000Z

103

What constrains spread growth in forecasts ini2alized from  

E-Print Network [OSTI]

1 What constrains spread growth in forecasts ini2alized from ensemble Kalman filters? Tom from manner in which ini2al condi2ons are generated, some due to the model (e.g., stochas2c physics as error; part of spread growth from manner in which ini2al condi2ons are generated, some due

Hamill, Tom

104

Wet climate and transportation routes accelerate spread of human plague  

Science Journals Connector (OSTI)

...provides new insights on transmission patterns and possible...behind variability in transmission speed, with implications...plague pandemic|spread route|spread velocity...facilitated spatial transmission of infectious diseases...in circles or along lines away from the central...

2014-01-01T23:59:59.000Z

105

Cincinnati Canvassing Spreads Retrofitting Message | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Cincinnati Canvassing Spreads Retrofitting Message Cincinnati Canvassing Spreads Retrofitting Message Cincinnati Canvassing Spreads Retrofitting Message May 28, 2010 - 3:07pm Addthis A volunteer canvasses the Mt. Washington neighborhood to spread awareness about home energy audits in the area. | Photo Courtesy GCEA A volunteer canvasses the Mt. Washington neighborhood to spread awareness about home energy audits in the area. | Photo Courtesy GCEA Lindsay Gsell What are the key facts? With help from the Greater Cincinnati Energy Alliance (GCEA), this resident was able to get his home energy audited for only $50, saving approximately $300 from the average audit cost. Stuart Schaefer's home sits on a quaint, tree-lined street in Wyoming, Ohio. Although he's always enjoyed the neighborhood and his house in the

106

Modeling of pool spreading of LNG on land  

Science Journals Connector (OSTI)

Abstract This paper presents a source term model for estimating the rate of spreading of LNG and other cryogenic mixtures on unconfined land. The model takes into account the composition changes of a boiling mixture, the varying thermodynamic properties due to preferential boiling within the mixture and the effect of the various boiling regimes on conductive heat transfer. A sensitivity analysis is conducted to determine the relative effect of each of these phenomena on pool spread. The model is applied to continuous and instantaneous spills. The model is compared to literature experimental data on cryogenic pool spreading.

Omar Basha; Tomasz Olewski; Luc Véchot; Marcelo Castier; Sam Mannan

2014-01-01T23:59:59.000Z

107

A Gravitational Spreading Origin For The Socompa Debris Avalanche | Open  

Open Energy Info (EERE)

Gravitational Spreading Origin For The Socompa Debris Avalanche Gravitational Spreading Origin For The Socompa Debris Avalanche Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Journal Article: A Gravitational Spreading Origin For The Socompa Debris Avalanche Details Activities (0) Areas (0) Regions (0) Abstract: Socompa Volcano arguably provides the world's best-exposed example of a sector collapse-derived debris avalanche deposit. New observations lead us to re-interpret the origin of the sector collapse. We show that it was triggered by failure of active thrust-anticlines in sediments and ignimbrites underlying the volcano. The thrust-anticlines were a result of gravitational spreading of substrata under the volcano load. About 80% of the resulting avalanche deposit is composed of substrata formerly residing under the volcano and in the anticlines. The collapse

108

Tight Product Balance Pushes Up Product Spread (Spot Product - Crude  

Gasoline and Diesel Fuel Update (EIA)

5 5 Notes: Gasoline inventories indicate how tight the gasoline product market is in any one region. When the gasoline market is tight, it affects the portion of gasoline price is the spread between spot product price and crude oil price. Note that in late 1998-and early 1999 spreads were very small when inventories were quite high. Contrast summers of 1998 or 1999 with summer 2000. Last summer's tight markets, resulting low stocks and transition to Phase 2 RFG added price pressure over and above the already high crude price pressure on gasoline -- particularly in the Midwest. As we ended last winter, gasoline inventories were low, and the spread between spot prices and crude oil were higher than typical as a result. Inventories stayed well below average and the spread during the

109

Golden Spread Electric Cooperative, Inc | Open Energy Information  

Open Energy Info (EERE)

Golden Spread Electric Cooperative, Inc Golden Spread Electric Cooperative, Inc Jump to: navigation, search Name Golden Spread Electric Cooperative, Inc Place Amarillo, Texas Utility Id 7349 Utility Location Yes Ownership C NERC Location SPP NERC ERCOT Yes NERC SPP Yes Operates Generating Plant Yes Activity Generation Yes Activity Transmission Yes Activity Buying Transmission Yes Activity Buying Distribution Yes Activity Wholesale Marketing Yes References EIA Form EIA-861 Final Data File for 2010 - File1_a[1] SGIC[2] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Golden Spread Electric Cooperative, Inc. Smart Grid Project was awarded $19,995,000 Recovery Act Funding with a total project value of $49,987,500.

110

spread their Photo:FeraCrownCopyright2011  

E-Print Network [OSTI]

...don't spread their germs! Photo:Fera©CrownCopyright2011 Plants get ill too... For more information please visit www.scotland.gov.uk/planthealth Photo:ForestryCommission©CrownCopyright2011 © Crown

111

Discontinuities in the History of Sea-floor Spreading  

Science Journals Connector (OSTI)

... following. Let X be the distance, measured parallel to the spreading direction, of a parcel of crust from the axis of the mid-ocean ridge. Then a lapse is ... occasional vulcanism and the effects of sedimentation.

ERIC D. SCHNEIDER; PETER R. VOGT

1968-03-30T23:59:59.000Z

112

Competing spreading processes on multiplex networks: awareness and epidemics  

E-Print Network [OSTI]

Epidemic-like spreading processes on top of multilayered interconnected complex networks reveal a rich phase diagram of intertwined competition effects. A recent study by the authors [Granell et al. Phys. Rev. Lett. 111, 128701 (2013)] presented the analysis of the interrelation between two processes accounting for the spreading of an epidemics, and the spreading of information awareness to prevent its infection, on top of multiplex networks. The results in the case in which awareness implies total immunization to the disease, revealed the existence of a metacritical point at which the critical onset of the epidemics starts depending on the reaching of the awareness process. Here we present a full analysis of these critical properties in the more general scenario where the awareness spreading does not imply total immunization, and where infection does not imply immediate awareness of it. We find the critical relation between both competing processes for a wide spectrum of parameters representing the interacti...

Granell, Clara; Arenas, Alex

2014-01-01T23:59:59.000Z

113

Evidence of thermonuclear flame spreading on neutron stars from burst rise oscillations  

E-Print Network [OSTI]

Burst oscillations during the rising phases of thermonuclear X-ray bursts are usually believed to originate from flame spreading on the neutron star surface. However, the decrease of fractional oscillation amplitude with rise time, which provides a main observational support for the flame spreading model, have so far been reported from only a few bursts. Moreover, the non-detection and intermittent detections of rise oscillations from many bursts are not yet understood considering the flame spreading scenario. Here, we report the decreasing trend of fractional oscillation amplitude from an extensive analysis of a large sample of Rossi X-ray Timing Explorer Proportional Counter Array bursts from ten neutron star low-mass X-ray binaries. This trend is 99.99% significant for the best case, which provides, to the best of our knowledge, by far the strongest evidence of such trend. Moreover, it is important to note that an opposite trend is not found from any of the bursts. The concave shape of the fractional ampli...

Chakraborty, Manoneeta

2014-01-01T23:59:59.000Z

114

North Carolina Nonprofit Helps Spread the Word About Weatherization |  

Broader source: Energy.gov (indexed) [DOE]

North Carolina Nonprofit Helps Spread the Word About Weatherization North Carolina Nonprofit Helps Spread the Word About Weatherization North Carolina Nonprofit Helps Spread the Word About Weatherization September 3, 2010 - 10:00am Addthis Stephen Graff Former Writer & editor for Energy Empowers, EERE On Tuesday night, about 15 people gathered at the Lewisville Library in Winston-Salem, N.C., to hear three energy experts talk about how to tighten homes to save money on utility bills. Weather stripping, insulation and even planting trees were among the tips discussed. For two hours, people asked questions and took notes, learning as much as they could about how to weatherize their own homes. "Afterwards, the reaction from everyone was, 'wow that is a really great amount of information,'" says Terri LeGrand, executive director of Piedmont

115

Golden Spread Electric Cooperative, Inc. Smart Grid Project | Open Energy  

Open Energy Info (EERE)

Golden Spread Electric Cooperative, Inc. Golden Spread Electric Cooperative, Inc. Country United States Headquarters Location Amarillo, Texas Recovery Act Funding $19,995,000.00 Total Project Value $49,987,500.00 Coverage Area Coverage Map: Golden Spread Electric Cooperative, Inc. Smart Grid Project Coordinates 35.2219971°, -101.8312969° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[]}

116

EcoCar Students Spread the Word | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

EcoCar Students Spread the Word EcoCar Students Spread the Word EcoCar Students Spread the Word June 16, 2011 - 11:34am Addthis Shannon Brescher Shea Communications Manager, Clean Cities Program "If you build it, they will come" is a mantra that might be well suited for rural sporting venues, but the organizers behind the EcoCAR competition realize that in the commercial sector, merely producing a finely tuned product often isn't enough to make it successful. That's why along with challenging students to re-engineer a donated vehicle to minimize gas consumption and emissions while maintaining consumer acceptability, they've made outreach and education key components of the competition. Whether they're speaking to policy makers or elementary school students, each of the teams have worked to convey the benefits of advanced technology

117

North Carolina Nonprofit Helps Spread the Word About Weatherization |  

Broader source: Energy.gov (indexed) [DOE]

Nonprofit Helps Spread the Word About Weatherization Nonprofit Helps Spread the Word About Weatherization North Carolina Nonprofit Helps Spread the Word About Weatherization September 3, 2010 - 10:00am Addthis Stephen Graff Former Writer & editor for Energy Empowers, EERE On Tuesday night, about 15 people gathered at the Lewisville Library in Winston-Salem, N.C., to hear three energy experts talk about how to tighten homes to save money on utility bills. Weather stripping, insulation and even planting trees were among the tips discussed. For two hours, people asked questions and took notes, learning as much as they could about how to weatherize their own homes. "Afterwards, the reaction from everyone was, 'wow that is a really great amount of information,'" says Terri LeGrand, executive director of Piedmont

118

Robust Inventory Routing with Flexible Time Window Allocation  

E-Print Network [OSTI]

Jan 15, 2015 ... ... time buffers are spread among deliveries and consecutive deliveries at a port are separated by at least some minimum number of periods.

Chengliang Zhang

2015-01-15T23:59:59.000Z

119

Radio-frequency identification could help reduce the spread of plant pathogens  

E-Print Network [OSTI]

frequency identification could help reduce the spread ofeconomic losses. It also helps control the Plant Protection

Luvisi, Andrea; Panattoni, Alessandra; Triolo, Enrico

2012-01-01T23:59:59.000Z

120

Design, Implementation, and Evaluation of a Hybrid DS/FFH Spread-Spectrum Radio Transceiver  

SciTech Connect (OSTI)

In recent years there has been great interest in using hybrid spread-spectrum (HSS) techniques for commercial applications, particularly in the Smart Grid, in addition to their inherent uses in military communications. This is because HSS can accommodate high data rates with high link integrity, even in the presence of significant multipath effects and interfering signals. A highly useful form of this transmission technique for many types of command, control, and sensing applications is the specific code-related combination of standard direct-sequence modulation with "fast" frequency-hopping, denoted hybrid DS/FFH, wherein multiple frequency hops occur within a single data-bit time. In this paper, we present the efforts carried out at Oak Ridge National Laboratory toward exploring the design, implementation, and evaluation of a hybrid DS/FFH spread-spectrum radio transceiver using a single Field Programmable Gate Array (FPGA). The FPGA allows the various subsystems to quickly communicate with each other and thereby maintain tight synchronization. We also investigate various hopping sequences against robustness to interference and jamming. Experimental results are presented that show the receiver sensitivity, radio data-rate/bit-error evaluations, and jamming and interference rejection capabilities of the implemented hybrid DS/FFH spread-spectrum system under widely varying design parameters.

Olama, Mohammed M [ORNL; Killough, Stephen M [ORNL; Kuruganti, Teja [ORNL; Carroll, Thomas E. [Pacific Northwest National Laboratory (PNNL)

2014-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

The spread of awareness and its impact on epidemic outbreaks  

Science Journals Connector (OSTI)

...There is a fatal flu in Guangzhou...syndrome (SARS) outbreak (5), causing people...present a network model for the spread...constrain an epidemic outbreak. This effectiveness...when trying to predict disease progression...disease (32). Our model suggests how...distancing in disease outbreaks to come. 1 Ferguson...

Sebastian Funk; Erez Gilad; Chris Watkins; Vincent A. A. Jansen

2009-01-01T23:59:59.000Z

122

GLASSY STATES OF ADSORBED FLEXIBLE POLYMERS AND SPREAD POLYMER "MONOLAYERS"  

E-Print Network [OSTI]

1269 GLASSY STATES OF ADSORBED FLEXIBLE POLYMERS AND SPREAD POLYMER "MONOLAYERS" K. KREMER* Exxon mechanism for the dynamics of irreversibly adsorbed polymers. We argue that glass-like states can exist near of polymer adsorbed ' ' and the thickness of the adsorbed layer 2-7. While the results of the different

Paris-Sud XI, Université de

123

Short range spread-spectrum radiolocation system and method  

DOE Patents [OSTI]

A short range radiolocation system and associated methods that allow the location of an item, such as equipment, containers, pallets, vehicles, or personnel, within a defined area. A small, battery powered, self-contained tag is provided to an item to be located. The tag includes a spread-spectrum transmitter that transmits a spread-spectrum code and identification information. A plurality of receivers positioned about the area receive signals from a transmitting tag. The position of the tag, and hence the item, is located by triangulation. The system employs three different ranging techniques for providing coarse, intermediate, and fine spatial position resolution. Coarse positioning information is provided by use of direct-sequence code phase transmitted as a spread-spectrum signal. Intermediate positioning information is provided by the use of a difference signal transmitted with the direct-sequence spread-spectrum code. Fine positioning information is provided by use of carrier phase measurements. An algorithm is employed to combine the three data sets to provide accurate location measurements.

Smith, Stephen F. (Loudon, TN)

2003-04-29T23:59:59.000Z

124

Magma to Microbe: Modeling Hydrothermal Processes at Ocean Spreading Centers  

E-Print Network [OSTI]

215 Magma to Microbe: Modeling Hydrothermal Processes at Ocean Spreading Centers Geophysical is very limited. Low-temperature diffuse vent fluids, ubiquitous at hydrothermal systems, provide one microorganisms from diffuse hydrothermal vent fluids and the subseafloor at basalt-hosted mid-ocean ridges

Holden, James F.

125

Original article Impact of spreading olive mill wastewater on soil  

E-Print Network [OSTI]

Original article Impact of spreading olive mill wastewater on soil characteristics: laboratory 2001) Abstract ­ A dynamic of soil pollution with olive mill wastewater (OMW) was investigated process forms an olive mill wastewater (OMW). The amount of this waste depends on the process used for oil

Paris-Sud XI, Université de

126

Timing Aware Partitioning for Multi-FPGA based Logic Simulation using Top-down Selective Flattening  

E-Print Network [OSTI]

is assigned a slack based weight slack edge wti calculated according to Equation 3.3. slack edge wti = dmax slack ckt? edge slacki+1e. (3.3) max slack ckt is the maximum slack of the circuit. edge slacki is the slack of the edgei. In the reference flat...

Poothamkurissi Swaminathan, Subramanian

2012-10-19T23:59:59.000Z

127

Mutational Analysis of the Wilms' Tumor (WTI) Gene  

Science Journals Connector (OSTI)

Mutations of the Wilms’ tumor (WT1) gene have been shown to underlie a proportion of cases of Wilms’ tumor, an embryonal kidney cancer occurring mainly in childhood. The WTl gene comprtses ten exons spanning a...

Linda King-Underwood; Kathy Pritchard-Jones

1996-01-01T23:59:59.000Z

128

Implications of changing correlations between WTI and other commoditie...  

Gasoline and Diesel Fuel Update (EIA)

if the level of correlation is different from quarter to quarter. A two tailed test of the difference between two correlations drawn from a sample is used to check if the...

129

A new statistical dispersion model for tracer tests and contaminant spread in porous media  

SciTech Connect (OSTI)

Dispersion of solutes moving in permeable media is an essential control to describe fluid flow in permeable media. Dispersion can be thought of as a spreading of a solute caused by the presence of microscopic inhomogeneities. An accurate model for dispersion is needed for accurate estimation of oil recovery efficiencies and clean up costs of subsurface contaminants. Current approaches utilizing the fickian assumption fall short in describing the real physics of spreading during a solute transport process. Numerous field investigations have shown that dispersivities measured in the field are much larger than those measured in the lab for the same type of porous material. Moreover, field measured dispersivities have been shown to be scale dependent, that is, a tracer test conducted over a longer travel path will yield a larger dispersivity value than a tracer test conducted in the same geologic formation over a shorter travel path. Numerous approaches to address this problem have been developed yet none attempted to go beyond the Fickian dispersion assumption. In this study, a convective dispersivity is introduced. New model assumes that dispersion is dimensionless and mainly determined by pore size distribution. The new model results in a spread that increases linearly with time contrary to conventional model, which predicts a mixing zone length that increases with square root of time. Therefore, new model explains the field test results that indicate increasing dispersivity with distance. The model validations are in perfect agreement with experimental results, which include; Ganapathy et al.`s slug experiment on Antolini sandstone, Handy`s radioactive tracer experiment on Alhambra sandstone, and CT experiment conducted at BDM-OK/NIPER facilities on Tallant sandstone.

Ates, H.; Kasap, E. [Univ. of Tulsa, OK (United States)

1995-12-31T23:59:59.000Z

130

Transverse spreading of electrons in high-intensity laser fields  

E-Print Network [OSTI]

We show that for collisions of electrons with a high-intensity laser, discrete photon emissions introduce a transverse beam spread which is distinct from that due to classical (or beam shape) effects. Via numerical simulations, we show that this quantum induced transverse momentum gain of the electron is manifest in collisions with a realistic laser pulse of intensity within reach of current technology, and we propose it as a measurable signature of strong-field quantum electrodynamics.

D. G. Green; C. N. Harvey

2014-03-18T23:59:59.000Z

131

Ocean Floor Spreading: Olduvai and Gilsa Events in the Matuyama Epoch  

Science Journals Connector (OSTI)

...3910.1267 David A. Emilia Donald F. Heinrichs Marathon Oil Company, Denver Research Center, Littleton, Colorado...the basic spread-ing hypothesis. DAVID A. EMILIA Marathon Oil Company, Denver Research Center, Littleton, Colorado...

David A. Emilia; Donald F. Heinrichs

1969-12-05T23:59:59.000Z

132

Fire spread probabilities for experimental beds composed of mixedwood boreal forest fuels  

E-Print Network [OSTI]

that fire spread was largely determined by the heat sink, heat of combustion, and fuel bed depth. We found

Johnson, Edward A.

133

Modeling the Spread of Epidemic Cholera: an Age-Structured Model  

E-Print Network [OSTI]

in crowded conditions and poor sanitation. A common type of model for the spread of an infectious disease

Gobbert, Matthias K.

134

Damage Spreading in the Ising Model Haye Hinrichsen and Eytan Domany  

E-Print Network [OSTI]

Damage Spreading in the Ising Model Haye Hinrichsen and Eytan Domany Department of Physics regarding damage spreading in ferromagnetic Ising models. First, we show that a damage spreading transition can occur in an Ising chain that evolves in contact with a thermal reservoir. Damage heals at low

Domany, Eytan

135

Anisotropic geometrical-spreading correction for wide-azimuth P-wave reflections  

E-Print Network [OSTI]

Anisotropic geometrical-spreading correction for wide-azimuth P-wave reflections Xiaoxia Xu1 spreading in stratified azi- muthally anisotropic media. The P-wave geometrical-spreading factor systems, nonhydrostatic stresses, or dipping trans- versely isotropic layers e.g., shales . The inversion

Tsvankin, Ilya

136

Comparing methods for measuring the rate of spread of invading populations  

E-Print Network [OSTI]

with known theoretical spread rates over a hypothetical region where a set of sampling points are distributed as well as the shape of the invaded area and then compare how different spread rate measurement methods biology, and in particular on the factors influencing spread into new environments (Sharov et al. 1999

Liebhold, Andrew

137

Radiation-Driven Flame Spread Over Thermally-Thick Fuels in Quiescent Microgravity Environments  

E-Print Network [OSTI]

Radiation-Driven Flame Spread Over Thermally-Thick Fuels in Quiescent Microgravity Environments-non-premixed, flame-spread Submitted to Twenty-Ninth International Symposium on Combustion, Sapporo, Japan, July 21 ­ July 26, 2002. #12;Radiation-Driven Flame Spread Over Thermally-Thick Fuels in Quiescent Microgravity

138

Assessing nitrogen losses after sewage sludge spreading: A method based on simulation models and spreader  

E-Print Network [OSTI]

1 Assessing nitrogen losses after sewage sludge spreading: A method based on simulation models performances. We define 45 sewage sludge spreading scenarios covering a wide range of situations in France. Several models are used to (i) assess nitrogen losses due to sewage sludge spreading and (ii) calculate

Paris-Sud XI, Université de

139

Long-term survival of the axial valley morphology at abandoned slow-spreading centers  

E-Print Network [OSTI]

Long-term survival of the axial valley morphology at abandoned slow-spreading centers Andrew M the preservation of prominent axial valleys at extinct spreading centers, where extension has long ceased. In other of mid-ocean ridges suggest that the axial valley topography created at active slow- spreading centers

Freed, Andrew

140

Low power implementation of audio watermarking using chirp spread spectrum technique  

Science Journals Connector (OSTI)

There are numerous implementations of software-based audio watermarking available, but the implementation of hardware-based audio watermarking helps to achieve real time performance by integrating an audio watermarking chip with an existing audio electronic device. For the secure communication of the secret messages and for the data protection, the watermarking should provide good imperceptibility, good robustness, high capacity (pay load) and high speed. Thus, this paper presents a new VLSI architecture to implement an audio watermarking using chirp spread spectrum technique. It uses a chirp signal as a secret key; the watermark message can be transmitted as a noise signal such that an intruder cannot retrieve the message which is transmitted, and the message can be retrieved at the receiver side only with the help of the secret key. This technique provides high security with a low power and less complexity and it is very difficult to detect and intercept, hence it is used for the application of military and wireless communication to provide a covert communication. To our knowledge, we are the first authors to propose the low power implementation of audio watermarking using spread spectrum technique.

P. Karthigaikumar; K. Baskaran; K. Jaraline Kirubavathy

2011-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

Thermonuclear Flame Spreading on Rapidly Spinning Neutron Stars: Indications of the Coriolis Force?  

E-Print Network [OSTI]

Millisecond period brightness oscillations during the intensity rise of thermonuclear X-ray bursts are likely caused by an azimuthally asymmetric, expanding burning region on the stellar surface. The time evolution of the oscillation amplitude during the intensity rise encodes information on how the thermonuclear flames spread across the stellar surface. This process depends on properties of the accreted burning layer, surface fluid motions, and the surface magnetic field structure, and thus can provide insight into these stellar properties. We present two examples of bursts from different sources that show a decrease in oscillation amplitude during the intensity rise. Using theoretical modeling, we demonstrate that the observed amplitude evolution of these bursts is not well described by a uniformly expanding circular burning region. We further show that by including in our model the salient aspects of the Coriolis force (as described by Spitkovsky, Levin, and Ushomirsky) we can qualitatively reproduce the observed evolution curves. Our modeling shows that the evolutionary structure of burst oscillation amplitude is sensitive to the nature of flame spreading, while the actual amplitude values can be very useful to constrain some source parameters.

Sudip Bhattacharyya; Tod E. Strohmayer

2007-08-27T23:59:59.000Z

142

Codebook Design for Communication in Spread and Nonspread Space-Time Block Codes-based systems  

E-Print Network [OSTI]

Marko Beko #1 , Jo~ao Xavier 2 , Victor Barroso 2 # Universidade Lus´ofona de Humanidades e Tecnologias

143

Nuclear fuel reprocessing and the problems of safeguarding against the spread of nuclear weapons  

SciTech Connect (OSTI)

In 1977, the executive branch reversed its long-standing support for nuclear fuel reprocessing, primarily because of the rick of spreading nuclear weapons. GAO reviewed safeguards technology designed to reduce such risks in Federal reprocessing facilities and found that concerns are warranted. Material in sufficient quantities to construct a nuclear weapon could be diverted and go undetected for a long time. Effective international control and safeguards over the production, storage, and use of separated plutonium are lacking. The United States should increase its efforts to: develop and ensure the use of effective safeguards for reprocessing facilities; and establish, in conjunction with major nuclear fuel users, suppliers, and reprocessors, an international system to control the storage and use of excess plutonium.

Staats, E.B.

1980-03-18T23:59:59.000Z

144

1904 IEEE TRANSACTIONS ON KNOWLEDGE AND DATA ENGINEERING, VOL. 26, NO. 8, AUGUST 2014 Influence Spreading Path and Its Application to  

E-Print Network [OSTI]

by utilizing "Word-of-Mouth" effect in social networks. Time plays an important role in the influence spread. The experimental results demonstrate the efficiency and effectiveness of the algorithms for both conventional, and subsequently trigger a large cas- cade of further adoptions by utilizing the "Word-of-Mouth" effect in social

Chee, Yeow Meng

145

Longitudinal bunch profile and electron beam energy spread  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Magnets and Power Supplies Up: APS Storage Ring Parameters Previous: Magnets and Power Supplies Up: APS Storage Ring Parameters Previous: Storage Ring Operation Modes Longitudinal bunch profile and electron beam energy spread Longitudinal bunch profile depends mainly on the single bunch charge (or single bunch current). Every APS operating mode has different single bunch current and therefore has different bunch length. The plot below shows measured bunch length dependence on the single bunch current between 1 mA and 18 mA and the fit that uses the formula shown below the plot. The bunch length in this plot is shorter than it was quoted before. Earlier numbers were obtained using a Gaussian fit, present numbers are calculated as true standard deviation. \includegraphics[width=0.8\textwidth]{otherFiles/bunchLength.eps} The following formula obtained by fitting the log of the data above can be

146

Reactive Spreading of a Lead-Free Solder on Alumina  

SciTech Connect (OSTI)

The wetting of Sn3Ag-based alloys on Al{sub 2}O{sub 3} has been studied using the sessile-drop configuration. Small additions of Ti decrease the contact angle of Sn3Ag alloys on alumina from 115 to 23 degrees. Adsorption of Ti-species at the solid-liquid interface prior to reaction is the driving force for the observed decrease in contact angle, and the spreading kinetics is controlled by the kinetics of Ti dissolution into the molten alloy. The addition of Ti increases the transport rates at the solid-liquid interface, resulting in the formation of triple-line ridges that pin the liquid front and promote a wide variability in the final contact angles.

Gremillard, L.; Saiz, E.; Radmilovic, V.R.; Tomsia, A.P.

2005-12-01T23:59:59.000Z

147

Similarity solutions and applications to turbulent upward flame spread on noncharring materials  

SciTech Connect (OSTI)

The primary achievement in this work has been the discovery that turbulent upward flame spread on noncharring materials (for pyrolysis lengths less than 1.8m) can be directly predicted by using measurable flammability parameters. These parameters are: a characteristic length scale which is proportional to a turbulent combustion and mixing related length scale parameter ({dot q}{double_prime}{sub net}({Delta}H{sub c}/{Delta}H{sub v})){sup 2}, a pyrolysis or ignition time {tau}{sub p}, and a parameter which determines the transient pyrolysis history of a non-charring material: {lambda} = L/c{Delta}T{sub p} = ratio of the latent heat to the sensible heat of the pyrolysis temperature of the material. In the length scale parameter, {dot q}{double_prime}{sub net} is the total net heat flux from the flames to the wall (i.e., total heat flux minus reradiation losses), {Delta}H{sub c} is the heat of combustion and {Delta}H{sub v} is an effective heat of gasification for the material. The pyrolysis or ignition time depends (for thermally thick conditions) on the material thermal inertia, the pyrolysis temperature, and the total heat flux from the flames to the wall, {dot q}{double_prime}{sub fw}. The present discovery was made possible by using both a numerical simulation, developed earlier, and exact similarity solutions, which are developed in this work. The predictions of the analysis have been validated by comparison with upward flame spread experiments on PMMA.

Delichatsios, M.A.; Delichatsios, M.; Chen, Y. [Factory Mutual Research Corporation, Norwood, MA (United States)] [Factory Mutual Research Corporation, Norwood, MA (United States); Hasemi, Y. [Ministry of Construction, Tsukuba (Japan). Building Research Inst.] [Ministry of Construction, Tsukuba (Japan). Building Research Inst.

1995-08-01T23:59:59.000Z

148

Microsoft Word - MPUR_May2012_final.docx  

Gasoline and Diesel Fuel Update (EIA)

Market Prices and Uncertainty Report 1 Crude Oil Prices: Front month futures prices for Brent and WTI settled at $113.18 and $98.49 per barrel, respectively, on May 4 (Figure 1). Brent is now $13 per barrel lower compared to its 2012 high reached on March 13 and WTI is $9 per barrel off its 2012 high on February 24. Brent time spreads continued their decline in April from a peak on March 1, supporting estimates that crude oil inventories are building and suggesting that crude oil markets may be less tight than earlier this year (Figure 2). The 1 st - 12 th month contract spread for Brent was $7.59 per barrel on April 2 and has decreased to $4.75 per barrel as of

149

IGNITION PROCESSES AND FLAME SPREADING IN A GRANULAR SOLID PROPELLANT BED.  

E-Print Network [OSTI]

??Understanding the detailed ignition, flame spreading, and combustion processes inside of a granular solid propellant bed is vital for accurate internal ballistic modeling and development… (more)

Colletti, Alexander

2010-01-01T23:59:59.000Z

150

Dynamic Modeling of Cell Migration and Spreading Behaviors on Fibronectin Coated Planar Substrates and Micropatterned Geometries  

E-Print Network [OSTI]

An integrative cell migration model incorporating focal adhesion (FA) dynamics, cytoskeleton and nucleus remodeling, actin motor activity, and lamellipodia protrusion is developed for predicting cell spreading and migration ...

Kim, Min-Cheol

151

Fundamentals of wetting and spreading with emphasis on soldering  

SciTech Connect (OSTI)

Soldering is often referred to as a mature technology whose fundamentals were established long ago. Yet a multitude of soldering problems persist, not the least of which are related to the wetting and spreading of solder. The Buff-Goodrich approach to thermodynamics of capillarity is utilized in a review of basic wetting principles. These thermodynamics allow a very compact formulation of capillary phenomena which is used to calculate various meniscus shapes and wetting forces. These shapes and forces lend themselves to experimental techniques, such as the sessile drop and the Wilhelmy plate, for measuring useful surface and interfacial energies. The familiar equations of Young, Wilhelmy, and Neumann are all derived with this approach. The force-energy duality of surface energy is discussed and the force method is developed and used to derive the Herring relations for anisotropic surfaces. The importance of contact angle hysteresis which results from surface roughness and chemical inhomogeneity is presented and Young's equation is modified to reflect these ever present effects. Finally, an analysis of wetting with simultaneous metallurigical reaction is given and used to discuss solder wetting phenomena. 60 refs., 13 figs.

Yost, F.G.

1991-01-01T23:59:59.000Z

152

Fibrin but Not Adsorbed Fibrinogen Supports Fibronectin Assembly by Spread Platelets  

E-Print Network [OSTI]

Fibrin but Not Adsorbed Fibrinogen Supports Fibronectin Assembly by Spread Platelets EFFECTS on fibrin matrices than by platelets spread on adsorbed fibrinogen. The difference between platelets adherent to adsorbed mutant fibrinogen lacking the QAGDV sequence ( 5FG) were assembly-competent, as were

Mosher, Deane F.

153

A model of the spread of randomly scanning Internet worms that saturate access links  

Science Journals Connector (OSTI)

We present a simple, deterministic mathematical model for the spread of randomly scanning and bandwidth-saturating Internet worms. Such worms include Slammer and Witty, both of which spread extremely rapidly. Our model, consisting of coupled Kermack-McKendrick ... Keywords: Internet worms, communications/computer networking, epidemiology, modeling

George Kesidis; Ihab Hamadeh; Youngmi Jin; Soranun Jiwasurat; Milan Vojnovi?

2008-04-01T23:59:59.000Z

154

Detectability of Radio Frequency Interference due to Spread Spectrum Communication Signals using the  

E-Print Network [OSTI]

Detectability of Radio Frequency Interference due to Spread Spectrum Communication Signals using-- Analysis of detectability of the kurtosis algorithm for pulsed-sinusoidal Radio Frequency Interference (RFI) has already been performed in detail. The detectability for wide- band spread-spectrum RFI

Ruf, Christopher

155

Spread of cattle led to the loss of matrilineal descent in Africa: a coevolutionary analysis  

Science Journals Connector (OSTI)

...2003 research-article Spread of cattle led to the loss of matrilineal descent in Africa...support the hypothesis that acquiring cattle led formerly matrilineal Bantu-speaking cultures...Coevolution|Phylogeny| Spread of cattle led to the loss of matrilineal descent in Africa...

2003-01-01T23:59:59.000Z

156

Temporal variations of the segmentation of slow to intermediate spreading mid-ocean ridges  

E-Print Network [OSTI]

Tectonophysics: Dynamics, convection currents and mantle plumes; KEYWORDS: Mid-ocean ridge, mantle convectionTemporal variations of the segmentation of slow to intermediate spreading mid-ocean ridges 1 missions reveal a set of small-scale lineations on the flanks of slow to intermediate spreading mid- ocean

Boyer, Edmond

157

Measurement of focal spread, beam divergence and vibration in HREM images CB Boothroyd1*  

E-Print Network [OSTI]

Measurement of focal spread, beam divergence and vibration in HREM images CB Boothroyd1* and RE, the measurement of focal spread, beam divergence and specimen vibration is more difficult, as these parameters from the change in the intensity around each ring measured as a function of defocus, and vibration can

Dunin-Borkowski, Rafal E.

158

GIS-Based Epidemiological Modeling of an Emerging Forest Disease: Spread of  

E-Print Network [OSTI]

247 GIS-Based Epidemiological Modeling of an Emerging Forest Disease: Spread of Sudden Oak Death applied in a GIS to real-world wildland landscapes. In this paper, we present and evaluate a GIS model was implemented (1990-2005) in a GIS to simulate disease spread across California at a spatial

Standiford, Richard B.

159

Observations of the longitudinal spread of solar energetic particle events in solar cycle 24  

E-Print Network [OSTI]

Observations of the longitudinal spread of solar energetic particle events in solar cycle 24 C://proceedings.aip.org/about/rights_permissions #12;Observations of the Longitudinal Spread of Solar Energetic Particle Events in Solar Cycle 24 C-based satellites such as ACE, simultaneous multi-point measurements of solar energetic particle (SEP

Jensen, Grant J.

160

Handling of Mutual Conflicts in Distributed Databases using Timestamps  

Science Journals Connector (OSTI)

......suppose s1 and s2 are two sites in the system. Let wTi and wTj be the initial and final update times at these...when both the sites are in one partition, will be {wTi, wTj }, {wTi, wTj }. After a network partition, suppose sites s1......

S. K. Madria

1998-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

Optimal transport bounds between the time-marginals of a multidimensional diffusion and its Euler scheme  

E-Print Network [OSTI]

+ b(ti, ¯Xti )(t - ti) + (ti, ¯Xti )(Wt - Wti ), t [ti, ti+1], (1.2) Universit´e Paris-Est, CERMICS

Paris-Sud XI, Université de

162

Spreading of Thermonuclear Flames on the Neutron Star in SAX J1808.4-3658: An Observational Tool  

Science Journals Connector (OSTI)

We analyze archival Rossi X-Ray Timing Explorer (RXTE) proportional counter array (PCA) data of thermonuclear X-ray bursts from the 2002 outburst of the accreting millisecond pulsar SAX J1808.4-3658. We present evidence of nonmonotonic variations of oscillation frequency during burst rise, and correlations among the time evolution of the oscillation frequency, amplitude, and the inferred burning region area. We also find that the amplitude and burning region area evolutions are consistent with thermonuclear flames spreading on the neutron star surface. Based on this discussion, we infer that for the 2002 October 15 thermonuclear burst, the ignition likely occurred in the midlatitudes, the burning region took ~0.2 s to nearly encircle the equatorial region of the neutron star, and after that the lower amplitude oscillation originated from the remaining asymmetry of the burning front in the same hemisphere where the burst ignited. Our observational findings and theoretical discussion indicate that studies of the evolution of burst oscillation properties during burst rise can provide a powerful tool to understand thermonuclear flame spreading on neutron star surfaces under extreme physical conditions.

Sudip Bhattacharyya; Tod E. Strohmayer

2006-01-01T23:59:59.000Z

163

Spreading of thermonuclear flames on the neutron star in SAX J1808.4-3658: an observational tool  

E-Print Network [OSTI]

We analyse archival Rossi X-Ray Timing Explorer (RXTE) proportional counter array (PCA) data of thermonuclear X-ray bursts from the 2002 outburst of the accreting millisecond pulsar SAX J1808.4-3658. We present evidence of nonmonotonic variations of oscillation frequency during burst rise, and correlations among the time evolution of the oscillation frequency, amplitude, and the inferred burning region area. We also discuss that the amplitude and burning region area evolutions are consistent with thermonuclear flame spreading on the neutron star surface. Based on this discussion, we infer that for the 2002 Oct. 15 thermonuclear burst, the ignition likely occured in the mid-latitudes, the burning region took ~ 0.2 s to nearly encircle the equatorial region of the neutron star, and after that the lower amplitude oscillation originated from the remaining asymmetry of the burning front in the same hemisphere where the burst ignited. Our observational findings and theoretical discussion indicate that studies of the evolution of burst oscillation properties during burst rise can provide a powerful tool to understand thermonuclear flame spreading on neutron star surfaces under extreme physical conditions.

Sudip Bhattacharyya; Tod E. Strohmayer

2006-04-03T23:59:59.000Z

164

Performance Study of Hybrid DS/FFH Spread-Spectrum Systems in the Presence of Frequency-Selective Fading and Multiple-Access Interference  

SciTech Connect (OSTI)

Hybrid spread-spectrum (HSS) systems have recently received considerable interest in commercial, Smart Grid, and military communication systems because they accommodate high data rates with high link integrity, even in the presence of significant multipath effects and interfering signals. A highly useful form of this modulation scheme is the specific code-related combination of standard direct-sequence spread spectrum (DSSS) with fast frequency-hopping (FFH) spread spectrum, denoted hybrid DS/FFH, wherein multiple frequency hops occur within a single data-bit time. In this paper we perform a simulation-based study of the DS/FFH performance as compared to the existing standard DSSS and FHSS wireless networks. The performance metrics are bit-error probability and multiple-access capability. The parameter space of DS/FFH, including the DS spreading rate, frequency hopping rate, carrier frequencies, and numbers of users, is explored to show its performance under frequency-selective Rayleigh fading environments and multiuser interference. Direct digital synthesizers to achieve fast hopping speeds are also considered in our study.

Olama, Mohammed M [ORNL; Smith, Stephen Fulton [ORNL; Kuruganti, Phani Teja [ORNL; Ma, Xiao [ORNL

2012-01-01T23:59:59.000Z

165

Material properties effects on the detonation spreading and propagation of diaminoazoxyfurazan (DAAF)  

SciTech Connect (OSTI)

Recent dynamic testing of Diaminoazoxyfurazan (DAAF) has focused on understanding the material properties affecting the detonation propagation, spreading, behavior and symmetry. Small scale gap testing and wedge testing focus on the sensitivity to shock with the gap test including the effects of particle size and density. Floret testing investigates the detonation spreading as it is affected by particle size, density, and binder content. The polyrho testing illustrates the effects of density and binder content on the detonation velocity. Finally the detonation spreading effect can be most dramatically seen in the Mushroom and Onionskin tests where the variations due to density gradients, pressing methods and geometry can be seen on the wave breakout behavior.

Francois, Elizabeth Green [Los Alamos National Laboratory; Morris, John S [Los Alamos National Laboratory; Novak, Alan M [Los Alamos National Laboratory; Kennedy, James E [HERE LLC

2010-01-01T23:59:59.000Z

166

Robust low-frequency spread-spectrum navigation system  

DOE Patents [OSTI]

Methods and apparatus are described for a navigation system. A process includes providing a plurality of transmitters distributed throughout a desired coverage area; locking the plurality of transmitters to a common timing reference; transmitting a signal from each of the plurality of transmitters. An apparatus includes a plurality of transmitters distributed throughout a desired coverage area; wherein each of the plurality of transmitters comprises a packet generator; and wherein the plurality of transmitters are locked to a common timing reference.

Smith, Stephen F; Moore, James A

2012-10-30T23:59:59.000Z

167

Robust low-frequency spread-spectrum navigation system  

DOE Patents [OSTI]

Methods and apparatus are described for a navigation system. A process includes providing a plurality of transmitters distributed throughout a desired coverage area; locking the plurality of transmitters to a common timing reference; transmitting a signal from each of the plurality of transmitters. An apparatus includes a plurality of transmitters distributed throughout a desired coverage area; wherein each of the plurality of transmitters comprises a packet generator; and wherein the plurality of transmitters are locked to a common timing reference.

Smith, Stephen F. (Loudon, TN); Moore, James A. (Powell, TN)

2012-01-03T23:59:59.000Z

168

PHY and MAC Layer Design of Hybrid Spread Spectrum Based Smart Meter Network  

SciTech Connect (OSTI)

The smart grid is a combined process of revitalizing the traditional power grid applications and introducing new applications to improve the efficiency of power generation, transmission and distribution. This can be achieved by leveraging advanced communication and networking technologies. Therefore the selection of the appropriate communication technology for different smart grid applications has been debated a lot in the recent past. After comparing different possible technologies, a recent research study has arrived at a conclusion that the 3G cellular technology is the right choice for distribution side smart grid applications like smart metering, advanced distribution automation and demand response management system. In this paper, we argue that the current 3G/4G cellular technologies are not an appropriate choice for smart grid distribution applications and propose a Hybrid Spread Spectrum (HSS) based Advanced Metering Infrastructure (AMI) as one of the alternatives to 3G/4G technologies. We present a preliminary PHY and MAC layer design of a HSS based AMI network and evaluate their performance using matlab and NS2 simulations. Also, we propose a time hierarchical scheme that can significantly reduce the volume of random access traffic generated during blackouts and the delay in power outage reporting.

Kuruganti, Phani Teja [ORNL] [ORNL

2012-01-01T23:59:59.000Z

169

Ecotoxicological assessment of organic wastes spread on land: Towards a proposal of a suitable test battery  

Science Journals Connector (OSTI)

Abstract The land spreading of organic wastes in agriculture is a common practice in Europe, under the regulation of the Directive 86/278/EEC. One of the objectives of this Directive is to prevent harmful effects of organic wastes on soil, plants and animals. Despite this regulatory framework, there is still a lack of harmonized ecotoxicological test strategy to assess the environmental hazard of such wastes. The aim of this study was to provide a first step towards the a priori ecotoxicological assessment of organic wastes before their land use. For that purpose, nine different organic wastes were assessed using direct (i.e. terrestrial tests) and indirect (i.e. tests on water eluates) approaches, for a total of thirteen endpoints. Then, multivariate analyzes were used to discriminate the most relevant test strategy, among the application rates and bioassays used. From our results, a draft of test strategy was proposed, using terrestrial bioassays (i.e. earthworms and plants) and a concentration range between one and ten times the recommended application rates of organic wastes.

Pierre Huguier; Nicolas Manier; Laure Chabot; Pascale Bauda; Pascal Pandard

2015-01-01T23:59:59.000Z

170

Microsoft Word - kiliandiscussion.doc  

Gasoline and Diesel Fuel Update (EIA)

Physical Market Conditions, Paper Market Physical Market Conditions, Paper Market Activity and the WTI-Brent Spread Discussion by: Lutz Kilian University of Michigan Crude Oil is Not Perfectly Homogeneous â—Ź Differences in: - Composition - Location â—Ź Traditional approach: Use of Benchmarks (WTI, Brent) â—Ź What explains the growing spread of Brent over WTI crude oil? â—Ź Is the WTI price unusually low or the Brent price unusually high? 1992 1994 1996 1998 2000 2002 2004 2006 2008 2010 0 20 40 60 80 100 120 140 U.S. Real RAC for Crude Oil Imports July 2008 Dollars 1992 1994 1996 1998 2000 2002 2004 2006 2008 2010 -30 -20 -10 0 10 20 30 Spread Over U.S. RAC for Crude Oil Imports Percent WTI Brent Source: Baumeister and Kilian (2012) Candidate Explanations â—Ź Regional supply shocks: Libyan supply disruption (temporary)

171

VR/Urban: Spread.gun Design Process and Challenges in Developing a Shared Encounter for Media Faades  

E-Print Network [OSTI]

VR/Urban: Spread.gun ­ Design Process and Challenges in Developing a Shared Encounter for Media intervention tool called Spread.gun, which was created for the Media Façade Festival 2008 in Berlin. Main social change. In this paper, we discuss our Spread.gun installation as a case study exemplifying

Hornecker, Eva

172

Second Price Component: Spread Impacted by Distillate Supply/Demand Balance  

Gasoline and Diesel Fuel Update (EIA)

8 8 Notes: While crude oil prices will be a major factor impacting distillate prices this winter, another important factor is the U.S. distillate supply/demand balance, as measured by distillate stocks. The distillate supply/demand balance influences the spread between spot distillate and spot crude oil prices. For example, when stocks are higher than normal, the spread will be lower than usual. This spread is the price incentive that encourages or discourages changes in supply. While high stocks in the distillate market are good news for consumers, an excess is bad news for refiners. Distillate spreads during the winter of 1998-99 and throughout most of 1999 were well below average. Distillate stocks were very high during this period, partially as a result of warm weather keeping demand down.

173

SmartPower Spreading Energy Efficiency to Echo-boomers | Department of  

Broader source: Energy.gov (indexed) [DOE]

SmartPower Spreading Energy Efficiency to Echo-boomers SmartPower Spreading Energy Efficiency to Echo-boomers SmartPower Spreading Energy Efficiency to Echo-boomers April 9, 2010 - 4:36pm Addthis Paul Lester Communications Specialist, Office of Energy Efficiency and Renewable Energy What are the key facts? Research shows that once young people start unplugging unused electronic devices, they are likely to take more action to reduce their energy use. Saving energy is cool. That's the message SmartPower is spreading online to 80 million echo-boomers, the generation born between 1982 and 1995. "They are the generation that best appreciates the need for mitigation of climate change," says Jonathan Edwards, vice president of SmartPower, a non-profit that has developed creative Web marketing campaigns aimed at

174

SmartPower Spreading Energy Efficiency to Echo-boomers | Department of  

Broader source: Energy.gov (indexed) [DOE]

SmartPower Spreading Energy Efficiency to Echo-boomers SmartPower Spreading Energy Efficiency to Echo-boomers SmartPower Spreading Energy Efficiency to Echo-boomers April 9, 2010 - 4:36pm Addthis Paul Lester Communications Specialist, Office of Energy Efficiency and Renewable Energy What are the key facts? Research shows that once young people start unplugging unused electronic devices, they are likely to take more action to reduce their energy use. Saving energy is cool. That's the message SmartPower is spreading online to 80 million echo-boomers, the generation born between 1982 and 1995. "They are the generation that best appreciates the need for mitigation of climate change," says Jonathan Edwards, vice president of SmartPower, a non-profit that has developed creative Web marketing campaigns aimed at

175

Predictable waves of sequential forest degradation and biodiversity loss spreading from an African city  

E-Print Network [OSTI]

- tainably reducing carbon storage and biodiversity. biodiversity conservation | carbon emissions | reducing, wood production, and biodiversity conservation. The impacts of individual forms of tropical forestPredictable waves of sequential forest degradation and biodiversity loss spreading from an African

Vermont, University of

176

Beam energy spread in FERMI@elettra gun and linac induced by intrabeam scattering  

E-Print Network [OSTI]

spread in FERMI@elettra gun and linac induced by intrabeamcathode area in the electron guns know in the literature asmost visible within the electron gun where the electron beam

Zholents, Alexander A

2008-01-01T23:59:59.000Z

177

Tradeoffs of Source Coding, Channel Coding and Spreading in Frequency Selective Rayleigh Fading Channels  

Science Journals Connector (OSTI)

This paper investigates the tradeoffs of source coding, channel coding and spreading in CDMA systems. We consider a system consisting of an image source coder, a convolutional channel coder, an interleaver, an...

1]Qinghua Zhao; Pamela Cosman…

2002-01-01T23:59:59.000Z

178

Spreading of Sn-Ag solders on FeNi alloys  

SciTech Connect (OSTI)

The spreading of Sn-3Ag-xBi solders on Fe-42Ni has been studied using a drop transfer setup. Initial spreading velocities as fast as {approx}0.5 m/s have been recorded. The results are consistent with a liquid front moving on a metastable, flat, unreacted substrate and can be described by using a modified molecular-kinetic model for which the rate controlling step is the movement of one atom from the liquid to the surface of the solid substrate. Although the phase diagram predicts the formation of two Fe-Sn intermetallics at the solder/substrate interface in samples heated at temperatures lower than 513 C, after spreading at 250 C only a thin FeSn reaction layer could be observed. Two interfacial layers (FeSn and FeSn2) were found after spreading at 450 C.

Saiz, Eduardo; Hwang, C-W.; Suganuma, Katsuaki; Tomsia, Antoni P.

2003-02-28T23:59:59.000Z

179

Collisional spreading of Enceladus' neutral cloud T.A. Cassidy *, R.E. Johnson  

E-Print Network [OSTI]

Collisional spreading of Enceladus' neutral cloud T.A. Cassidy *, R.E. Johnson Charlottesville exchange momentum, causing deflections whether or not a charge exchange occurs (e.g., Johnson et al., 2006a

Johnson, Robert E.

180

The tectonics and three-dimensional structure of spreading centers--microearthquake studies and tomographic inversions  

E-Print Network [OSTI]

Two-thirds of the Earth's surface has been formed along a global system of spreading centers that are presently manifested in several different structural forms, including the classic rift valley of the Mid-Atlantic Ridge, ...

Toomey, Douglas R

1987-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

The spread of violent civil conflict : rare state-driven, and preventable  

E-Print Network [OSTI]

This dissertation advances and tests an explanation for the spread of violent civil conflict from one state to another. The fear of such "substate conflict contagion" is frequently invoked by American policymakers as a ...

Black, Nathan Wolcott

2012-01-01T23:59:59.000Z

182

Landau damping effects and evolutions of energy spread in small isochronous ring  

SciTech Connect (OSTI)

This paper presents the Landau damping effects on the microwave instability of a coasting long bunch in an isochronous ring due to finite energy spread and emittance. Our two-dimensional (2D) dispersion relation gives more accurate predictions of the microwave instability growth rates of short-wavelength perturbations than the conventional 1D formula. The long-term evolution of energy spread is also studied by measurements and simulations.

Li, Yingjie [Michigan State University; Wang, Langfa [SLAC; Lin, Fanglei [JLAB

2014-11-01T23:59:59.000Z

183

Direct, physically motivated derivation of triggering probabilities for spreading processes on generalized random networks  

E-Print Network [OSTI]

We derive a general expression for the probability of global spreading starting from a single infected seed for contagion processes acting on generalized, correlated random networks. We employ a simple probabilistic argument that encodes the spreading mechanism in an intuitive, physical fashion. We use our approach to directly and systematically obtain triggering probabilities for contagion processes acting on a series of interrelated random network families.

Dodds, Peter Sheridan; Payne, Joshua L

2011-01-01T23:59:59.000Z

184

Enhanced Spreading of Aqueous Films Containing Ionic Surfactants on Solid Substrates  

Science Journals Connector (OSTI)

The spreading behavior of ionic surfactant aqueous systems on organosulfur monolayers with differing compositions and surface energies has been investigated. ... Wetting often plays a critical role in applications such as coatings, cosmetics, agrochemicals, and lubrication. ... The poor understanding of the relationship between surfactant composition and structure and dynamic wetting prompted us to examine the spreading behavior of aqueous media containing a variety of nonionic surfactants. ...

T. Stoebe; Randal M. Hill; Michael D. Ward; H. Ted Davis

1997-12-24T23:59:59.000Z

185

Spreading Dead Zones and Consequences for Marine Ecosystems  

Science Journals Connector (OSTI)

...factor affecting ecosystem energy flows. Within most systems...on the upward flow of energy in the food chain...fisheries and affecting energy flows in the same way...countries is highly likely if wind patterns shift and cause...times, most coastal and offshore ecosystems never became...

Robert J. Diaz; Rutger Rosenberg

2008-08-15T23:59:59.000Z

186

Lower hybrid instability driven by mono-energy {alpha}-particles with finite pitch angle spread in a plasma  

SciTech Connect (OSTI)

A kinetic formalism of lower hybrid wave instability, driven by mono-energy {alpha}-particles with finite pitch angle spread, is developed. The instability arises through cyclotron resonance interaction with high cyclotron harmonics of {alpha}-particles. The {alpha}-particles produced in D-T fusion reactions have huge Larmor radii ({approx}10 cm) as compared to the wavelength of the lower hybrid wave, whereas their speed is an order of magnitude smaller than the speed of light in vacuum. As a result, large parallel phase velocity lower hybrid waves, suitable for current drive in tokamak, are driven unstable via coupling to high cyclotron harmonics. The growth rate decreases with increase in pitch angle spread of the beam. At typical electron density of {approx}10{sup 19} m{sup -3}, magnetic field {approx}4 Tesla and {alpha}-particle concentration {approx}0.1%, the large parallel phase velocity lower hybrid wave grows on the time scale of 20 ion cyclotron periods. The growth rate decreases with plasma density.

Kumar, Pawan; Singh, Vishwesh; Tripathi, V. K. [Department of Physics, IIT Delhi, New Delhi-110016 (India)

2013-02-15T23:59:59.000Z

187

Production of low axial energy spread ion beams with multicusp sources  

SciTech Connect (OSTI)

Multicusp ion sources are capable of producing ions with low axial energy spread which are necessary in applications such as: ion projection lithography (IPL) and focused ion beams for the next generation lithographic tools and nuclear science experiments such as radioactive ion beam production. The axial ion energy spread for multicusp source is approximately 6 eV which is too large for IPL and radioactive ion beam applications. The addition of a magnetic filter which consists of a pair of permanent magnets to the multicusp source reduces the energy spread considerably. The reduction is due to the improvement in the uniformity of the axial plasma potential distribution in the discharge region. Axial ion energy spread of the filament driven ion source has been measured using three different techniques. In all cases, it was found to be less than 2 eV. Energy spread of the radio frequency (RF) driven source has also been explored, and it was found to be less than 3 eV with the proper RF-shielding. A new multicusp source configuration has been designed and constructed to further reduce the energy spread. To achieve a more uniform axial plasma potential distribution, a cylindrical magnetic filter has been designed and constructed for a 2-cm-diameter source. This new source configuration, the co-axial source, is new in its kind. The energy spread in this source has been measured to be a record low of 0.6 eV. Because of the novelty of this device, some plasma parameters inside the source have been studied. Langmuir probe has been used to measure the plasma potential, the electron temperature and the density distribution.

Lee, Y.H.Y. [Univ. of California, Berkeley, CA (United States)

1998-05-01T23:59:59.000Z

188

Could ocean currents be responsible for the west to east spread of aquatic invasive species in Maritime Canadian waters?  

Science Journals Connector (OSTI)

Abstract The circulation in the shelf seas of Maritime Canada is predominantly in the northeast–southwest direction. Despite the mean northeast–southwest flow, a number of AIS invasions have been observed to proceed in the opposite direction – from the Gulf of Maine, around Nova Scotia, and into the southern Gulf of St. Lawrence. Flow fields from a numerical circulation model are used to investigate whether these invasions could be due to drift in ocean currents. Particle tracking experiments are performed and probability density functions (PDFs) derived that describe the probability of drifting a given upstream distance in a given drift time. Analysis of these \\{PDFs\\} revealed that for invasions that took 20–40 y to occur, propagule drift in ocean currents could be responsible for the upstream spread, while this was not the case for short timescale invasions (<10 y). Rafting could be responsible for both short and long timescale invasions.

D. Brickman

2014-01-01T23:59:59.000Z

189

Spread the word about how to help | ENERGY STAR Buildings & Plants  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Spread the word about how to help Spread the word about how to help Secondary menu About us Press room Contact Us Portfolio Manager Login Facility owners and managers Existing buildings Commercial new construction Industrial energy management Small business Service providers Service and product providers Verify applications for ENERGY STAR certification Design commercial buildings Energy efficiency program administrators Commercial and industrial program sponsors Associations State and local governments Federal agencies Tools and resources Training In this section Learn the benefits Get started Use Portfolio Manager Save energy Stamp out energy waste Find cost-effective investments Engage occupants Provide a seat at the table Share energy goals and progress Identify energy-saving actions Spread the word about how to help

190

Methods and apparatuses using filter banks for multi-carrier spread-spectrum signals  

DOE Patents [OSTI]

A transmitter includes a synthesis filter bank to spread a data symbol to a plurality of frequencies by encoding the data symbol on each frequency, apply a common pulse-shaping filter, and apply gains to the frequencies such that a power level of each frequency is less than a noise level of other communication signals within the spectrum. Each frequency is modulated onto a different evenly spaced subcarrier. A demodulator in a receiver converts a radio frequency input to a spread-spectrum signal in a baseband. A matched filter filters the spread-spectrum signal with a common filter having characteristics matched to the synthesis filter bank in the transmitter by filtering each frequency to generate a sequence of narrow pulses. A carrier recovery unit generates control signals responsive to the sequence of narrow pulses suitable for generating a phase-locked loop between the demodulator, the matched filter, and the carrier recovery unit.

Moradi, Hussein; Farhang, Behrouz; Kutsche, Carl A

2014-05-20T23:59:59.000Z

191

Methods and apparatuses using filter banks for multi-carrier spread-spectrum signals  

DOE Patents [OSTI]

A transmitter includes a synthesis filter bank to spread a data symbol to a plurality of frequencies by encoding the data symbol on each frequency, apply a common pulse-shaping filter, and apply gains to the frequencies such that a power level of each frequency is less than a noise level of other communication signals within the spectrum. Each frequency is modulated onto a different evenly spaced subcarrier. A demodulator in a receiver converts a radio frequency input to a spread-spectrum signal in a baseband. A matched filter filters the spread-spectrum signal with a common filter having characteristics matched to the synthesis filter bank in the transmitter by filtering each frequency to generate a sequence of narrow pulses. A carrier recovery unit generates control signals responsive to the sequence of narrow pulses suitable for generating a phase-locked loop between the demodulator, the matched filter, and the carrier recovery unit.

Moradi, Hussein; Farhang, Behrouz; Kutsche, Carl A

2014-10-14T23:59:59.000Z

192

No Evidence for Significant Age Spreads in Young Massive LMC Clusters  

E-Print Network [OSTI]

Recent discoveries have put the picture of stellar clusters being simple stellar populations into question. In particular, the color-magnitude diagrams of intermediate age (1-2 Gyr) massive clusters in the Large Magellanic Cloud (LMC) show features that could be interpreted as age spreads of 100-500 Myr. If multiple generations of stars are present in these clusters then, as a consequence, young (test this hypothesis. We analyzed the color-magnitude diagrams of these clusters and fitted their star formation history to derive upper limits of potential age spreads. We find that none of the clusters analyzed in this work shows evidence for an extended star formation history that would be consistent with the age spreads proposed for intermediat...

Niederhofer, Florian; Bastian, Nate; Silva-Villa, Esteban

2015-01-01T23:59:59.000Z

193

Use of incomplete energy recovery for the energy compression of large energy spread charged particle beams  

DOE Patents [OSTI]

A method of energy recovery for RF-base linear charged particle accelerators that allows energy recovery without large relative momentum spread of the particle beam involving first accelerating a waveform particle beam having a crest and a centroid with an injection energy E.sub.o with the centroid of the particle beam at a phase offset f.sub.o from the crest of the accelerating waveform to an energy E.sub.full and then recovering the beam energy centroid a phase f.sub.o+Df relative to the crest of the waveform particle beam such that (E.sub.full-E.sub.o)(1+cos(f.sub.o+Df))>dE/2 wherein dE=the full energy spread, dE/2=the full energy half spread and Df=the wave form phase distance.

Douglas, David R. (Newport News, VA); Benson, Stephen V. (Yorktown, VA)

2007-01-23T23:59:59.000Z

194

On formulating equations for plume spreads for near-surface releases  

Science Journals Connector (OSTI)

Recent concerns about effects of automobile emissions on the health of people living close to roads have motivated an examination of models to estimate dispersion in the surface boundary layer. This examination led to new formulations for horizontal and vertical plume spread described in Venkatram et al. (2013). Concentration estimates based on the proposed plume spread equations compare well with data from both the Prairie Grass experiment (Barad, 1958) as well as the recently conducted Idaho Falls experiment (Finn et al., 2010). This paper describes a simpler approach to deriving the new equations proposed in the earlier paper.

Akula Venkatram; Nico Schulte

2014-01-01T23:59:59.000Z

195

Surfactant-assisted spreading of an oil-in-water emulsion on the surface of a liquid bath  

E-Print Network [OSTI]

This fluid dynamics video shows how an oil-in-water emulsion stabilized by an ionic surfactant spreads on the free surface of a layer of pure water. The spreading shows two intriguing features: a transparent area surrounding the source of oil droplets, and a fast retraction of the layer of oil droplets on itself once the source has emptied. We show that the dynamics of spreading are strongly connected to the interfacial/bulk properties of the surfactant.

Roche, Matthieu; Griffiths, Ian; Saint-Jalmes, Arnaud; Stone, Howard A

2010-01-01T23:59:59.000Z

196

Proceedings of the Sudden Oak Death Fifth Science Symposium Reducing the Spread of Phytophthora ramorum  

E-Print Network [OSTI]

Proceedings of the Sudden Oak Death Fifth Science Symposium 141 Reducing the Spread of Phytophthora on the Rogue River-Siskiyou National Forest was found infected with Phytophthora ramorum. The trail University. Phytophthora ramorum was recovered from at least one of the 11 samples on all occasions except

Standiford, Richard B.

197

Dispersed Repetitive DNA Has Spread to New Genomes Since Polyploid Formation in Cotton  

E-Print Network [OSTI]

Dispersed Repetitive DNA Has Spread to New Genomes Since Polyploid Formation in Cotton Xin recently formed polyploid, cotton (Gossypium barbadense L.; AD genome), 83 non-cross-hybridizing DNA clones tetraploid cotton. In tetraploid cotton, FISH analysis showed that some A-genome dispersed repeats appear

Wendel, Jonathan F.

198

Code-Red: a case study on the spread and victims of an Internet worm  

E-Print Network [OSTI]

Code-Red: a case study on the spread and victims of an Internet worm David Moore, Colleen Shannon infected with the Code- Red (CRv2) worm in less than 14 hours. The cost of this epidemic, including subsequent strains of Code-Red, is es- timated to be in excess of $2.6 billion. Despite the global damage

Somayaji, Anil

199

The Effect of Rumor Spreading in Reputation Systems for Mobile Ad-hoc Networks  

E-Print Network [OSTI]

The Effect of Rumor Spreading in Reputation Systems for Mobile Ad-hoc Networks Sonja Buchegger IBM EPFL-DSC CH-1015 Lausanne, Switzerland jean-yves.leboudec@epfl.ch Abstract: Mobile ad-hoc networks rely- liciously pose a threat to availability in mobile ad- hoc networks. Several approaches have been pro- posed

Paris-Sud XI, Université de

200

40 Cognitive Science class intervals that are equally spread across the data  

E-Print Network [OSTI]

40 Cognitive Science class intervals that are equally spread across the data range. For example and geographic visualization. Englewood Cliffs, NJ: PearsonJPrentice Hall. COGNITIVE SCIENCE Cognitive science. Cognition includes perception, thinking, learning, memory, reasoning and problem solving, and linguistic

Montello, Daniel R.

Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

Energy Spot Price Models and Spread Options Pricing Samuel Hikspoors and Sebastian Jaimungal a  

E-Print Network [OSTI]

). The world wide energy commodities markets have created a need for a deeper quan- titative understandingEnergy Spot Price Models and Spread Options Pricing Samuel Hikspoors and Sebastian Jaimungal a a Department of Statistics and Mathematical Finance Program, University of Toronto, 100 St. George Street

Jaimungal, Sebastian

202

LONG EXPOSURE POINT SPREAD FUNCTION ESTIMATION FROM SOLAR ADAPTIVE OPTICS LOOP DATA  

E-Print Network [OSTI]

Astronomer, National Solar Observatory, New Mexico, USA Dr. Haimin Wang, Dissertation Co-Advisor DateABSTRACT LONG EXPOSURE POINT SPREAD FUNCTION ESTIMATION FROM SOLAR ADAPTIVE OPTICS LOOP DATA during solar observations due to the lack of point sources in the field-of-view. Moreover, the highly

203

THE VALUATION OF CLEAN SPREAD OPTIONS: LINKING ELECTRICITY, EMISSIONS RENE CARMONA, MICHAEL COULON, AND DANIEL SCHWARZ  

E-Print Network [OSTI]

on CO2 by the regulation should be included in the costs of production to set the price of electricity which can be run when it is profitable to do so (namely when the price of electricity is greater thanTHE VALUATION OF CLEAN SPREAD OPTIONS: LINKING ELECTRICITY, EMISSIONS AND FUELS REN´E CARMONA

Carmona, Rene

204

Insights into the Origin, Emergence, and Current Spread of a Successful Russian Clone of Mycobacterium tuberculosis  

Science Journals Connector (OSTI)

...regimen and wide use of the key first-line anti-TB drugs. In contrast, a link...operon), and the virulence-related eis, mce, and esx gene families. Other...emergence and spread in the human population. Supplemental material for this article may be found...

Igor Mokrousov

2013-04-01T23:59:59.000Z

205

Asymmetry in Directional Spreading Function of Random Waves due to Refraction  

E-Print Network [OSTI]

for deep water conditions. Analytic directional spreading functions take the form cos2 - p Pierson et al. Introduction Water waves generated by the wind are multidirectional random waves. The wave energy increases, 1970 , the Joint North Sea Wave Project JONSWAP spectrum Hassel- mann et al. 1973 , and the TEXEL storm

Haller, Merrick

206

DOCUMENTS DE TRAVAIL -WORKING PAPERS The spread of international financial shocks to Asean  

E-Print Network [OSTI]

to Asean countries Céline Gimet Décembre 2009 GATE Groupe d'Analyse et de Théorie �conomique UMR 5824 du;1 The spread of international financial shocks to Asean countries Céline Gimet1 November 2009 ABSTRACT This article focuses on the reaction of Asean economies to international financial shocks. The crises

Paris-Sud XI, Université de

207

A Spreading Activation Framework for Ontology-enhanced Adaptive Information Access  

E-Print Network [OSTI]

A Spreading Activation Framework for Ontology-enhanced Adaptive Information Access Md Maruf Hasan for Ontology-enhanced Adaptive Information Access Md Maruf Hasan, Enrico Motta, John B. Domingue, Simon Keynes, MK7 6AA, United Kingdom {m.m.hasan, e.motta, j.b.domingue, s.buckingham.sham, m.vargas-vera, m

208

Modelling the influence of human behaviour on the spread of infectious diseases: a review  

Science Journals Connector (OSTI)

...Funk 1 Marcel Salathe 2 * Vincent A. A. Jansen 1 * Author for correspondence ( salathe...more recently, with the MMR vaccine (Jansen et al. 2003). By making a rational...Gilad, C. Watkins, and V. A. A. Jansen 2009 The spread of awareness and its impact...

2010-01-01T23:59:59.000Z

209

Lifeasweknowit To understand the human genome, researchers must spread their wings to all branches of life.  

E-Print Network [OSTI]

and a worm to its ENCODE project, which aims to catalogue all the functional parts of the human genome is moving more forcefully into purely human genomics. The biggest new projects recently announcedLifeasweknowit To understand the human genome, researchers must spread their wings to all branches

Pratt, Vaughan

210

Current spread and overheating of high power laser bars B. Laikhtmana)  

E-Print Network [OSTI]

-power lasers, the width of the stripe is much larger than the cladding thick- ness, and the substrate thicknessCurrent spread and overheating of high power laser bars B. Laikhtmana) Power Photonic, 214 Old 11794 Received 27 May 2003; accepted 12 January 2004 The heating of a semiconductor laser bar imbedded

211

The Point Spread Function of the Human Head and its Implications for Transcranial Current  

E-Print Network [OSTI]

The Point Spread Function of the Human Head and its Implications for Transcranial Current distribution in the head resulting from the application of scalp currents. Derivation of forward models has represented a major effort in brain stimulation research, with model complexity ranging from spherical shells

Parra, Lucas C.

212

Modeling the Spread of Methicillin-Resistant Staphylococcus aureus in Nursing Homes for Elderly  

E-Print Network [OSTI]

Modeling the Spread of Methicillin-Resistant Staphylococcus aureus in Nursing Homes for Elderly hospital settings, including nursing homes. It is an important nosocomial pathogen that causes mortality homes is both hospital- and community-like. Transmission occurs via hands of health care workers (HCWs

Ruan, Shigui

213

Evaluation and Tuning of Model Trajectories and Spreading Rates in the Baltic Sea Using  

E-Print Network [OSTI]

Stockholm, Sweden e-mail: joakim@misu.su.se K. Döös e-mail: doos@misu.su.se T. Soomere Wave Engineering. The initial spreading, up to a distance of about d = 100­150 m, is governed by the power law d t0.27 whereas

Döös, Kristofer

214

A state-space solution search method for apparel industry spreading and cutting  

Science Journals Connector (OSTI)

The spreading of fabric onto cutting tables in several layers, and the cutting of this fabric in the most cost-efficient manner to produce a pre-determined number of garments is the apparel manufacturing phase that precedes assembly (sewing) and finishing. The problem consists of determining the lowest cost spreading and cutting schedule for garments of different styles, colors, and sizes, subject to physical constraints of cutting table length and cutting knife height as well as business constraints of required demand for each stock-keeping unit (SKU). The determination of this optimal spreading and cutting schedule for various garment styles is a difficult combinatorial NP-complete optimization problem. This paper proposes the use of an innovative state-space approach using heuristic rules to solve the problem: it is modeled as a least-cost search in a graph where each node represents a different spreading and cutting schedule. Several solution algorithms and heuristics are proposed and tested and an illustrative application to a Brazilian apparel company is presented.

Daniela B. Nascimento; J. Neiva de Figueiredo; S.F. Mayerle; P.R. Nascimento; R.M. Casali

2010-01-01T23:59:59.000Z

215

Trends and characteristics of part-time farming in post-war Japan  

Science Journals Connector (OSTI)

Part-time farming is a wide-spread phenomenon in contemporary rural Japan. Characterized by an extremely small-scale rice ... unimodal equitable rural development, most Japanese farm households have combined farm...

R. Kada

1982-01-01T23:59:59.000Z

216

EE 744 Coding Theory and Spread Spectrum Class Info: Meeting time: 2:20-3:40 Tuesday and Thursday  

E-Print Network [OSTI]

. Fundamentals of Codes, Graphs, and Iterative Decoding, Kluwer, 2003. Objectives: By the end of the semester you student handbook. The penalties for cheating and plagiarism are defined in the handbook. Web Site: A web

Joiner, Laurie L.

217

J. Phycol. 39, 411 (2003) THE SYMBIOTIC BIRTH AND SPREAD OF PLASTIDS: HOW MANY TIMES AND WHODUNIT?  

E-Print Network [OSTI]

primary, cyanobacterial endosymbio- sis. Although the analyses in this issue by Stiller and colleagues is the subject of a paper in this issue by Stiller et al. (2003), who challenge the widespread view that primary

Palmer, Jeffrey

218

A microscopic model for thin lm spreading Douglas B. Abraham 1 , Rodolfo Cuerno 2 , and Esteban Moro 1  

E-Print Network [OSTI]

A microscopic model for thin #12;lm spreading Douglas B. Abraham 1 , Rodolfo Cuerno 2 , and Esteban-temporal uc- tuations of the precursor #12;lm observed in spreading experiments. Matter is transported both;lm about one molecule thick; this can be followed laterally out to an extension of the order of 10 7

Moro, Esteban

219

Revealing latent factors of temporal networks for mesoscale intervention in epidemic spread  

E-Print Network [OSTI]

The customary perspective to reason about epidemic mitigation in temporal networks hinges on the identification of nodes with specific features or network roles. The ensuing individual-based control strategies, however, are difficult to carry out in practice and ignore important correlations between topological and temporal patterns. Here we adopt a mesoscopic perspective and present a principled framework to identify collective features at multiple scales and rank their importance for epidemic spread. We use tensor decomposition techniques to build an additive representation of a temporal network in terms of mesostructures, such as cohesive clusters and temporally-localized mixing patterns. This representation allows to determine the impact of individual mesostructures on epidemic spread and to assess the effect of targeted interventions that remove chosen structures. We illustrate this approach using high-resolution social network data on face-to-face interactions in a school and show that our method afford...

Gauvin, Laetitia; Barrat, Alain; Cattuto, Ciro

2015-01-01T23:59:59.000Z

220

Space charge modeling of dense electron beams with large energy spreads  

Science Journals Connector (OSTI)

Theoretical and numerical studies of the transport in vacuum of multi-nC, multi-MeV electron beams are performed using several methods, including envelope models, a novel semianalytic approach using ellipsoidal shell decomposition, a modified electrostatic particle-in-cell method, and a point-to-point interaction model. The effects of space-charge forces on the longitudinal and transverse bunch properties are evaluated for various bunch lengths, energies, energy spreads, and charges. An evaluation of the various methods for studying space-charge effects in large energy spread, high charge beams is summarized. Examples are given for beam distributions typical of those generated by plasma-based accelerators. It is found that, for the highly correlated beams produced in the self-modulated regime, the high energy portion of the beam can gain significant energy while propagating in vacuum due to space-charge effects.

G. Fubiani; J. Qiang; E. Esarey; W. P. Leemans; G. Dugan

2006-06-22T23:59:59.000Z

Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

A Hierarchy of Linear Threshold Models for the Spread of Political Revolutions on Social Networks  

E-Print Network [OSTI]

We study a linear threshold agent-based model (ABM) for the spread of political revolutions on social networks using empirical network data. We propose new techniques for building a hierarchy of simplified ordinary differential equation (ODE) based models that aim to capture essential features of the ABM, including effects of the actual networks, and give insight in the parameter regime transitions of the ABM. We relate the ABM and the hierarchy of models to a population-level compartmental ODE model that we proposed previously for the spread of political revolutions [1], which is shown to be mathematically consistent with the proposed ABM and provides a way to analyze the global behaviour of the ABM. This consistency with the linear threshold ABM also provides further justification a posteriori for the compartmental model of [1]. Extending concepts from epidemiological modelling, we define a basic reproduction number $R_0$ for the linear threshold ABM and apply it to predict ABM behaviour on empirical networ...

Lang, John C

2015-01-01T23:59:59.000Z

222

Modelling of Infrared emission from Cyg X3 and the UKIRT IRCAM3 point spread function  

E-Print Network [OSTI]

in order to test for any extended emission around the X­ray binary Cyg X­3. We found that the point spread ranging from 12 magnitude (Cyg X­3) to 18th mag for some of the faintest stars. The positions of the stars instrument. 2 #12; 2.1 k­band image The k­band image, figure 2 or the finder chart provided by Fender (Fender

Ogley, Richard

223

How Do You Spread the Word About Saving Energy? | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

How Do You Spread the Word About Saving Energy? How Do You Spread the Word About Saving Energy? How Do You Spread the Word About Saving Energy? May 25, 2012 - 2:03pm Addthis Earlier this week, Drew talked about how you can follow Energy Savers and the Office of Energy Efficiency and Renewable Energy on Facebook. But do you share energy saving tips with your own friends, family, and readers? Do you use social media? Do you share tips about how to save energy? And if you do, how? You have the chance to share your thoughts on a question about energy efficiency or renewable energy for consumers. E-mail your responses to the Energy Saver team at consumer.webmaster@nrel.gov. Addthis Related Articles Navigating the New EnergySaver.gov What Are Your Top Tips for Saving Energy? By taking simple steps to improve your home's energy efficiency, you can save up to 30 percent on your energy bill. | Infographic by Sarah Gerrity.

224

On compensating tune spread induced by space charge in bunched beams  

SciTech Connect (OSTI)

Space charge effects play significant role in modern-day accelerators. These effects frequently constrain attainable beam parameters in an accelerator, or, in an accelerator chain. They also could limit the luminosity of hadron colliders operating either at low energies or with a sub-TeV high brightness hadron beams. The latter is applied for strongly cooled proton and ion beams in eRHIC – the proposed future electron-ion collider at Brookhaven National Laboratory. A number of schemes for compensating space charge effects in a coasting (e.g. continuous) hadron beam were proposed and some of them had been tested. Using a proper transverse profile of the electron beam (or plasma column) for a coasting beam would compensate both the tune shift and the tune spread in the hadron beam. But all of these methods do not address the issue of tune spread compensation of a bunched hadron beam, e.g. the tune shift dependence on the longitudinal position inside the bunch. In this paper we propose and evaluate a novel idea of using a co-propagating electron bunch with miss-matched longitudinal velocity to compensate the space charge induced tune-shift and tune spread. We present a number of practical examples of such system.

Litvinenko, V. N.; Wang, G.

2014-05-09T23:59:59.000Z

225

Saturday: Lasagna and potato wedges prep time: 30mins Cooking time: 1 hr Items: 1 ice-cream container and 1 yoghurt container of white sauce  

E-Print Network [OSTI]

Saturday: Lasagna and potato wedges prep time: 30mins Cooking time: 1 hr Items: 1 ice of bean mixture (vegetarian option) 1 supermarket bag of potato wedges, pre-seasoned and cooked 3 boxes! If you want it to cook in time, DON"T OPEN THE OVEN!) The potato wedges are already cooked, so spread

Sainudiin, Raazesh

226

Modeling the Spread and Outbreak Dynamics of Avian Influenza (H5N1) Virus and Its Possible Control  

Science Journals Connector (OSTI)

Avian Influenza, commonly known as Bird Flu, is an epidemic caused by H5N1 Virus ... The present chapter is aimed at developing mathematical models that predict the spread and outbreak diversity of low pathogenic...

V. Sree Hari Rao; Ranjit Kumar Upadhyay

2013-01-01T23:59:59.000Z

227

Nonvolcanic seafloor spreading and corner-flow rotation accommodated by extensional faulting at 15N on the Mid-  

E-Print Network [OSTI]

mafic crust is constructed by volcanism and shallow magma intrusion (Figure 1a) [e.g., Sinton sections of intermediate- and slow- spreading ridges [Sinton and Detrick, 1992]. Non-

228

Russia's Wild Wild South: Two Tales of Economic Woes, Political Corruption and Spreading Insurgent Violence in Ingushetia and Dagestan  

E-Print Network [OSTI]

The Northern Caucasus has been a troubled region for the Russian Federation for nearly two decades. In the 1990s, two wars took place in Chechnya and violence spread into the neighboring republics of Ingushetia and Dagestan. ...

Grandstaff, John M.

2011-05-14T23:59:59.000Z

229

Annex A -Potential threats in EU Organism(s) Means of spread Control measures Control approaches being used in  

E-Print Network [OSTI]

Annex A - Potential threats in EU Organism(s) Means of spread Control measures Control approaches options Potential threats in EU keep out, knowledge of trade routes, awareness on nurseries, foresters

230

A Multidomain Model for Ionic Electrodiffusion and Osmosis with an Application to Cortical Spreading Depression  

E-Print Network [OSTI]

Ionic electrodiffusion and osmotic water flow are central processes in many physiological systems. We formulate a system of partial differential equations that governs ion movement and water flow in biological tissue. A salient feature of this model is that it satisfies a free energy identity, ensuring the thermodynamic consistency of the model. A numerical scheme is developed for the model in one spatial dimension and is applied to a model of cortical spreading depression, a propagating breakdown of ionic and cell volume homeostasis in the brain.

Yoichiro Mori

2014-10-30T23:59:59.000Z

231

On the spreading of Weddell Sea deep water in the southwestern Atlantic Ocean  

E-Print Network [OSTI]

poleward heat flux by abyssal boundary currents across the ACC. 35' S ARGENTINE BASIN 45' S * 0 ~ rlL OEI WICH IN 55' S 65' S RGB o ~D 6' pI 1 WEDDELL SEA Attt Btk 70 W 60' W 50' W 40' W 30' W 20 W 10' W 0 Fig 2. Bathymetric chart... Water. Chlorofluorocarbon measurements indicate that WSDW with an age of about a decade can reach the Georgia Basin via the Scotia Sea faster than by spreading equatorward over the South Sandwich Trench. Geostrophic calculations show that about 1. 8...

Locarnini, Ricardo A

2012-06-07T23:59:59.000Z

232

Speculation and Return Volatility: Evidence from the WTI Crude Oil Market.  

E-Print Network [OSTI]

??Based on the data of the Commitments of Traders reports from 2000 to 2013, this paper investigates the impact of speculative futures trading on the… (more)

Wang, Rui

2013-01-01T23:59:59.000Z

233

Explaining the convenience yield in the WTI crude oil market using realized volatility and jumps  

Science Journals Connector (OSTI)

Abstract In this paper, we first provide an empirical evidence of the existence of intraday jumps in the crude oil price series. We then show that these jumps, in conjunction with realized volatility measures, are important in modeling the convenience yield over the 2001–2010 period. Our empirical results indicate that lagged jump mean only explains around 16% of the weekly convenience yield. Our best specification, including variation in inventories, 8-week realized variance and the 250-day jump mean is able to explain around 61% of the weekly convenience yield. Importantly, our results are not driven by the simultaneous determination of the various variables at work as we only use lagged variables in all regressions.

Benoît Sévi

2015-01-01T23:59:59.000Z

234

The role of trader positions in spot and futures prices for WTI  

Science Journals Connector (OSTI)

Abstract We extend the analysis of causal relations between trader positions and oil prices and the process of price discovery by estimating a cointegrating vector autoregression (CVAR) model that expands the cash-and-carry relation between spot and futures prices to quantify long- and short-run relations among oil prices, trader positions, interest rates, and oil inventories. Results indicate that oil inventories and trader positions are needed to generate cointegration between spot and futures prices. The presence of trader positions and oil inventories suggest that both play a role in price discovery. Furthermore, the cointegrating relation for price loads into the equation for both oil prices and trader positions. This suggests a bi-directional simultaneous adjustment process between oil prices and trader positions. This expands the unidirectional causal relation from oil prices to trader positions that is generated by previous studies. Additional results suggest that price discovery occurs in the market for heavily traded near-month futures contracts, but discovery for thin far-month futures markets occurs in the spot market. Together, these results suggest mechanisms by which speculation could affect oil prices but the results presented here are moot regarding their effects.

Marek Kolodziej; Robert K. Kaufmann

2013-01-01T23:59:59.000Z

235

Conceptual design and comparison of aramid and polyester taut leg spread moorings for deepwater applications  

SciTech Connect (OSTI)

As the offshore industry looks beyond water depths of 3,000 ft for future oil and gas production, the industry standard steel catenary spread mooring (CSM) system used on all floating production systems installed to date becomes increasingly inefficient and costly. An alternative to the CSM is the Taut Leg Spread Mooring (TLSM) system with its characteristic short scope legs and vertically loaded anchors. In water depths greater than 3,000 ft, it has been shown that TLSMs comprised of synthetic mooring lines have performance advantages over systems utilizing steel wire rope and demonstrated potential for significant cost reductions. Early studies investigated the use of aramid fiber rope due to its high strength, lower in-water weight and lower axial stiffness as compared to ropes made from steel. Later studies indicated that the material properties of polyester fiber, primarily its lower Young`s modulus, made polyester mooring lines more suitable for use in TLSMs. As the TLSM knowledge base expanded, aramid rope construction evolved. Earlier efforts to match the characteristics of steel wire rope have given way to new generation soft aramid constructions. This paper compares the mooring performance and total installed cost of a soft aramid TLSM to a typical polyester configuration. Both systems were designed for use in the Gulf of Mexico (GOM) with an FPS based on the Aker P45.

Wilde, B.; Kelly, P.; Librino, F.; Whitehill, A.S.

1996-12-31T23:59:59.000Z

236

Photon data shed new light upon the GDR spreading width in heavy nuclei  

E-Print Network [OSTI]

A global study of the electric dipole strength in and below the isovector giant dipole resonance (GDR) is presented for mass numbers A>80. It relies on the recently established remarkably good match between data for the nuclear photo effect to novel photon scattering data covering the region below the neutron emission threshold as well as by average resonance neutron capture (ARC). From the wide energy coverage of these data the correlation of the GDR spreading width with energy can be studied with remarkable accuracy. A clear sensitivity to details of the nuclear shape, i.e. the beta- and gamma-deformations, is demonstrated. Based hereon a new parameterization of the energy dependence of the nuclear electric-dipole strength is proposed which - with only two new parameters - allows to describe the dipole strength in all heavy nuclei with A>80. Although it differs significantly from previous parameterizations it holds for spherical, transitional, triaxial and well deformed nuclei. The GDR spreading width depends in a regular way on the respective resonance energy, but it is independent of the photon energy.

A. R. Junghans; G. Rusev; R. Schwengner; A. Wagner; E. Grosse

2008-10-13T23:59:59.000Z

237

Product Price Spreads Over Crude Oil Vary With Seasons and Supply/Demand  

Gasoline and Diesel Fuel Update (EIA)

6 6 Notes: Of course, petroleum product prices don't move in lockstep to crude oil prices, for a number of reasons. We find it useful to look at variations in the spread between product and crude oil prices, in this case comparing spot market prices for each. The difference between heating oil and crude oil spot prices tends to vary seasonally; that is, it's generally higher in the winter, when demand for distillate fuels is higher due to heating requirements, and lower in the summer. (Gasoline, as we'll see later, generally does the opposite.) However, other factors affecting supply and demand, including the relative severity of winter weather, can greatly distort these "typical" seasonal trends. As seen on this chart, the winters of 1995-96 and 1996-97 featured

238

What can you do to stop the flu? Cover your cough! Help stop the spread of germs by  

E-Print Network [OSTI]

What can you do to stop the flu? · Cover your cough! Help stop the spread of germs by covering your mouth and nose when you cough or sneeze with a tissue or with your upper sleeve. · Wash your hands surfaces. · Flu symptoms include: - Fever - Extreme tiredness - Headache - Cough - Muscle aches - Runny

Burke, Peter

239

Improved photovoltaic performance of InGaN/GaN solar cells with optimized transparent current spreading layers  

Science Journals Connector (OSTI)

In0.135Ga0.865N/GaN p–i–n solar cells are fabricated and investigated with three types of transparent current spreading layers (TCSLs): Ni/Au layer type (Ni/Au-L), Ni/Au grid type (Ni/Au-G), and ITO layer type (I...

X. M. Cai; Y. Wang; Z. D. Li; X. Q. Lv; J. Y. Zhang; L. Y. Ying…

2013-05-01T23:59:59.000Z

240

Morphology and segmentation of the western Galapagos Spreading Center, 90.598W: Plume-ridge interaction at  

E-Print Network [OSTI]

-ridge interaction at an intermediate spreading ridge John Sinton Department of Geology and Geophysics, University of Hawai`i, Honolulu, Hawai`i 96822, USA (sinton@hawaii.edu) Robert Detrick and J. Pablo Canales Department. Sinton, J., R. Detrick, J. P. Canales, G. Ito, and M. Behn, Morphology and segmentation of the western

Ito, Garrett

Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

First Observation of the Point Spread Function of Optical Transition Radiation Pavel Karataev,1,* Alexander Aryshev,2  

E-Print Network [OSTI]

First Observation of the Point Spread Function of Optical Transition Radiation Pavel Karataev,1 Energy Accelerator Research Organization, 1-1 Oho, Tsukuba, Ibaraki 305-0801, Japan 3 John Adams) of optical transition radiation (OTR) performed at KEK-Accelerator Test Facility extraction line. We have

Sheldon, Nathan D.

242

A numerical model of hydrothermal cooling and crustal accretion at a fast spreading mid-ocean ridge  

E-Print Network [OSTI]

: 7360 words, 11 figures. Keywords: Mid-ocean ridge processes; hydrothermal cooling; numerical modelA numerical model of hydrothermal cooling and crustal accretion at a fast spreading mid-ocean ridge present a steady state numerical representation of the sill model that explicitly includes hydrothermal

Toomey, Doug

243

Two-dimensional nonlinear advection?diffusion in a model of surfactant spreading on a thin liquid film  

Science Journals Connector (OSTI)

......Grotberg, 1994; Halpern et al., 1998), notably as a vehicle for drug delivery. + Present address: Department of Biomedical...mathematical model for the transport and spreading of oil slicks. Ecological Model. 22, 325 - 339. O ' B RIEN, S. B. G. M 1993 On......

H. A. R. Williams; O. E. Jensen

2001-01-01T23:59:59.000Z

244

Background Model formulation Patch model SIK model Conclusions War of the Worlds: Modelling the spread of an  

E-Print Network [OSTI]

Background Model formulation Patch model SIK model Conclusions War of the Worlds: Modelling the spread of an invasive species an #12;Background Model formulation Patch model SIK model Conclusions Model formulation Patch model SIK model Conclusions Outline 1 Background 2 Model formulation Equations

Linder, Tamás

245

Digestion time  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Digestion time Digestion time Name: Don Mancosh Location: N/A Country: N/A Date: N/A Question: I have always given the rule of thumb in class that material we eat is with us for about 24 hours before exiting the body. The question arises about the time value of liquids. Getting a big coke prior to a 3 hour drive generally means that there will be a stop along the way. Is there a generalization made about liquids in the body similar to the one for solid food? Replies: A physician would give a better answer, but I hazard this: the only liquids which people consume (deliberately) in significant quantities are water, ethyl alcohol and various oils. Water and alcohol are absorbed on a time scale of seconds to minutes through the mouth, stomach and digestive tract. The oils are huge molecules, so I'd guess like any other greasy food they get absorbed in the upper digestive tract. Some of them, perhaps the longest and most nonpolar, are not absorbed at all --- cf. the old-time remedy of mineral oil for constipation --- so there should be some average time-before-what's-left-is-excreted such as you're looking for, and my (wild) guess is that it would not differ substantially from that for food. You can define an average lifetime in the body for alcohol, since the natural level is zero. Rough guidelines are widespread in the context of drunk driving laws. But this is not really possible for water. One's body is normally full up to the brim with water, and there's no way for the body to distinguish between water molecules recently absorbed and molecules that've been moping around since the Beatles split up. Thus the water entering the toilet bowl after the pit stop is not in general the same water as was in the big coke. If you were to consider for water just the average time between drinking and peeing, it would seem to depend strongly on how well hydrated the body was before the drink, and how much was drunk. During sustained heavy exertion in the sun and dry air one can easily drink a pint of water an hour without peeing at all. On the other hand, if one is willing to drink enough water fast enough, so as to establish a high excess of body water one can pee 8 ounces 15 minutes or less after drinking 8 ounces.

246

The reversibility of the glutathionyl-quercetin adduct spreads oxidized quercetin-induced toxicity  

SciTech Connect (OSTI)

Quercetin is one of the most prominent dietary antioxidants. During its antioxidant activity, quercetin becomes oxidized into its o-quinone/quinone methide QQ. QQ is toxic since it instantaneously reacts with thiols of, e.g., proteins. In cells, QQ will initially form an adduct with glutathione (GSH), giving GSQ. We have found that GSQ is not stable; it dissociates continuously into GSH and QQ with a half life of 2 min. Surprisingly, GSQ incubated with 2-mercapto-ethanol (MSH), a far less reactive thiol, results in the conversion of GSQ into the MSH-adduct MSQ. A similar conversion of GSQ into relatively stable protein thiol-quercetin adducts is expected. With the dithiol dihydrolipoic acid (L(SH){sub 2}), quercetin is formed out of GSQ. These results indicate that GSQ acts as transport and storage of QQ. In that way, the initially highly focussed toxicity of QQ is dispersed by the formation of GSQ that finally spreads QQ-induced toxicity, probably even over cells.

Boots, Agnes W. [Department of Pharmacology and Toxicology, Faculty of Medicine, University of Maastricht, P.O. Box 616, 6200 MD Maastricht (Netherlands)]. E-mail: a.boots@farmaco.unimaas.nl; Balk, Jiska M. [Department of Pharmacology and Toxicology, Faculty of Medicine, University of Maastricht, P.O. Box 616, 6200 MD Maastricht (Netherlands); Bast, Aalt [Department of Pharmacology and Toxicology, Faculty of Medicine, University of Maastricht, P.O. Box 616, 6200 MD Maastricht (Netherlands); Haenen, Guido R.M.M. [Department of Pharmacology and Toxicology, Faculty of Medicine, University of Maastricht, P.O. Box 616, 6200 MD Maastricht (Netherlands)

2005-12-16T23:59:59.000Z

247

Stopping the spread of nuclear weapons. The Heritage lectures; No. 506  

SciTech Connect (OSTI)

This lecture is on the proliferation of nuclear arms. More precisely, it will be on how best to prevent the proliferation of nuclear arms. For as much as the policy community may disagree about the proper policies for preventing nuclear proliferation, the author thinks all share the goal of preventing proliferation. The best prescription for preventing all sorts of proliferation - biological, chemical, missile, and space technology, as well as nuclear is for the U.S. government to pursue a balanced non-proliferation policy. Such a balanced policy requires bringing four distinct approaches to addressing the proliferation problem together in a coherent fashion. These distinct approaches are: (1) deterring the use of the weapon in question, (2) defending against the use of the weapon in question, (3) destroying preemptively the weapon in question, and (4) controlling the spread of the weapon in question directly through arms control. In the authors view, a balanced and effective nonproliferation policy should not shun or slight any of these approaches. All make a unique contribution toward the whole and serve to reinforce one another in limiting the effects of proliferation and ultimately discouraging proliferation itself. This does not mean, however, that there is no requirement to make trade-offs among the four. Indeed, the real trick is assuring that there is an appropriate division of labor among the four. The author explains this general policy in terms of the specific challenges posed by the proliferation of nuclear arms.

Spring, B.

1994-12-31T23:59:59.000Z

248

Female Team Overall Name Age Rank Time Rank Time Rank Time Pace Rank Time Rank Time Pace Time  

E-Print Network [OSTI]

Female Team Overall Name Age Rank Time Rank Time Rank Time Pace Rank Time Rank Time Pace Time 1 Amy:56:27.6 Deborah Mc Eligot Deborah Storrings Male Team Overall Name Age Rank Time Rank Time Rank Time Pace Rank Time Rank Time Pace Time 1 Macon Fessenden 20 1 5:42.2 2 0:26.9 1 34:29.7 3:23 1 0:12.8 1 17:41.1 3

Suzuki, Masatsugu

249

Universitt Tbingen Mathematisches Institut  

E-Print Network [OSTI]

Approximation S() := m-1 i=0 [(1 - )Wti + Wti+1 ](Wti+1 - Wti ) des Integrals t 0 WsdWs. Zeigen Sie lim ||||0 S

Tübingen, Universität

250

The point-spread function measure of resolution for the 3-D electrical resistivity experiment  

Science Journals Connector (OSTI)

......infrastructure. Application to a time-lapse ground-water monitoring experiment demonstrates the utility...localization. Application of the PSF to a time-lapse ground-water remediation experiment demonstrates the utility of the PSF......

Greg A. Oldenborger; Partha S. Routh

2009-02-01T23:59:59.000Z

251

Emergence, spread, persistence and fade-out of sylvatic plague in Kazakhstan  

Science Journals Connector (OSTI)

...observation motivated our study of the space-time dynamics of plague...methods were applied. Only space-time points (i,t) that...routine contained in the MASS library [40]. The results were combined...a model describing the local space-time dynamics of the disease...

2011-01-01T23:59:59.000Z

252

Damage Spreading in a 2D Ising Model with SwendsenWang Dynamics Haye Hinrichsen 1;2 , Eytan Domany 1 and Dietrich Stauffer 3;4  

E-Print Network [OSTI]

Damage Spreading in a 2D Ising Model with Swendsen­Wang Dynamics Haye Hinrichsen 1;2 , Eytan Domany K¨oln, Germany (printed: February 10, 1998) Damage spreading for 2D Ising cluster dynamics to be a useful tool [4] to investigate the dynamics of Ising models. Two replicas of the same system, which

Domany, Eytan

253

Measles virus mutants possessing the fusion protein with enhanced fusion activity spread effectively in neuronal cells without causing strong cytopathology, but not in other cells  

Science Journals Connector (OSTI)

...in human neuroblastoma cell lines and brains of suckling hamsters. In this study...these viruses spread efficiently in the brains of SLAM knock-in mice, they did not...virus spread in human neuronal cells and brains of suckling hamsters. In this study...

Shumpei Watanabe; Shinji Ohno; Yuta Shirogane; Satoshi O. Suzuki; Ritsuko Koga; Yusuke Yanagi

2014-12-17T23:59:59.000Z

254

The potential role of wildlife in the spread and control of foot and mouth disease in an extensive livestock management system  

E-Print Network [OSTI]

. This research project is designed to investigate the potential role of wildlife (deer) in the transmission and spread of FMD in an extensive livestock management system in southern Texas. The spread of FMD was simulated in white tailed deer populations using a...

Highfield, Linda

2009-05-15T23:59:59.000Z

255

Surface Structure Spread Single Crystals ((SC)-C-4): Preparation and characterization  

SciTech Connect (OSTI)

A set of six spherically curved Cu single crystals referred to as Surface Structure Spread Single Crystals (S{sup 4}Cs) has been prepared in such a way that their exposed surfaces collectively span all possible crystallographic surface orientations that can be cleaved from the face centered cubic Cu lattice. The method for preparing these S{sup 4}Cs and for finding the high symmetry pole point are described. Optical profilometry has been used to determine the true shapes of the S{sup 4}Cs and show that over the majority of the surface, the shape is extremely close to that of a perfect sphere. The local orientations of the surfaces lie within ±1{degree} of the orientation expected on the basis of the spherical shape; their orientation is as good as that of many commercially prepared single crystals. STM imaging has been used to characterize the atomic level structure of the Cu(111)±11{degree}-S{sup 4}C. This has shown that the average step densities and the average step orientations match those expected based on the spherical shape. In other words, although there is some distribution of step-step spacing and step orientations, there is no evidence of large scale reconstruction or faceting. The Cu S{sup 4}Cs have local structures based on the ideal termination of the face centered cubic Cu lattice in the direction of termination. The set of Cu S{sup 4}Cs will serve as the basis for high throughput investigations of structure sensitive surface chemistry on Cu.

de Alwis, A.; Holsclaw, B.; Pushkarev, V. V.; Reinicker, A.; Lawton, T. J.; Blecher, M. E.; Sykes, E. C. H.; Gellman, A. J.

2013-02-01T23:59:59.000Z

256

Time Brightness  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Perlmutter, et al., in Thermonuclear Supernovae, NATO ASI, v. 486 (1997) Perlmutter, et al., in Thermonuclear Supernovae, NATO ASI, v. 486 (1997) Cosmology from . . . Time Brightness ... . . . 50-100 Fields Lunar Calendar Scheduled Follow-Up Imaging at Hubble, Cerro Tololo, WIYN, Isaac Newton Scheduled Follow-Up Spectroscopy at Keck Almost 1000 Galaxies per Field RESULT: ~24 Type Ia supernovae discovered while still brightening, at new moon Berkeley Lab Keck WIYN Cerro Tololo Isaac Newton Hubble Strategy We developed a strategy to guarantee a group of supernova discoveries on a certain date. Just after a new moon, we observe some 50 to 100 high-galactic lattitute fields-each containing almost a thousand high-redshift galaxies-in two nights on the Cerro Tololo 4-meter telescope with Tyson & Bernstein's wide-field camera. We return three weeks later to observe the same

257

Evidence for extinct subduction zones and spreading centers in the Sulu and Celebes Seas from gravity and seismic refraction data  

E-Print Network [OSTI]

EVIDENCE FOR EXTINCT SUBDUCTION ZONES AND SPREADING CENTERS IN THE SULU AND CELEBES SEAS FROM GRAVITY AND SEISMIC REFRACTION DATA A Thesis by FAKHAR HABIB SYED Submitted to the 0%ce of Graduate Studies of Texas ARM University in partial... to examine the tectonic features of the study area. The results of gravity modeling using existing seismic reflection and refraction data (Murauchi et al. , 1973) are consistent with the concept that subduction existed along both margins of the Sulu Arc...

Syed, Fakhar Habib

2012-06-07T23:59:59.000Z

258

Measurement of Propagation Time Dispersion in a Scintillator  

E-Print Network [OSTI]

One contribution to the time resolution of a scintillation detector is the signal time spread due to path length variations of the detected photons from a point source. In an experimental study a rectangular scintillator was excited by means of a fast pulsed ultraviolet laser at different positions along its longitudinal axis. Timing measurements with a photomultiplier tube in a detection plane displaced from the scintillator end face showed a correlation between signal time and tube position indicating only a small distortion of photon angles during transmission. The data is in good agreement with a Monte Carlo simulation used to compute the average photon angle with respect to the detection plane and the average propagation time. Limitations on timing performance that arise from propagation time dispersion are expected for long and thin scintillators used in future particle identification systems.

P. Achenbach; C. Ayerbe Gayoso; J. Bernauer; R. Böhm; M. O. Distler; L. Doria; J. Friedrich; H. Merkel; U. Müller; L. Nungesser; J. Pochodzalla; S. Sánchez Majos; S. Schlimme; Th. Walcher; M. Weinriefer

2007-02-25T23:59:59.000Z

259

Weyl's principle, cosmic time and quantum fundamentalism  

E-Print Network [OSTI]

We examine the necessary physical underpinnings for setting up the cosmological standard model with a global cosmic time parameter. In particular, we discuss the role of Weyl's principle which asserts that cosmic matter moves according to certain regularity requirements. After a brief historical introduction to Weyl's principle we argue that although the principle is often not explicitly mentioned in modern standard texts on cosmology, it is implicitly assumed and is, in fact, necessary for a physically well-defined notion of cosmic time. We finally point out that Weyl's principle might be in conflict with the wide-spread idea that the universe at some very early stage can be described exclusively in terms of quantum theory.

Svend E. Rugh; Henrik Zinkernagel

2010-06-30T23:59:59.000Z

260

Weyl's principle, cosmic time and quantum fundamentalism  

E-Print Network [OSTI]

We examine the necessary physical underpinnings for setting up the cosmological standard model with a global cosmic time parameter. In particular, we discuss the role of Weyl's principle which asserts that cosmic matter moves according to certain regularity requirements. After a brief historical introduction to Weyl's principle we argue that although the principle is often not explicitly mentioned in modern standard texts on cosmology, it is implicitly assumed and is, in fact, necessary for a physically well-defined notion of cosmic time. We finally point out that Weyl's principle might be in conflict with the wide-spread idea that the universe at some very early stage can be described exclusively in terms of quantum theory.

Rugh, Svend E

2010-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

LINEAR TIME PERIODIC MODELLING OF POWER ELECTRONIC DEVICES FOR POWER SYSTEM HARMONIC ANALYSIS AND SIMULATION  

E-Print Network [OSTI]

LINEAR TIME PERIODIC MODELLING OF POWER ELECTRONIC DEVICES FOR POWER SYSTEM HARMONIC ANALYSIS by simulation. 1. INTRODUCTION The variety and the wide spread use of power electronic devices in the power networks is due to their diverse and multiple functions: compensation, protection and interface

Boyer, Edmond

262

Determining factors for Eurasian watermilfoil (M. spicatum) spread in and around Lake Tahoe, CA-NV  

E-Print Network [OSTI]

area underneath the curve (AOC), or discrimination capacity,for the unoccupied site. The AOC of the wavy-sites removedsites 71.29% of the time. AOC of the wavy and differing

Kendall, Bruce E.; MacIntyre, Sally

2008-01-01T23:59:59.000Z

263

Time-dependent entropy of simple quantum model systems  

Science Journals Connector (OSTI)

Information-theoretic entropy measures are useful tools for quantifying the spreading of quantum states in phase space. In the present paper, we compare the time evolution of the joint entropy for three simple quantum systems: (i) a free Gaussian wave packet, (ii) a wave packet in a monochromatic electromagnetic field, and (iii) a wave packet tunneling through a ? barrier. As initial condition maximal classical states are used, which minimize the Heisenberg uncertainty and the entropy. It is found that, in all three cases, the joint entropy increases in time.

Jörn Dunkel and Sergey A. Trigger

2005-05-10T23:59:59.000Z

264

Reducing ion energy spread in hole-boring radiation pressure acceleration by using two-ion-species targets  

E-Print Network [OSTI]

The generation of fast ion beams in the hole-boring radiation pressure acceleration by intense laser pulses has been studied for targets with different ion components. We find that the oscillation of the longitudinal electric field for accelerating ions can be effectively suppressed by using a two-ion-species target, because fast ions from a two-ion-species target are distributed into more bunches and each bunch bears less charge. Consequently, the energy spread of ion beams generated in the hole-boring radiation pressure acceleration can be greatly reduced down to 3.7% according to our numerical simulation.

Weng, S M; Sheng, Z M

2014-01-01T23:59:59.000Z

265

H-SPREAD: A Hybrid Multipath Scheme for Secure and Reliable Data Collection in Wireless  

E-Print Network [OSTI]

number of low-cost sensor nodes which work collectively to carry out some real-time sensing in a hostile ground, remote sensing in nuclear plants, mines, and other hazardous industrial venues, real are the common communication pattern. While a WSN is typically formed around one (or more) base station (BS, a

Hou, Y. Thomas

266

Spot Distillate & Crude Oil Prices  

Gasoline and Diesel Fuel Update (EIA)

mid-January, 2000. WTI crude oil price rose about $17 per mid-January, 2000. WTI crude oil price rose about $17 per barrel or 40 cents per gallon from its low point in mid February 1999 to January 17, 2000. Over this same time period, New York Harbor spot heating oil had risen about 42 cents per gallon, reflecting both the crude price rise and the beginning of a return to a more usual seasonal spread over the price of crude oil. The week ending January 21, distillate spot prices in the Northeast spiked dramatically to record levels, closing on Friday at $1.26 per gallon -- up 50 cents from the prior week. Gulf Coast prices were not spiking, but were probably pulled higher as the New York Harbor market began to draw on product from other areas. They closed at 83 cents per gallon, an increase of 11 cents from the prior Friday. Crude oil had risen about 4 cents from

267

Notes from Financial and Physical Oil Market Linkages  

Gasoline and Diesel Fuel Update (EIA)

Workshop Summary Notes Workshop Summary Notes Financial and Physical Oil Market Linkages II September 27, 2012 Department of Energy 1000 Independence Avenue, SW Washington, D.C. 20585 Session 1: 9:15 a.m. - 10:45 a.m. Paper Title: Physical Market Conditions, Paper Market Activity, and the Brent-WTI Spread Presenter: Michel Robe, American University Discussant: Lutz Kilian, University of Michigan Presentation: [Presentation materials link in here] Paper Abstract We document that, starting in the Fall of 2008, the benchmark West Texas Intermediate (WTI) crude oil has periodically traded at unheard of discounts to the corresponding Brent benchmark. We further document that this discount is not reflected in spreads between Brent and other benchmarks that are directly comparable to WTI. Drawing on extant models linking inventory

268

Calculation method using Clarkson integration for the physical dose at the center of the spread-out Bragg peak in carbon-ion radiotherapy  

SciTech Connect (OSTI)

Purpose: In broad-beam carbon-ion radiotherapy performed using the heavy-ion medical accelerator in Chiba, the number of monitor units is determined by measuring the physical dose at the center of the spread-out Bragg peak (SOBP) for the treatment beam. The total measurement time increases as the number of treatment beams increases, which hinders the treatment of an increased number of patients. Hence, Kusano et al.[Jpn. J. Med. Phys. 23(Suppl. 2), 65-68 (2003)] proposed a method to calculate the physical dose at the center of the SOBP for a treatment beam. Based on a recent study, the authors here propose a more accurate calculation method.Methods: The authors measured the physical dose at the center of the SOBP while varying the circular field size and range-shifter thickness. The authors obtained the physical dose at the center of the SOBP for an irregularly shaped beam using Clarkson integration based on these measurements.Results: The difference between the calculated and measured physical doses at the center of the SOBP varied with a change in the central angle of the sector segment. The differences between the calculated and measured physical doses at the center of the SOBP were within {+-}1% for all irregularly shaped beams that were used to validate the calculation method.Conclusions: The accuracy of the proposed method depends on both the number of angular intervals used for Clarkson integration and the fineness of the basic data used for calculations: sampling numbers for the field size and thickness of the range shifter. If those parameters are properly chosen, the authors can obtain a calculated monitor unit number with high accuracy sufficient for clinical applications.

Tajiri, Minoru; Maeda, Takamasa; Isobe, Yoshiharu; Kuroiwa, Toshitaka; Tanimoto, Katsuyuki; Shibayama, Koichi [Department of Hospital, Research Center for Charged Particle Therapy, National Institute of Radiological Sciences, 4-9-1 Anagawa, Inage-ku, Chiba 263-8555 (Japan); Koba, Yusuke; Fukuda, Shigekazu [Department of Medical Physics, Research Center for Charged Particle Therapy, National Institute of Radiological Sciences, 4-9-1 Anagawa, Inage-ku, Chiba 263-8555 (Japan)

2013-07-15T23:59:59.000Z

269

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incineration facility (East Liverpool, Ohio). Volume 1. Executive summary  

SciTech Connect (OSTI)

Contents: Introduction and Summary of Results; Facility Background; Facility Emissions; Atmospheric Dispersion and Deposition Modeling of Emissions; Human Health Risk Assessment; Screening Ecological Risk Assessment; Accident Analysis; Additional Analysis in Response to Peer Review Recommendations; References.

NONE

1997-05-01T23:59:59.000Z

270

Volatility regimes, asymmetric basis effects and forecasting performance: An empirical investigation of the WTI crude oil futures market  

Science Journals Connector (OSTI)

This study employs a flexible regime-switching EGARCH model with Student-t distributed error terms to investigate whether volatility regimes and basis affect the behavior of crude oil futures returns, including the conditional mean, variance, skewness, kurtosis as well as the extent of heavy-tailedness. The study also examines whether volatility regimes and asymmetric basis effects can improve the forecasting accuracy. The main merit of the empirical model is that the basis effect is allowed to be asymmetric and to vary across volatility regimes. Empirical results suggest that the conditional mean and variance respond to the basis asymmetrically and nonlinearly, and that the responses of transition probabilities to the basis are symmetric. Furthermore, the conditional higher moments are sensitive to the absolute value of basis, and the heavy tailed characteristic can be greatly alleviated by taking into account the asymmetric basis effects and regime switches. Finally, the regime switches and asymmetric basis effects play decisive roles in forecasting return, volatility and tail distribution.

Kuang-Liang Chang

2012-01-01T23:59:59.000Z

271

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incinerator facility (east Liverpool, Ohio). Volume 2. Introduction. Draft report  

SciTech Connect (OSTI)

This volume provides a description of the facility, and its location and setting in the three-state area of Ohio, Pennsylvania, and West Virginia; an overview of previous risk assessments conducted by U.S. EPA for this site, including the preliminary assessment of inhalation exposure and the screening-level risk analyses of indirect exposure; and a summary of comments provided by the Peer Review Panel on the Project Plan.

NONE

1995-11-01T23:59:59.000Z

272

Energy biomass from large rangeland shrubs of the intermountain United States. [Sagebrush, Saltbush, Greasewood, Rubber Rabbitbrush, Spreading Rabbitbush  

SciTech Connect (OSTI)

Large individual plants within a few species of rangeland shrubs were studied in several intermountain states for their potential use in establishing biomass fuel energy plantations. Biomass and other shrub physical characteristics plus site data were recorded for big sagebrush, fourwing saltbush, big saltbush, greasewood, rubber rabbitbrush, and spreading rabbitbrush (C. linifolius) in 34 locations. Samples of current year's growth and woody tissue were analyzed for burning qualities (heat of combustion, S, mositure, and ash content). Greatest biomass/plant of the individuals sampled was found in greasewood with fourwing saltbush, rubber rabbitbrush, and sagebrush following in decreasing order. Burning qualities varied among the species analyzed. The heat of combustion of the woody material from all shrubs was approximately 4500 kcal/kg, but current year's growth varied considerably among species.

van Epps, G.A.; Barker, J.R.; McKell, C.M.

1982-01-01T23:59:59.000Z

273

Precision Timed Machines  

E-Print Network [OSTI]

1.4 Precision Timed Machines . . . . .Precision Timed Machine 2.1precision timed (PRET) machine. pages 264–265, June 2007. [

Liu, Isaac Suyu

2012-01-01T23:59:59.000Z

274

Hippocampal ``Time Cells'': Time versus Path Integration  

E-Print Network [OSTI]

Neuron Article Hippocampal ``Time Cells'': Time versus Path Integration Benjamin J. Kraus,1 function of hippocampal networks (Etienne and Jeffery, 2004; McNaughton et al., 1991, 1996, 2006; O

Hasselmo, Michael

275

Time in quantum mechanics  

E-Print Network [OSTI]

OF CONTENTS I. INTRODUCTION II. HISTORICAL DEVELOPMENT A. Classical Mechanics B. Quantum Theory . C. The Problem 3 4 6 III. TIME ATOMS AND DISCRETE TIME A. The Earliest Applications of Atomistic and Discrete Time . . . . . B. The Radiating Electron... . C. Quantum Field Theory 8 10 l2 IV. TIME OPERATOR FORMULATIONS 16 A. Advocates Against a Time Operator . B. The Possibility of a Time Operator C, Advocates in Favor of a Time Operator D. A Restricted Time Delay Operator: Scattering Theory...

Chapin, Kimberly R.

2012-06-07T23:59:59.000Z

276

This Week In Petroleum Printer-Friendly Version  

Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

the start of October 2009, the daily closing spot price for West Texas Intermediate (WTI) crude oil has fallen between 70 and 85 dollars per barrel 92 percent of the time....

277

Geological and geophysical investigation of the Mid-Cayman Spreading Centre: seismic velocity measurements and implications for the constitution of layer 3  

Science Journals Connector (OSTI)

......Geophysics of the Pacific Ocean Basin and its Margin, eds Sutton...velocities of rocks from the Ming's Bight-Betts Cove Ophiolite Complex...spreading rates, in marginal basins, at different distances from...Geophysics of the Pacific Ocean Basin and its Margin, eds Sutton......

J. A. Karson; P. J. Fox

1986-04-01T23:59:59.000Z

278

ABSTRACT: Farms that once spread only manures are now also applying sewage biosolids (sludge) and/or other wastes such as  

E-Print Network [OSTI]

ABSTRACT: Farms that once spread only manures are now also applying sewage biosolids (sludge) and streamwater concentrations in most cases. (KEY TERMS: nonpoint source pollution; sludge; waste such as food processing wastes and sewage biosolids (sludge). A concurrent trend in agriculture is the con

Walter, M.Todd

279

Use of a Marker Organism To Model the Spread of Central Nervous System Tissue in Cattle and the Abattoir Environment during Commercial Stunning and Carcass Dressing  

Science Journals Connector (OSTI)

...McGinnis, and M. Badoni. 1996. Assessment of the hygienic characteristics...vacuum-hot water cleaning and steam pasteurisation during routine...disruption of central nervous system tissue in beef cattle by different...the spread of central nervous system tissue in cattle and the abattoir...

D. J. Daly; D. M. Prendergast; J. J. Sheridan; I. S. Blair; D. A. McDowell

2002-02-01T23:59:59.000Z

280

Mirrors for X-ray telescopes: Fresnel diffraction-based computation of Point Spread Functions from metrology  

E-Print Network [OSTI]

The imaging sharpness of an X-ray telescope is chiefly determined by the optical quality of its focusing optics, which in turn mostly depends on the shape accuracy and the surface finishing of the grazing incidence X-ray mirrors that compose the optical modules. In order to ensure the imaging performance during the mirror manufacturing, a fundamental step is represented by the prediction of the mirror Point Spread Function (PSF) from the metrology of its surface. Traditionally, the PSF computation in X-rays is assumed to be different depending on whether the surface defects are classified as figure errors or roughness [...] The aim of this work is to overcome this limit, providing analytical formulae, valid at any light wavelength, to compute the PSF of an X-ray mirror shell from the measured longitudinal profiles and the roughness Power Spectral Density (PSD), without distinguishing spectral ranges with different treatments. The method we adopted is based on the Huygens-Fresnel principle to compute the diffr...

Raimondi, Lorenzo

2014-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

Spreading the net  

Science Journals Connector (OSTI)

......during the operation of a project examining radio scintillations...Horowitz and Sagan 1993) and Project PHOENIX/HRMS (Tarter 1994...home computer linked up to the project. A screensaver program analyses...institutes, the SETI League (433 Liberty Street, PO Box 555, Little......

Ian R Carstairs

2002-12-01T23:59:59.000Z

282

Time-Resolved  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Time-Resolved Time-Resolved Time-Resolved Print Of the four fundamental parameters that we use to perceive the physical world (energy, momentum, position, and time) three correspond to the three broad categories of synchrotron experimental measurement techniques: spectroscopy (energy), scattering (momentum), and imaging (position). The fourth parameter-time-can in principle be applied to all the techniques. At the ALS, many experiments can be carried out in real time, with data being recorded from the same sample as it changes over time. Some time-resolved experiments take advantage of the pulsed nature of the ALS's synchrotron radiation, which, like a strobe light, can capture a series of "snapshots" of a process that, when viewed sequentially, show us how a given process evolves over time. Other experiments simply require two pulses: one to "pump" energy into the sample system and a second to probe the system's excited state.

283

Be-CoDiS: An epidemiological model to predict the risk of human diseases spread worldwide. Application to the 2014 Ebola Virus Disease epidemic  

E-Print Network [OSTI]

Ebola virus disease is a lethal human and primate disease that currently requires a particular attention from the national and international health authorities due to important outbreaks concurring in some Western African countries and possible spread to other continents, which has already occurred in the USA and Spain. Regarding the emergency of this situation, there is a need of development of decision tools to help the authorities to focus their efforts in important factors that can help to eradicate Ebola. Mathematical modeling and, more precisely, epidemiological modeling can help to predict the possible evolution of the Ebola outbreaks and to give some recommendations in the region to be prioritized for surveillance. In this work, we present a first formulation of a new spatial-temporal epidemiological model, called Be-CoDiS (Between-COuntries Disease Spread), based on the combination of a deterministic Individual-Based model (modelling the interaction between countries, considered as individual) for be...

Benjamin, Ivorra; Dične, Ngom

2014-01-01T23:59:59.000Z

284

Strong side of weak topological insulators  

Science Journals Connector (OSTI)

Three-dimensional topological insulators are classified into “strong” (STI) and “weak” (WTI) according to the nature of their surface states. While the surface states of the STI are topologically protected from localization, this does not hold for the WTI. In this work, we show that the surface states of the WTI are actually protected from any random perturbation that does not break time-reversal symmetry, and does not close the bulk energy gap. Consequently, the conductivity of metallic surfaces in the clean system remains finite even in the presence of strong disorder of this type. In the weak disorder limit, the surfaces are found to be perfect metals, and strong surface disorder only acts to push the metallic surfaces inwards. We find that the WTI differs from the STI primarily in its anisotropy, and that the anisotropy is not a sign of its weakness but rather of its richness.

Zohar Ringel; Yaacov E. Kraus; Ady Stern

2012-07-02T23:59:59.000Z

285

Integrating knowledge-based techniques into well-test interpretation  

SciTech Connect (OSTI)

The goal of the Spirit Project was to develop a prototype of next-generation well-test-interpretation (WTI) software that would include knowledge-based decision support for the WTI model selection task. This paper describes how Spirit makes use of several different types of information (pressure, seismic, petrophysical, geological, and engineering) to support the user in identifying the most appropriate WTI model. Spirit`s knowledge-based approach to type-curve matching is to generate several different feasible interpretations by making assumptions about the possible presence of both wellbore storage and late-time boundary effects. Spirit fuses information from type-curve matching and other data sources by use of a knowledge-based decision model developed in collaboration with a WTI expert. The sponsors of the work have judged the resulting prototype system a success.

Harrison, I.W.; Fraser, J.L. [Artificial Intelligence Applications Inst., Edinburgh (United Kingdom)

1995-04-01T23:59:59.000Z

286

The Morphology of the Sub-Giant Branch and Red Clump Reveal No Sign of Age Spreads in Intermediate Age Clusters  

E-Print Network [OSTI]

A recent surprise in stellar cluster research, made possible through the precision of Hubble Space Telescope photometry, was that some intermediate age (1-2 Gyr) clusters in the Large and Small Magellanic Clouds have main sequence turn-off (MSTO) widths that are significantly broader than would be expected for a simple stellar population (SSP). One interpretation of these extended MSTOs (eMSTOs) is that age spreads of the order of ~500 Myr exist within the clusters, radically redefining our view of stellar clusters, which are traditionally thought of as single age, single metallicity stellar populations. Here we test this interpretation by studying other regions of the CMD that should also be affected by such large age spreads, namely the width of the sub-giant branch (SGB) and the red clump (RC). We study two massive clusters in the LMC that display the eMSTO phenomenon (NGC 1806 & NGC 1846) and show that both have SGB and RC morphologies that are in conflict with expectations if large age spreads exist ...

Bastian, Nate

2015-01-01T23:59:59.000Z

287

CHAPTER XV - TIME SERIES  

Science Journals Connector (OSTI)

Publisher Summary This chapter provides an overview of time series. A time series is a set of observations of a variable made at different points of time and arranged in chronological order, each observation representing the value of the variable either at a given moment or during the interval of time between this observation and the preceding one. In general, the observations forming a time-series as made at equidistant intervals of time are considered. The factors affecting time-series may be recurring or nonrecurring, or evolutionary, periodic, or random. The method of moving averages consists in determining the average value for a certain number of terms of a time series and taking this average as the trend normal value for the middle of the period covered in the calculation of the average, that is, the period extent of the moving average.

ISAAC PAENSON

1970-01-01T23:59:59.000Z

288

The Y-12 Times  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

good use Pages 4 and 5 The comings and goings during June Page 7 Y-12's new talent Ray Smith Donna Watson Bill Wilburn Lisa Xiques times times the B&W Technical Services Y-12,...

289

Markets & Finance - Data - U.S. Energy Information Administration (EIA)  

Gasoline and Diesel Fuel Update (EIA)

Market Prices and Uncertainty Report Charts Market Prices and Uncertainty Report Charts Selected Charts Figure 1: Historical crude oil front month futures prices Figure 6: Probability of the November 2012 WTI contract expiring above different price levels Figure 7: Historical RBOB futures prices and crack spreads Figure 9: Probability of November 2012 retail gasoline exceeding different prices levels at expiration Figure 13: Historical front month U.S. natural gas prices Figure 15: Probability of the November 2012 Henry Hub contract expiring above price levels West Texas Intermediate (WTI) Crude Oil Price Confidence Intervals XLS West Texas Intermediate (WTI) Crude Oil Price Probabilities XLS Henry Hub Natural Gas Prices and Confidence Intervals XLS Henry Hub Natural Gas Price Probabilities XLS

290

Price discovery in crude oil futures  

Science Journals Connector (OSTI)

Abstract This study examines price discovery among the two most prominent price benchmarks in the market for crude oil, WTI sweet crude and Brent sweet crude. Using data on the most active futures contracts measured at the one-second frequency, we find that WTI maintains a dominant role in price discovery relative to Brent, with an estimated information share in excess of 80%, over a sample from 2007 to 2012. Our analysis is robust to different decompositions of the sample, over pit-trading sessions and non-pit trading sessions, segmentation of days associated with major economic news releases, and data measured to the millisecond. We find no evidence that the dominant role of WTI in price discovery is diminished by the price spread between Brent that emerged in 2008.

John Elder; Hong Miao; Sanjay Ramchander

2014-01-01T23:59:59.000Z

291

Virological Synapse-Mediated Spread of Human Immunodeficiency Virus Type 1 between T Cells Is Sensitive to Entry Inhibition  

Science Journals Connector (OSTI)

...at the intercellular interface, and percentages were...events by the number of interfaces. Gag transfer was...number of conjugate interfaces. Time-lapse LSCM...stacked into a three-dimensional box with time along...bars represent the standard errors of the mean...

Nicola Martin; Sonja Welsch; Clare Jolly; John A. G. Briggs; David Vaux; Quentin J. Sattentau

2010-01-20T23:59:59.000Z

292

Noncommutative Two Time Physics  

E-Print Network [OSTI]

We present a classical formalism describing two-time physics with Abelian canonical gauge field backgrounds. The formalism can be used as a starting point for the construction of an interacting quantized two-time physics theory in a noncommutative soace-time.

W. Chagas-Filho

2006-04-03T23:59:59.000Z

293

Asia Times -Search Asia  

E-Print Network [OSTI]

Asia Times - Search Asia Times Advanced Search Southeast Asia Scapegoats for Indonesia's timber://www.atimes.com/atimes/Southeast_Asia/EI19Ae01.html (1 of 4)9/4/2007 3:01:50 PM Search #12;Asia Times - rather than on the nationwide band

294

Asia Times -Search Asia  

E-Print Network [OSTI]

Asia Times - Search Asia Times Advanced Search Southeast Asia Scapegoats for Indonesia's timber://www.atimes.com/atimes/Southeast_Asia/EI19Ae01.html (1 of 4)9/4/2007 12:55:07 PM Search #12;Asia Times - rather than on the nationwide band

295

Variability assessment and mitigation in advanced VLSI manufacturing through design-manufacturing co-optimization  

E-Print Network [OSTI]

related to read stability; WTI (WTV) is write trip current (SINM increases and WTI decreases, as the transistor widthread ability and smaller WTI represents worse writeability.

Jeong, Kwangok

2011-01-01T23:59:59.000Z

296

Theory of Topological Phenomena in Condensed Matter Systems  

E-Print Network [OSTI]

topological insulators (WTI). However, a more surprisingBurgers vector and three WTI indices[144] is nonzero - whichin the case of the WTI. Thus far, the characterization of

Zhang, Yi

2012-01-01T23:59:59.000Z

297

The Smell of Petroleum: Health, Insecurity, and Citizenship in "Revolutionary" Ecuador  

E-Print Network [OSTI]

in relation to the international WTI price benchmark. 3 Inproducts, and can The WTI index is one of two internationalfor crude petroleum. WTI, the West Texas Intermediate, is

Welcome, Nicholas Scott

2013-01-01T23:59:59.000Z

298

Go Global Newsletter, Winter/Spring 2006  

E-Print Network [OSTI]

The World Tribunal on Iraq (WTI) held its final session inits inception and conduct. The WTI is one expression of themoral globalization. ” The WTI generated intense interest in

Global & International Studies

2006-01-01T23:59:59.000Z

299

Intrinsic Time Quantum Geometrodynamics  

E-Print Network [OSTI]

Quantum Geometrodynamics with intrinsic time development and momentric variables is presented. An underlying SU(3) group structure at each spatial point regulates the theory. The intrinsic time behavior of the theory is analyzed, together with its ground state and primordial quantum fluctuations. Cotton-York potential dominates at early times when the universe was small; the ground state naturally resolves Penrose's Weyl Curvature Hypothesis, and thermodynamic and gravitational `arrows of time' point in the same direction. Ricci scalar potential corresponding to Einstein's General Relativity emerges as a zero-point energy contribution. A new set of fundamental canonical commutation relations without Planck's constant emerges from the unification of Gravitation and Quantum Mechanics.

Eyo Eyo Ita III; Chopin Soo; Hoi-Lai Yu

2015-01-26T23:59:59.000Z

300

Time Series Analysis  

Science Journals Connector (OSTI)

Know how to apply simple methods for time series forecasting such as moving averages and the three levels of exponential smoothing.

Marc Goetschalckx

2011-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

Time functions as utilities  

E-Print Network [OSTI]

Every time function on spacetime gives a (continuous) total preordering of the spacetime events which respects the notion of causal precedence. The problem of the existence of a (semi-)time function on spacetime and the problem of recovering the causal structure starting from the set of time functions are studied. It is pointed out that these problems have an analog in the field of microeconomics known as utility theory. In a chronological spacetime the semi-time functions correspond to the utilities for the chronological relation, while in a K-causal (stably causal) spacetime the time functions correspond to the utilities for the K^+ relation (Seifert's relation). By exploiting this analogy, we are able to import some mathematical results, most notably Peleg's and Levin's theorems, to the spacetime framework. As a consequence, we prove that a K-causal (i.e. stably causal) spacetime admits a time function and that the time or temporal functions can be used to recover the K^+ (or Seifert) relation which indeed turns out to be the intersection of the time or temporal orderings. This result tells us in which circumstances it is possible to recover the chronological or causal relation starting from the set of time or temporal functions allowed by the spacetime. Moreover, it is proved that a chronological spacetime in which the closure of the causal relation is transitive (for instance a reflective spacetime) admits a semi-time function. Along the way a new proof avoiding smoothing techniques is given that the existence of a time function implies stable causality, and a new short proof of the equivalence between K-causality and stable causality is given which takes advantage of Levin's theorem and smoothing techniques.

E. Minguzzi

2009-09-04T23:59:59.000Z

302

Acceleration of Time Integration  

SciTech Connect (OSTI)

We outline our strategies for accelerating time integration for long-running simulations, such as those for global climate modeling. The strategies target the Cray XT systems at the National Center for Computational Sciences at Oak Ridge National Laboratory. Our strategies include fully implicit, parallel-in-time, and curvelet methods.

White III, James B [ORNL; Drake, John B [ORNL; Worley, Patrick H [ORNL; Archibald, Richard K [ORNL; Evans, Katherine J [ORNL; Kothe, Douglas B [ORNL

2007-01-01T23:59:59.000Z

303

Is Time Inhomogeneous ?  

E-Print Network [OSTI]

In this article, we discuss probability of inhomogeneous time in high or low energy scale of physics. Consequently, the possibility was investigated of using theories such as varying speed of light (VSL) and fractal mathematics to build a framework within which answers can be found to some of standard cosmological problems and physics theories on the basis of time non-homogeneity.

S. Davood Sadatian

2014-05-08T23:59:59.000Z

304

TIMELY WARNING CAMPUS ALERT  

E-Print Network [OSTI]

TIMELY WARNING CAMPUS ALERT 13 September 2007 This communication is prepared as part of the Timely of 1990. This federal law requires a general communication to the campus community of all crimes reported. Consider carefully whether your presence at or near the Lancaster Green Apartments while unaccompanied

Hardy, Christopher R.

305

Implementing multi-step chemical kinetics models in opposed-flow flame spread over cellulose and a comparison to single-step chemistry  

SciTech Connect (OSTI)

Multi-step, gas-phase chemical kinetics are introduced into flame spread modeling efforts. An unsteady multi-step, gas-phase kinetics model both with and without steady-state species assumptions, and including nonunit Lewis number, is compared with a model including a single, finite-rate gas-phase reaction, which has been the usual approach in flame spread modeling. Laminar diffusion flames over a thin fuel in an opposing O{sub 2}/N{sub 2} flow are considered with the solution in two-dimensional space of momentum, energy, and 12 gas-phase species. Results for the multi-step models show detailed flame structure in terms of species and heat release distributions throughout the flame and the role of chemical kinetics as a controlling mechanism in flame spread. Of particular interest is the potential of multi-step chemical kinetics in solutions at near-extinction limit conditions. While the incorporation of nonunit Le alone affords more detailed species transport, in high opposing flows it was found to give only minor structural differences form the single-step unit Le model. The multi-step chemistry allows for the gas kinetics to be self-adjusting to environmental conditions. As a result, the distribution of endothermicity and exothermicity throughout the flame and for particular reversible reactions is found to be a function of the flow environment, which overcomes a major drawback of single-step models, namely a fixed heat of combustion independent of environmental conditions, or one that must be determined separately from the model itself.

Wolverton, M.K.; Altenkirch, R.A.; Tang, L. [Mississippi State Univ., MS (United States)] [Mississippi State Univ., MS (United States)

1999-07-01T23:59:59.000Z

306

Growth of Spread in Convection-Allowing and Convection-Parameterizing Ensembles ADAM J. CLARK AND WILLIAM A. GALLUS JR.  

E-Print Network [OSTI]

the 2007 NOAA Hazardous Weather Testbed Spring Experiment, a 10-member 4-km grid-spacing Storm-Scale Ensemble Forecast (SSEF) system was run in real time to provide experimental severe weather forecasting-error metrics for the two SSEF system configurations are compared to similarly configured 20-km grid

Xue, Ming

307

Kairoscope : coordinating time socially  

E-Print Network [OSTI]

If everyone says time is relative, why is it still so rigidly defined? There have been many attempts to address the issue of coordinating schedules, but each of these attempts runs into an issue of rigidity: in order to ...

Martin, Reed Eric

2010-01-01T23:59:59.000Z

308

California's Shaking Next Time  

Science Journals Connector (OSTI)

...ground along a road. Only 10 hours...expect that the design expertise lavished...architectural designs ofthat time as...the left. The pipelines, rail lines, and aqueducts crossing the San Andreas...block mountain roads. Forty-six...

RICHARD A. KERR

1982-01-22T23:59:59.000Z

309

Bern, 5. Juli 2010 Nachhaltige Entwicklung an der Universitt Bern  

E-Print Network [OSTI]

...............................................................................................................37 3.3 World Trade Institute (WTI), Prof. Matthi

Richner, Heinz

310

U.S. Energy Information Administration (EIA) - Sector  

Gasoline and Diesel Fuel Update (EIA)

2025, 2035, and 2040 (2011 dollars per barrel) Projections 2011 2025 2035 2040 WTI Brent WTI Brent WTI Brent WTI Brent AEO2013 (Reference case) 94.86 111.26 115.36 117.36...

311

Universit'es de Paris 6 & Paris 7 -CNRS (UMR 7599) PR'EPUBLICATIONS DU LABORATOIRE  

E-Print Network [OSTI]

) "Zti-1 * * (Wti Wti-1) , together with the final data "Ytssn= g(Xsstn). Of course, given (Y= (ti ti-1) E Yti(Wti Wti-1)jFti-1 ss ss ss ss

Université Pierre-et-Marie-Curie, Paris 6

312

The Solar Energetic Particle Event on 2013 April 11: An Investigation of its Solar Origin and Longitudinal Spread  

E-Print Network [OSTI]

We investigate the solar phenomena associated with the origin of the solar energetic particle (SEP) event observed on 2013 April 11 by a number of spacecraft distributed in the inner heliosphere over a broad range of heliolongitudes. We use Extreme UltraViolet (EUV) and white-light coronagraph observations from the Solar Dynamics Observatory (SDO), the SOlar and Heliospheric Observatory (SOHO) and the twin Solar TErrestrial RElations Observatory spacecraft (STEREO-A and STEREO-B) to determine the angular extent of the EUV wave and coronal mass ejection (CME) associated with the origin of the SEP event. We compare the estimated release time of SEPs observed at each spacecraft with the arrival time of the structures associated with the CME at the footpoints of the field lines connecting each spacecraft with the Sun. Whereas the arrival of the EUV wave and CME-driven shock at the footpoint of STEREO-B is consistent, within uncertainties, with the release time of the particles observed by this spacecraft, the EUV...

Lario, D; Kwon, R -Y; Zhang, J; Gomez-Herrero, R; Dresing, N; Riley, P

2014-01-01T23:59:59.000Z

313

America and the Misshaping of a New World Order  

E-Print Network [OSTI]

the World Tribunal on Iraq (WTI) held in Istanbul in Juneinternational criminal law. The WTI heard testimony from ?

Gunn, Giles; Gutiérrez-Jones, Carl

2010-01-01T23:59:59.000Z

314

Probabilistic timed behavior trees  

Science Journals Connector (OSTI)

The Behavior Tree notation has been developed as a method for systematically and traceably capturing user requirements. In this paper we extend the notation with probabilistic behaviour, so that reliability, performance, and other dependability properties ... Keywords: behavior trees, model checking, probabilities, timed automata

Robert Colvin; Lars Grunske; Kirsten Winter

2007-07-01T23:59:59.000Z

315

Time reversal communication system  

DOE Patents [OSTI]

A system of transmitting a signal through a channel medium comprises digitizing the signal, time-reversing the digitized signal, and transmitting the signal through the channel medium. The channel medium may be air, earth, water, tissue, metal, and/or non-metal.

Candy, James V. (Danville, CA); Meyer, Alan W. (Danville, CA)

2008-12-02T23:59:59.000Z

316

Time-Encoded Imagers.  

SciTech Connect (OSTI)

This report provides a short overview of the DNN R&D funded project, Time-Encoded Imagers. The project began in FY11 and concluded in FY14. The Project Description below provides the overall motivation and objectives for the project as well as a summary of programmatic direction. It is followed by a short description of each task and the resulting deliverables.

Marleau, Peter; Brubaker, Erik

2014-11-01T23:59:59.000Z

317

Genepool Time Heatmaps  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Genepool Time Heatmaps Genepool Time Heatmaps Heatmap of Time and Slots Requested vs Time Waited (in hours) | Queue: All | Last 7 Days Time Requested Slots 1wk Job Count Longest Wait 1 23.0 (233) 0.37 (1819) 27.54 (49888) 5.85 (124593) 1.23 (39835) 0.34 (732) 0 0.4 (224) 0.02 (1) 217325 538.96 2 0 0.01 (19) 2.54 (78) 0.2 (140) 0.99 (2683) 0 0 0 0 2920 9.1 4 0.08 (1) 0 2.82 (141) 0.36 (143) 1.07 (12) 0.06 (5) 0.01 (5) 0.06 (1) 1.3 (5) 313 20.48 6 0.01 (2) 0 0.09 (32) 0.07 (1) 0 0 0 0 0 35 1.22 8 0.04 (24) 4.32 (7423) 5.31 (1999) 0.53 (316) 13.14 (2486) 0.01 (2) 1.21 (88) 1.3 (34) 8.33 (68) 12440 46.16 10 0 0 0 0 0 0 0 8.56 (1) 0 1 8.56 16 0 0 0 0.03 (1) 0 0 0 0 0 1 0.03 24 0 0 0 0 0 0 0 0 0.01 (1) 1 0.01 32 0 0 0 0.04 (14) 0 0 0 0.01 (6) 0 20 0.26

318

STOPPING TIMES IN QUANTUM MECHANICS  

E-Print Network [OSTI]

(Stinespring, Kraus). 3". Time-dependant case General time evolution of an open quantum sys- tem = (Pt)t0

Attal, Stéphane

319

Rick Grush Brain time and phenomenological time (draft) Page 1/37 Brain time and phenomenological time  

E-Print Network [OSTI]

Rick Grush Brain time and phenomenological time (draft) Page 1/37 Brain time and phenomenological "forthwith" in a common structure. - Edmund Husserl, Phenomenology of Inner Time Consciousness1 1 time and phenomenological time (draft) Page 2/37 information-processing structure that accounts

Grush, Rick

320

Tevatron injection timing  

SciTech Connect (OSTI)

Bunched beam transfer from one accelerator to another requires coordination and synchronization of many ramped devices. During collider operation timing issues are more complicated since one has to switch from proton injection devices to antiproton injection devices. Proton and antiproton transfers are clearly distinct sequences since protons and antiprotons circulate in opposite directions in the Main Ring (MR) and in the Tevatron. The time bumps are different, the kicker firing delays are different, the kickers and lambertson magnets are different, etc. Antiprotons are too precious to be used for tuning purposes, therefore protons are transferred from the Tevatron back into the Main Ring, tracing the path of antiprotons backwards. This tuning operation is called ``reverse injection.`` Previously, the reverse injection was handled in one supercycle. One batch of uncoalesced bunches was injected into the Tevatron and ejected after 40 seconds. Then the orbit closure was performed in the MR. In the new scheme the lambertson magnets have to be moved and separator polarities have to be switched, activities that cannot be completed in one supercycle. Therefore, the reverse injection sequence was changed. This involved the redefinition of TVBS clock event $D8 as MRBS $D8 thus making it possible to inject 6 proton batches (or coalesced bunches) and eject them one at a time on command, performing orbit closure each time in the MR. Injection devices are clock event driven. The TCLK is used as the reference clock. Certain TCLK events are triggered by the MR beam synchronized clock (MRBS) events. Some delays are measured in terms of MRBS ticks and MR revolutions. See Appendix A for a brief description of the beam synchronized clocks.

Saritepe, S.; Annala, G.

1993-06-01T23:59:59.000Z

Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

Improvements to laser wakefield accelerated electron beam stability, divergence, and energy spread using three-dimensional printed two-stage gas cell targets  

SciTech Connect (OSTI)

High intensity, short pulse lasers can be used to accelerate electrons to ultra-relativistic energies via laser wakefield acceleration (LWFA) [T. Tajima and J. M. Dawson, Phys. Rev. Lett. 43, 267 (1979)]. Recently, it was shown that separating the injection and acceleration processes into two distinct stages could prove beneficial in obtaining stable, high energy electron beams [Gonsalves et al., Nat. Phys. 7, 862 (2011); Liu et al., Phys. Rev. Lett. 107, 035001 (2011); Pollock et al., Phys. Rev. Lett. 107, 045001 (2011)]. Here, we use a stereolithography based 3D printer to produce two-stage gas targets for LWFA experiments on the HERCULES laser system at the University of Michigan. We demonstrate substantial improvements to the divergence, pointing stability, and energy spread of a laser wakefield accelerated electron beam compared with a single-stage gas cell or gas jet target.

Vargas, M.; Schumaker, W.; He, Z.-H.; Zhao, Z.; Behm, K.; Chvykov, V.; Hou, B.; Krushelnick, K.; Maksimchuk, A.; Yanovsky, V.; Thomas, A. G. R., E-mail: agrt@umich.edu [Center for Ultrafast Optical Science, University of Michigan, Ann Arbor, Michigan 48109 (United States)

2014-04-28T23:59:59.000Z

322

Exploiting VERITAS Timing Information  

E-Print Network [OSTI]

The 499 pixel photomultiplier cameras of the VERITAS gamma ray telescopes are instrumented with 500MHz sampling Flash ADCs. This paper describes a preliminary investigation of the best methods by which to exploit this information so as to optimize the signal-to-noise ratio for the detection of Cherenkov light pulses. The FADCs also provide unprecedented resolution for the study of the timing characteristics of Cherenkov images of cosmic-ray and gamma-ray air showers. This capability is discussed, together with the implications for gamma-hadron separation.

J. Holder; for the VERITAS Collaboration

2005-07-19T23:59:59.000Z

323

Invariant time-series factorization  

Science Journals Connector (OSTI)

Time-series analysis is an important domain of machine learning and a plethora of methods have been developed for the task. This paper proposes a new representation of time series, which in contrast to existing approaches, decomposes a time-series dataset ... Keywords: Data mining, Time-series classification, Time-series factorization

Josif Grabocka; Lars Schmidt-Thieme

2014-09-01T23:59:59.000Z

324

Real time automated inspection  

DOE Patents [OSTI]

A method and apparatus relating to the real time automatic detection and classification of characteristic type surface imperfections occurring on the surfaces of material of interest such as moving hot metal slabs produced by a continuous steel caster. A data camera transversely scans continuous lines of such a surface to sense light intensities of scanned pixels and generates corresponding voltage values. The voltage values are converted to corresponding digital values to form a digital image of the surface which is subsequently processed to form an edge-enhanced image having scan lines characterized by intervals corresponding to the edges of the image. The edge-enhanced image is thresholded to segment out the edges and objects formed by the edges are segmented out by interval matching and bin tracking. Features of the objects are derived and such features are utilized to classify the objects into characteristic type surface imperfections.

Fant, Karl M. (Minneapolis, MN); Fundakowski, Richard A. (Saint Paul, MN); Levitt, Tod S. (Minneapolis, MN); Overland, John E. (Plymouth, MN); Suresh, Bindinganavle R. (New Brighton, MN); Ulrich, Franz W. (Minneapolis, MN)

1985-01-01T23:59:59.000Z

325

Real time automated inspection  

DOE Patents [OSTI]

A method and apparatus are described relating to the real time automatic detection and classification of characteristic type surface imperfections occurring on the surfaces of material of interest such as moving hot metal slabs produced by a continuous steel caster. A data camera transversely scans continuous lines of such a surface to sense light intensities of scanned pixels and generates corresponding voltage values. The voltage values are converted to corresponding digital values to form a digital image of the surface which is subsequently processed to form an edge-enhanced image having scan lines characterized by intervals corresponding to the edges of the image. The edge-enhanced image is thresholded to segment out the edges and objects formed by the edges by interval matching and bin tracking. Features of the objects are derived and such features are utilized to classify the objects into characteristic type surface imperfections. 43 figs.

Fant, K.M.; Fundakowski, R.A.; Levitt, T.S.; Overland, J.E.; Suresh, B.R.; Ulrich, F.W.

1985-05-21T23:59:59.000Z

326

Time encoded radiation imaging  

DOE Patents [OSTI]

The various technologies presented herein relate to detecting nuclear material at a large stand-off distance. An imaging system is presented which can detect nuclear material by utilizing time encoded imaging relating to maximum and minimum radiation particle counts rates. The imaging system is integrated with a data acquisition system that can utilize variations in photon pulse shape to discriminate between neutron and gamma-ray interactions. Modulation in the detected neutron count rates as a function of the angular orientation of the detector due to attenuation of neighboring detectors is utilized to reconstruct the neutron source distribution over 360 degrees around the imaging system. Neutrons (e.g., fast neutrons) and/or gamma-rays are incident upon scintillation material in the imager, the photons generated by the scintillation material are converted to electrical energy from which the respective neutrons/gamma rays can be determined and, accordingly, a direction to, and the location of, a radiation source identified.

Marleau, Peter; Brubaker, Erik; Kiff, Scott

2014-10-21T23:59:59.000Z

327

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incineration facility (East Liverpool, Ohio). Volume 8. Additional analysis in response to peer review recommendations  

SciTech Connect (OSTI)

Contents: Introduction; Combustion Engineering; Air Dispersion and Deposition Modeling; Accident Analysis; Exposure Assessment; Toxicology; and Ecological Risk Assessment.

NONE

1997-05-01T23:59:59.000Z

328

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incineration facility (East Liverpool, Ohio). Volume 7. Accident analysis; selection and assessment of potential release scenarios  

SciTech Connect (OSTI)

In this part of the assessment, several accident scenarios are identified that could result in significant releases of chemicals into the environment. These scenarios include ruptures of storage tanks, large magnitude on-site spills, mixing of incompatible wastes, and off-site releases caused by tranpsortation accidents. In evaluating these scenarios, both probability and consequence are assessed, so that likelihood of occurrence is coupled with magnitude of effect in characterizing short term risks.

NONE

1997-05-01T23:59:59.000Z

329

Risk assessment for the Waste Technologies Industries (WTI) Hazardous Waste Incineration Facility (East Liverpool, Ohio). Volume 3. Characterization of the nature and magnitude of emissions  

SciTech Connect (OSTI)

Contents: Introduction; Data Used in Characterizing Emissions; Incinerator Stack Emissions; Fugitive Emissions; Uncertainty in Emissions Characterization; and References.

NONE

1997-05-01T23:59:59.000Z

330

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incineration facility (East Liverpool, Ohio). Volume 4. Atmospheric dispersion and deposition modeling of emissions  

SciTech Connect (OSTI)

Contents: Introduction; Technical Description of ISC-COMPDEP; Modeling Input Parameters; Discussion of Modeling Results; Summary and Major Assumptions; and References.

NONE

1997-05-01T23:59:59.000Z

331

SLH Timing Belt Powertrain  

SciTech Connect (OSTI)

The main goal of this proposal was to develop and test a novel powertrain solution for the SLH hydroEngine?, a low-cost, efficient low-head hydropower technology. Nearly two-thirds of U.S. renewable electricity is produced by hydropower (EIA 2010). According to the U.S. Department of Energy; this amount could be increased by 50% with small hydropower plants, often using already-existing dams (Hall 2004). There are more than 80,000 existing dams, and of these, less than 4% generate power (Blankinship 2009). In addition, there are over 800 irrigation districts in the U.S., many with multiple, non-power, low-head drops. These existing, non-power dams and irrigation drops could be retrofitted to produce distributed, baseload, renewable energy with appropriate technology. The problem is that most existing dams are low-head, or less than 30 feet in height (Ragon 2009). Only about 2% of the available low-head hydropower resource in the U.S. has been developed, leaving more than 70 GW of annual mean potential low-head capacity untapped (Hall 2004). Natel Energy, Inc. is developing a low-head hydropower turbine that operates efficiently at heads less than 6 meters and is cost-effective for deployment across multiple low-head structures. Because of the unique racetrack-like path taken by the prime-movers in the SLH, a flexible powertrain is required. Historically, the only viable technological solution was roller chain. Despite the having the ability to easily attach blades, roller chain is characterized by significant drawbacks, including high cost, wear, and vibration from chordal action. Advanced carbon-#12;fiber-reinforced timing belts have been recently developed which, coupled with a novel belt attachment system developed by Natel Energy, result in a large reduction in moving parts, reduced mass and cost, and elimination of chordal action for increased fatigue life. The work done in this project affirmatively addressed each of the following 3 major uncertainties concerning a timing-belt based hydroEngine ?powertrain: 1. Can a belt handle the high torques and power loads demanded by the SLH? (Yes.) 2. Can the SLH blades be mounted to belt with a connection that can withstand the loads encountered in operation? (Yes.) 3. Can the belt, with blade attachments, live through the required cyclic loading? (Yes.) The research adds to the general understanding of sustainable small hydropower systems by using innovative system testing to develop and demonstrate performance of a novel powertrain solution, enabling a new type of hydroelectric turbine to be commercially developed. The technical effectiveness of the methods investigated has been shown to be positive through an extensive design and testing process accommodating many constraints and goals, with a major emphasis on high cycle fatigue life. Economic feasibility of the innovations has been demonstrated through many iterations of design for manufacturability and cost reduction. The project is of benefit to the public because it has helped to develop a solution to a major problem -- despite the large available potential for new low-head hydropower, high capital costs and high levelized cost of electricity (LCOE) continue to be major barriers to project development. The hydroEngine? represents a significant innovation, leveraging novel fluid mechanics and mechanical configuration to allow lower-cost turbine manufacture and development of low head hydropower resources.

Schneider, Abe

2014-04-09T23:59:59.000Z

332

Local Resistance Profiling of Ultra Shallow Junction Annealed with Combination of Spike Lamp and Laser Annealing Processes using Scanning Spreading Resistance Microscope  

SciTech Connect (OSTI)

Local resistance profiles of ultra shallow boron and arsenic implanted into silicon with energies of 2.0 and 4.0 keV and doses of 2.0x10{sup 15} and 1.0x10{sup 15} ions/cm{sup 2} activated by a combination of conventional spike lamp and laser annealing processes were measured by scanning spreading resistance microscope (SSRM) with a depth resolution of less than 10 nm. The lowest local resistance at the low resistance region in 2.0 keV boron implanted silicon with 1050 deg. C spike lamp annealing followed by 0.35 kW/mm{sup 2} laser annealing was half of that without laser annealing. The lowest local resistance at the low resistance region in the arsenic implanted silicon activated by 1050 deg. C spike lamp annealing followed by 0.39 kW/mm{sup 2} laser annealing was 74% lower than that followed by 0.36 kW/mm{sup 2} laser annealing. The lowest local resistances at the low resistance regions in the arsenic implanted silicon with 0.36 and 0.39 kW/mm{sup 2} laser annealing followed by 1050 deg. C spike lamp annealing were 41 and 33% lower than those with spike lamp annealing followed by laser annealing. Laser annealing followed by spike lamp annealing could suppress the diffusion of the impurities and was suitable for making the ultra shallow and low resistance regions.

Abo, Satoshi; Nishikawa, Kazuhisa; Ushigome, Naoya; Wakaya, Fujio; Takai, Mikio [Center for Quantum Science and Technology under Extreme Conditions, Osaka University, 1-3, Machikaneyama, Toyonaka, Osaka, 560-8531 (Japan); Iwamatsu, Toshiaki; Oda, Hidekazu [Advanced Device Technology Department, Production and Technology Unit, Devices and Analysis Technology Division, Renesas Electronics Corporation, 751, Horiguchi, Hitachinaka, Ibaraki, 312-8504 (Japan)

2011-01-07T23:59:59.000Z

333

Weight-balanced security-aware scheduling for real-time computational grid  

Science Journals Connector (OSTI)

Security-aware scheduling for real-time grid applications is an important task and a little work has been done to accomplish this. In this paper, we propose two scheduling algorithms for real-time grid applications with stringent security requirements, and the proposed algorithms are compared with a few existing scheduling algorithms, i.e. MinMin, MaxMin, EDF/ECT, SPMinMin and SPMaxMin. Security overhead computation for existing and proposed models is done on the basis of security level demand of the tasks. Performance of WB-EDFMin on success rate performance metric is considered to be the best among all the contemporary scheduling algorithms. SFWB-EDFMin compromises on the overall success rate of the grid application but its task scheduling is uniformly spread over the tasks of all security levels.

Rekha Kashyap; Deo Prakash Vidyarthi

2011-01-01T23:59:59.000Z

334

First-passage-time problems in time-aware networks  

E-Print Network [OSTI]

First passage time or the first time that a stochastic process crosses a boundary is a random variable whose probability distribution is sought in engineering, statistics, finance, and other disciplines. The probability ...

Suwansantisuk, Watcharapan, 1978-

2012-01-01T23:59:59.000Z

335

LPMEOH reader spreads for pdf  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Commercial-Scale Demonstration of the Commercial-Scale Demonstration of the Liquid Phase Methanol (LPMEOH TM ) Process TOPICAL REPORT NUMBER 11 APRIL 1999 TOPICAL REPORT NUMBER 11 A report on a project conducted jointly under a cooperative agreement between: The U.S. Department of Energy and Air Products Liquid Phase Conversion Company, L.P. April 1999 Commercial-Scale Demonstration of the Liquid Phase Methanol (LPMEOH(tm)) Process Commercial-Scale Demonstration of the Liquid Phase Methanol (LPMEOH(tm)) Process Executive Summary ........................................................................................... 5 Background ........................................................................................................ 6 Project Description ............................................................................................

336

Studies on upward flame spread  

E-Print Network [OSTI]

transfer coefficient heat of combustion per unit mass ofwidth, m ? and the heat of combustion per unit mass of fuelthe sample, and the heat of combustion ?H c was assigned the

Gollner, Michael J.

2012-01-01T23:59:59.000Z

337

Crustal Spreading in Southern California  

Science Journals Connector (OSTI)

...Thermal effects in the Buttes geothermal area at the southern end of...convection, a range of linear geothermal gradients is shown, for different...have propagated north A A' HEATING RISING GEOTHERMS 3 BASALT...Im-perial fault at the Brawley geothermal anomaly and at the Buttes...

Wilfred A. Elders; Robert W. Rex; Paul T. Robinson; Shawn Biehler; Tsvi Meidav

1972-10-06T23:59:59.000Z

338

Properties of few-body systems in relativistic quantum mechanics and constraints from transformations under Poincaré space-time translations  

E-Print Network [OSTI]

Different approaches have been applied to the calculation of form factors of various hadronic systems within relativistic quantum mechanics. In a one-body current approximation, they can lead to results evidencing large discrepancies. Looking for an explanation of this spreading, it is shown that, for the largest part, these discrepancies can be related to a violation of Poincar\\'e space-time translation invariance. Beyond energy-momentum conservation, which is generally assumed, fulfilling this symmetry implies specific relations that are generally ignored. Their relevance within the present context is discussed in detail both to explain the differences between predictions and to remove them.

B. Desplanques

2006-11-17T23:59:59.000Z

339

Abstract crystals Department of Mathematics  

E-Print Network [OSTI]

is a normal crystal define a bijection si : B B by sib = ~f wti(b) i b, if wti(b) 0, ~e -wti(b) i b, if wti, b2 B2} with wti(b1 b2) = wti(b1) + wti(b2), i(b1 b2) = max{i(b1), i(b2) - wt(b1), i }, i(b1 b2

Ram, Arun

340

Dust time in quantum cosmology  

E-Print Network [OSTI]

We give a formulation of quantum cosmology with a pressureless dust and arbitrary additional matter fields. The dust provides a natural time gauge corresponding to a cosmic time, yielding a physical time independent Hamiltonian. The approach simplifies the analysis of both Wheeler-deWitt and loop quantum cosmology models, broadening the applicability of the latter.

Husain, Viqar

2013-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

Microsoft Word - MPUR_Mar2011_final.docx  

Gasoline and Diesel Fuel Update (EIA)

March 2011 March 2011 1 March 2011 Short-Term Energy Outlook Market Prices and Uncertainty Report 1 March 8, 2011 Release Crude Oil Prices. West Texas Intermediate (WTI) crude oil spot prices averaged $88.58 per barrel in February, slightly lower than the January average, while over the same time period the estimated average cost of all crude oil to U.S. refineries increased by about $4.50 per barrel to $92.50. Growing volumes of Canadian crude oil imported into the United States contributed to record-high storage levels at Cushing, Oklahoma, and a price discount for WTI compared with similar quality world crudes such as Brent crude oil. Projected WTI spot prices rise to an average of $105 per barrel in December

342

Microsoft Word - MPUR_Feb2011_final_rh.docx  

Gasoline and Diesel Fuel Update (EIA)

11 11 1 February 2011 Short-Term Energy Outlook Market Prices and Uncertainty Report 1 February 8, 2011 Release Crude Oil Prices. WTI crude oil spot prices averaged $89 per barrel in January, about the same as the December average, while over the same time period the estimated average cost of all crude oil to U.S. refineries increased by about $1 per barrel. Growing volumes of Canadian crude oil imported into the United States contributed to record-high storage levels at Cushing, Oklahoma, and a price discount for WTI compared with similar quality world crudes such as Brent crude oil. Projected WTI spot prices rise to an average of $95 per barrel in December 2011 and continue to increase to $99 per barrel by the

343

Subsystem real-time Time Dependent Density Functional Theory  

E-Print Network [OSTI]

We present the extension of Frozen Density Embedding (FDE) theory to real-time Time Dependent Density Functional Theory (rt-TDDFT). FDE a is DFT-in-DFT embedding method that allows to partition a larger Kohn-Sham system into a set of smaller, coupled Kohn-Sham systems. Additional to the computational advantage, FDE provides physical insight into the properties of embedded systems and the coupling interactions between them. The extension to rt-TDDFT is done straightforwardly by evolving the Kohn-Sham subsystems in time simultaneously, while updating the embedding potential between the systems at every time step. Two main applications are presented: the explicit excitation energy transfer in real time between subsystems is demonstrated for the case of the Na$_4$ cluster and the effect of the embedding on optical spectra of coupled chromophores. In particular, the importance of including the full dynamic response in the embedding potential is demonstrated.

Krishtal, Alisa; Pavanello, Michele

2015-01-01T23:59:59.000Z

344

EMSL - time-of-flight  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

time-flight en Physical Properties of Ambient and Laboratory-Generated Secondary Organic Aerosol. http:www.emsl.pnl.govemslwebpublicationsphysical-properties-ambient-and-labor...

345

Time for money? Prathap Haridoss  

E-Print Network [OSTI]

Time for money? Prathap Haridoss "The more money you earn, the less time you will have to spend, you have to keep enquiring around. To get the maximum money that you possibly can get, you can't just `get a salary', you have to actively work towards increasing your income. Making money can be a full

Krishnapura, Nagendra

346

Electric Time in Quantum Cosmology  

E-Print Network [OSTI]

Effective quantum cosmology is formulated with a realistic global internal time given by the electric vector potential. New possibilities for the quantum behavior of space-time are found, and the high-density regime is shown to be very sensitive to the specific form of state realized.

Stephon Alexander; Martin Bojowald; Antonino Marciano; David Simpson

2012-12-10T23:59:59.000Z

347

Cosmological Significance of Time Reversal  

Science Journals Connector (OSTI)

... reversal at nearly the same time, that time being coincident with the occurrence of the Schwarzschild singularity, that is, the point at which the limiting radius, R = GM/ ... increases it would seem that a phenomenon not dissimilar to the spherical gravitational collapse of Schwarzschild will inevitably commence. This phenomenon depends on the relative velocity, and thus the position ...

KARY MULLIS

1968-05-18T23:59:59.000Z

348

Beam Time Allocation Committee (BAC)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Time Allocation Committee (BAC) Time Allocation Committee (BAC) Charter Purpose: Allocates general user beam time by instrument to promote diverse and high- impact science and a broad-based user community to meet DOE and NSSD goals. Participants: BAC Chair (appointed by NSSD Director), Instrument Group Leaders, User Office Schedule: Tied to proposal calls - expected to meet at least 2 times/year with meetings scheduled about 6 weeks after the proposal call has closed and at least 1 month prior to scheduled operations. Process: 1. Instrument Group Leaders (with group members): a. Confirm feasibility (equipment requirements and instrument capabilities) and safe operations b. Review amount of beam time requested and adjust as needed with consideration for instrument and sample environment availability.

349

Time-Domain Reflectometry for Tamper Indication in Unattended Monitoring Systems for Safeguards  

SciTech Connect (OSTI)

The International Atomic Energy Agency (IAEA) continues to expand its use of unattended, remotely monitored measurement systems. An increasing number of systems and an expanding family of instruments create challenges in terms of deployment efficiency and the implementation of data authentication measures. Pacific Northwest National Laboratory (PNNL) leads a collaboration that is exploring various tamper-indicating (TI) measures that could help to address some of the long-standing detector and data-transmission authentication challenges with IAEA’s unattended systems. PNNL is investigating the viability of active time-domain reflectometry (TDR) along two parallel but interconnected paths: (1) swept-frequency TDR as the highly flexible, laboratory gold standard to which field-deployable options can be compared, and (2) a low-cost commercially available spread-spectrum TDR technology as one option for field implementation. This report describes PNNL’s progress and preliminary findings from the first year of the study, and describes the path forward.

Tedeschi, Jonathan R.; Smith, Leon E.; Moore, David E.; Sheen, David M.; Conrad, Ryan C.

2014-12-17T23:59:59.000Z

350

Peptide translocation by variants of the transporter associated with antigen processing  

Science Journals Connector (OSTI)

...test the transactivational properties of WTI-del2, we used transient transfections...level. In contrast, trans-fection of WTi-del2 led to twofold greater transcriptional...antagonistic effect of wild-type W/Ti and WTI-del2 suggests that W/Ti function may...

MT Heemels; TN Schumacher; K Wonigeit; HL Ploegh

1993-12-24T23:59:59.000Z

351

Random time series in astronomy  

Science Journals Connector (OSTI)

...Thomas J. Maccarone Random time series in astronomy Simon Vaughan e-mail: simon.vaughan@leicester.ac.uk X-ray and Observational Astronomy Group, Department of Physics and Astronomy, University of Leicester, Leicester LE1...

2013-01-01T23:59:59.000Z

352

Hard Times in Uranium Enrichment  

Science Journals Connector (OSTI)

...either advanced centrifuges or an entirely...of an advanced centrifuge with three times...in the summer of 1985. If DOE chooses...with the advanced centrifuge, the new machines...decisions." But John Longenecker, the head of the...

COLIN NORMAN

1984-03-09T23:59:59.000Z

353

January 2008 Y-12 Times  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

January 2008 www.y12.doe.govnewsy12times.php P.O. Box 2009 Oak Ridge, TN 37831-8245 Managing Editor Melissa Leinart 865-574-1621 (6ml) Associate Editors Amy Alley Heidi Spurling...

354

Travel Time Forecasting Lyngby 2007  

E-Print Network [OSTI]

part of a new real-time traffic reporting system. This system is in the pipeline in the framework steps . . . . . . . . . . . . . . . . . . . . . . . . . . . 26 7.4 Data cleaning, repair and aggregation

355

Time Machine at the LHC  

E-Print Network [OSTI]

Recently, black hole and brane production at CERN's Large Hadron Collider (LHC) has been widely discussed. We suggest that there is a possibility to test causality at the LHC. We argue that if the scale of quantum gravity is of the order of few TeVs, proton-proton collisions at the LHC could lead to the formation of time machines (spacetime regions with closed timelike curves) which violate causality. One model for the time machine is a traversable wormhole. We argue that the traversable wormhole production cross section at the LHC is of the same order as the cross section for the black hole production. Traversable wormholes assume violation of the null energy condition (NEC) and an exotic matter similar to the dark energy is required. Decay of the wormholes/time machines and signatures of time machine events at the LHC are discussed.

I. Ya. Aref'eva; I. V. Volovich

2007-10-15T23:59:59.000Z

356

Geothermal Exploration Cost and Time  

SciTech Connect (OSTI)

The Department of Energy’s Geothermal Technology Office (GTO) provides RD&D funding for geothermal exploration technologies with the goal of lowering the risks and costs of geothermal development and exploration. The National Renewable Energy Laboratory (NREL) was tasked with developing a metric in 2012 to measure the impacts of this RD&D funding on the cost and time required for exploration activities. The development of this cost and time metric included collecting cost and time data for exploration techniques, creating a baseline suite of exploration techniques to which future exploration cost and time improvements can be compared, and developing an online tool for graphically showing potential project impacts (all available at http://en.openei.org/wiki/Gateway: Geothermal). This paper describes the methodology used to define the baseline exploration suite of techniques (baseline), as well as the approach that was used to create the cost and time data set that populates the baseline. The resulting product, an online tool for measuring impact, and the aggregated cost and time data are available on the Open Energy Information website (OpenEI, http://en.openei.org) for public access. - Published 01/01/2013 by US National Renewable Energy Laboratory NREL.

Scott Jenne

2013-02-13T23:59:59.000Z

357

Reduction in maximum time uncertainty of paired time signals  

DOE Patents [OSTI]

Reduction in the maximum time uncertainty (t/sub max/ - t/sub min/) of a series of paired time signals t/sub 1/ and t/sub 2/ varying between two input terminals and representative of a series of single events where t/sub 1/ less than or equal to t/sub 2/ and t/sub 1/ + t/sub 2/ equals a constant, is carried out with a circuit utilizing a combination of OR and AND gates as signal selecting means and one or more time delays to increase the minimum value (t/sub min/) of the first signal t/sub 1/ closer to t/sub max/ and thereby reduce the difference. The circuit may utilize a plurality of stages to reduce the uncertainty by factors of 20 to 800.

Theodosiou, G.E.; Dawson, J.W.

1981-02-11T23:59:59.000Z

358

On Time in Quantum Mechanics  

E-Print Network [OSTI]

Although time measurements are routinely performed in laboratories, their theoretical description is still an open problem. Correspondingly, the status of the energy-time uncertainty relation is unsettled. In the first part of this work the necessity of positive operator valued measures (POVM) as descriptions of every quantum experiment is reviewed, as well as the suggestive role played by the probability current in time measurements. Furthermore, it is shown that no POVM exists, which approximately agrees with the probability current on a very natural set of wave functions; nevertheless, the choice of the set is crucial, and on more restrictive sets the probability current does provide a good arrival time prediction. Some ideas to experimentally detect quantum effects in time measurements are discussed. In the second part of the work the energy-time uncertainty relation is considered, in particular for a model of alpha decay for which the variance of the energy can be calculated explicitly, and the variance of time can be estimated. This estimate is tight for systems with long lifetimes, in which case the uncertainty relation is shown to be satisfied. Also the linewidth-lifetime relation is shown to hold, but contrary to the common expectation, it is found that the two relations behave independently, and therefore it is not possible to interpret one as a consequence of the other. To perform the mentioned analysis quantitative scattering estimates are necessary. To this end, bounds of the form $\\|1_Re^{-iHt}\\psi\\|_2^2 \\leq C t^{-3}$ have been derived, where $\\psi$ denotes the initial state, $H$ the Hamiltonian, $R$ a positive constant, and $C$ is explicitly known. As intermediate step, bounds on the derivatives of the $S$-matrix in the form $\\|1_K S^{(n)}\\|_\\infty \\leq C_{n,K} $ have been established, with $n=1,2,3$, and the constants $C_{n,K}$ explicitly known.

Nicola Vona

2014-03-11T23:59:59.000Z

359

Time-lapse gravity inversion with an active time constraint  

Science Journals Connector (OSTI)

......J. Zhang 1 D.D. Werkema 5 1 Department of Geophysics, Colorado School of Mines, Golden, CO 80401, USA. E-mail: arevil...We applied the time-lapse inversion algorithm to a water-flood and secondary oil recovery experiment in which water was injected......

M. Karaoulis; A. Revil; B. Minsley; M. Todesco; J. Zhang; D.D. Werkema

2014-01-01T23:59:59.000Z

360

May 2008 Y-12 Times  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

5 5 May 2008 www.y12.doe.gov/news/times.php P.O. Box 2009 Oak Ridge, TN 37831-8245 Managing Editor Melissa Leinart 865-574-1621 (6ml) Associate Editors Amy Alley Heidi Spurling Layout/Design Lisa Harris Contributors Ellen Boatner Ken Davis Kathy Fahey Stuart Hames Sharon McConathy Patrick McCoy I N S I D E Page 3 Fire department members come to the rescue Page 4 Driving green to protect our natural resources Page 5 73s: Best regards from Y-12's hams Page8 What's the secret? Mary Murray Brett Pate Ray Smith Donna Watson Bill Wilburn Lisa Xiques times times the B&W Technical Services Y-12, LLC, a partnership between Babcock & Wilcox Technical Services Group Inc. and Bechtel National Inc., operates the Y-12 National Security Complex. When you see information regarding the recent Voluntary Separation Payment

Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

Tough Times for the Muskrats  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Tough Times for the Muskrats Tough Times for the Muskrats Nature Bulletin No. 3 February 24, 1945 Forest Preserve District of Cook County Clayton F Smith, President Roberts Mann, Superintendent of Conservation TOUGH TIMES FOR THE MUSKRATS This has been a sorry year for the muskrats. The long drought, last summer and fall, dried up many of the smaller marshes and ponds where they had been living and forced them to migrate overland to new homes. Many undoubtedly were killed while enroute by mink, hawks, or dogs. Even the larger marshes and ponds were made smaller and more shallow by the drought and now this severe winter, with its long, bitter cold, has caused many of them to freeze solid to the very bottom; thus sealing the muskrats up in their lodges and preventing them from swimming around under the ice to get food.

362

Time-Off Awards Scale  

Broader source: Energy.gov (indexed) [DOE]

/1/2010 /1/2010 TIME OFF AWARD SCALE The following chart is recommended and should be used unless another time-off award scale has been adopted by the servicing human resources office. TIME OFF SCALE VALUE OF THE EMPLOYEE'S CONTRIBUTION HOURS TO BE AWARDED MODERATE - A contribution to a product, program or service to the public which is of sufficient value to merit formal recognition. Beneficial change or modification of operating principles or procedures. 1 - 10 Hours SUBSTANTIAL - An important contribution to the value of a product, activity, program or service to the public. Significant change or modification or operating principles or procedures. 11 - 20 Hours HIGH - A significant contribution to the value of a product, activity, program or service to

363

The Broken Symmetry of Time  

SciTech Connect (OSTI)

This paper seeks to clarify features of time asymmetry in terms of symmetry breaking. It is observed that, in general, a contingent situation or event requires the breaking of an underlying symmetry. The distinction between the universal anisotropy of temporal processes and the irreversibility of certain physical processes is clarified. It is also proposed that the Transactional Interpretation of quantum mechanics offers an effective way to explain general thermodynamic asymmetry in terms of the time asymmetry of radiation, where prior such efforts have fallen short.

Kastner, Ruth E. [Department of Philosophy, University of Maryland, College Park, MD 20742 (United States)

2011-11-29T23:59:59.000Z

364

High Level of Vector Competence of Aedes aegypti and Aedes albopictus from Ten American Countries as a Crucial Factor in the Spread of Chikungunya Virus  

Science Journals Connector (OSTI)

...was detected for the first time in the Americas...coinfection in patients were first reported in 1967 (54...RF Breiman, and AM Powers. 2009. Chikungunya...pone.0005895 . 39. Powers, AM , and CH Logue...albopictus from the Indian Ocean region to two chikungunya...

Anubis Vega-Rúa; Karima Zouache; Romain Girod; Anna-Bella Failloux; Ricardo Lourenço-de-Oliveira

2014-03-26T23:59:59.000Z

365

NEW PRODUCTS:  

Science Journals Connector (OSTI)

......Concentrations from 0.01 to 5 percent by volume are detected. Response time is 0.2 seconds with a flame ionization detector. WTI B.V. 28 Triglyceride Analysis by HPLC SUPELCOSIL-LC columns are high efficiency reverse-phase HPLC col- umns, which......

New Products

1980-05-01T23:59:59.000Z

366

Hedge Fund, Financial Stress, and Cross-Market Linkages  

Gasoline and Diesel Fuel Update (EIA)

Physical Market Conditions, Paper Physical Market Conditions, Paper Market Activity & the WTI-Brent Spread Bahattin BĂĽyĂĽkĹźahin Thomas Lee Jim Moser Michel Robe * 1 Brent WTI - BĂĽyĂĽkĹźahin, Lee, Moser & Robe 2012 Physical Market Conditions, Paper Market Activity & the WTI-Brent Spread Bahattin BĂĽyĂĽkĹźahin Thomas Lee Jim Moser Michel Robe * 2 Brent WTI - BĂĽyĂĽkĹźahin, Lee, Moser & Robe 2012 * T H I S P R E S E N T A T I O N R E F L E C T S T H E O P I N I O N S O F I T S A U T H O R S O N L Y A N D N O T T H O S E O F T H E I N T E R N A T I O N A L E N E R G Y A G E N C Y ( O E C D - I E A ) O R M E M B E R C O U N T R I E S , T H E U . S . D E P A R T M E N T O F E N E R G Y ( E I A ) , I T S A D M I N I S T R A T O R , T H E U . S . C O M M O D I T I E S F U T U R E S T R A D I N G C O M M I S S I O N ( C F T C ) , T H E C O M M I S S I O N E R S , O

367

Last Time... on the website  

E-Print Network [OSTI]

will block until the command finishes netscape & #12;Complex Commands · The shell's power is in its abilityLast Time... on the website #12;Lecture 6 Shell Scripting #12;What is a shell? · The user interface programming language · A program like any other ­ This is why there are so many shells #12;Shell History

Mohri, Mehryar

368

Time for State Bicycle Helmet  

E-Print Network [OSTI]

Time for State Bicycle Helmet Legislation? ?? Jon Roesler, MS Ayo Adeniyi, MBBS, MPH Mark Kinde is the most bike- friendly city in the U.S. in Y2010 #12;#12;Minneapolis is #1 Bike City Bicycling.com list? · Bicycle helmets reduce head injuries and deaths by up to 85%* · If each rider wore a helmet one death per

Minnesota, University of

369

The impact of uncertainty and risk measures  

E-Print Network [OSTI]

West Texas Intermediate (WTI) price series begins in 1983,West Texas In- termediate (WTI) is used to estimate theof data sets by using WTI for both the main VAR and realized

Jo, Soojin; Jo, Soojin

2012-01-01T23:59:59.000Z

370

Animal-Vehicle Collision Data Collection Throughout the United States and Canada  

E-Print Network [OSTI]

Montana State University (WTI-MSU), P.O. Box 174250,and population dynamics. At WTI-MSU, Julie worked withroad ecology projects at WTI-MSU. She is currently working

Huijser, Marcel P.; Wagner, Meredith E.; Hardy, Amanda; Clevenger, Anthony P.; Fuller, Julie A.

2007-01-01T23:59:59.000Z

371

Large-Scale Variability Characterization and Robust Design Techniques for Nanoscale SRAM  

E-Print Network [OSTI]

2.22 Definition of WTV and WTI from measured N-DD . The write trip current (WTI) is defined as the currentthe definitions of WTV and WTI on the N-curve. One important

Guo, Zheng

2009-01-01T23:59:59.000Z

372

ARE Update Volume 11, Number 5  

E-Print Network [OSTI]

West Texas Intermediate (WTI), which describes the grade ofarticle, we describe how the WTI spot price relates to worldCushing is a hub at which WTI and other domestic crude oils

de Wit, Joeri; Smith, Aaron; Kovacs, Kent; Simon, Leo K.; Stratton, Susan

2008-01-01T23:59:59.000Z

373

Classification and characterization of topological insulators and superconductors  

E-Print Network [OSTI]

Weak topological insulators (WTI) . . . . . 1.4 Topologicalweak topological insulators (WTI). The surfaces of STIs haveSTI STM TI TRIM/TRIMs TRS TKNN VPT WTI one-dimension, two-

Mong, Roger

2012-01-01T23:59:59.000Z

374

Comparison of measured and calculated dose rates for the castor® HAW 20/28 CG  

Science Journals Connector (OSTI)

......Scheib 2 A. Rimpler 2 Corresponding author: kuehl@wti.wse.de 1 WTI Wissenschaftlich-Technische Ingenieurberatung GmbH...10) dose rate from the Bonner sphere system. | WTI Wissenschaftlich-Technische Ingenieurberatung GmbH......

O. Ringleb; H. Kühl; H. Scheib; A. Rimpler

2005-12-20T23:59:59.000Z

375

354 2010 IEEE International Solid-State Circuits Conference ISSCC 2010 / SESSION 19 / HIGH-PERFORMANCE EMBEDDED MEMORY / 19.7  

E-Print Network [OSTI]

.92) with the write trip current (WTI) met- ric. Although WTI is a static current metric [4], it reflects dynamic WTI, however, requires access to internal nodes, which is impractical in dense SRAM arrays. Figure 19

Nikolic, Borivoje

376

Expression of the Wilms' tumor suppressor gene WT1 during mouse embryogenesis  

Science Journals Connector (OSTI)

...ifferential Regulation of the Wilms' Tumor Gene, WTI, during Differentiation of Embryonal Carcinoma...pattern of the Wilms' tumor suppressor gene, WTI, during embryonal development suggests a role for the WTI proteins in the differentiation of specific...

RR Rackley; AM Flenniken; NP Kuriyan; PM Kessler; MH Stoler; BR Williams

1993-12-01T23:59:59.000Z

377

General Langevin Equation and Anomaly  

Science Journals Connector (OSTI)

......anomalous chiral Ward- Takahashi identity (WTI). Thus, we have found out that the anomalous chiral WTI is obtained by rewriting the trivial stationary...obtain the conventional regularized chiral WTI, (2 12) Next, let us consider how the above......

Satoshi Tanaka

1993-01-01T23:59:59.000Z

378

Increased expression of the insulin-like growth factor I receptor gene, IGF1R, in Wilms tumor is correlated with modulation of IGF1R promoter activity by the WT1 Wilms tumor gene product  

Science Journals Connector (OSTI)

...expression of the Wilms tumor suppressor gene WTI, whose inactivation appears to be a key step...constructs driving luciferase reporter genes and with WTI expression vectors showed that the active WTI gene product represses IGF-IR promoter activity...

H Werner; G G Re; I A Drummond; V P Sukhatme; F J Rauscher; 3rd; D A Sens; A J Garvin; D LeRoith; C T Roberts; Jr

1993-01-01T23:59:59.000Z

379

Homozygous somatic Wt1 point mutations in sporadic unilateral Wilms tumor.  

Science Journals Connector (OSTI)

...1993 Medical Sciences Homozygous somatic WTI point mutations in sporadic unilateral...loci. A Wilms tumor suppressor gene, WTI, at chromosome 11 band p13, has recently been cloned and characterized. WTI has been implicated in the develop- ment...

M J Coppes; G J Liefers; P Paul; H Yeger; B R Williams

1993-01-01T23:59:59.000Z

380

Remaining Sites Verification Package for the 600-111, P-11 Critical Mass Laboratory Crib, and UPR-600-16, Fire and Contamination Spread Waste Sites, Waste Site Reclassification Form 2008-045  

SciTech Connect (OSTI)

The UPR-600-16, Fire and Contamination Spread waste site is an unplanned release that occurred on December 4, 1951, when plutonium contamination was spread by a fire that ignited inside the 120 Experimental Building. The 120 Experimental Building was a laboratory building that was constructed in 1949 and used for plutonium criticality studies as part of the P-11 Project. In November 1951, a criticality occurred in the 120 Experimental Building that resulted in extensive plutonium contamination inside the building. The confirmatory evaluation supports a reclassification of this site to Interim Closed Out. The current site conditions achieve the remedial action objectives and the corresponding remedial action goals established in the Remaining Sites ROD. The results of the extensive radiological survey of the surface soil and the confirmatory and verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River.

J. M. Capron

2008-10-28T23:59:59.000Z

Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

Mar_13Times.indd  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

MARCH 2013 MARCH 2013 inside this issue ... FIRP draws to a close Page 2 Reminisce: Y-12 turns 70 Page 4 Russia's secret city Page 5 Development retools its CONOPS Page 6 ... and other Y-12 news Miss an issue? Find us online, http://www.y12.doe.gov/news/times.php MISSION, cont. on pg. 2 The National Nuclear Security Administration's Performance Evaluation Report for B&W Y-12, released Feb. 11, gave "Very Good" ratings to B&W Y-12 in areas related to all three core missions: maintaining the nuclear weapons stockpile, powering the nuclear Navy and nonproliferation. The report evaluates B&W Y-12's performance based on the Performance Evaluation Plan approved at the beginning of fi scal 2012. Programs The Y-12 Times highlighted the success of fi

382

High resolution time interval meter  

DOE Patents [OSTI]

Method and apparatus are provided for measuring the time interval between two events to a higher resolution than reliability available from conventional circuits and component. An internal clock pulse is provided at a frequency compatible with conventional component operating frequencies for reliable operation. Lumped constant delay circuits are provided for generating outputs at delay intervals corresponding to the desired high resolution. An initiation START pulse is input to generate first high resolution data. A termination STOP pulse is input to generate second high resolution data. Internal counters count at the low frequency internal clock pulse rate between the START and STOP pulses. The first and second high resolution data are logically combined to directly provide high resolution data to one counter and correct the count in the low resolution counter to obtain a high resolution time interval measurement.

Martin, A.D.

1986-05-09T23:59:59.000Z

383

Global Warming in Geologic Time  

ScienceCinema (OSTI)

The notion is pervasive in the climate science community and in the public at large that the climate impacts of fossil fuel CO2 release will only persist for a few centuries. This conclusion has no basis in theory or models of the atmosphere / ocean carbon cycle, which we review here. The largest fraction of the CO2 recovery will take place on time scales of centuries, as CO2 invades the ocean, but a significant fraction of the fossil fuel CO2, ranging in published models in the literature from 20-60%, remains airborne for a thousand years or longer. Ultimate recovery takes place on time scales of hundreds of thousands of years, a geologic longevity typically associated in public perceptions with nuclear waste. The glacial / interglacial climate cycles demonstrate that ice sheets and sea level respond dramatically to millennial-timescale changes in climate forcing. There are also potential positive feedbacks in the carbon cycle, including methane hydrates in the ocean, and peat frozen in permafrost, that are most sensitive to the long tail of the fossil fuel CO2 in the atmosphere.

David Archer

2010-01-08T23:59:59.000Z

384

DC SQUID spectrometers for nuclear quadrupole and low-field nuclear magnetic resonance spectroscopy  

E-Print Network [OSTI]

as dpJdt + O, where The thermal transition rates Wti can bewritten as Wti = By Wji , where By is the Boltzmann ratio (

TonThat, D.H.

2011-01-01T23:59:59.000Z

385

2006 Long Range Development Plan Final Environmental Impact Report  

E-Print Network [OSTI]

Glenwood, New Mexico, [WTI 02-1], 1995. Zeiner, D.C. , W.F.Manual, Glenwood, New Mexico, [WTI 02-1], 1995. Yee, Henry,

Philliber, Jeff

2007-01-01T23:59:59.000Z

386

In the Beginnings: The Apotropaic Use of Scriptural Incipits in Late Antique Egypt  

E-Print Network [OSTI]

katafugh~j tou~ sw~sai/ me. wti krataiwsij k(ai\\ ) katafugh/read me); me (read moi); wti (read o#ti) krataiwsij (read

Sanzo, Joseph Emanuel

2012-01-01T23:59:59.000Z

387

Generalized fractional smoothness and Lp-variation of BSDEs with non-Lipschitz  

E-Print Network [OSTI]

-distance between the stochastic integral T 0 ZsdWs and its discrete counterpart n i=1 Zti-1 (Wti -Wti-1 ) is upper

Paris-Sud XI, Université de

388

Universitat Tubingen Mathematisches Institut  

E-Print Network [OSTI]

i=0 Wi (Wti+1 - Wti ) des Integrals t 0 WsdWs, wobei i = (1 - )ti + ti+1. Zeigen Sie lim 0 R = 1 2 W

Tübingen, Universität

389

Isolation and characterization of a cDNA clone for the Cat2 gene in maize and its homology with other catalases  

Science Journals Connector (OSTI)

...EAVIY|CKFHYKTDQGIIKNIL|PVEEA|GRLAQEDjPIDYGLRbDLIFNAIAS|G|NYIPS|WTI BWV LVINADIGIEAVIY|CKFHYKTDQIGIIKNIL|SVEDA|ARLAHEDIP|DYGLRIDLIFNAIAT|G|NYIPS|WTI HNIM LEVINANIGEAVIYICKFNYKTDQGIIKNIL|SVEDA|ARLSQED PIDYGIR[LIFNAIAT...

L A Bethards; R W Skadsen; J G Scandalios

1987-01-01T23:59:59.000Z

390

Effective Rural ITS Outreach: The California Program for  

E-Print Network [OSTI]

stakeholder involvement methods, and examples of how the Western Transportation Institute (WTI), Montana State were prioritized to local conditions, WTI and Caltrans conducted a of pilot workshop. Based

McGowen, Patrick

391

Analyzing Static and Dynamic Write Margin for Nanometer  

E-Print Network [OSTI]

: Static Approaches `0' `1' BL Sweep (VBL) N-Curve (WTV,WTI) WM WM WTI WTV #12;10/6/2008 ISLPED 2008 5

Calhoun, Benton H.

392

Development of a real-time residue number processor for SAFT inspection. Phase II. Final report, September 1984-April 1986  

SciTech Connect (OSTI)

A high speed SAFT imaging system has been designed using residue number system (RNS) computational methods. The imaging system is based on a new frequency domain correlation process applied to conventional pulse-echo ultrasonic data, wherein the data is collected over a two-dimensional aperture. The resulting three-dimensional data set in x, y, and 'time-of-flight' may be processed by the frequency domain SAFT (FSAFT) system in either real-time or batch (post-test) modes. In the real-time mode it is expected that true flaw recognition would be of primary interest and the resulting images would be competitive with current time-domain SAFT (TSAFT) techniques. However, the greatest benefit of FSAFT is for detailed analysis of critical flaw types using the high speed batch or fast inspection mode. The system's performance results from using custom RNS hardware to speed the correlation process, which for typical sub-volumes of 64 x 128 x 400 sample points would execute in 11 seconds. This rapid execution time includes all memory exchange overhead as well as forward and inverse number theoretic transforms (NTTs) and point spread function (PSF) multiplication. The hardware design concentrated on a custom memory management processor and RNS computational modules. A FORTRAN coded software simulation was developed in conjunction with the analysis phase of this effort. It was determined by analysis and simulation that the PSF is the critical element in the effective use of FSAFT for inspection.

Polky, J.N.

1986-05-01T23:59:59.000Z

393

dec11-Times.indd  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

1 1 December 2011 www.y12.doe.gov/news/times.php P.O. Box 2009 Oak Ridge, TN 37831-8245 W H A T ' S I N S I D E Page 2 Governance Transformation at Y-12 Page 3 Employees bring benefi ts to life Pages 4 and 5 A healthy start to 2012 Page 6 A visit from Christmas past Page 8 Have a plan - just in case B&W Technical Services Y-12, LLC, a partnership between Babcock & Wilcox Technical Services Group Inc. and Bechtel National Inc., operates the Y-12 National Security Complex. A newsletter for employees and friends of the Y-12 National Security Complex Managing Editors Amy Alley: alleyab@y12.doe.gov Heidi Spurling: spurlinghw@y12.doe.gov Layout Lisa Harris Contributors Mary Bryant Ellen Boatner Ashley Douglas Kathy Fahey Scott Fraker John Holbrook David Keim Terry Marlar Jill McNutt

394

jul10_Times.indd  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

7 7 July 2010 www.y12.doe.gov/news/times.php P.O. Box 2009 Oak Ridge, TN 37831-8245 W H A T ' S I N S I D E Page 2 Want to know about Y-12's budget? Read what Darrel Kohlhorst said. Page 3 Y-12 employees get a LIFE Center Pages 4 and 5 Safeguards, Security and Emergency Services' Sentinel Page 6 Employees raise money for Relay for Life Page 8 Refl ections of Y-12's history B&W Technical Services Y-12, LLC, a partnership between Babcock & Wilcox Technical Services Group Inc. and Bechtel National Inc., operates the Y-12 National Security Complex. A newsletter for employees and friends of the Y-12 National Security Complex Managing Editors Amy Alley: alleyab@y12.doe.gov Heidi Spurling: spurlinghw@y12.doe.gov Layout Lisa Harris Contributors Mary Bryant Cynthia Ensor Ryn Etter

395

C-O-H ratios of silicate melt inclusions in basalts from the Galapagos spreading center near 95 degree W: A leaser decrepitation mass spectrometry study  

SciTech Connect (OSTI)

Volatile ratios (primarily of H{sub 2}O and CO{sub 2}) in individual silicate melt (glass) inclusions in minerals have been analyzed using laser volatilization and mass spectrometry. A Nd-glass laser was used to produce 50-micrometer diameter pits in silicate melt inclusions. Released volatiles were analyzed directly with a computer-controlled quadrupole mass spectrometer. The mean CO{sub 2}/H{sub 2}O from the propagating rift (0.245 {plus minus} 0.068) silicate glass inclusions is significantly lower than that of the actively failing rift (0.641 {plus minus} 0.241); this difference probably reflects different degrees of degassing during contrasting magmatic histories for the two regions. Relatively undifferentiated failing rift magmas must have relatively short crustal residence time prior to eruption and, therefore, have not undergone significant degassing of CO{sub 2}, as would appear to be the case for the more highly fractionated propagating rift magmas. The laser-mass spectrometric system described herein has the ability to act as a point-source probing device that can differentiate between the various volatile sites in minerals and rocks (as well as synthetic materials) on a micrometer scale.

Yonover, R.N.; Sinton, J.M. (Univ. of Hawaii, Honolulu (USA)); Gibson, E.K. (NASA/Johnson Space Center, Houston, TX (USA)); Sommer, M.A.

1989-12-01T23:59:59.000Z

396

March 2009 Y-12 Times  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

3 3 March 2009 www.y12.doe.gov/news/times.php P.O. Box 2009 Oak Ridge, TN 37831-8245 Managing Editors Amy Alley: alleyab@y12.doe.gov Heidi Spurling: spurlinghw@y12.doe.gov Layout/Design Lisa Harris Contributors Ellen Boatner Ken Davis Kathy Fahey Vicki Hinkel Jamie Loveday Mary Murray W H A T ' S I N S I D E W H A T ' S I N S I D E Page 2 Page 2 New UPF room is out of sight Page 3 Page 3 Training simulates terrorist attack, prepares fi rst responders Page 3 Page 3 Tanker cars on the right track Page 5 Page 5 Third-generation employee follows his father's sage advice Page 7 Page 7 Car enthusiasts go into overdrive Brett Pate Ray Smith Donna Watson Mona Wright Lisa Xiques B&W Technical Services Y-12, LLC, a partnership between Babcock & Wilcox Technical Services Group Inc. and Bechtel National Inc., operates the

397

Benchmarking of energy time series  

SciTech Connect (OSTI)

Benchmarking consists of the adjustment of time series data from one source in order to achieve agreement with similar data from a second source. The data from the latter source are referred to as the benchmark(s), and often differ in that they are observed at a lower frequency, represent a higher level of temporal aggregation, and/or are considered to be of greater accuracy. This report provides an extensive survey of benchmarking procedures which have appeared in the statistical literature, and reviews specific benchmarking procedures currently used by the Energy Information Administration (EIA). The literature survey includes a technical summary of the major benchmarking methods and their statistical properties. Factors influencing the choice and application of particular techniques are described and the impact of benchmark accuracy is discussed. EIA applications and procedures are reviewed and evaluated for residential natural gas deliveries series and coal production series. It is found that the current method of adjusting the natural gas series is consistent with the behavior of the series and the methods used in obtaining the initial data. As a result, no change is recommended. For the coal production series, a staged approach based on a first differencing technique is recommended over the current procedure. A comparison of the adjustments produced by the two methods is made for the 1987 Indiana coal production series. 32 refs., 5 figs., 1 tab.

Williamson, M.A.

1990-04-01T23:59:59.000Z

398

Psychological barriers in oil futures markets  

Science Journals Connector (OSTI)

Abstract WTI and Brent futures are tested for the presence of psychological barriers around $10 price levels, applying a multiple hypothesis testing approach for statistical robustness. Psychological barriers are found to be present in Brent prices but not in WTI prices, which is argued to be due to the more prominent role that Brent plays as a global benchmark and, based on recent behavioural finance research, the greater complexity inherent in Brent fundamental value determination. Brent particularly displays evidence that when breaching a $10 barrier level from below with rising prices, the trend is for prices to fall on average subsequently. Similar behavioural-based patterns are evidenced at the $1 barrier level for the WTI–Brent spread. We show that psychological barriers only appear to influence prices in the pre-credit crisis period of 1990–2006, with such effects dissipating during the crisis and as markets reverted back to wider economy focused fundamentals. A range of reaction windows are applied with the main finding being that the trading potential around such psychological barrier levels is primarily in the immediate 1–5 days following a breach. The research contributes to the scant existing research on psychological influences on energy market traders, and suggests strong potential for further application of behavioural finance theories to improving understanding of energy markets price dynamics.

Michael Dowling; Mark Cummins; Brian M. Lucey

2014-01-01T23:59:59.000Z

399

Timed CSP: A Retrospective Joel Ouaknine 1  

E-Print Network [OSTI]

APC 2005 Timed CSP: A Retrospective Jo¨el Ouaknine 1 Oxford University Computing Laboratory, UK Timed CSP, from its inception nearly twenty years ago to very recent semantical and algorithmic developments. Key words: Process algebra, Timed CSP. Timed CSP was first proposed in 1986 by Reed and Roscoe

Ouaknine, Joël

400

pdf version of the entry Time Machines  

E-Print Network [OSTI]

pdf version of the entry Time Machines http://plato.stanford.edu/archives/win2010/entries/time-machine, Stanford, CA 94305 Time Machines Copyright c 2010 by the authors John Earman and Christian W¨uthrich All rights reserved. Copyright policy: https://leibniz.stanford.edu/friends/info/copyright/ Time Machines

WĂĽthrich, Christian

Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

Isobar separation by time-of-flight mass spectrometry for low-energy radioactive ion beam facilities  

Science Journals Connector (OSTI)

A multiple-reflection time-of-flight mass spectrometer (MR-TOF-MS) system for low-energy radioactive ion beam facilities has been developed, which can be used for (i) isobar separation and (ii) direct mass measurements of very short-lived nuclei with half-lives of about 1 ms or longer, and (iii) for identification and diagnosis of the ion beam by mass spectrometry. The system has been designed and simulated, and individual subsystems have been built and characterized experimentally. An injection trap for cooling and bunching of the ion beam has been developed, and cooling times of less than one millisecond have been achieved. The performance of the MR-TOF-MS was characterized using the isobaric doublet of carbon monoxide and nitrogen molecular ions. A mass resolving power of 105 (FWHM) has been obtained even with an uncooled ion population. The separator capabilities of the MR-TOF-MS have been demonstrated by removing either carbon monoxide or nitrogen ions from the beam in a Bradbury-Nielsen Gate after a flight time of 320 ?s. The separation power achieved is thus at least 7000 (FWHM) and increases for longer time-of-flight. An energy buncher stage has been designed that compresses the energy spread of the beam after the separation and facilitates efficient injection of the selected ions into an accumulation trap prior to transfer of the ions to experiments downstream of the MR-TOF-MS.

Wolfgang R. Plaß; Timo Dickel; Ulrich Czok; Hans Geissel; Martin Petrick; Katrin Reinheimer; Christoph Scheidenberger; Mikhail I.Yavor

2008-01-01T23:59:59.000Z

402

Real time simulation of 2007 Santa Ana fires  

E-Print Network [OSTI]

There are many wildfire behaviors of increasing relevance that are outside the forecast capabilities of even the most sophisticated operational fire spread and fire behavior model. The limitations of the operational models are due primarily to their inability to represent coupled fire-atmosphere interactions. Coupled wildfire-atmosphere models are physics-based fluid-dynamical prognostic models of wildfire spread and behavior that attempt an almost complete representation of fire-atmosphere interactions. This level of fidelity however means that these models cannot be used operationally. The reason is that, despite ever increasing computational resources, the complexity and range of processes and scales (1 mm to 100 km) involved in this modeling approach make computational costs prohibitively expensive. In this study we propose an intermediate approach. A physics-based coupled atmosphere-fire model is used to resolve the large-scale and local weather as well as the atmosphere-fire interactions, while combusti...

Kochanski, A K; Krueger, S K; Mandel, J; Beezley, J D

2012-01-01T23:59:59.000Z

403

Apply for Beam Time | Advanced Photon Source  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Apply for Beam Time Apply for Beam Time NEXT PROPOSAL DEADLINE: March 7, 2014 @ 11:59 PM (Chicago time) Submit Proposal » SEE ALSO: Calendar: deadlines, run & review dates Help Page: frequently asked questions, tips for success, common errors, blank forms, instructions Review Criteria Sectors Directory: check CAT websites for info about managed beam time The Run 2014-2 proposal submission deadline is 11:59 p.m. (Chicago time) March 7, 2014. The system will open to accept proposals beginning December 20, 2013. NEW USERS: to avoid delays and to make the most of your time on site, read Become a User. You must register as a user and receive a badge number before submitting a proposal. About the Beam Time Request Process All beam time at the APS must be requested each cycle through the web-based

404

Parental Time, Behaviors and Childhood Obesity  

E-Print Network [OSTI]

towards child health are modeled and analyzed using instrument variable (IV) methods. Results indicate that the effect of mother's time allocation reduces child weight status. Her decision to allocate time to the child is affected by unseen factors. Father...

Kuteesa, Annette

2012-02-14T23:59:59.000Z

405

EnergyPlus Run Time Analysis  

E-Print Network [OSTI]

Tree Lawrence Berkeley National Laboratory  Page 37  California EnergyEnergy Commission EnergyPlus Run Time Analysis Plant Supply Calling Tree (Energy Commission EnergyPlus Run Time Analysis Appendix A – EnergyPlus Call Tree

Hong, Tianzhen

2009-01-01T23:59:59.000Z

406

Time-predictable Computer Architecture Martin Schoeberl  

E-Print Network [OSTI]

Time-predictable Computer Architecture Martin Schoeberl Institute of Computer Engineering Vienna. Then we propose solutions for a time- predictable computer architecture. The proposed architecture in computer architectures are: pipelining, instruction and data caching, dynamic branch prediction, out

407

Time Structure of the LANSCE Beam  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Beam One of the greatest strengths of the LANSCE facility is that it can produce proton beams with a wide range of time structures. Time Structure of the LANSCE Beam One of the...

408

Enabling time travel for the scholarly web  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Enabling time travel for the scholarly web Enabling time travel for the scholarly web An international team of information scientists has begun a study to investigate how web links...

409

Time series anomaly detection using recessive subsequence  

Science Journals Connector (OSTI)

Time series arise frequently in many sciences and engineering application, including finance, digital audio, motion capture, network security, and transportation. In this work, we propose a technique for discovering anomalies in time series that takes ...

Yonchanok Khaokaew; Sirikarn Pukkawanna

2012-02-01T23:59:59.000Z

410

Time Dependent Density Functional Theory An introduction  

E-Print Network [OSTI]

Time Dependent Density Functional Theory An introduction Francesco Sottile LSI, Ecole Polytechnique) Time Dependent Density Functional Theory Palaiseau, 26 May 2014 1 / 62 #12;Outline 1 Introduction: why and Resources Francesco Sottile (ETSF) Time Dependent Density Functional Theory Palaiseau, 26 May 2014 2 / 62

Botti, Silvana

411

Timing Attacks on software implementation of RSA  

E-Print Network [OSTI]

the amount of time required to perform private key operations (Decryptions etc.). Timing attacks are related to a class of attacks called side-channel attacks. Others include power analysis and attacks based decryption times are masked by many concurrent processes running on the system. It is also believed

412

Time (hole?) machines John Byron Manchak  

E-Print Network [OSTI]

Time (hole?) machines John Byron Manchak Department of Philosophy, University of Washington, Box machines Hole machines Time travel General relativity a b s t r a c t Within the context of general relativity, we consider a type of "time machine" and introduce the related "hole machine". We review what

Manchak, John

413

Real-time Detection of Parametric Roll  

E-Print Network [OSTI]

Early Detection of PArametric ROLL on Ships #12;Real-time Detection of Parametric Roll: FullReal-time Detection of Parametric Roll: Full-scale Validation Roberto Galeazzi Assistant Professor-time Detection of Parametric Roll: Full-scale validation CeSOS Highlights & AMOS Visions Conference 2 DTU

Nørvåg, Kjetil

414

Convex Optimization: from Real-Time Embedded  

E-Print Network [OSTI]

Convex Optimization: from Real-Time Embedded to Large-Scale Distributed Stephen Boyd Neal Parikh of Edinburgh, June 25 2014 1 #12;Outline Convex Optimization Real-Time Embedded Optimization Large-Scale Distributed Optimization Summary 2 #12;Outline Convex Optimization Real-Time Embedded Optimization Large

Hall, Julian

415

Time-optimal transfer of coherence  

Science Journals Connector (OSTI)

We provide exact analytical solutions for the problem of time-optimal transfer of coherence from one spin-polarization to a threefold coherence in a trilinear Ising chain with a fixed energy available and subject to local controls with a non-negligible time cost. The time of transfer is optimal and consistent with a previous numerical result obtained assuming instantaneous local controls.

Alberto Carlini and Tatsuhiko Koike

2012-11-26T23:59:59.000Z

416

CPO semantics of timed interactive actor networks  

Science Journals Connector (OSTI)

We give a denotational framework for composing interactive components into closed or open systems and show how to adapt classical domain-theoretic approaches to open systems and to timed systems. For timed systems, prior approaches are based on temporal ... Keywords: Actors, Agents, CPOs, Dataflow, Discrete events, Interaction, Posets, Process networks, Semantics, Timed systems

Xiaojun Liu; Edward A. Lee

2008-12-01T23:59:59.000Z

417

Predicting Time-Delays under Real-Time Scheduling for Linear Model Predictive Control  

E-Print Network [OSTI]

Predicting Time-Delays under Real-Time Scheduling for Linear Model Predictive Control Zhenwu Shi prediction of time-delays caused by real-time scheduling. Then, a model predictive controller is designed, the interaction between real-time scheduling and control design has received interest in the literature

Zhang, Fumin

418

Markets & Finance - U.S. Energy Information Administration (EIA)  

Gasoline and Diesel Fuel Update (EIA)

Workshops Workshops Financial and Physical Oil Market Linkages Workshop (September 23, 2013) Workshop Agenda and Participants Financial and Physical Oil Market Linkages II Workshop (September 27, 2012) Workshop Agenda and Participants Workshop Summary Notes Physical Market Conditions, Paper Market Activity, and the Brent-WTI Spread Bahattin Buyuksahin, Thomas K. Lee, James T. Moser and Michel A. Robe Presentation (Michel Robe) Discussant Presentation (Lutz Kilian) Speculation in the Oil Market Luciana Juvenal and Ivan Petrella Presentation (Luciana Juvenal) Discussant Presentation (James Hamilton) Financial Investment in Commodities Markets: Potential Impact on Commodity Prices and Volatilities Institute of International Finance (IIF) Commodities Task Force Presentation (Hung Tran)

419

Time-Energy Measure for Quantum Processes  

E-Print Network [OSTI]

Quantum mechanics sets limits on how fast quantum processes can run given some system energy through time-energy uncertainty relations, and they imply that time and energy are tradeoff against each other. Thus, we propose to measure the time-energy as a single unit for quantum channels. We consider a time-energy measure for quantum channels and compute lower and upper bounds of it using the channel Kraus operators. For a special class of channels (which includes the depolarizing channel), we can obtain the exact value of the time-energy measure. One consequence of our result is that erasing quantum information requires $\\sqrt{(n+1)/n}$ times more time-energy resource than erasing classical information, where $n$ is the system dimension.

Chi-Hang Fred Fung; H. F. Chau

2013-05-24T23:59:59.000Z

420

Estimation and tracking of rapidly time-varying broadband acoustic communication channels  

E-Print Network [OSTI]

This thesis develops methods for estimating wideband shallow-water acoustic communication channels. The very shallow water wideband channel has three distinct features: large dimension caused by extensive delay spread; ...

Li, Weichang, 1972-

2006-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

The spread of innovations in social networks  

Science Journals Connector (OSTI)

...social networks, World Wide Web, and the Internet. Another popular class of models for the...certain connectivity properties of the Internet topology . J Comput...S Vt such that L1 |S|h L2. With an abuse of notation, we wrote hVt for hG(Vt...

Andrea Montanari; Amin Saberi

2010-01-01T23:59:59.000Z

422

Ignition and spread of electrical wire fires  

E-Print Network [OSTI]

processes of phase change material (PCM) induced bymolten process of phase change material (PCM) to understand

Huang, Xinyan

2012-01-01T23:59:59.000Z

423

Spread of Detonation in High Explosives  

Science Journals Connector (OSTI)

... W. C. F. Shepherd makes the interesting observation that in the initial stages of detonation in a cylindrical cartridge of high explosive initiated with a detonator, a phase, referred ... of high explosive initiated with a detonator, a phase, referred to as the pre-detonation phase, is often noticeable during which the rate of propagation of the reaction is ...

ELWYN JONES; DUGALD MITCHELL

1948-01-17T23:59:59.000Z

424

cover image The spreading of information, ideas  

E-Print Network [OSTI]

; News & Views p838 metal spintronics Thermal spin injection Letter p879 editorial 825 Development Zhao 879 Thermally driven spin injection from a ferromagnet into a non-magnetic metal A. Slachter, F. L

Loss, Daniel

425

stay healthy, my friends PREVENT THE SPREAD  

E-Print Network [OSTI]

secretions by close personal contact, such as coughing, sharing drinks, and kissing, or being in close NOT cough into anyone's face. Cough into your sleeve or tissue. Wash or sanitize hands frequently. drinking

Akhmedov, Azer

426

A new theory for interface spreading  

E-Print Network [OSTI]

0=0. 08, t=960 s, a=69. 5 pm. 0. 1 0. 08 0. 04 0 0. 02 0. 04 0. 06 0. 08 0. 1 XO FIG. 5. z (m) as a function of z for so=0. OB, t=1236 s, a=69. 5 pm. 0. 1 0. 08 S 0. 06 0. 04 0. 05 ~ ~ 0 0. 02 0, 04 0. 06 0. 08 0. 1 FIG. 6. z (m) as a...=69. 5 pm. . z (m) as a function of x for xo=0. 08, t=966 s, a=69. 5 pm. z (m) as a function of z for zc=0. 08, t=1236 s, a=69. 5 pm. z (m) as a function of x for xc=0. 08, t=1506 s, a=69. 5 pm. x (m) as a function of z for xo=0. 10, t=182 s, a=68...

Puthran, Hansraj Nagappa

2012-06-07T23:59:59.000Z

427

Ignition and spread of electrical wire fires  

E-Print Network [OSTI]

Airplane fires; (b) Nuclear power plant fires; (c) Chemicalignition sources in nuclear power plants: statistical,number of fire cases in nuclear power plants (NPP) [2]. Most

Huang, Xinyan

2012-01-01T23:59:59.000Z

428

How chemicals spread in soils | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

simulated four sets of experimental data using micromodels fabricated in the new microfluidics laboratory at EMSL, a U.S. Department of Energy (DOE) national scientific user...

429

Prevent the Spread of Zoonotic Diseases (Spanish)  

E-Print Network [OSTI]

. Ubique pozos de agua cuesta arriba y al menos 100 pies de ?reas para ? animales y sistemas s?pticas. Nunca deje mangueras sobre el suelo en ?reas para animales.? Reduzca el contacto de visitantes con los animales.? Mantenga nuevos animales alejados de...

Pena, Josefa

2008-11-10T23:59:59.000Z

430

EECBG Success Story: Cincinnati Canvassing Spreads Retrofitting...  

Broader source: Energy.gov (indexed) [DOE]

home energy audits in the area. | Photo Courtesy GCEA The Greater Cincinnati Energy Alliance (GCEA) in Ohio is financing a residential energy audit program to get home energy...

431

Differential Renormalization of Supersymmetric Gauge Theories in Superspace  

E-Print Network [OSTI]

-Takahashi Identities in SQED . . . . . . . . . . . . . . . 62 5.1.3 Perturbative Calculations of Super WTI

Slatkin, Montgomery

432

Patrick T. McGowen, P.E., Ph.D. Research Engineer, Western Transportation Institute / Civil Engineering  

E-Print Network [OSTI]

jointly appointed between the Western Transportation Institute (WTI) and Civil Engineering Department

McGowen, Patrick

433

MMMAT H E M AT I C A LAT H E M AT I C A LAT H E M AT I C A L SSSC I E N C E SC I E N C E SC I E N C E S Undergraduate major  

E-Print Network [OSTI]

Transportation Institute (WTI). Cooperative on- campus projects involved the departments of Animal & Range

Maxwell, Bruce D.

434

Equivariant K-homology for some Coxeter groups  

Science Journals Connector (OSTI)

......of the cell, that is, there is an i such that wWTi = WTi so that w WTi WT . 784 RUB EN J. S ANCHEZ-GARC IA Secondly, we observe...spherical subsets of generators up to rank n. Define Ai = W WTi CWTi 0 i m. Then n = A i and Ai Aj n-1 for all i......

Rubén J. Sánchez-García

2007-06-01T23:59:59.000Z

435

Developing a Crash Prediction Model for Deer-Vehicle Collisions Neil DeZort  

E-Print Network [OSTI]

-Bozeman A report prepared for the WTI Undergraduate Research Experience Program April 28, 2010 #12;Developing

McGowen, Patrick

436

DEPARTMENT OF ECONOMICS AND FINANCE COLLEGE OF BUSINESS AND ECONOMICS  

E-Print Network [OSTI]

in the world of international trading today are: 1) West Texas Intermediate (WTI), the reference crude

Hickman, Mark

437

MMMAT H E M AT I C A LAT H E M AT I C A LAT H E M AT I C A L SSSC I E N C E SC I E N C E SC I E N C E S Undergraduate majors  

E-Print Network [OSTI]

Transportation Institute (WTI). Cooperative on- campus projects involved the departments of Animal & Range

Maxwell, Bruce D.

438

Property:Event/Time | Open Energy Information  

Open Energy Info (EERE)

Time Time Jump to: navigation, search Property Name Event/Time Property Type String Description The time an event occurs. For events which span an entire day, please use 'All Day'. When entering a specific time, please be sure to include the timezone information, for example: '2:45 PM MDT' or '10:00 AM GST'. Pages using the property "Event/Time" Showing 25 pages using this property. (previous 25) (next 25) A April Fool's Day + All Day + B Blane Harvey co-facilitating a session on use of climate decision making tools with CARE and Tearfund + 13:00-14:00 + Blane Harvey facilitating a lunchtime session on Indigenous Knowledge and Adaptation + 13:00-14:00 + Blane Harvey facilitating a lunchtime session on knowledge platforms and online communities of practice + 13:00-14:00 +

439

An overview of time?reversal acoustics  

Science Journals Connector (OSTI)

Time?reversal invariance is a very powerful concept in physics. In the field of acoustics where time reversal invariance occurs time?reversal experiments may be achieved simply with arrays of transmit?receive transducers allowing an incident wave field to be sampled recorded time?reversed and re?emitted. Time reversal mirrors (TRMs) may be used to study random media and chaotic reverberating structures. Common to these complex media is a remarkable robustness exemplified by observations that the more complex the medium between the probe source and the TRM the sharper the focus. TRMs open the way to new signal processings that interest imaging detection telecommunications and therapy. Time reversal mirrors have plenty of applications including ultrasonic therapy and medical imaging non destructive testing telecommunications underwater acoustics seismology sound control home automation. An overview of these fields will be presented.

Mathias Fink

2008-01-01T23:59:59.000Z

440

Time-Energy Costs of Quantum Measurements  

E-Print Network [OSTI]

Time and energy of quantum processes are a tradeoff against each other. We propose to ascribe to any given quantum process a time-energy cost to quantify how much computation it performs. Here, we analyze the time-energy costs for general quantum measurements, along a similar line as our previous work for quantum channels, and prove exact and lower bound formulae for the costs. We use these formulae to evaluate the efficiencies of actual measurement implementations. We find that one implementation for a Bell measurement is optimal in time-energy. We also analyze the time-energy cost for unambiguous state discrimination and find evidence that only a finite time-energy cost is needed to distinguish any number of states.

Chi-Hang Fred Fung; H. F. Chau

2014-02-20T23:59:59.000Z

Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

Time-energy costs of quantum measurements  

Science Journals Connector (OSTI)

Time and energy of quantum processes are a tradeoff against each other. We propose to ascribe to any given quantum process a time-energy cost to quantify how much computation it performs. Here, we analyze the time-energy costs for general quantum measurements, along a similar line as our previous work for quantum channels, and prove exact and lower bound formulas for the costs. We use these formulas to evaluate the efficiencies of actual measurement implementations. We find that one implementation for a Bell measurement is optimal in time energy. We also analyze the time-energy cost for unambiguous state discrimination and find evidence that only a finite time-energy cost is needed to distinguish any number of states.

Chi-Hang Fred Fung and H. F. Chau

2014-05-08T23:59:59.000Z

442

Time-parallel multiscale/multiphysics framework  

Science Journals Connector (OSTI)

We introduce the time-parallel compound wavelet matrix method (tpCWM) for modeling the temporal evolution of multiscale and multiphysics systems. The method couples time parallel (TP) and CWM methods operating at different spatial and temporal scales. ... Keywords: 02.00.00, 02.10.Jf, 05.10.-a, 46.15.-x, 47.70.Fw, Parallel-in-time, Wavelet-based multiscaling

G. Frantziskonis; K. Muralidharan; P. Deymier; S. Simunovic; P. Nukala; S. Pannala

2009-11-01T23:59:59.000Z

443

Construction Timing and Expectations | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Construction Timing and Expectations Construction Timing and Expectations Construction Timing and Expectations October 16, 2013 - 5:07pm Addthis Creating a detailed construction schedule that allows all the project elements to be coordinated in a timely manner is fundamental to any successful construction project. The construction schedule should take into account that many tasks cannot be started before others are finished. It should also account for special schedule considerations related to renewable energy systems. Key elements of most new construction or major renovation projects include landscape, structural, architectural, mechanical, electrical, plumbing, communication systems, and renewable energy systems. Maintaining the highest quality of construction across all elements is fundamental to any

444

Nonlinear time-fractional dispersive equations  

E-Print Network [OSTI]

In this paper we study some cases of time-fractional nonlinear dispersive equations (NDEs) involving Caputo derivatives, by means of the invariant subspace method. This method allows to find exact solutions to nonlinear time-fractional partial differential equations by separating variables. We first consider a third order time-fractional NDE that admits a four-dimensional invariant subspace and we find a similarity solution. We also study a fifth order NDE. In this last case we find a solution involving Mittag-Leffler functions. We finally observe that the invariant subspace method permits to find explicit solutions for a wide class of nonlinear dispersive time-fractional equations.

P. Artale Harris; R. Garra

2014-10-29T23:59:59.000Z

445

The Y-12 Times, May 2011  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

PFD also is continuing to concentrate on enhanced fl oor surveillance, which focuses on conduct of operations and timely feedback to facilitate improvement. "PFD is proving to be...

446

Development of Nonlinear SSI Time Domain Methodology  

Broader source: Energy.gov [DOE]

Development of Nonlinear SSI Time Domain Methodology Justin Coleman, P.E. Nuclear Science and Technology Idaho National Laboratory October 22, 2014

447

Multiplicative cascades and seismicity in natural time  

Science Journals Connector (OSTI)

Natural time ? enables the distinction of two origins of self-similarity, i.e., the process memory and the process increments infinite variance. Employing multiplicative cascades in natural time, the most probable value of the variance ?1(???2?????2) is explicitly related with the parameter b of the Gutenberg-Richter law of randomly shuffled earthquake data. Moreover, the existence of temporal and magnitude correlations is studied in the original earthquake data. Magnitude correlations are larger for closer in time earthquakes, when the maximum interoccurrence time varies from half a day to 1 min.

N. V. Sarlis; E. S. Skordas; P. A. Varotsos

2009-08-11T23:59:59.000Z

448

Sunrise-Sunset Times - Hanford Site  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Station Real Time Met Data from Around the Site Current HMS Observations Daily HMS Extremes in Met Data Met and Climate Data Summary Products Historical Weather Charts Contacts...

449

Nordic Journal of Computing 10(2003), 135. TIMED CSP = CLOSED TIMED -AUTOMATA  

E-Print Network [OSTI]

Nordic Journal of Computing 10(2003), 1­35. TIMED CSP = CLOSED TIMED -AUTOMATA JO¨EL OUAKNINE CSP which significantly increase expressiveness. As a result, we are able to capture some of the most of the finite-state fragment of this augmented version of Timed CSP as that of closed timed -automata

Ouaknine, Joël

450

Nordic Journal of Computing 10(2003), 1--35. TIMED CSP = CLOSED TIMED #AUTOMATA  

E-Print Network [OSTI]

Nordic Journal of Computing 10(2003), 1--35. TIMED CSP = CLOSED TIMED #­AUTOMATA JO Ë? EL OUAKNINE CSP which significantly increase expressiveness. As a result, we are able to capture some of the most of the finite­state fragment of this augmented version of Timed CSP as that of closed timed #­automata

Ouaknine, Joël

451

Working times in atypical forms of employment: the special case of part-time work  

E-Print Network [OSTI]

market. In an Employment Survey carried out by the French National Statistics Office (INSEE), part- timeChapter 5 Working times in atypical forms of employment: the special case of part-time work Patrick Abstract: In the present article, we attempt to devise a typology of forms of part-time employment

Paris-Sud XI, Université de

452

Author's personal copy The time dependent vehicle routing problem with time windows  

E-Print Network [OSTI]

: (a) formulate a time dependent vehicle routing problem with a general cost function and time windowAuthor's personal copy The time dependent vehicle routing problem with time windows: Benchmark College of Engineering and Computer Science, PO Box 0751, Portland State University, Portland, OR 97207

Bertini, Robert L.

453

A ROUTE IMPROVEMENT ALGORITHM FOR THE VEHICLE ROUTING PROBLEM WITH TIME DEPENDENT TRAVEL TIMES  

E-Print Network [OSTI]

) formulate a time dependent vehicle routing problem with a general cost function and time window constraintsA ROUTE IMPROVEMENT ALGORITHM FOR THE VEHICLE ROUTING PROBLEM WITH TIME DEPENDENT TRAVEL TIMES MIGUEL A. FIGLIOZZI Civil & Environmental Engineering Department Portland State University P.O. Box 751

Bertini, Robert L.

454

Risk assessment for the Waste Technologies Industries (WTI) hazardous waste incineration facility (East Liverpool, Ohio). Volume 5. Human health risk assessment; evaluation of potential risks from multipathway exposure to emissions  

SciTech Connect (OSTI)

The report provide estimates of: (1) individual risks based on central tendency exposure; (2) individual risks based on maximum environmental concentrations; (3) risks to highly exposed or susceptible subgroups of the population (e.g., subsistence farmers and school children); (4) risks associated with specific activities that may result in elevated exposures (e.g., subsistence fishermen and deer hunters); and (5) population risk. This approach allows for the estimation of risks to specific segments of the population taking into consideration activity patterns, number of individuals, and actual locations of individuals in these subgroups with respect to the facility. The fate and transport modeling of emissions from the facility to estimate exposures to identified subgroups is described.

NONE

1997-05-01T23:59:59.000Z

455

Laser Telecommunication timeLaser beam  

E-Print Network [OSTI]

Laser Telecommunication Experiment Laser time Laser beam intensity timeLaser beam Laser battery Laser connected to a circuit without a modulator. Bottom graph illustrates what happen when a modulating signal is superimposed to the DC voltage driving the laser Laser beam intensity DC Input voltage DC

La Rosa, Andres H.

456

Light gas gun with reduced timing jitter  

DOE Patents [OSTI]

Gas gun with reduced timing jitter. A gas gun having a prepressurized projectile held in place with a glass rod in compression is described. The glass rod is destroyed with an explosive at a precise time which allows a restraining pin to be moved and free the projectile.

Laabs, Gary W. (Los Alamos, NM); Funk, David J. (Los Alamos, NM); Asay, Blaine W. (Los Alamos, NM)

1998-01-01T23:59:59.000Z

457

HR EMPLOYMENT LAW UPDATES TIME TO TRAIN  

E-Print Network [OSTI]

HR EMPLOYMENT LAW UPDATES TIME TO TRAIN Since 6 April 2010 employers have had to seriously consider an eligible employee's formal request for time away from their core duties to undertake training. Employees can request to undertake training they think will improve both their own and the University

Sussex, University of

458

EnergyPlus Run Time Analysis  

SciTech Connect (OSTI)

EnergyPlus is a new generation building performance simulation program offering many new modeling capabilities and more accurate performance calculations integrating building components in sub-hourly time steps. However, EnergyPlus runs much slower than the current generation simulation programs. This has become a major barrier to its widespread adoption by the industry. This paper analyzed EnergyPlus run time from comprehensive perspectives to identify key issues and challenges of speeding up EnergyPlus: studying the historical trends of EnergyPlus run time based on the advancement of computers and code improvements to EnergyPlus, comparing EnergyPlus with DOE-2 to understand and quantify the run time differences, identifying key simulation settings and model features that have significant impacts on run time, and performing code profiling to identify which EnergyPlus subroutines consume the most amount of run time. This paper provides recommendations to improve EnergyPlus run time from the modeler?s perspective and adequate computing platforms. Suggestions of software code and architecture changes to improve EnergyPlus run time based on the code profiling results are also discussed.

Hong, Tianzhen; Buhl, Fred; Haves, Philip

2008-09-20T23:59:59.000Z

459

Photo cathode laser timing response measurements  

E-Print Network [OSTI]

Photo cathode laser timing response measurements F. Löhl, H. Schlarb, E. Vogel, W. Koprek, V on the gun phase 2.) Arrival time change of photo injector laser pulses #12;Florian Löhl FLASH Seminar, June 19th, 2007 photo injector laser ~ 1.3 GHz vector modulator DAC I Q DOOCS Courtesy of I. Will #12

460

TimeVariable Photo-Evaporation of  

E-Print Network [OSTI]

TimeVariable Photo-Evaporation of Protoplanetary Disks Henry Throop (SwRI) John Bally (U. Colorado) #12;Takeaway: Photo-evaporation alters the disk structure in essentially unpredictable ways, because for disks formed at the same time in the same cluster. #12;30 Doradus: 100+ O/B stars Photo

Throop, Henry

Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

StoryTime: experiencing place through history  

Science Journals Connector (OSTI)

In this paper, we present our vision of the future of maps. Story Time is a system of geographically associated "stories" as told by the people who experienced them. Story Time allows visitors to a location to explore a place from a new perspective, ... Keywords: cartography, experience design, participatory mapping, psychogeography, way-showing

Lorelei Kelly; Sarah Reeder; Xuan Wang; Susan Coleman Morse

2009-11-01T23:59:59.000Z

462

Correcting and combining time series forecasters  

Science Journals Connector (OSTI)

Combined forecasters have been in the vanguard of stochastic time series modeling. In this way it has been usual to suppose that each single model generates a residual or prediction error like a white noise. However, mostly because of disturbances not ... Keywords: Artificial neural networks hybrid systems, Linear combination of forecasts, Maximum likelihood estimation, Time series forecasters, Unbiased forecasters

Paulo Renato A. Firmino; Paulo S. G. De Mattos Neto; Tiago A. E. Ferreira

2014-02-01T23:59:59.000Z

463

Mathematical Structure of Discrete Space-time  

E-Print Network [OSTI]

In this letter we briefly investigate the mathematical structure of space-time in the framework of discretization. It is shown that the discreteness of space-time may result in a new mechanical system which differ from the usual quantum mechanics (QM).

An-Wei Zhang

2009-10-08T23:59:59.000Z

464

Nature of time and causality in Physics  

E-Print Network [OSTI]

The conceptual definition and understanding of the nature of time, both qualitatively and quantitatively is of the utmost difficulty and importance, and plays a fundamental role in physics. Physical systems seem to evolve in paths of increasing entropy and of complexity, and thus, the arrow of time shall be explored in the context of thermodynamic irreversibility and quantum physics. In Newtonian physics, time flows at a constant rate, the same for all observers; however, it necessarily flows at different rates for different observers in special and general relativity. Special relativity provides important quantitative elucidations of the fundamental processes related to time dilation effects, and general relativity provides a deep analysis to effects of time flow, such as in the presence of gravitational fields. Through the special theory of relativity, time became intimately related with space, giving rise to the notion of spacetime, in which both parameters cannot be considered as separate entities. As time is incorporated into the proper structure of the fabric of spacetime, it is interesting to note that general relativity is contaminated with non-trivial geometries that generate closed timelike curves, and thus apparently violates causality. The notion of causality is fundamental in the construction of physical theories; therefore time travel and its associated paradoxes have to be treated with great caution. These issues are briefly analyzed in this review paper.

Francisco S. N. Lobo

2008-02-14T23:59:59.000Z

465

System Identification: Time Varying and Nonlinear Methods  

E-Print Network [OSTI]

that the choice of the generalized time varying ARX model (GTV-ARX) can be set to realize a time varying dead beat observer. Methods to use the developed algorithm(s) in this research are then considered for application to the identification of system models...

Majji, Manoranjan

2010-07-14T23:59:59.000Z

466

Fractal analysis of time varying data  

DOE Patents [OSTI]

Characteristics of time varying data, such as an electrical signal, are analyzed by converting the data from a temporal domain into a spatial domain pattern. Fractal analysis is performed on the spatial domain pattern, thereby producing a fractal dimension D.sub.F. The fractal dimension indicates the regularity of the time varying data.

Vo-Dinh, Tuan (Knoxville, TN); Sadana, Ajit (Oxford, MS)

2002-01-01T23:59:59.000Z

467

Contractions of planar graphs in polynomial time?  

E-Print Network [OSTI]

Contractions of planar graphs in polynomial time? Marcin Kami´nski??1 , Dani¨el Paulusma2 that for every graph H, there exists a polyno- mial-time algorithm deciding if a planar graph can be contracted to H. We introduce contractions and topological minors of embedded (plane) graphs and show that a plane

Dimitrios, Thilikos

468

Designing Distributed, Real-Time Systems  

E-Print Network [OSTI]

- - Designing Distributed, Real-Time Systems Kevin L. Mills INFT 796 SUMMER 1993 DIRECTED READINGS IN SOFTWARE ENGINEERING WITH DR. H. GOMAA GEORGE MASON UNIVERSITY #12;Designing Distributed, Real-Time Systems problem faced by designers of software systems, and particularly by designers of distributed, real

Mills, Kevin

469

Time Series Analysis James D. Hamilton  

E-Print Network [OSTI]

Time Series Analysis James D. Hamilton Since its publication just over ten years ago, James Hamilton's Time Series Analysis has taken its place in the canon of modern technical eco- nomic literature study, Hamilton's book en- joyed popularity among econometricians in seminars in Europe and North

Landweber, Laura

470

A REAL-TIME AUTONOMOUS NAVIGATION ARCHITECTURE  

E-Print Network [OSTI]

A REAL-TIME AUTONOMOUS NAVIGATION ARCHITECTURE Gang Chen, Thierry Fraichard and Luis Martinez for autonomous navigation: perception, localisation, mapping, real-time motion planning and motion tracking. INTRODUCTION Autonomous navigation requires to solve a num- ber of challenging problems in domains as dif

Paris-Sud XI, Université de

471

Absolute Time Radiometric Dating: the source  

E-Print Network [OSTI]

Absolute Time Radiometric Dating: the source of the dates on the Geologic Time Scale #12 as an element changes to another element, e.g. uranium to lead. · The parent element is radioactive · Carbon-14, C14 Nitrogen-14, N14 · Uranium-235, U235 Lead-207, Pb207 · Potassium-40, K40 Argon-40, Ar40

Kammer, Thomas

472

First Passage Time for Stochastic Dynamic System  

E-Print Network [OSTI]

First Passage Time for Stochastic Dynamic System and Climate Modeling Peter C Chu Naval Ocean, P.C., 2007: First passage time analysis on climate indices. Journal of Atmospheric and Oceanic. Poberezhny, 2002: Power law decay in model predictability skill. Geophysical Research Letters, 29 (15), 10

Chu, Peter C.

473

It's Time to ACT | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

It's Time to ACT It's Time to ACT It's Time to ACT May 25, 2011 - 10:32am Addthis John Lippert In my November 29, 2010 and my February 15, 2011 blog postings, I described some tools and strategies based on behavioral psychology that some companies and organizations are using to encourage people to use less energy and purchase clean energy. Here's another one. I was reading an article the other day in which University of Nevada, Reno, psychologist Steven Hayes gave his explanation of why we Americans are so reluctant to adjust our thermostats. He believes our culture has conditioned us to avoid all discomfort. In other words, we believe that we should feel good all the time. The funny thing is that I heard multiple times essentially the same message at religious services I attended. The common thread in these messages and

474

Fermilab | Fermilab Time and Labor | Launch  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Go to FTL timecard Click here to create and submit your timecard on the Fermilab Time and Labor system. Alternate System Login This link uses html only and may work on your mobile device. It is provided for ease of use only. If it doesn't work for you, please use the other link. Fermilab Time and Labor All employees use a single, standard system to report their time and effort electronically. Log in to the system here. This has modernized our time and labor reporting system and helps Fermilab comply with DOE requirements. Use this page to access tools that will help you use the Fermilab Time & Labor electronic timecard. You can login to your timecard, access training materials and documentation and ensure that your browser has the settings and software it needs to access the system.

475

It's Time to ACT | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

It's Time to ACT It's Time to ACT It's Time to ACT May 25, 2011 - 10:32am Addthis John Lippert In my November 29, 2010 and my February 15, 2011 blog postings, I described some tools and strategies based on behavioral psychology that some companies and organizations are using to encourage people to use less energy and purchase clean energy. Here's another one. I was reading an article the other day in which University of Nevada, Reno, psychologist Steven Hayes gave his explanation of why we Americans are so reluctant to adjust our thermostats. He believes our culture has conditioned us to avoid all discomfort. In other words, we believe that we should feel good all the time. The funny thing is that I heard multiple times essentially the same message at religious services I attended. The common thread in these messages and

476

Space-time defects and teleparallelism  

E-Print Network [OSTI]

We consider the class of space-time defects investigated by Puntigam and Soleng. These defects describe space-time dislocations and disclinations (cosmic strings), and are in close correspondence to the actual defects that arise in crystals and metals. It is known that in such materials dislocations and disclinations require a small and large amount of energy, respectively, to be created. The present analysis is carried out in the context of the teleparallel equivalent of general relativity (TEGR). We evaluate the gravitational energy of these space-time defects in the framework of the TEGR and find that there is an analogy between defects in space-time and in continuum material systems: the total gravitational energy of space-time dislocations and disclinations (considered as idealized defects) is zero and infinit, respectively.

J. W. Maluf; A. Goya

2001-10-24T23:59:59.000Z

477

Stat 39000/FinMath 34500 Lecture 8 STOCHASTIC INTEGRALS  

E-Print Network [OSTI]

INTEGRAND IF t IS NONRANDOM: t 0 sdWs = limit of ti+1t ti Wti ti+1t ti Wti : · LINEAR COMBINATION OF NORMAL RANDOM VARIABLES IS A NORMAL RANDOM VARIABLE · MEAN: E ti+1t ti Wti = 0 · VARIANCE: Var ( ti+1t ti Wti ) = ti+1t 2 ti Var (Wti ) = ti+1t 2 ti ti IN THE LIMIT: t 0 sdWs: · NORMAL RANDOM VARIABLE · MEAN IS ZERO

Mykland, Per A.

478

Posterior vs. Parameter Sparsity in Latent Variable Supplementary Material  

E-Print Network [OSTI]

(1) The Lagrangian becomes: L(q, c, , ) = KL(q||p) + wt cwt + wti wti(Eq[fwti] - cwt) - · c (2, , ) cwt = - i wti - wt (5) setting this to zero gives us wt = - i wti. Knowing that wt 0 we will have to introduce the constraint i wti. Substituting into the KL term we have: yields: KL(q||p) = z p(z) exp

Plotkin, Joshua B.

479

Stat 39100/FinMath 34600 Lecture 8 STOCHASTIC INTEGRALS  

E-Print Network [OSTI]

INTEGRAND IF t IS NONRANDOM: t 0 sdWs = limit of ti+1t ti Wti ti+1t ti Wti : · LINEAR COMBINATION OF NORMAL RANDOM VARIABLES IS A NORMAL RANDOM VARIABLE · MEAN: E ti+1t ti Wti = 0 · VARIANCE: Var ( ti+1t ti Wti ) = ti+1t 2 ti Var (Wti ) = ti+1t 2 ti ti IN THE LIMIT: t 0 sdWs: · NORMAL RANDOM VARIABLE · MEAN IS ZERO

Mykland, Per A.

480

MATH 56A SPRING 2008 STOCHASTIC PROCESSES 191 9.2. Integration wrt Brownian motion. We want to define the sto-  

E-Print Network [OSTI]

is given by t 0 Ys dWs := k i=1 Yi-1(Wti - Wti-1 ) + Yk(Wt - Wtk ) = Y W if t (tk, tk+1]. The first thing and notice that the future stuff has expectation zero by Lemma A. If s > t then Zs = m i=1 Yi-1 Wti - Wti-1 )E(W2 ) #12;194 STOCHASTIC INTEGRATION since Y, W are independent. In fact, we know that W = Wti

Igusa, Kiyoshi

Note: This page contains sample records for the topic "time spread wti" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

Time-Domain Electromagnetics | Open Energy Information  

Open Energy Info (EERE)

Time-Domain Electromagnetics Time-Domain Electromagnetics Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Technique: Time-Domain Electromagnetics Details Activities (10) Areas (10) Regions (0) NEPA(0) Exploration Technique Information Exploration Group: Geophysical Techniques Exploration Sub Group: Electrical Techniques Parent Exploration Technique: Electromagnetic Sounding Techniques Information Provided by Technique Lithology: Detection of rock units or geological features with contrasting apparent resistivity. Stratigraphic/Structural: Structural information may be inferred from TDEM data. Hydrological: Hydrological information such as depth to groundwater table may be determined. Thermal: Extent of hydrothermal alteration mineralogy may be inferred. Cost Information

482

Undergraduate Program Time Limits and Work Schedules  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Time Limits and Work Schedules Time Limits and Work Schedules Undergraduate Program Time Limits and Work Schedules Point your career towards LANL: work with the best minds on the planet in an inclusive environment that is rich in intellectual vitality and opportunities for growth. Contact Student Programs (505) 665-8899 Email Time limits The length of participation in the undergraduate program is limited to a maximum of six years for students pursuing a bachelor's degree and three years for students pursuing an associate's degree. Work schedules Year-round students Students participating in some special undergraduate programs, post-baccalaureate appointments, post-master's appointments, and GRA students working on a thesis or dissertation are excluded from the 30-hour per week work restriction.

483

NSLS User Access | Requesting Beam Time  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Requesting Beam Time Requesting Beam Time Use one of the following options depending on your research: General User Proposal General User proposals are peer reviewed for scientific merit by a Proposal Review Panel (PRP). General User proposals compete for beamtime with other General User Proposals based on scientific merit. Once the original proposal and beam time request is reviewed and rated in the PASS System, additional beam time requests can be submitted against the original proposal for its lifetime, a period of up to six cycles (two years). Data taken during experiments associated with a General User proposal is considered to be in the public domain. There is no charge for General User beamtime. Rapid Access Rapid Access proposals are a subset of General User proposals available for

484

Graduate Program Time Limits and Work Schedules  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Time Limits and Work Schedules Time Limits and Work Schedules Graduate Program Time Limits and Work Schedules Point your career towards LANL: work with the best minds on the planet in an inclusive environment that is rich in intellectual vitality and opportunities for growth. Contact Student Programs (505) 665-8899 Email Time Limits The length of participation in the graduate program is limited as follows: With a bachelor's pursuing a master's degree: 4 years With a bachelor's pursuing a PhD: 7 years With a master's pursuing a second master's degree: 2 years With a master's pursuing a PhD: 4 years With a master's pursuing a master's and PhD in a new field: 6 years Students may remain in the GRA program for up to three months after receiving their PhD. Work schedules Year-round students Students participating in the MBA program, post-baccalaureate appointments,

485

Space-Time Insight | Open Energy Information  

Open Energy Info (EERE)

Space-Time Insight Space-Time Insight Jump to: navigation, search Name Space-Time Insight Address 45680 Northport Loop East Place Fremont, California Zip 94538 Sector Efficiency Product SpaceTime Awareness Server Year founded 2008 Number of employees 11-50 Website http://www.spacetimeinsight.co Coordinates 37.4923832°, -121.9532879° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":37.4923832,"lon":-121.9532879,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

486

Property:Real-Time | Open Energy Information  

Open Energy Info (EERE)

Real-Time Real-Time Jump to: navigation, search Property Name Real-Time Property Type String Pages using the property "Real-Time" Showing 25 pages using this property. (previous 25) (next 25) 1 1.5-ft Wave Flume Facility + No + 10-ft Wave Flume Facility + No + 11-ft Wave Flume Facility + No + 2 2-ft Flume Facility + No + 3 3-ft Wave Flume Facility + No + 5 5-ft Wave Flume Facility + No + 6 6-ft Wave Flume Facility + No + A Alden Large Flume + Yes + Alden Small Flume + Yes + Alden Tow Tank + Yes + Alden Wave Basin + Yes + B Breakwater Research Facility + No + Bucknell Hydraulic Flume + No + C Carderock 2-ft Variable Pressure Cavitation Water Tunnel + No + Carderock 3-ft Variable Pressure Cavitation Water Tunnel + No + Carderock Circulating Water Channel + No +

487

Unraveling life four letters at a time  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Unraveling life four letters at a time Unraveling life four letters at a time 1663 Los Alamos science and technology magazine Latest Issue:November 2013 All Issues » submit Unraveling life four letters at a time Major advances in sequencing since the official end of the Human Genome Project are fueling a revolution in genomics research. November 25, 2013 Unraveling life four letters at a time Reading the genetic code of life keeps getting faster and cheaper, bringing more and more new discoveries within reach. The genomics revolution that came after the Human Genome Project The Human Genome Project officially ended in 2003, but the 10 years since have seen dramatic improvements in genomics technology and discovery. New, rapid sequencing machines provide high throughput conversion of genetic material (DNA or RNA) into data to be arranged into its proper order by a

488

Valuation Made Simple: No Uncertainties, Just Time  

Science Journals Connector (OSTI)

Finance deals with time and uncertainty. This chapter introduces the very basics of financial economics in a deterministic setting. Leaving aside any consideration of risk is obviously restrictive, yet importa...

L. M. Abadie; J. M. Chamorro

2013-01-01T23:59:59.000Z

489

Virtual stationary timed automata for mobile networks  

E-Print Network [OSTI]

In this thesis, we formally define a programming abstraction for mobile networks called the Virtual Stationary Automata programming layer, consisting of real mobile clients, virtual timed I/O automata called virtual ...

Nolte, Tina Ann, 1979-

2009-01-01T23:59:59.000Z

490

Development Cycle Time Simulation For Civil Aircraft  

Science Journals Connector (OSTI)

Cycle Time Reduction (CTR) will be one of the major factors affecting the future of the civil aerospace industry. This focus is the end reflection of the level of competition in the commercial large carrier aircraft industry. Aircraft manufacturer must ...

Spitz William; Golaszewski Richard; Berardino Frank; Johnson Jesse

2001-01-01T23:59:59.000Z

491

Time dependences of atmospheric Carbon dioxide fluxes  

E-Print Network [OSTI]

Understanding the lifetime of CO2 in the atmosphere is critical for predictions regarding future climate changes. A simple mass conservation analysis presented here generates tight estimations for the atmosphere's retention time constant. The analysis uses a leaky integrator model that combines the observed deficit (only less than 40% of CO2 produced from combustion of fossil fuels is actually retained in the atmosphere, while more than 60% is continuously shed) with the exponential growth of fossil fuel burning. It reveals a maximum characteristic time of less than 23 year for the transfer of atmospheric CO2 to a segregation sink. This time constant is further constrained by the rapid disappearance of 14C after the ban of atmospheric atomic bomb tests, which provides a lower limit of 18 years for this transfer. The study also generates evaluations of other CO2 fluxes, exchange time constants and volumes exchanged. Analysis of large harmonic oscillations of atmospheric CO2 concentration, often neglected in th...

DeSalvo, Riccardo

2014-01-01T23:59:59.000Z

492

Extensions To Standard Hold Time Calculations  

Science Journals Connector (OSTI)

The paper extends existing methods of calculating the hold time for a fire extinguishing gas in an enclosure to cover mechanical HVAC systems and wide descending interfaces, and compares ... the sharp descending ...

J. Dewsbury; R. A. Whiteley

2000-11-01T23:59:59.000Z

493

It's About Time: Investing in Transportation to  

E-Print Network [OSTI]

MARCH 2011 It's About Time: Investing in Transportation to Keep Texas Economically Competitive #12 of Contents Preface 1 The Challenge Facing Texans 3 Texas Transportation Action Principles 6 Texas' Deteriorating Transportation System: Background and Measurement 8 Baseline Scenario: Unacceptable Conditions

494

Automatic tuning of continuous-time filters  

E-Print Network [OSTI]

Integrated high-Q continuous-time filters require adaptive tuning circuits that will correct the filter parameters such as center frequency and quality factor (Q). Three different automatic tuning techniques are introduced. In all of the proposed...

Sumesaglam, Taner

2004-11-15T23:59:59.000Z

495

Wind and time in Homeric epic  

E-Print Network [OSTI]

73–83. Scott, W. C. 1966. “Wind Imagery in the Oresteia. ”30–35; West 1961: 133–36. Wind and Time in Homeric Epic ———56. Stern, L. 2004. “‘Paths That Wind through the Thicket of

Purves, AC

2010-01-01T23:59:59.000Z

496

A discussion about God and time  

E-Print Network [OSTI]

that depend on STR (either forthrightly or heuristically) fail. Instead, I propose that God is in immeasurable ontological time both prior to creation and after creation. In this way He can be really related to His creation....

Miles, Craig Lambert

2012-06-07T23:59:59.000Z

497

Automatic program timing profiles with FTN4  

SciTech Connect (OSTI)

Design of a scheme for producing execution timing profiles of FORTRAN programs automatically is proposed with a recommendation to implement it as an option to the compiler. An experimental implementation on the LBL 7600 is also described. 1 figure.

Friedman, R.

1980-09-01T23:59:59.000Z

498

Time-Resolved Photoluminescence and Photovoltaics  

SciTech Connect (OSTI)

The time-resolved photoluminescence (TRPL) technique and its ability to characterize recombination in bulk photovoltaic semiconductor materials are reviewed. Results from a variety of materials and a few recent studies are summarized and compared.

Metzger, W. K.; Ahrenkiel, R. K.; Dippo, P.; Geisz, J.; Wanlass, M. W.; Kurtz, S.

2005-01-01T23:59:59.000Z

499

Real time vibraphone pitch and timbre classification :  

E-Print Network [OSTI]

A Pitch Tracking . . . . . . B Percussion Classi?cation CDIEGO Real Time Vibraphone Pitch and Timbre Classi?cation ABrown, G. J. , 2003: A multi-pitch tracking algorithm for

Larke, Kevin

2008-01-01T23:59:59.000Z

500

Picosecond laser timing by rf phase shifting  

E-Print Network [OSTI]

lasers pumped by synchronized mode?locked, Q?switched, cw Nd:YAG lasers. The phase shifter operates with better than 10?ps precision and generates time delays from 0 to 26 ns....

Johnson, Carey K.; Qian, Jun

1990-01-01T23:59:59.000Z