National Library of Energy BETA

Sample records for time m-f mail

  1. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  2. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Subscription Jefferson Lab Home Search Contact JLab Descriptions A - C autocad: No description available briefs: On-Target Briefs cctest-alert: No description available clas_drift_chambers: Hall B Drift Chambers Group clas_offline: Discussion group for CLAS RECSIS group clas_slow_control: CLAS slow control working group clas_strangep: Hall B Strange Particles using CLAS discussion group clas_tof: CLAS Time of Flight Collaboration credit-card: List of JLab Credit Card buyers csc_all:

  3. Electronic Mail Analysis Capability

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    Establishes the pilot program to test the Department of Energy (DOE) Electronic Mail Analysis Capability (EMAC), which will be used to monitor and analyze outgoing and incoming electronic mail (e-mail) from the National Nuclear Security Administration (NNSA) and DOE laboratories that are engaged in nuclear weapons design or work involving special nuclear material. No cancellation.

  4. Mail Services User's Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    This Manual provides detailed information on using the Department of Energy (DOE) mail services. Canceled by DOE G 573.1-1.

  5. mail_paycheck_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)


  6. Request Repository Mailing List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support 1-800-66-NERSC, option 2 or 510-486-8612 Consulting 1-800-66-NERSC, option 3 or 510-486-8611 Home » For Users » Request Repository Mailing List Request Repository Mailing List Use this form to request a

  7. Mail and Distribution | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  8. By Certified Mail May

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By Certified Mail May 4,2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestLand Transfer Dear Ms. Riehle: Pursuant to the...

  9. By E-Mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By E-Mail May 29, 2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestTank Inventories Dear Ms. Riehle: Pursuant to the...

  10. Mail Services | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  11. PDSF Mailing Lists

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Lists PDSF Mailing Lists This is voluntary. You have to subscribe to it. This list can be chatty, since major and minor problems are sent to this list. Also multiple status updates will be sent for extended outages. Subscribe: Send email to with subscribe in the subject of the message. Unsubscribe: Send email to with unsubscribe in the subject of the message. Users are subscribed to

  12. Mail Services User's Guide

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    This Guide provides information on using Department of Energy (DOE) mail services in accordance with U.S. Postal Service, General Services Administration (GSA), and DOE regulations. Cancels DOE M 573.1-1. Canceled by DOE N 251.89.

  13. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May 16, 2013 Mail discussion Joe Whitford opened the meeting by introducing Al Majors to talk about mail related items. 1) Update on the USPS mail name changes. If approved by the Postal Regulatory Commission the following name changes will go into effective July 28, 2013: a. Express Mail will be called Priority Mail Express b. Express Mail International will be Priority Mail International c. Express Mail Corporate Account will become USPS Express Corporate Account Only the names of these

  14. M F

    Gasoline and Diesel Fuel Update (EIA)

    Energy Technology Laboratory Driving Innovation ♦ Delivering Results Timothy J. Skone, PE 2015 EIA Energy Conference, Washington, D.C. June 15, 2015 Life Cycle Greenhouse Gas Emissions: Natural Gas and Power Production 2 National Energy Technology Laboratory Agenda * Importance of Understanding GHG Emissions from the Power and Natural Gas Sectors * Understanding the Life Cycle GHG Emissions of Natural Gas * Understanding the Life Cycle GHG Emissions of Power Production 3 National Energy

  15. LLNL E-Mail Utilities

    Energy Science and Technology Software Center (OSTI)


    The LLNL E-mail Utilities software library is a Java API that simplifies the creation and delivery of email in Java business applications. It consists of a database-driven template engine, various strategies for composing, queuing, dispatching email and a Java Swing GUI for creating and editing email templates.

  16. Mail Management Memorandum, July 2, 2010 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and ...

  17. Minutes from the Print and Mail Managers Exchange Forum Teleconference...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail...

  18. Field Facilities Contacts for Printing and Mail

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Print and Mail Contacts Site Printing Contact Mail Contact NNSA, Albuquerque Deborah Miller (505) 845-6049 Thomas H. Clinkenbeard NNSA Service Center PO Box 5400 Albuquerque, NM 87185-5400 (505) 845-4602 ( Argonne National Laboratory Doreen Schoening Argonne National Laboratory U.S. Department of Energy 9700 South Cass Avenue Blvd 340 Lemonmt, IL 60439 (630) 840-6399

  19. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 21, 2013 Mail Managers discussion Joe Whitford opened the meeting by introducing Tony Nellums to talk about mail related items. 1) Mr. Nellums introduced Derek Milner, Policy Advisor from the GSA Office of Government-wide policy. a. Mr. Milner stated that he is being replaced as primary policy contact by Linda Willoughby ( or (202) 219-1083. b. Initiatives discussed by Mr. Milner included: Upcoming mail reports. The SMART system is online and available now.

  20. Minutes from the January 10, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 10, 2013 Mail discussion Al Majors opened the meeting by discussing the Mail Management Report and latest update on status. One final report is yet to be submitted, after which close out will be accomplished. Copies will be provided to the Mail Managers once completed. Al introduced Derrick Miliner, Program Manager from the General Services Administration, Office of Government-wide Policy, and acknowledged Mr. Miliner's role in completing the Mail Management Report. Mail Security Plans A

  1. Field Facilities Contacts for Printing and Mail | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

  2. Read Your E-mail | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read Your E-mail All Argonne employees can read their e-mail through the web. Argonne E-Mail service is a robust, reliable electronic communication solution for supporting day-to-day business activities. Features include e-mail, calendar, task lists, and contact lists. While it is designed to work Microsoft Outlook, it also works with other POP- and IMAP-based clients. All employees can read their e-mail through the web. Use the login link at right to get started. Login to E-mail

  3. T-618: Debian update for exim4: Mail Transport Agent

    Broader source: [DOE]

    It was discovered that Exim, the default mail transport agent in Debian, uses DKIM data obtain from DNS directly in a format string, potentially allowing malicious mail senders to execute arbitrary code.

  4. Minutes from the January 19, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide FY-2010 Three-Year Plan Dallas Woodruff, Headquarters in formed the group that the Department-wide Printing and Publishing Activities is currently in the concurrence

  5. Minutes from the January 20, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    , 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Department-wide Printing and Publishing Activities Report Three-Year Plan. Dallas Woodruff,

  6. Minutes from the July 21, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    July 21, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Government Printing Office revisions to the Standard Form one (SF!), Twenty-five

  7. Minutes from the June 28, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    June 28, 2012 Mail discussion Al Majors opened the meeting by introducing United Parcel Service (UPS) Representative Shelly Scott. Ms. Scott's contact information is: Shelly Scott 404 402-9827 (cell) Ms. Scott discussed issues relating to various UPS services available to the department. Next Al introduced Michael R. Sanders, President and Chief Executive Officer of Intra-Mail Network, an innovative, information Technology Company that improves the delivery of mail or email

  8. Minutes from the May 26, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    26, 2010 Printing and Mail Managers Exchange Forum Teleconference Seventeen individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the FY 2010, Congressional Joint Committee on Printing Commercial Printing Report "JCP

  9. Minutes from the November 01, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 1, 2012 Mail discussion Al Majors opened the meeting by introducing Derrick Milner, Program Manager from the General Services Administration, Office of Government-wide Policy. Mr. Majors and Mr. Miliner discussed the pending Official Mail Management Report for the FY-2012. The question on where to put data relating to certified and registered mail was addressed. It should be placed under the others section or under first class, standard delivery. Mr. Majors also discussed the pending

  10. Minutes from the November 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 17, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty seven individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide "Three-Year Plan" Dallas Woodruff, Headquarters opened the meeting by thanking everyone for providing their sites Three-Year Plan data to Headquarters in

  11. Minutes from the September 15, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    September 15, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-four individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Upcoming FY 2010 Department-wide Three-Year Plan Dallas Woodruff, Headquarters informed the

  12. Headquarters Program & Staff Office Mailing Addresses | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000

  13. Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular MOF-5 Analogues Comprising Commercially Available Organic Molecules Previous Next List R. L. Martin, L.-C. Lin,...

  14. Minutes from the Print and Mail Managers Exchange Forum Teleconferences

    Broader source: [DOE]

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences.  Contact the Office of Administrative Management and Support at (202) 586-4318 with any questions.

  15. Minutes from the May 3, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    http:www.gsa.govmailpolicy (for training options) ... discussion Brainstorming discussion on methodsapproaches to reduce printing expenses: ...

  16. Effect of sulfur isotopic composition of zinc and lead sulfides on the E. M. F. of electrochemical cells

    SciTech Connect (OSTI)

    Lusk, J.; Krouse, H.R.; Batts, B.D.


    A new effect is reported in which unexpectedly large voltages are produced by electrochemical cells containing sulfides at natural isotopic abundance levels. Room temperature experiments were undertaken to determine whether electrochemical cells employing silver bromide and silver beta alumina as solid electrolytes would be sufficiently sensitive to detect small variations in sulfur isotopic composition for zinc and lead sulfides. Voltages obtained for silver bromide cells tended to increase progressively over at least 20 days, and increased in a regular fashion with increasing differences in isotopic composition between charges. Voltages exceeding 150 mV were obtained for /sup delta/S/sup 3,4/ differences up to 85 per mil for zinc sulfide, but reached only about 20 mV for lead sulfide. Silver beta alumina cells with opposing zinc and lead sulfide charges yielded larger voltages and E.M.F. minimum corresponding to a +8(/plus minus/2) per mil difference. This value shows reasonable agreement with interpolated 20/degrees/C equilibrium values of between +7.5 to +9.8 obtained from the literature. Matured silver bromide cells with opposed zinc and lead sulfide charges behaved similarly but yielded lower voltages. Silver concentration cells of the opposed type are thus able to detect isotopic equilibrium and this will permit calibration of sulfur isotope thermometers down to unexpectedly low temperatures.

  17. Minutes from the October 26, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Woodruff also said the files are due back to Headquarters no later November 11, 2011, and the report is due to congress by February 10, 2012. Mail Agenda Items...... Fiscal ...

  18. The Future of Electric Vehicles and Arizona State University's MAIL

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  19. Minutes from the March 14, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 14, 2013 Mail discussion Al Majors is on leave today. Ellsworth Howell Jr. and Tony Nellums are sitting for Al. There are no agenda items for the Mail portion. A discussion period for questions, comments, or suggestions was opened without response Printing discussion Discussed suggestions for reducing printing expenses Presidential Executive Order 13589 and reducing hard copy printing in favor of electronic publishing Sec. 5. Printing. Agencies are encouraged to limit the publication and

  20. Mailing Addresses and Information Numbers for Operations, Field, and Site

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Offices | Department of Energy About » Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Name Telephone Number U.S. Department of Energy Ames Site Office 111 TASF, Iowa State University Ames, Iowa 50011 515-294-9557 U.S. Department of Energy Argonne Site Office 9800 S. Cass Avenue Argonne, IL 60439 630-252-2000 U.S. Department of Energy Berkeley Site Office Berkeley

  1. E-mail et Web : pour une navigation sans risque

    ScienceCinema (OSTI)



    Présentation orale en français, support visuel en anglais. À travers des exemples concrets, vous consoliderez vos connaissances et pourrez ainsi réajuster vos habitudes concernant l?utilisation sécurisée de votre boîte e-mail et de votre navigateur Web.

  2. V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets May 2, 2013 - 6:00am Addthis...

  3. Mail-Order Metal-Organic Frameworks (MOFs) | Center for Gas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SeparationsRelevant to Clean Energy Technologies | Blandine Jerome Mail-Order Metal-Organic Frameworks (MOFs)

  4. Minutes from the February 23, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes Printing and Mail Managers Exchange Forum Teleconference February 23, 2012 Participants: Headquarters (5) National Energy Technology Laboratory, PA National Security Complex Y-12 (2) Oak Ridge National Laboratory Y-12 Site Office (2) Hanford Site Office Oak Ridge Association University Oak Ridge Operations Office BWXT Pantex Site Office JanTec Corporation, Richland, Washington Los Alamos National Laboratory Chicago Office Bettis Atomic Power Laboratory National Security Technology C1,


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HQ F 1410.2 (06-93) U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE (Receipt No.) MAIL STATION: DATE: TO: NAME: ROUTING SYMBOL: FROM: DOE Mail Facility, Office of Administration Services 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. ITEM NO. ITEM NO. ITEM NO. SIGN AND RETURN WITHIN 24 HOURS TO AVOID TRACER ACTION TO DOE MAIL FACILITY (Stamp Location) RECEIVED BY: DATE: Printed with soy ink on recycled paper

  6. U-157: Ruby Mail Gem Directory Traversal and Shell Command Injection Vulnerabilities

    Broader source: [DOE]

    Some vulnerabilities have been reported in the Mail gem for Ruby, which can be exploited by malicious people to manipulate certain data and compromise a vulnerable system.

  7. {open_quotes}Media-On-Demand{close_quotes} multimedia electronic mail: A tool for collaboration on the web

    SciTech Connect (OSTI)

    Tsoi, Kei Nam; Rahman, S.M.


    Undoubtedly, multimedia electronic mail has many advantages in exchanging information electronically in a collaborative work. The existing design of e-mail systems architecture is inefficient in exchanging multimedia message which has much larger volume, and requires more bandwidth and storage space than the text-only messages. This paper presents an innovative method for exchanging multimedia mail messages in a heterogeneous environment to support collaborative work over YAW on the Internet. We propose a {open_quotes}Parcel Collection{close_quotes} approach for exchanging multimedia electronic mail messages. This approach for exchanging multimedia electronic mail messages integrates the current WWW technologies with the existing electronic mail systems.

  8. Time

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 4 5 6 7 8 9 10 Time with respect to the BNB Trigger Time [µs] 0.9 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 Fractional Flash Count per 0.15 µs with respect to Cosmic Background Measured Cosmic Rate (Beam-Off) BNB Trigger Data (Beam-On) [4.51E18 POT]

  9. Time

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    10 15 20 Time with respect to the NuMI Trigger Time [µs] 0.9 1.0 1.1 1.2 1.3 1.4 1.5 Fractional Flash Count per 0.5 µs with respect to Cosmic Background Measured Cosmic Rate (Beam-Off) NuMI Trigger Data (Beam-On) [4.83E18 POT]

  10. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  11. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  12. Sign Up for E-mail Updates | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Sign Up for E-mail Updates Materials Sciences and Engineering (MSE) Division MSE Home About Staff What's New Research Areas Reports and Activities Science Highlights Principal Investigators' Meetings BES Home What's New Sign Up for E-mail Updates Print Text Size: A A A FeedbackShare Page The Division has a "Dear Colleague" email list, which is used to circulate general information such as funding opportunity announcements and administrative information such as position openings. To

  13. Legal and policy issues associated with monitoring employee E-mail

    SciTech Connect (OSTI)

    Segura, M.A.; Rither, A.C.


    This paper examines the legal issues involved with employer monitoring of employee e-mail. In addition to identifying pertinent legal issues, the paper provides guidelines that will help the Pacific Northwest National Laboratory (PNNL) establish a program for monitoring outgoing e-mail to insure compliance with company policies, particularly those regarding protection of trade secrets and proprietary information, and to comply with the Department of Energy`s (DOE) procedures for protecting Export Controlled Information (ECI). Electronic communication has allowed companies to enhance efficiency, responsiveness and effectiveness. E-mail allows employees to transmit all types of data to other individuals inside and outside of their companies. The ease with which information can be transmitted by e-mail has placed trade secrets, proprietary information, and other sensitive data at risk from inadvertent disclosure by employees. As employers attempt to protect their interests through measures such as monitoring e-mail, they may expose themselves to liability under federal and state laws for violating employee privacy. Business use of e-mail has proliferated so rapidly that the federal and state legal systems have not been able to adequately address the issues arising out of its use in the workplace.

  14. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    June 19, 2012 By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency U.S. Department of Energy Office of the General Counsel 1000 Independence Ave., SW Washington, D.C. 20585 Re: Regulatory Burden RFI Dear Mr. Cohen: The Association of Home Appliance Manufacturers (AHAM) respectfully submits the following comments to the Department of Energy (DOE) on its Regulatory Burden RFI, 77 Fed. Reg. 28518 (May 15, 2012). AHAM

  15. Extremely High-Frequency Holographic Radar Imaging of Personnel and Mail

    SciTech Connect (OSTI)

    McMakin, Douglas L.; Sheen, David M.; Griffin, Jeffrey W.; Lechelt, Wayne M.


    The awareness of terrorists covertly transporting chemical warfare (CW) and biological warfare (BW) agents into government, military, and civilian facilities to harm the occupants has increased dramatically since the attacks of 9/11. Government and civilian security personnel have a need for innovative surveillance technology that can rapidly detect these lethal agents, even when they are hidden away in sealed containers and concealed either under clothing or in hand-carried items such as mailed packages or handbags. Sensor technology that detects BW and CW agents in mail or sealed containers carried under the clothing are under development. One promising sensor technology presently under development to defeat these threats is active millimeter-wave holographic radar imaging, which can readily image concealed items behind paper, cardboard, and clothing. Feasibility imaging studies at frequencies greater than 40 GHz have been conducted to determine whether simulated biological or chemical agents concealed in mail packages or under clothing could be detected using this extremely high-frequency imaging technique. The results of this imaging study will be presented in this paper.

  16. Time-Off Awards Scale | Department of Energy

    Energy Savers [EERE]

    Time-Off Awards Scale Time-Off Awards Scale This chart is the departmental recommended time-off award scale and should be used unless another time-off award scale has been adopted by the servicing human resources office. PDF icon Time-Off Awards Scale Responsible Contacts Lorrenda Buckner HUMAN RESOURCES SPECIALIST (PERFORMANCE MANAGEMENT) E-mail Phone 202-586-8451 More Documents & Publications Supervisory - Non-Supervisory Employee Performance Management and

  17. Site Office Contracting Officer E-mail address Ames Site Office Jackie York

    National Nuclear Security Administration (NNSA)

    Site Office Contracting Officer E-mail address Ames Site Office Jackie York Argonne Site Office Jacquelyn York Brookhaven Site Office Evelyn Landini Jennifer Hartmann Idaho Site Office Paul Allen Kansas City Site Office Ralph Tennant Lawrence Livermore Site Office Homer Williamson Los Alamos Site Office Barbara Romero Robert M. Poole

  18. Microsoft Word - WD Proposed Plan D5 R8 MASTER 10-29-14 _final with reply mail_ rev 1

    Energy Savers [EERE]

    WD-PLN-0034, Rev. 8 1 DOE/PPPO/03-0312&D5 Aerial photo of the Portsmouth Gaseous Diffusion Plant showing the three large process buildings (center of photo) and other support facilities, facing southwest PUBLIC COMMENT PERIOD NOVEMBER 12, 2014 TO JANUARY 10, 2015 HOW YOU CAN PARTICIPATE Read this Proposed Plan and review related documents in the Administrative Record. Comment on this Proposed Plan by mail, email, or fax to: Ms. Kristi Wiehle Department of Energy P.O. Box 370 Piketon, Ohio


    U.S. Energy Information Administration (EIA) Indexed Site

    Government Printing Office Main Order Desk (202) 512-1800 FAX: (202) 512-2250 8 a.m. to 4:30 p.m., eastern time, M-F All mail orders should be directed to: U.S. Government Printing...

  20. MailedForm.pptx

    National Nuclear Security Administration (NNSA)

    Businesses using high-activity radioactive sources (Cesium-137, Cobalt-60, Americium-241, ... to: Kristina Hatcher, U.S. Department of Energy, 1000 Independence Ave., S.W., ...

  1. Date centerdTimes New Roman

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... by meeting with andor sending electronic mail messages to five prospective ... of all activity and associated fees and books for all attendees, was almost one-third ...


    DOE Patents [OSTI]

    Bennett, A.E.; Geisow, J.C.H.


    The timing device comprises an escapement wheel and pallet, a spring drive to rotate the escapement wheel to a zero position, means to wind the pretensioned spring proportional to the desired signal time, and a cam mechanism to control an electrical signal switch by energizing the switch when the spring has been wound to the desired position, and deenergizing it when it reaches the zero position. This device produces an accurately timed signal variably witain the control of the operator.

  3. Time Off

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Time Off Time Off A comprehensive benefits package with plan options for health care and retirement to take care of our employees today and tomorrow. Contact Benefits Office (505) 667-1806 Email Time Off Work schedules A variety of work schedules are available that allow flexibility for workers and Laboratory programs. The most popular work schedule is the 9/80-employees work 80 hours over a 9 workday (two week) period, with a Friday off every other week. Holidays The Lab recognizes these 12


    SciTech Connect (OSTI)

    Abramczyk, G; Paul Blanton, P; Kurt Eberl, K


    This Safety Analysis Report for Packaging (SARP) documents the analysis and testing performed on and for the 9977 Shipping Package, referred to as the General Purpose Fissile Package (GPFP). The performance evaluation presented in this SARP documents the compliance of the 9977 package with the regulatory safety requirements for Type B packages. Per 10 CFR 71.59, for the 9977 packages evaluated in this SARP, the value of ''N'' is 50, and the Transport Index based on nuclear criticality control is 1.0. The 9977 package is designed with a high degree of single containment. The 9977 complies with 10 CFR 71 (2002), Department of Energy (DOE) Order 460.1B, DOE Order 460.2, and 10 CFR 20 (2003) for As Low As Reasonably Achievable (ALARA) principles. The 9977 also satisfies the requirements of the Regulations for the Safe Transport of Radioactive Material--1996 Edition (Revised)--Requirements. IAEA Safety Standards, Safety Series No. TS-R-1 (ST-1, Rev.), International Atomic Energy Agency, Vienna, Austria (2000). The 9977 package is designed, analyzed and fabricated in accordance with Section III of the American Society of Mechanical Engineers (ASME) Boiler and Pressure Vessel (B&PV) Code, 1992 edition.

  5. UGE Scheduler Cycle Time

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    UGE Scheduler Cycle Time UGE Scheduler Cycle Time Genepool Cycle Time Genepool Daily Genepool Weekly Phoebe Cycle Time Phoebe Daily Phoebe Weekly What is the Scheduler Cycle? The...

  6. Metal-Air Electric Vehicle Battery: Sustainable, High-Energy Density, Low-Cost Electrochemical Energy Storage Metal-Air Ionic Liquid (MAIL) Batteries

    SciTech Connect (OSTI)


    Broad Funding Opportunity Announcement Project: ASU is developing a new class of metal-air batteries. Metal-air batteries are promising for future generations of EVs because they use oxygen from the air as one of the batterys main reactants, reducing the weight of the battery and freeing up more space to devote to energy storage than Li-Ion batteries. ASU technology uses Zinc as the active metal in the battery because it is more abundant and affordable than imported lithium. Metal-air batteries have long been considered impractical for EV applications because the water-based electrolytes inside would decompose the battery interior after just a few uses. Overcoming this traditional limitation, ASUs new battery system could be both cheaper and safer than todays Li-Ion batteries, store from 4-5 times more energy, and be recharged over 2,500 times.


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    DOSIMETER ASSIGNMENT CHECK SHEET (Please type or print clearly) 1. Last Name: 2. First Name: 3. M.I.: 4. DOB (mmddyy): 5. SSN * : 6. Bengal ID: 7. Sex: M F 8. E-mail: 9. Home...

  8. PACE: Pattern Accurate Computationally Efficient Bootstrapping for Timely Discovery of Cyber-Security Concepts

    SciTech Connect (OSTI)

    McNeil, Nikki C; Bridges, Robert A; Iannacone, Michael D; Czejdo, Bogdan; Perez, Nicolas E; Goodall, John R


    Public disclosure of important security information, such as knowledge of vulnerabilities or exploits, often occurs in blogs, tweets, mailing lists, and other online sources significantly before proper classification into structured databases. In order to facilitate timely discovery of such knowledge, we propose a novel semi-supervised learning algorithm, PACE, for identifying and classifying relevant entities in text sources. The main contribution of this paper is an enhancement of the traditional bootstrapping method for entity extraction by employing a time-memory trade-off that simultaneously circumvents a costly corpus search while strengthening pattern nomination, which should increase accuracy. An implementation in the cyber-security domain is discussed as well as challenges to Natural Language Processing imposed by the security domain.


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    » ; * * " \ ) I O O l i n O A O U 3 N 3 9 6 6 L I M d v This publication and other Energy Information Administration (EIA) publications may be purchased from the Superintendent of Documents, U.S. Government Printing Office. Telephone orders may be directed to: Superintendent of Documents U.S. Government Printing Office Main Order Desk (202)512-1800 FAX: (202) 512-2250 8 a.m. to 4:30 p.m., eastern time, M-F All mail orders should be directed to: U.S. Government Printing Office P.O. Box


    Gasoline and Diesel Fuel Update (EIA)

    61- NOIJLVaiSINIWaV NOIlVlAldOdNI AOU3N3 Z661 This publication and other Energy Information Administration (EIA) publications may be purchased from the Superintendent of Documents, U.S. Government Printing Office. AH telephone orders should be directed to: U.S. Government Printing Office McPherson Square Bookstore 1510 H Street, N.W. Washington, DC 20005 (202)653-2050 FAX (202)376-5055 9 a.m. to 5 p.m., eastern time, M-F All mail orders should be directed to: Superintendent of Documents U.S.

  11. Daylight Savings Time Starts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Daylight Savings Time Starts Daylight Savings Time Starts WHEN: Mar 08, 2015 3:00 AM - 11:59 PM WHERE: World Time Zones CATEGORY: Holiday INTERNAL: Calendar Login Daylight Savings...

  12. UGE Scheduler Cycle Time

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    UGE Scheduler Cycle Time UGE Scheduler Cycle Time Genepool Cycle Time Genepool Scheduler Cycle Time Genepool Jobs Dispatched / Hour What is the Scheduler Cycle? The Univa Grid Engine Scheduler cycle performs a number of important tasks, including: Prioritizing Jobs Reserving Resources for jobs requesting more resources (slots / memory) Dispatching jobs or tasks to the compute nodes Evaluating job dependencies The "cycle time" is the length of time it takes the scheduler to complete all

  13. Climate Time-Machine

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Climate Time-Machine Climate Time-Machine 20th Century Reanalysis Project Explores Earth's Past and Future Climate January 25, 2011 Berkeley Lab Contact: Jon Bashor, ...


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    (865) 574-2105 (Alternate) Miller, Ruth Oak Ridge Nat'l Laboratory ... Ashley, Tom CWI, Idaho Cleanup Project (208) 360-3552 McGary, ...

  15. Mail Management Memorandum, July 2, 2010

    Energy Savers [EERE]

  16. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    New reporting due date will be October 31 of each year starting in FY-2014. On-line ... Change to Schedule 5-1. Requirement is to now enter numbers rounded to the nearest dollar ...

  17. Widget:MailChimp | Open Energy Information

    Open Energy Info (EERE)

    source History View New Pages Recent Changes All Special Pages Semantic SearchQuerying Get Involved Help Apps Datasets Community Login | Sign Up Search Widget Edit History...

  18. Time-Resolved

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and time) three correspond to the three broad categories of synchrotron experimental measurement techniques: spectroscopy (energy), scattering (momentum), and imaging...

  19. Task Time Tracker

    Energy Science and Technology Software Center (OSTI)


    This client-side web app tracks the amount of time spent on arbitrary tasks. It allosw the creation of an unlimited number of arbitrarily named tasks ans via simple interactions, tracks the amount of time spent working on the drfined tasks.


    DOE Patents [OSTI]

    Owren, H.M.; Johnson, B.M.; Smith, V.L.


    The time calibrator of an electric signal displayed on an oscilloscope is described. In contrast to the conventional technique of using time-calibrated divisions on the face of the oscilloscope, this invention provides means for directly superimposing equal time spaced markers upon a signal displayed upon an oscilloscope. More explicitly, the present invention includes generally a generator for developing a linear saw-tooth voltage and a circuit for combining a high-frequency sinusoidal voltage of a suitable amplitude and frequency with the saw-tooth voltage to produce a resultant sweep deflection voltage having a wave shape which is substantially linear with respect to time between equal time spaced incremental plateau regions occurring once each cycle of the sinusoidal voltage. The foregoing sweep voltage when applied to the horizontal deflection plates in combination with a signal to be observed applied to the vertical deflection plates of a cathode ray oscilloscope produces an image on the viewing screen which is essentially a display of the signal to be observed with respect to time. Intensified spots, or certain other conspicuous indications corresponding to the equal time spaced plateau regions of said sweep voltage, appear superimposed upon said displayed signal, which indications are therefore suitable for direct time calibration purposes.


    DOE Patents [OSTI]

    Sander, H.H.


    The travel time of a nuclear shock wave from its point of origin to a location can be determined accurately by an apparatus for noting and comparably recording both zerotime, as indicated by the electromagnetic transient associated with the nuclear detonation, and shock wave arrival time.


    DOE Patents [OSTI]

    Tuck, J.L.


    This patent relates to means for ascertaining the instant of arrival of a shock wave in an exploslve charge and apparatus utilizing this means to coordinate the timing of two operations involving a short lnterval of time. A pair of spaced electrodes are inserted along the line of an explosive train with a voltage applied there-across which is insufficient to cause discharge. When it is desired to initiate operation of a device at the time the explosive shock wave reaches a particular point on the explosive line, the device having an inherent time delay, the electrodes are located ahead of the point such that the ionization of the area between the electrodes caused by the traveling explosive shock wave sends a signal to initiate operation of the device to cause it to operate at the proper time. The operated device may be photographic equipment consisting of an x-ray illuminating tube.

  3. Parallel time integration software

    Energy Science and Technology Software Center (OSTI)


    This package implements an optimal-scaling multigrid solver for the (non) linear systems that arise from the discretization of problems with evolutionary behavior. Typically, solution algorithms for evolution equations are based on a time-marching approach, solving sequentially for one time step after the other. Parallelism in these traditional time-integrarion techniques is limited to spatial parallelism. However, current trends in computer architectures are leading twards system with more, but not faster. processors. Therefore, faster compute speeds mustmore » come from greater parallelism. One approach to achieve parallelism in time is with multigrid, but extending classical multigrid methods for elliptic poerators to this setting is a significant achievement. In this software, we implement a non-intrusive, optimal-scaling time-parallel method based on multigrid reduction techniques. The examples in the package demonstrate optimality of our multigrid-reduction-in-time algorithm (MGRIT) for solving a variety of parabolic equations in two and three sparial dimensions. These examples can also be used to show that MGRIT can achieve significant speedup in comparison to sequential time marching on modern architectures.« less

  4. Digital time delay

    DOE Patents [OSTI]

    Martin, A.D.


    Method and apparatus are provided for generating an output pulse following a trigger pulse at a time delay interval preset with a resolution which is high relative to a low resolution available from supplied clock pulses. A first lumped constant delay provides a first output signal at predetermined interpolation intervals corresponding to the desired high resolution time interval. Latching circuits latch the high resolution data to form a first synchronizing data set. A selected time interval has been preset to internal counters and corrected for circuit propagation delay times having the same order of magnitude as the desired high resolution. Internal system clock pulses count down the counters to generate an internal pulse delayed by an internal which is functionally related to the preset time interval. A second LCD corrects the internal signal with the high resolution time delay. A second internal pulse is then applied to a third LCD to generate a second set of synchronizing data which is complementary with the first set of synchronizing data for presentation to logic circuits. The logic circuits further delay the internal output signal with the internal pulses. The final delayed output signal thereafter enables the output pulse generator to produce the desired output pulse at the preset time delay interval following input of the trigger pulse.

  5. Time of Flight

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of Flight Techniques Since the LANSCE proton beam is pulsed, the energy of the neutrons that are produced can be determined by Time-of-Flight (TOF) techniques. Neutron Time-of-Flight Since the LANSCE proton beam is pulsed, the energy of the neutrons that are produced can be determined by Time-of-Flight (TOF) techniques. The proton beam pulse strikes the tungsten neutron production target and neutrons, gamma rays and charged particles are produced. The charged particles are removed from the beam


    DOE Patents [OSTI]

    Clemensen, R.E.


    An electrically variable time delay line is described which may be readily controlled simuitaneously with variable impedance matching means coupied thereto such that reflections are prevented. Broadly, the delay line includes a signal winding about a magnetic core whose permeability is electrically variable. Inasmuch as the inductance of the line varies directly with the permeability, the time delay and characteristic impedance of the line both vary as the square root of the permeability. Consequently, impedance matching means may be varied similariy and simultaneously w:th the electrically variable permeability to match the line impedance over the entire range of time delay whereby reflections are prevented.

  7. X Time Series

    Energy Savers [EERE]

    11 Figure 5-11: 1-Hour Ozone Time Series Observed (C506) v. Predicted (CAMx) for WRF AACOG Base Case Run 3, 2006 5-12 5.3.2 Hourly NO X Time Series Time series plots of modeled and predicted hourly NO X for each monitor located in the San Antonio MSA were constructed. The model over predicted NO X emissions at the C58 monitor on almost every day during the June 2006 episode. The average predicted hourly NO X was 7.3 ppb, while the average observed hourly NO X was only 3.9 ppb. Likewise, the


    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SPECIAL DATE AND TIME Evolving views of the outer solar system: new insights from NASA's New Horizons mission's historic first Pluto fly-by Dr. Kimberly Ennico Smith NASA Ames ...

  9. Time-Resolved

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ultrafast Spectroscopy of Warm Dense Matter Real-Time Chemical Imaging of Bacterial Biofilm Development Using Light to Control How X Rays Interact with Matter X-Ray Imaging of...

  10. Time Card Entry System

    Energy Science and Technology Software Center (OSTI)


    The Time Card Entry System was developed for the Department of Enegy, Idaho Operations Office (DOE-ID) to interface with the DOE headquarters (DOE-HQ) Electronic Time and Attendance (ETA) system for payroll. It features pop-up window pick lists for Work Breakdown Structure numbers and Hour Codes and has extensive processing that ensures that time and attendance reported by the employee fulfills U.S. Government/OMB requirements before Timekeepers process the data at the end of the two weekmore » payroll cycle using ETA. A tour of duty profile (e.g., ten hour day, four day week with Sunday, friday and Saturday off), previously established in the ETA system, is imported into the Time Card Entry System by the timekeepers. An individual''s profile establishes the basis for validation of time of day and number of hours worked per day. At the end of the two cycle, data is exported by the timekeepers from the Time Card Entry System into ETA files.« less

  11. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    business on the web.) To use this service, we recommend the use of Microsoft Internet Explorer 5.5 or later or Netscape 4.77 or later. Send your surveys using this secure...

  12. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    over the web using secure, encrypted processes. (It is the same method that commercial companies communicate with customers when transacting business on the web.) To use this ...

  13. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    over the web using secure, encrypted processes. (It is the same method that commercial companies use to communicate with customers when transacting business on the web.) To use ...

  14. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    month." " since the last report, enter an ""X"" in the block:" " ",,,..."Mo",,,"Yea... "If this is a resubmission, enter an ""X"" in the block:",,,...

  15. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    ,,," Version No: 2014.001" "ANNUAL REPORT OF THE ORIGIN OF NATURAL GAS LIQUIDS PRODUCTION" "FORM EIA-64A" "REPORT YEAR 2014" "This report is...

  16. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    ...www.eia.govsurveyformeia782alist782a.pdf" "Phone No.:",,,..."Ex... you are reporting:" "Type of Report (Check One):" ,,"Original",,,..."Mo",,,"Da...

  17. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. ...

  18. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. Title 18 USC 1001 makes it a criminal offense for any person knowingly and ...

  19. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    "REPORT YEAR 2011" "This report is mandatory under Public Law 93-275. Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. ...

  20. Time reversal communication system

    DOE Patents [OSTI]

    Candy, James V.; Meyer, Alan W.


    A system of transmitting a signal through a channel medium comprises digitizing the signal, time-reversing the digitized signal, and transmitting the signal through the channel medium. The channel medium may be air, earth, water, tissue, metal, and/or non-metal.

  1. Time and Attendance Reporting

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    DOE O 535.1 establishes the Department's requirements and responsibilities governing time and attendance reporting. The purpose of this revision is to reflect the transition of payroll processing from the Capital Accounting Center to the Defense Finance and Accounting System. Cancels DOE O 3600.1B. Canceled by DOE O 322.1C.

  2. Time-Encoded Imagers.

    SciTech Connect (OSTI)

    Marleau, Peter; Brubaker, Erik


    This report provides a short overview of the DNN R&D funded project, Time-Encoded Imagers. The project began in FY11 and concluded in FY14. The Project Description below provides the overall motivation and objectives for the project as well as a summary of programmatic direction. It is followed by a short description of each task and the resulting deliverables.

  3. Time Series Database

    Energy Science and Technology Software Center (OSTI)


    TSDB is a Python module for storing large volumes of time series data. TSDB stores data in binary files indexed by a timestamp. Aggregation functions (such as rate, sum, avg, etc.) can be performed on the data, but data is never discarded. TSDB is presently best suited for SNMP data but new data types are easily added.

  4. Genepool Time Heatmaps

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Genepool Time Heatmaps Heatmap of Time and Slots Requested vs Time Waited (in hours) | Queue: All | Last 7 Days Time Requested Slots <1h 1-2h 2-6h 6-12h 12-24h 24-36h 36-48h 48h-1wk >1wk Job Count Longest Wait 1 23.0 (233) 0.37 (1819) 27.54 (49888) 5.85 (124593) 1.23 (39835) 0.34 (732) 0 0.4 (224) 0.02 (1) 217325 538.96 2 0 0.01 (19) 2.54 (78) 0.2 (140) 0.99 (2683) 0 0 0 0 2920 9.1 4 0.08 (1) 0 2.82 (141) 0.36 (143) 1.07 (12) 0.06 (5) 0.01 (5) 0.06 (1) 1.3 (5) 313 20.48 6 0.01 (2) 0 0.09

  5. Efficient Real-Time Time-Dependent Density Functional Theory...

    Office of Scientific and Technical Information (OSTI)

    Efficient Real-Time Time-Dependent Density Functional Theory Method and its Application to a Collision of an Ion with a 2D Material Title: Efficient Real-Time Time-Dependent ...

  6. Tevatron injection timing

    SciTech Connect (OSTI)

    Saritepe, S.; Annala, G.


    Bunched beam transfer from one accelerator to another requires coordination and synchronization of many ramped devices. During collider operation timing issues are more complicated since one has to switch from proton injection devices to antiproton injection devices. Proton and antiproton transfers are clearly distinct sequences since protons and antiprotons circulate in opposite directions in the Main Ring (MR) and in the Tevatron. The time bumps are different, the kicker firing delays are different, the kickers and lambertson magnets are different, etc. Antiprotons are too precious to be used for tuning purposes, therefore protons are transferred from the Tevatron back into the Main Ring, tracing the path of antiprotons backwards. This tuning operation is called ``reverse injection.`` Previously, the reverse injection was handled in one supercycle. One batch of uncoalesced bunches was injected into the Tevatron and ejected after 40 seconds. Then the orbit closure was performed in the MR. In the new scheme the lambertson magnets have to be moved and separator polarities have to be switched, activities that cannot be completed in one supercycle. Therefore, the reverse injection sequence was changed. This involved the redefinition of TVBS clock event $D8 as MRBS $D8 thus making it possible to inject 6 proton batches (or coalesced bunches) and eject them one at a time on command, performing orbit closure each time in the MR. Injection devices are clock event driven. The TCLK is used as the reference clock. Certain TCLK events are triggered by the MR beam synchronized clock (MRBS) events. Some delays are measured in terms of MRBS ticks and MR revolutions. See Appendix A for a brief description of the beam synchronized clocks.

  7. The Y-12 Times

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 July 2008 P.O. Box 2009 Oak Ridge, TN 37831-8245 Managing Editors Amy Alley: Heidi Spurling: Layout/Design Lisa Harris Contributors Ellen Boatner Alice Brandon Ken Davis Kathy Fahey Jane Miller Mary Murray Brett Pate Cindy Robinson Sandra Schwartz I N S I D E Page 2 Major milestone celebrated Page 3 Putting 70 cents to good use Pages 4 and 5 The comings and goings during June Page 7 Y-12's new talent Ray Smith Donna

  8. The time it takes

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    time it takes... 180 days 254 days 280 days 365 days to grow 3 inches of hair to travel to and land on Mars for a human baby to develop to term for one Earth-year 12 1 2 3 4 5 6 7 8 9 10 11 39 minutes longer than a day on Earth. A day on Mars lasts This year's high school graduates have never known a world in which there were no robotic vehicles cruising around on Mars. There are presently six active spacecraft orbiting around or driving on Mars. Los Alamos scientists helped to develop the

  9. Real time Faraday spectrometer

    DOE Patents [OSTI]

    Smith, Jr., Tommy E. (Fremont, CA); Struve, Kenneth W. (Albuquerque, NM); Colella, Nicholas J. (Livermore, CA)


    This invention uses a dipole magnet to bend the path of a charged particle beam. As the deflected particles exit the magnet, they are spatially dispersed in the bend-plane of the magnet according to their respective momenta and pass to a plurality of chambers having Faraday probes positioned therein. Both the current and energy distribution of the particles is then determined by the non-intersecting Faraday probes located along the chambers. The Faraday probes are magnetically isolated from each other by thin metal walls of the chambers, effectively providing real time current-versus-energy particle measurements.

  10. Aug 2010 Times

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    8 August 2010 P.O. Box 2009 Oak Ridge, TN 37831-8245 W H A T ' S I N S I D E Page 2 ARRA work continues Page 4 Sharing secrets with the public Page 5 Apprentices are a sure bet Page 6 Need a yo-yo? Stop by JA BizTown's Y-12 booth Page 8 Employees drop the pounds B&W Technical Services Y-12, LLC, a partnership between Babcock & Wilcox Technical Services Group Inc. and Bechtel National Inc., operates the Y-12 National Security Complex. A newsletter for

  11. Real time automated inspection

    DOE Patents [OSTI]

    Fant, K.M.; Fundakowski, R.A.; Levitt, T.S.; Overland, J.E.; Suresh, B.R.; Ulrich, F.W.


    A method and apparatus are described relating to the real time automatic detection and classification of characteristic type surface imperfections occurring on the surfaces of material of interest such as moving hot metal slabs produced by a continuous steel caster. A data camera transversely scans continuous lines of such a surface to sense light intensities of scanned pixels and generates corresponding voltage values. The voltage values are converted to corresponding digital values to form a digital image of the surface which is subsequently processed to form an edge-enhanced image having scan lines characterized by intervals corresponding to the edges of the image. The edge-enhanced image is thresholded to segment out the edges and objects formed by the edges by interval matching and bin tracking. Features of the objects are derived and such features are utilized to classify the objects into characteristic type surface imperfections. 43 figs.

  12. Real time automated inspection

    DOE Patents [OSTI]

    Fant, Karl M.; Fundakowski, Richard A.; Levitt, Tod S.; Overland, John E.; Suresh, Bindinganavle R.; Ulrich, Franz W.


    A method and apparatus relating to the real time automatic detection and classification of characteristic type surface imperfections occurring on the surfaces of material of interest such as moving hot metal slabs produced by a continuous steel caster. A data camera transversely scans continuous lines of such a surface to sense light intensities of scanned pixels and generates corresponding voltage values. The voltage values are converted to corresponding digital values to form a digital image of the surface which is subsequently processed to form an edge-enhanced image having scan lines characterized by intervals corresponding to the edges of the image. The edge-enhanced image is thresholded to segment out the edges and objects formed by the edges are segmented out by interval matching and bin tracking. Features of the objects are derived and such features are utilized to classify the objects into characteristic type surface imperfections.

  13. Time encoded radiation imaging

    DOE Patents [OSTI]

    Marleau, Peter; Brubaker, Erik; Kiff, Scott


    The various technologies presented herein relate to detecting nuclear material at a large stand-off distance. An imaging system is presented which can detect nuclear material by utilizing time encoded imaging relating to maximum and minimum radiation particle counts rates. The imaging system is integrated with a data acquisition system that can utilize variations in photon pulse shape to discriminate between neutron and gamma-ray interactions. Modulation in the detected neutron count rates as a function of the angular orientation of the detector due to attenuation of neighboring detectors is utilized to reconstruct the neutron source distribution over 360 degrees around the imaging system. Neutrons (e.g., fast neutrons) and/or gamma-rays are incident upon scintillation material in the imager, the photons generated by the scintillation material are converted to electrical energy from which the respective neutrons/gamma rays can be determined and, accordingly, a direction to, and the location of, a radiation source identified.

  14. SLH Timing Belt Powertrain

    SciTech Connect (OSTI)

    Schneider, Abe


    The main goal of this proposal was to develop and test a novel powertrain solution for the SLH hydroEngine—, a low-cost, efficient low-head hydropower technology. Nearly two-thirds of U.S. renewable electricity is produced by hydropower (EIA 2010). According to the U.S. Department of Energy; this amount could be increased by 50% with small hydropower plants, often using already-existing dams (Hall 2004). There are more than 80,000 existing dams, and of these, less than 4% generate power (Blankinship 2009). In addition, there are over 800 irrigation districts in the U.S., many with multiple, non-power, low-head drops. These existing, non-power dams and irrigation drops could be retrofitted to produce distributed, baseload, renewable energy with appropriate technology. The problem is that most existing dams are low-head, or less than 30 feet in height (Ragon 2009). Only about 2% of the available low-head hydropower resource in the U.S. has been developed, leaving more than 70 GW of annual mean potential low-head capacity untapped (Hall 2004). Natel Energy, Inc. is developing a low-head hydropower turbine that operates efficiently at heads less than 6 meters and is cost-effective for deployment across multiple low-head structures. Because of the unique racetrack-like path taken by the prime-movers in the SLH, a flexible powertrain is required. Historically, the only viable technological solution was roller chain. Despite the having the ability to easily attach blades, roller chain is characterized by significant drawbacks, including high cost, wear, and vibration from chordal action. Advanced carbon-#12;fiber-reinforced timing belts have been recently developed which, coupled with a novel belt attachment system developed by Natel Energy, result in a large reduction in moving parts, reduced mass and cost, and elimination of chordal action for increased fatigue life. The work done in this project affirmatively addressed each of the following 3 major uncertainties concerning a timing-belt based hydroEngine —powertrain: 1. Can a belt handle the high torques and power loads demanded by the SLH? (Yes.) 2. Can the SLH blades be mounted to belt with a connection that can withstand the loads encountered in operation? (Yes.) 3. Can the belt, with blade attachments, live through the required cyclic loading? (Yes.) The research adds to the general understanding of sustainable small hydropower systems by using innovative system testing to develop and demonstrate performance of a novel powertrain solution, enabling a new type of hydroelectric turbine to be commercially developed. The technical effectiveness of the methods investigated has been shown to be positive through an extensive design and testing process accommodating many constraints and goals, with a major emphasis on high cycle fatigue life. Economic feasibility of the innovations has been demonstrated through many iterations of design for manufacturability and cost reduction. The project is of benefit to the public because it has helped to develop a solution to a major problem -- despite the large available potential for new low-head hydropower, high capital costs and high levelized cost of electricity (LCOE) continue to be major barriers to project development. The hydroEngine— represents a significant innovation, leveraging novel fluid mechanics and mechanical configuration to allow lower-cost turbine manufacture and development of low head hydropower resources.

  15. Real-Time Benchmark Suite

    Energy Science and Technology Software Center (OSTI)


    This software provides a portable benchmark suite for real time kernels. It tests the performance of many of the system calls, as well as the interrupt response time and task response time to interrupts. These numbers provide a baseline for comparing various real-time kernels and hardware platforms.

  16. Nagios Down-Time scripts

    Energy Science and Technology Software Center (OSTI)


    The Nagios Down-Time scripts are a set of Python scripts that create a commandline interface to Nagios' scheduled down-times. This allows for large-scale management of down-times, beyond what is feasible with the default web interface. Additionally, one of the scripts can be setup to periodically send emails of down-times that are scheduled to end within a specified amount of time after the script has been run; for example, it could run once a day andmore » send an email including down-times ending within the next 24 hours.« less

  17. ARM - Measurement - Extreme event time

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    would love to hear from you Send us a note below or call us at 1-888-ARM-DATA. Send Measurement : Extreme event time The time of extreme meteorological events such as minmax...

  18. Charging Your Time - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Health & Safety Exposition Charging Your Time About Us Charging Your Time Committee Members Contact Us Electronic Registration Form Exhibitor and Vendor Information EXPO 2016 Sponsors EXPO Award Criteria How to Get to TRAC Special Events What is EXPO Why Should I Participate in EXPO Charging Your Time Email Email Page | Print Print Page |Text Increase Font Size Decrease Font Size How Do I Charge My Time Spent at EXPO? Each Hanford Prime Contractor may have different policies for attending

  19. Three-body dwell time

    SciTech Connect (OSTI)

    Kelkar, N. G.


    The lifetime of an unstable state or resonance formed as an intermediate state in two-body scattering is known to be related to the dwell time or the time spent within a given region of space by the two interacting particles. This concept is extended to the case of three-body systems and a relation connecting the three-body dwell time with the two-body dwell times of the substructures of the three-body system is derived for the case of separable wave functions. The Kapur-Peierls formalism is revisited to discover one of the first definitions of dwell time in the literature. An extension of the Kapur-Peierls formalism to the three-body case shows that the lifetime of a three-body resonance can indeed be given by the three-body dwell time.


    DOE Patents [OSTI]

    Gross, J.E.


    This patent relates to a pulse generator and more particularly to a time interval generator wherein the time interval between pulses is precisely determined. The variable time generator comprises two oscillators with one having a variable frequency output and the other a fixed frequency output. A frequency divider is connected to the variable oscillator for dividing its frequency by a selected factor and a counter is used for counting the periods of the fixed oscillator occurring during a cycle of the divided frequency of the variable oscillator. This defines the period of the variable oscillator in terms of that of the fixed oscillator. A circuit is provided for selecting as a time interval a predetermined number of periods of the variable oscillator. The output of the generator consists of a first pulse produced by a trigger circuit at the start of the time interval and a second pulse marking the end of the time interval produced by the same trigger circuit.

  1. Reactor control rod timing system

    SciTech Connect (OSTI)

    Wu, P.T.


    A fluid driven jet-edge whistle timing system for control rods of a nuclear reactor for producing real-time detection of the timing of each control rod in its scram operation. An important parameter in reactor safety, particularly for liquid metal fast breeder reactors (LMFBR), is the time deviation between the time the control rod is released and the time the rod actually reaches the down position. The whistle has a nearly pure tone signal with center frequency (Above 100 kHz) far above the frequency band in which the energy of the background noise is concentrated. Each control rod can be fitted with a whistle with a different frequency so that there is no ambiguity in differentiating the signal from each control rod.

  2. Reactor control rod timing system

    DOE Patents [OSTI]

    Wu, Peter T. K.


    A fluid driven jet-edge whistle timing system for control rods of a nuclear reactor for producing real-time detection of the timing of each control rod in its scram operation. An important parameter in reactor safety, particularly for liquid metal fast breeder reactors (LMFBR), is the time deviation between the time the control rod is released and the time the rod actually reaches the down position. The whistle has a nearly pure tone signal with center frequency (above 100 kHz) far above the frequency band in which the energy of the background noise is concentrated. Each control rod can be fitted with a whistle with a different frequency so that there is no ambiguity in differentiating the signal from each control rod.


    DOE Patents [OSTI]

    Gross, J.E.


    An electronic device for measuring the time interval between two control pulses is presented. The device incorporates part of a previous approach for time measurement, in that pulses from a constant-frequency oscillator are counted during the interval between the control pulses. To reduce the possible error in counting caused by the operation of the counter gating circuit at various points in the pulse cycle, the described device provides means for successively delaying the pulses for a fraction of the pulse period so that a final delay of one period is obtained and means for counting the pulses before and after each stage of delay during the time interval whereby a plurality of totals is obtained which may be averaged and multplied by the pulse period to obtain an accurate time- Interval measurement.

  4. Radiation Levels in Real Time?

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Levels in Real Time? There's an App for That Gamma radiation levels in the southern Nevada area will soon be accessible around the world at the touch of a finger. Makers of the ...

  5. Piercing 'The Illusion of Time'

    Broader source: [DOE]

    Take an hour tonight to tune into PBS Nova's "The Fabric of the Cosmos" series — tonight's episode offers a whole new perspective on time as we know it. It suggests that time itself – or at least what our perceptions and experiences tell us it is – could be an illusion.
 Host Brian Greene is joined by a theoretical physicist from Fermilab.

  6. Geothermal Exploration Cost and Time

    SciTech Connect (OSTI)

    Jenne, Scott


    The Department of Energys Geothermal Technology Office (GTO) provides RD&D funding for geothermal exploration technologies with the goal of lowering the risks and costs of geothermal development and exploration. The National Renewable Energy Laboratory (NREL) was tasked with developing a metric in 2012 to measure the impacts of this RD&D funding on the cost and time required for exploration activities. The development of this cost and time metric included collecting cost and time data for exploration techniques, creating a baseline suite of exploration techniques to which future exploration cost and time improvements can be compared, and developing an online tool for graphically showing potential project impacts (all available at Geothermal). This paper describes the methodology used to define the baseline exploration suite of techniques (baseline), as well as the approach that was used to create the cost and time data set that populates the baseline. The resulting product, an online tool for measuring impact, and the aggregated cost and time data are available on the Open Energy Information website (OpenEI, for public access. - Published 01/01/2013 by US National Renewable Energy Laboratory NREL.

  7. Reduction in maximum time uncertainty of paired time signals

    DOE Patents [OSTI]

    Theodosiou, G.E.; Dawson, J.W.


    Reduction in the maximum time uncertainty (t/sub max/ - t/sub min/) of a series of paired time signals t/sub 1/ and t/sub 2/ varying between two input terminals and representative of a series of single events where t/sub 1/ less than or equal to t/sub 2/ and t/sub 1/ + t/sub 2/ equals a constant, is carried out with a circuit utilizing a combination of OR and AND gates as signal selecting means and one or more time delays to increase the minimum value (t/sub min/) of the first signal t/sub 1/ closer to t/sub max/ and thereby reduce the difference. The circuit may utilize a plurality of stages to reduce the uncertainty by factors of 20 to 800.

  8. Reduction in maximum time uncertainty of paired time signals

    DOE Patents [OSTI]

    Theodosiou, G.E.; Dawson, J.W.


    Reduction in the maximum time uncertainty (t[sub max]--t[sub min]) of a series of paired time signals t[sub 1] and t[sub 2] varying between two input terminals and representative of a series of single events where t[sub 1][<=]t[sub 2] and t[sub 1]+t[sub 2] equals a constant, is carried out with a circuit utilizing a combination of OR and AND gates as signal selecting means and one or more time delays to increase the minimum value (t[sub min]) of the first signal t[sub 1] closer to t[sub max] and thereby reduce the difference. The circuit may utilize a plurality of stages to reduce the uncertainty by factors of 20--800. 6 figs.

  9. Reduction in maximum time uncertainty of paired time signals

    DOE Patents [OSTI]

    Theodosiou, George E.; Dawson, John W.


    Reduction in the maximum time uncertainty (t.sub.max -t.sub.min) of a series of paired time signals t.sub.1 and t.sub.2 varying between two input terminals and representative of a series of single events where t.sub.1 .ltoreq.t.sub.2 and t.sub.1 +t.sub.2 equals a constant, is carried out with a circuit utilizing a combination of OR and AND gates as signal selecting means and one or more time delays to increase the minimum value (t.sub.min) of the first signal t.sub.1 closer to t.sub.max and thereby reduce the difference. The circuit may utilize a plurality of stages to reduce the uncertainty by factors of 20-800.

  10. Subscribe Today to E-mail Alerts from GTO

    Broader source: [DOE]

    Sign up today to get the most up-to-date information on Geothermal Technologies Office (GTO)-sponsored webinars and funding announcements as they become available—delivered right to your inbox for free.

  11. Customer Feedback during Development of 1998 MECS: Mail/Electronic...

    U.S. Energy Information Administration (EIA) Indexed Site

    and its composition (by fuel type) in China; - commercial and industrial energy management market data, specifically in software market; - energy consumption in health,...

  12. Data-Driven Mailing Helps Heat Up Untapped Seattle Market

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... you're probably reaching folks who aren't strong prospects for energy efficiency upgrades. ... Whether it's the age of the home, heating source, or age of the families living there, use ...

  13. Fermilab | Press Room | Subscribe to Press Release mailing list

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Sheets and Brochures Fermilab Today symmetry Photo and Video Archive Resources for ... Employees Researchers, Postdocs and Graduate Students Job Seekers Neighbors...

  14. Mailing Addresses and Information Numbers for Operations, Field...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy National Nuclear Security Administration ... Rocky Mountain Oilfield Testing Center 907 N. Poplar, ... Contractors News & Blog Data Phonebook Web Policies History

  15. Report Period: EIA ID NUMBER: Appendix A: Mailing Address: Appendix...

    U.S. Energy Information Administration (EIA) Indexed Site

    This report is mandatory under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other ...

  16. Mailing Addresses for National Laboratories and Technology Centers...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Livermore, CA 94551-0969 925-294-3000 U.S. Department of Energy Savannah River Ecology Laboratory Building 737-A, Drawer E Aiken, SC 29802 803-725-2472 U.S. Department of Energy ...

  17. Minutes from the March 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Printing Agenda Items... Upcoming Congressional Joint Committee on Printing Commercial ... Woodruff also said Headquarters is planning visits to other sites this fiscal year. ...

  18. Real-Time Weather Data Access Guide: Updated February 2006

    SciTech Connect (OSTI)

    Long, N.


    The format of the weather data received from the National Weather Service is extremely inconvenient for building engineers to read, especially for trending historical data; therefore, a weather parsing program was created by NREL building engineers to simplify the data. The weather-parsing program collects current weather conditions for over 4,000 sites around the world and allows access to the data via a web page designed by NREL building researchers. The database provides data for some locations from late 1998 through today. Users can request data to be sent to them via e-mail by using the interactive web page.


    DOE Patents [OSTI]

    Creveling, R.


    A tine-delay circuit which produces a delay time in d. The circuit a capacitor, an te back resistance, connected serially with the anode of the diode going to ground. At the start of the time delay a negative stepfunction is applied to the series circuit and initiates a half-cycle transient oscillatory voltage terminated by a transient oscillatory voltage of substantially higher frequency. The output of the delay circuit is taken at the junction of the inductor and diode where a sudden voltage rise appears after the initiation of the higher frequency transient oscillations.

  20. Normalized Elution Time Prediction Utility

    Energy Science and Technology Software Center (OSTI)


    This program is used to compute the predicted normalized elution time (NET) for a list of peptide sequences. It includes the Kangas/Petritis neural network trained model, the Krokhin hydrophobicity model, and the Mant hydrophobicity model. In addition, it can compute the predicted strong cation exchange (SCX) fraction (on a 0 to 1 scale) in which a given peptide will appear.

  1. High resolution time interval counter

    DOE Patents [OSTI]

    Condreva, K.J.


    A high resolution counter circuit measures the time interval between the occurrence of an initial and a subsequent electrical pulse to two nanoseconds resolution using an eight megahertz clock. The circuit includes a main counter for receiving electrical pulses and generating a binary word--a measure of the number of eight megahertz clock pulses occurring between the signals. A pair of first and second pulse stretchers receive the signal and generate a pair of output signals whose widths are approximately sixty-four times the time between the receipt of the signals by the respective pulse stretchers and the receipt by the respective pulse stretchers of a second subsequent clock pulse. Output signals are thereafter supplied to a pair of start and stop counters operable to generate a pair of binary output words representative of the measure of the width of the pulses to a resolution of two nanoseconds. Errors associated with the pulse stretchers are corrected by providing calibration data to both stretcher circuits, and recording start and stop counter values. Stretched initial and subsequent signals are combined with autocalibration data and supplied to an arithmetic logic unit to determine the time interval in nanoseconds between the pair of electrical pulses being measured. 3 figs.

  2. High resolution time interval counter

    DOE Patents [OSTI]

    Condreva, Kenneth J.


    A high resolution counter circuit measures the time interval between the occurrence of an initial and a subsequent electrical pulse to two nanoseconds resolution using an eight megahertz clock. The circuit includes a main counter for receiving electrical pulses and generating a binary word--a measure of the number of eight megahertz clock pulses occurring between the signals. A pair of first and second pulse stretchers receive the signal and generate a pair of output signals whose widths are approximately sixty-four times the time between the receipt of the signals by the respective pulse stretchers and the receipt by the respective pulse stretchers of a second subsequent clock pulse. Output signals are thereafter supplied to a pair of start and stop counters operable to generate a pair of binary output words representative of the measure of the width of the pulses to a resolution of two nanoseconds. Errors associated with the pulse stretchers are corrected by providing calibration data to both stretcher circuits, and recording start and stop counter values. Stretched initial and subsequent signals are combined with autocalibration data and supplied to an arithmetic logic unit to determine the time interval in nanoseconds between the pair of electrical pulses being measured.

  3. Time-Dependent Reliability Analysis

    Energy Science and Technology Software Center (OSTI)


    FRANTIC-3 was developed to evaluate system unreliability using time-dependent techniques. The code provides two major options: to evaluate standby system unavailability or, in addition to the unavailability to calculate the total system failure probability by including both the unavailability of the system on demand as well as the probability that it will operate for an arbitrary time period following the demand. The FRANTIC-3 time dependent reliability models provide a large selection of repair and testingmore » policies applicable to standby or continously operating systems consisting of periodically tested, monitored, and non-repairable (non-testable) components. Time-dependent and test frequency dependent failures, as well as demand stress related failure, test-caused degradation and wear-out, test associated human errors, test deficiencies, test override, unscheduled and scheduled maintenance, component renewal and replacement policies, and test strategies can be prescribed. The conditional system unavailabilities associated with the downtimes of the user specified failed component are also evaluated. Optionally, the code can perform a sensitivity study for system unavailability or total failure probability to the failure characteristics of the standby components.« less


    SciTech Connect (OSTI)

    Andrei Tokmakoff, MIT; Paul Champion, Northeastern University; Edwin J. Heilweil, NIST; Keith A. Nelson, MIT; Larry Ziegler, Boston University


    This document contains the Proceedings from the 14th International Conference on Time-Resolved Vibrational Spectroscopy, which was held in Meredith, NH from May 9-14, 2009. The study of molecular dynamics in chemical reaction and biological processes using time-resolved spectroscopy plays an important role in our understanding of energy conversion, storage, and utilization problems. Fundamental studies of chemical reactivity, molecular rearrangements, and charge transport are broadly supported by the DOE’s Office of Science because of their role in the development of alternative energy sources, the understanding of biological energy conversion processes, the efficient utilization of existing energy resources, and the mitigation of reactive intermediates in radiation chemistry. In addition, time-resolved spectroscopy is central to all five of DOE’s grand challenges for fundamental energy science. The Time-Resolved Vibrational Spectroscopy conference is organized biennially to bring the leaders in this field from around the globe together with young scientists to discuss the most recent scientific and technological advances. The latest technology in ultrafast infrared, Raman, and terahertz spectroscopy and the scientific advances that these methods enable were covered. Particular emphasis was placed on new experimental methods used to probe molecular dynamics in liquids, solids, interfaces, nanostructured materials, and biomolecules.

  5. Time of flight mass spectrometer

    DOE Patents [OSTI]

    Ulbricht, Jr., William H.


    A time-of-flight mass spectrometer is described in which ions are desorbed from a sample by nuclear fission fragments, such that desorption occurs at the surface of the sample impinged upon by the fission fragments. This configuration allows for the sample to be of any thickness, and eliminates the need for complicated sample preparation.

  6. Time Ordered Astrophysics Scalable Tools

    Energy Science and Technology Software Center (OSTI)


    This software package provides tools for astrophysical experiments which record data in the form of individual time streams from discrete detectors. TOAST provides tools from meta-data manipulation and job set up, I/O operation, telescope pointing reconstruction, and map-making. It also provides tools for constructing simulated observations.

  7. Time and Resource Estimation Tool

    Energy Science and Technology Software Center (OSTI)


    RESTORE is a computer software tool that allows one to model a complex set of steps required to accomplish a goal (e.g., repair a ruptured natural gas pipeline and restore service to customers). However, the time necessary to complete step may be uncertain and may be affected by conditions, such as the weather, the time of day, the day of the week. Therefore, "nature" can influence which steps are taken and the time needed tomore » complete each step. In addition, the tool allows one to model the costs for each step, which also may be uncertain. RESTORE allows the user to estimate the time and cost, both of which may be uncertain, to achieve an intermediate stage of completion, as well as overall completion. The software also makes it possible to model parallel, competing groups of activities (i.e., parallel paths) so that progreSs at a ‘merge point’ can proceed before other competing activities are completed. For example, RESTORE permits one to model a workaround and a simultaneous complete repair to determine a probability distribution for the earliest time service can be restored to a critical customer. The tool identifies the ‘most active path’ through the network of tasks, which is extremely important information for assessing the most effective way to speed-up or slow-down progress. Unlike other project planning and risk analysis tools, RESTORE provides an intuitive, graphical, and object-oriented environment for structuring a model and setting its parameters.« less

  8. Remote Whispering Applying Time Reversal

    SciTech Connect (OSTI)

    Anderson, Brian Eric


    The purpose of this project was to explore the use of time reversal technologies as a means for communication to a targeted individual or location. The idea is to have the privacy of whispering in one’s ear, but to do this remotely from loudspeakers not located near the target. Applications of this work include communicating with hostages and survivors in rescue operations, communicating imaging and operational conditions in deep drilling operations, monitoring storage of spent nuclear fuel in storage casks without wires, or clandestine activities requiring signaling between specific points. This technology provides a solution in any application where wires and radio communications are not possible or not desired. It also may be configured to self calibrate on a regular basis to adjust for changing conditions. These communications allow two people to converse with one another in real time, converse in an inaudible frequency range or medium (i.e. using ultrasonic frequencies and/or sending vibrations through a structure), or send information for a system to interpret (even allowing remote control of a system using sound). The time reversal process allows one to focus energy to a specific location in space and to send a clean transmission of a selected signal only to that location. In order for the time reversal process to work, a calibration signal must be obtained. This signal may be obtained experimentally using an impulsive sound, a known chirp signal, or other known signals. It may also be determined from a numerical model of a known environment in which the focusing is desired or from passive listening over time to ambient noise.


    DOE Patents [OSTI]

    Smith, V.L.; Carstensen, H.K.


    An improved time calibrated sweep circuit is presented, which extends the range of usefulness of conventional oscilloscopes as utilized for time calibrated display applications in accordance with U. S. Patent No. 2,832,002. Principal novelty resides in the provision of a pair of separate signal paths, each of which is phase and amplitude adjustable, to connect a high-frequency calibration oscillator to the output of a sawtooth generator also connected to the respective horizontal deflection plates of an oscilloscope cathode ray tube. The amplitude and phase of the calibration oscillator signals in the two signal paths are adjusted to balance out feedthrough currents capacitively coupled at high frequencies of the calibration oscillator from each horizontal deflection plate to the vertical plates of the cathode ray tube.

  10. High resolution time interval meter

    DOE Patents [OSTI]

    Martin, A.D.


    Method and apparatus are provided for measuring the time interval between two events to a higher resolution than reliability available from conventional circuits and component. An internal clock pulse is provided at a frequency compatible with conventional component operating frequencies for reliable operation. Lumped constant delay circuits are provided for generating outputs at delay intervals corresponding to the desired high resolution. An initiation START pulse is input to generate first high resolution data. A termination STOP pulse is input to generate second high resolution data. Internal counters count at the low frequency internal clock pulse rate between the START and STOP pulses. The first and second high resolution data are logically combined to directly provide high resolution data to one counter and correct the count in the low resolution counter to obtain a high resolution time interval measurement.

  11. Magnetic transit-time flowmeter

    DOE Patents [OSTI]

    Forster, George A.


    The flow rate of a conducting fluid in a stream is determined by disposing two permanent-magnet flowmeters in the stream, one downstream of the other. Flow of the conducting fluid causes the generation of both d-c and a-c electrical signals, the a-c comprising flow noise. Measurement of the time delay between similarities in the a-c signals by cross-correlation methods provides a measure of the rate of flow of the fluid.

  12. Radiation Levels in Real Time?

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Levels in Real Time? There's an App for That! Gamma radiation levels in the southern Nevada area will soon be accessible around the world at the touch of a finger. Makers of the cell phone application EcoData: Radiation are expanding their global network of radiation monitoring stations to include up-to-date readings from the Community Environmental Monitoring Program (CEMP) based out of southern Nevada. The CEMP was established in 1981 to monitor manmade and natural radiation levels surrounding

  13. January 2008 Y-12 Times

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    January 2008 P.O. Box 2009 Oak Ridge, TN 37831-8245 Managing Editor Melissa Leinart 865-574-1621 (6ml) Associate Editors Amy Alley Heidi Spurling Layout/Design Lisa Harris Contributors Campbell Cloar Ken Davis Kathy Fahey John Holbrook Jamie Loveday Brett Pate Cindy Robinson Ray Smith Donna Watson I N S I D E Page 2 Angels in our midst Page 3 Preparing for a widespread fl u outbreak Page 3 10 tips to help you say what you mean Pages 4 and 5 Bunton, Domm and

  14. October 2008 Y-12 Times

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0 October 2008 P.O. Box 2009 Oak Ridge, TN 37831-8245 Managing Editors Amy Alley: Heidi Spurling: Layout/Design Lisa Harris Contributors Ellen Boatner Ken Davis Cynthia Ensor Ryn Etter Kathy Fahey Vicki Hinkel Jamie Loveday Brett Pate I N S I D E Page 2 HR director's plan for success Page 3 Apprenticeship program gets boost with job training grant Page 3 Wellness coordinator is fi red up Page 4 It's offi cial: Y-12 is

  15. Mar_13Times.indd

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MARCH 2013 inside this issue ... FIRP draws to a close Page 2 Reminisce: Y-12 turns 70 Page 4 Russia's secret city Page 5 Development retools its CONOPS Page 6 ... and other Y-12 news Miss an issue? Find us online, MISSION, cont. on pg. 2 The National Nuclear Security Administration's Performance Evaluation Report for B&W Y-12, released Feb. 11, gave "Very Good" ratings to B&W Y-12 in areas related to all three core missions: maintaining

  16. May 2008 Y-12 Times

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 May 2008 P.O. Box 2009 Oak Ridge, TN 37831-8245 Managing Editor Melissa Leinart 865-574-1621 (6ml) Associate Editors Amy Alley Heidi Spurling Layout/Design Lisa Harris Contributors Ellen Boatner Ken Davis Kathy Fahey Stuart Hames Sharon McConathy Patrick McCoy I N S I D E Page 3 Fire department members come to the rescue Page 4 Driving green to protect our natural resources Page 5 73s: Best regards from Y-12's hams Page8 What's the secret? Mary Murray Brett Pate

  17. Real time infrared aerosol analyzer

    DOE Patents [OSTI]

    Johnson, Stanley A.; Reedy, Gerald T.; Kumar, Romesh


    Apparatus for analyzing aerosols in essentially real time includes a virtual impactor which separates coarse particles from fine and ultrafine particles in an aerosol sample. The coarse and ultrafine particles are captured in PTFE filters, and the fine particles impact onto an internal light reflection element. The composition and quantity of the particles on the PTFE filter and on the internal reflection element are measured by alternately passing infrared light through the filter and the internal light reflection element, and analyzing the light through infrared spectrophotometry to identify the particles in the sample.

  18. Fermi Timing and Synchronization System

    SciTech Connect (OSTI)

    Wilcox, R.; Staples, J.; Doolittle, L.; Byrd, J.; Ratti, A.; Kaertner, F.X.; Kim, J.; Chen, J.; Ilday, F.O.; Ludwig, F.; Winter, A.; Ferianis, M.; Danailov, M.; D'Auria, G.


    The Fermi FEL will depend critically on precise timing of its RF, laser and diagnostic subsystems. The timing subsystem to coordinate these functions will need to reliably maintain sub-100fs synchronicity between distant points up to 300m apart in the Fermi facility. The technology to do this is not commercially available, and has not been experimentally demonstrated in a working facility. Therefore, new technology must be developed to meet these needs. Two approaches have been researched by different groups working with the Fermi staff. At MIT, a pulse transmission scheme has been developed for synchronization of RF and laser devices. And at LBL, a CW transmission scheme has been developed for RF and laser synchronization. These respective schemes have advantages and disadvantages that will become better understood in coming years. This document presents the work done by both teams, and suggests a possible system design which integrates them both. The integrated system design provides an example of how choices can be made between the different approaches without significantly changing the basic infrastructure of the system. Overall system issues common to any synchronization scheme are also discussed.

  19. Real time analysis under EDS

    SciTech Connect (OSTI)

    Schneberk, D.


    This paper describes the analysis component of the Enrichment Diagnostic System (EDS) developed for the Atomic Vapor Laser Isotope Separation Program (AVLIS) at Lawrence Livermore National Laboratory (LLNL). Four different types of analysis are performed on data acquired through EDS: (1) absorption spectroscopy on laser-generated spectral lines, (2) mass spectrometer analysis, (3) general purpose waveform analysis, and (4) separation performance calculations. The information produced from this data includes: measures of particle density and velocity, partial pressures of residual gases, and overall measures of isotope enrichment. The analysis component supports a variety of real-time modeling tasks, a means for broadcasting data to other nodes, and a great degree of flexibility for tailoring computations to the exact needs of the process. A particular data base structure and program flow is common to all types of analysis. Key elements of the analysis component are: (1) a fast access data base which can configure all types of analysis, (2) a selected set of analysis routines, (3) a general purpose data manipulation and graphics package for the results of real time analysis. Each of these components are described with an emphasis upon how each contributes to overall system capability. 3 figs.

  20. Global Warming in Geologic Time

    SciTech Connect (OSTI)

    David Archer


    The notion is pervasive in the climate science community and in the public at large that the climate impacts of fossil fuel CO2 release will only persist for a few centuries. This conclusion has no basis in theory or models of the atmosphere / ocean carbon cycle, which we review here. The largest fraction of the CO2 recovery will take place on time scales of centuries, as CO2 invades the ocean, but a significant fraction of the fossil fuel CO2, ranging in published models in the literature from 20-60%, remains airborne for a thousand years or longer. Ultimate recovery takes place on time scales of hundreds of thousands of years, a geologic longevity typically associated in public perceptions with nuclear waste. The glacial / interglacial climate cycles demonstrate that ice sheets and sea level respond dramatically to millennial-timescale changes in climate forcing. There are also potential positive feedbacks in the carbon cycle, including methane hydrates in the ocean, and peat frozen in permafrost, that are most sensitive to the long tail of the fossil fuel CO2 in the atmosphere.

  1. Global Warming in Geologic Time

    SciTech Connect (OSTI)

    Archer, David


    The notion is pervasive in the climate science community and in the public at large that the climate impacts of fossil fuel CO2 release will only persist for a few centuries. This conclusion has no basis in theory or models of the atmosphere/ ocean carbon cycle, which we review here. The largest fraction of the CO2 recovery will take place on time scales of centuries, as CO2 invades the ocean, but a significant fraction of the fossil fuel CO2, ranging in published models in the literature from 20-60%, remains airborne for a thousand years or longer. Ultimate recovery takes place on time scales of hundreds of thousands of years, a geologic longevity typically associated in public perceptions with nuclear waste. The glacial/interglacial climate cycles demonstrate that ice sheets and sea level respond dramatically to millennial-timescale changes in climate forcing. There are also potential positive feedbacks in the carbon cycle, including methane hydrates in the ocean, and peat frozen in permafrost, that are most sensitive to the long tail of the fossil fuel CO2 in the atmosphere.

  2. Global Warming in Geologic Time

    ScienceCinema (OSTI)

    David Archer


    The notion is pervasive in the climate science community and in the public at large that the climate impacts of fossil fuel CO2 release will only persist for a few centuries. This conclusion has no basis in theory or models of the atmosphere / ocean carbon cycle, which we review here. The largest fraction of the CO2 recovery will take place on time scales of centuries, as CO2 invades the ocean, but a significant fraction of the fossil fuel CO2, ranging in published models in the literature from 20-60%, remains airborne for a thousand years or longer. Ultimate recovery takes place on time scales of hundreds of thousands of years, a geologic longevity typically associated in public perceptions with nuclear waste. The glacial / interglacial climate cycles demonstrate that ice sheets and sea level respond dramatically to millennial-timescale changes in climate forcing. There are also potential positive feedbacks in the carbon cycle, including methane hydrates in the ocean, and peat frozen in permafrost, that are most sensitive to the long tail of the fossil fuel CO2 in the atmosphere.


    DOE Patents [OSTI]

    Carr, B.J.; Peckham, V.D.


    A precision time-delay generator circuit with low jitter is described. The first thyratron has a series resonant circuit and a diode which is connected to the second thyratron. The first thyratron is triggered at the begin-ning of a time delay and a capacitor is discharged through the first thyratron and the diode, thereby, triggering the second thyratron. (T.R.H.) l6l9O The instrument described can measure pressures between sea level and 300,000 ft. The pressure- sensing transducer of the instrument is a small cylindrical tube with a thin foil of titanium-tritium fastened around the inside of the tube. Output is a digital signal which can be used for storage or telemetering more conveniently than an analog signal. (W.D.M.) l6l9l An experimental study was made on rolling contacts in the temperature range of 550 to 1000 deg F. Variables such as material composition, hardness, and operating conditions were investigated in a rolling test stand. Ball bearing tests were run to determine the effect of design parameters, bearing materials, lubricants, and operating conditions. (auth)

  4. Variable residence time vortex combustor

    DOE Patents [OSTI]

    Melconian, Jerry O.


    A variable residence time vortex combustor including a primary combustion chamber for containing a combustion vortex, and a plurality of louvres peripherally disposed about the primary combustion chamber and longitudinally distributed along its primary axis. The louvres are inclined to impel air about the primary combustion chamber to cool its interior surfaces and to impel air inwardly to assist in driving the combustion vortex in a first rotational direction and to feed combustion in the primary combustion chamber. The vortex combustor also includes a second combustion chamber having a secondary zone and a narrowed waist region in the primary combustion chamber interconnecting the output of the primary combustion chamber with the secondary zone for passing only lower density particles and trapping higher density particles in the combustion vortex in the primary combustion chamber for substantial combustion.

  5. March 2009 Y-12 Times

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 March 2009 P.O. Box 2009 Oak Ridge, TN 37831-8245 Managing Editors Amy Alley: Heidi Spurling: Layout/Design Lisa Harris Contributors Ellen Boatner Ken Davis Kathy Fahey Vicki Hinkel Jamie Loveday Mary Murray W H A T ' S I N S I D E W H A T ' S I N S I D E Page 2 Page 2 New UPF room is out of sight Page 3 Page 3 Training simulates terrorist attack, prepares fi rst responders Page 3 Page 3 Tanker cars on the right track

  6. Time domain electromagnetic metal detectors

    SciTech Connect (OSTI)

    Hoekstra, P.


    This presentation focuses on illustrating by case histories the range of applications and limitations of time domain electromagnetic (TDEM) systems for buried metal detection. Advantages claimed for TDEM metal detectors are: independent of instrument response (Geonics EM61) to surrounding soil and rock type; simple anomaly shape; mitigation of interference by ambient electromagnetic noise; and responsive to both ferrous and non-ferrous metallic targets. The data in all case histories to be presented were acquired with the Geonics EM61 TDEM system. Case histories are a test bed site on Molokai, Hawaii; Fort Monroe, Virginia; and USDOE, Rocky Flats Plant. The present limitations of this technology are: discrimination capabilities in terms of type of ordnance, and depth of burial is limited, and ability of resolving targets with small metallic ambient needs to be improved.

  7. Date centerdTimes New Roman

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Page 2 Details of Finding and reduced billing rates for time spent traveling. ... * A third contractor paid attorneys their full billing rates for time spent traveling. ...

  8. Space-Time Insight | Open Energy Information

    Open Energy Info (EERE)

    Space-Time Insight Jump to: navigation, search Name: Space-Time Insight Address: 45680 Northport Loop East Place: Fremont, California Zip: 94538 Region: Bay Area Sector: Efficiency...

  9. Time differentiated nuclear resonance spectroscopy coupled with...

    Office of Scientific and Technical Information (OSTI)

    Time differentiated nuclear resonance spectroscopy coupled with pulsed laser heating in diamond anvil cells Citation Details In-Document Search Title: Time differentiated nuclear ...

  10. Timing Carbon Ltd | Open Energy Information

    Open Energy Info (EERE)

    Timing Carbon Ltd Jump to: navigation, search Name: Timing Carbon Ltd Place: Beijing, Beijing Municipality, China Zip: 100022 Product: UK registered, China based CDM and voluntary...

  11. Alec R. Sandy | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Alec Sandy Alec R. Sandy Physicist, Time Resolved Research Group Leader Telephone 630-252-0281 E-mail asandy

  12. Multiple output timing and trigger generator

    SciTech Connect (OSTI)

    Wheat, Robert M.; Dale, Gregory E


    In support of the development of a multiple stage pulse modulator at the Los Alamos National Laboratory, we have developed a first generation, multiple output timing and trigger generator. Exploiting Commercial Off The Shelf (COTS) Micro Controller Units (MCU's), the timing and trigger generator provides 32 independent outputs with a timing resolution of about 500 ns. The timing and trigger generator system is comprised of two MCU boards and a single PC. One of the MCU boards performs the functions of the timing and signal generation (the timing controller) while the second MCU board accepts commands from the PC and provides the timing instructions to the timing controller. The PC provides the user interface for adjusting the on and off timing for each of the output signals. This system provides 32 output or timing signals which can be pre-programmed to be in an on or off state for each of 64 time steps. The width or duration of each of the 64 time steps is programmable from 2 {micro}s to 2.5 ms with a minimum time resolution of 500 ns. The repetition rate of the programmed pulse train is only limited by the time duration of the programmed event. This paper describes the design and function of the timing and trigger generator system and software including test results and measurements.

  13. Time-of-flight radio location system

    DOE Patents [OSTI]

    McEwan, T.E.


    A bi-static radar configuration measures the direct time-of-flight of a transmitted RF pulse and is capable of measuring this time-of-flight with a jitter on the order of about one pico-second, or about 0.01 inch of free space distance for an electromagnetic pulse over a range of about one to ten feet. A transmitter transmits a sequence of electromagnetic pulses in response to a transmit timing signal, and a receiver samples the sequence of electromagnetic pulses with controlled timing in response to a receive timing signal, and generates a sample signal in response to the samples. A timing circuit supplies the transmit timing signal to the transmitter and supplies the receive timing signal to the receiver. The receive timing signal causes the receiver to sample the sequence of electromagnetic pulses such that the time between transmission of pulses in the sequence and sampling by the receiver sweeps over a range of delays. The receive timing signal sweeps over the range of delays in a sweep cycle such that pulses in the sequence are sampled at the pulse repetition rate, and with different delays in the range of delays to produce a sample signal representing magnitude of a received pulse in equivalent time. Automatic gain control circuitry in the receiver controls the magnitude of the equivalent time sample signal. A signal processor analyzes the sample signal to indicate the time-of-flight of the electromagnetic pulses in the sequence. 7 figs.

  14. Time-of-flight radio location system

    DOE Patents [OSTI]

    McEwan, Thomas E.


    A bi-static radar configuration measures the direct time-of-flight of a transmitted RF pulse and is capable of measuring this time-of-flight with a jitter on the order of about one pico-second, or about 0.01 inch of free space distance for an electromagnetic pulse over a range of about one to ten feet. A transmitter transmits a sequence of electromagnetic pulses in response to a transmit timing signal, and a receiver samples the sequence of electromagnetic pulses with controlled timing in response to a receive timing signal, and generates a sample signal in response to the samples. A timing circuit supplies the transmit timing signal to the transmitter and supplies the receive timing signal to the receiver. The receive timing signal causes the receiver to sample the sequence of electromagnetic pulses such that the time between transmission of pulses in the sequence and sampling by the receiver sweeps over a range of delays. The receive timing signal sweeps over the range of delays in a sweep cycle such that pulses in the sequence are sampled at the pulse repetition rate, and with different delays in the range of delays to produce a sample signal representing magnitude of a received pulse in equivalent time. Automatic gain control circuitry in the receiver controls the magnitude of the equivalent time sample signal. A signal processor analyzes the sample signal to indicate the time-of-flight of the electromagnetic pulses in the sequence.

  15. Apply for Beam Time | Advanced Photon Source

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    All About Proposals Users Home Apply for Beam Time Deadlines Proposal Types Concepts, Definitions, and Help My APS Portal My APS Portal Apply for Beam Time Next Proposal Deadline...

  16. Graduate Program Time Limits and Work Schedules

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Time Limits and Work Schedules Graduate Program Time Limits and Work Schedules Point your career towards Los Alamos Lab: work with the best minds on the planet in an inclusive...

  17. Undergraduate Program Time Limits and Work Schedules

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Time Limits and Work Schedules Undergraduate Program Time Limits and Work Schedules Point your career towards Los Alamos Lab: work with the best minds on the planet in an inclusive...

  18. Time Structure of the LANSCE Beam

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Structure of the LANSCE Beam One of the greatest strengths of the LANSCE facility is that it can produce proton beams with a wide range of time structures. Time Structure of the LANSCE Beam One of the greatest strengths of the LANSCE facility is that it can produce proton beams with a wide range of time structures. The time structure of the LANSCE proton beam can be optimized for particular experiments within the constraints of the accelerator operating parameters. The linac accelerates beam

  19. Time-of-flight radio location system

    DOE Patents [OSTI]

    McEwan, Thomas E.


    A bi-static radar configuration measures the direct time-of-flight of a transmitted RF pulse and is capable of measuring this time-of-flight with a jitter on the order of about one pico-second, or about 0.01 inch of free space distance for an electromagnetic pulse over a range of about one to ten feet. A transmitter transmits a sequence of electromagnetic pulses in response to a transmit timing signal, and a receiver samples the sequence of electromagnetic pulses with controlled timing in response to a receive timing signal, and generates a sample signal in response to the samples. A timing circuit supplies the transmit timing signal to the transmitter and supplies the receive timing signal to the receiver. The receive timing signal causes the receiver to sample the sequence of electromagnetic pulses such that the time between transmission of pulses in the sequence and sampling by the receiver sweeps over a range of delays. The receive timing signal sweeps over the range of delays in a sweep cycle such that pulses in the sequence are sampled at the pulse repetition rate, and with different delays in the range of delays to produce a sample signal representing magnitude of a received pulse in equivalent time. Automatic gain control circuitry in the receiver controls the magnitude of the equivalent time sample signal. A signal processor analyzes the sample signal to indicate the time-of-flight of the electromagnetic pulses in the sequence. The sample signal in equivalent time is passed through an envelope detection circuit, formed of an absolute value circuit followed by a low pass filter, to convert the sample signal to a unipolar signal to eliminate effects of antenna misorientation.

  20. Time-of-flight radio location system

    DOE Patents [OSTI]

    McEwan, T.E.


    A bi-static radar configuration measures the direct time-of-flight of a transmitted RF pulse and is capable of measuring this time-of-flight with a jitter on the order of about one pico-second, or about 0.01 inch of free space distance for an electromagnetic pulse over a range of about one to ten feet. A transmitter transmits a sequence of electromagnetic pulses in response to a transmit timing signal, and a receiver samples the sequence of electromagnetic pulses with controlled timing in response to a receive timing signal, and generates a sample signal in response to the samples. A timing circuit supplies the transmit timing signal to the transmitter and supplies the receive timing signal to the receiver. The receive timing signal causes the receiver to sample the sequence of electromagnetic pulses such that the time between transmission of pulses in the sequence and sampling by the receiver sweeps over a range of delays. The receive timing signal sweeps over the range of delays in a sweep cycle such that pulses in the sequence are sampled at the pulse repetition rate, and with different delays in the range of delays to produce a sample signal representing magnitude of a received pulse in equivalent time. Automatic gain control circuitry in the receiver controls the magnitude of the equivalent time sample signal. A signal processor analyzes the sample signal to indicate the time-of-flight of the electromagnetic pulses in the sequence. The sample signal in equivalent time is passed through an envelope detection circuit, formed of an absolute value circuit followed by a low pass filter, to convert the sample signal to a unipolar signal to eliminate effects of antenna misorientation. 8 figs.

  1. Amplitude- and rise-time-compensated filters

    DOE Patents [OSTI]

    Nowlin, Charles H.


    An amplitude-compensated rise-time-compensated filter for a pulse time-of-occurrence (TOOC) measurement system is disclosed. The filter converts an input pulse, having the characteristics of random amplitudes and random, non-zero rise times, to a bipolar output pulse wherein the output pulse has a zero-crossing time that is independent of the rise time and amplitude of the input pulse. The filter differentiates the input pulse, along the linear leading edge of the input pulse, and subtracts therefrom a pulse fractionally proportional to the input pulse. The filter of the present invention can use discrete circuit components and avoids the use of delay lines.

  2. Statistical criteria for characterizing irradiance time series.

    SciTech Connect (OSTI)

    Stein, Joshua S.; Ellis, Abraham; Hansen, Clifford W.


    We propose and examine several statistical criteria for characterizing time series of solar irradiance. Time series of irradiance are used in analyses that seek to quantify the performance of photovoltaic (PV) power systems over time. Time series of irradiance are either measured or are simulated using models. Simulations of irradiance are often calibrated to or generated from statistics for observed irradiance and simulations are validated by comparing the simulation output to the observed irradiance. Criteria used in this comparison should derive from the context of the analyses in which the simulated irradiance is to be used. We examine three statistics that characterize time series and their use as criteria for comparing time series. We demonstrate these statistics using observed irradiance data recorded in August 2007 in Las Vegas, Nevada, and in June 2009 in Albuquerque, New Mexico.

  3. Reactor control rod timing system. [LMFBR

    DOE Patents [OSTI]

    Wu, P.T.K.


    A fluid driven jet-edge whistle timing system is described for control rods of a nuclear reactor for producing real-time detection of the timing of each control rod in its scram operation. An important parameter in reactor safety, particularly for liquid metal fast breeder reactors (LMFBR), is the time deviation between the time the control rod is released and the time the rod actually reaches the down position. The whistle has a nearly pure tone signal with center frequency (above 100 kHz) far above the frequency band in which the energy of the background noise is concentrated. Each control rod can be fitted with a whistle with a different frequency so that there is no ambiguity in differentiating the signal from each control rod.

  4. Time Reversal of Bose-Einstein Condensates

    SciTech Connect (OSTI)

    Martin, J.; Georgeot, B.; Shepelyansky, D. L. [Laboratoire de Physique Theorique, Universite de Toulouse III, CNRS, 31062 Toulouse (France)


    Using Gross-Pitaevskii equation, we study the time reversibility of Bose-Einstein condensates (BEC) in kicked optical lattices, showing that in the regime of quantum chaos, the dynamics can be inverted from explosion to collapse. The accuracy of time reversal decreases with the increase of atom interactions in BEC, until it is completely lost. Surprisingly, quantum chaos helps to restore time reversibility. These predictions can be tested with existing experimental setups.

  5. Undergraduate Program Time Limits and Work Schedules

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Time Limits and Work Schedules Undergraduate Program Time Limits and Work Schedules Point your career towards Los Alamos Lab: work with the best minds on the planet in an inclusive environment that is rich in intellectual vitality and opportunities for growth. Contact Student Programs (505) 665-0987 Email Time limits The length of participation in the undergraduate program is limited to a maximum of six years for students pursuing a bachelor's degree and three years for students pursuing an

  6. Circuit for measuring time differences among events

    DOE Patents [OSTI]

    Romrell, Delwin M.


    An electronic circuit has a plurality of input terminals. Application of a first input signal to any one of the terminals initiates a timing sequence. Later inputs to the same terminal are ignored but a later input to any other terminal of the plurality generates a signal which can be used to measure the time difference between the later input and the first input signal. Also, such time differences may be measured between the first input signal and an input signal to any other terminal of the plurality or the circuit may be reset at any time by an external reset signal.

  7. Development of Nonlinear SSI Time Domain Methodology

    Broader source: [DOE]

    Development of Nonlinear SSI Time Domain Methodology Justin Coleman, P.E. Nuclear Science and Technology Idaho National Laboratory October 22, 2014

  8. Light gas gun with reduced timing jitter

    DOE Patents [OSTI]

    Laabs, Gary W. (Los Alamos, NM); Funk, David J. (Los Alamos, NM); Asay, Blaine W. (Los Alamos, NM)


    Gas gun with reduced timing jitter. A gas gun having a prepressurized projectile held in place with a glass rod in compression is described. The glass rod is destroyed with an explosive at a precise time which allows a restraining pin to be moved and free the projectile.

  9. Light gas gun with reduced timing jitter

    DOE Patents [OSTI]

    Laabs, G.W.; Funk, D.J.; Asay, B.W.


    Gas gun with reduced timing jitter is disclosed. A gas gun having a prepressurized projectile held in place with a glass rod in compression is described. The glass rod is destroyed with an explosive at a precise time which allows a restraining pin to be moved and free the projectile. 4 figs.

  10. Count-doubling time safety circuit

    DOE Patents [OSTI]

    Rusch, Gordon K.; Keefe, Donald J.; McDowell, William P.


    There is provided a nuclear reactor count-factor-increase time monitoring circuit which includes a pulse-type neutron detector, and means for counting the number of detected pulses during specific time periods. Counts are compared and the comparison is utilized to develop a reactor scram signal, if necessary.

  11. Integrated method for chaotic time series analysis

    DOE Patents [OSTI]

    Hively, L.M.; Ng, E.G.


    Methods and apparatus for automatically detecting differences between similar but different states in a nonlinear process monitor nonlinear data are disclosed. Steps include: acquiring the data; digitizing the data; obtaining nonlinear measures of the data via chaotic time series analysis; obtaining time serial trends in the nonlinear measures; and determining by comparison whether differences between similar but different states are indicated. 8 figs.

  12. Integrated method for chaotic time series analysis

    DOE Patents [OSTI]

    Hively, Lee M.; Ng, Esmond G.


    Methods and apparatus for automatically detecting differences between similar but different states in a nonlinear process monitor nonlinear data. Steps include: acquiring the data; digitizing the data; obtaining nonlinear measures of the data via chaotic time series analysis; obtaining time serial trends in the nonlinear measures; and determining by comparison whether differences between similar but different states are indicated.

  13. Fractal analysis of time varying data

    DOE Patents [OSTI]

    Vo-Dinh, Tuan; Sadana, Ajit


    Characteristics of time varying data, such as an electrical signal, are analyzed by converting the data from a temporal domain into a spatial domain pattern. Fractal analysis is performed on the spatial domain pattern, thereby producing a fractal dimension D.sub.F. The fractal dimension indicates the regularity of the time varying data.

  14. Three component vibrational time reversal communication

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Anderson, Brian E.; Ulrich, Timothy J.; Ten Cate, James A.


    Time reversal provides an optimal prefilter matched signal to apply to a communication signal before signal transmission. Time reversal allows compensation for wave speed dispersion and can function well in reverberant environments. Time reversal can be used to focus elastic energy to each of the three components of motion independently. A pipe encased in concrete was used to demonstrate the ability to conduct communications of information using three component time reversal. Furthermore, the ability of time reversal to compensate for multi-path distortion (overcoming reverberation) will be demonstrated and the rate of signal communication will be presented. [The U.S. Department ofmore » Energy, through the LANL/LDRD Program, is gratefully acknowledged for supporting this work.]« less

  15. Time delay measurement in the frequency domain

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Durbin, Stephen M.; Liu, Shih -Chieh; Dufresne, Eric M.; Li, Yuelin; Wen, Haidan


    Pump–probe studies at synchrotrons using X-ray and laser pulses require accurate determination of the time delay between pulses. This becomes especially important when observing ultrafast responses with lifetimes approaching or even less than the X-ray pulse duration (~100 ps). The standard approach of inspecting the time response of a detector sensitive to both types of pulses can have limitations due to dissimilar pulse profiles and other experimental factors. Here, a simple alternative is presented, where the frequency response of the detector is monitored versus time delay. Measurements readily demonstrate a time resolution of ~1 ps. Improved precision is possible bymore » simply extending the data acquisition time.« less

  16. Time delay measurement in the frequency domain

    SciTech Connect (OSTI)

    Durbin, Stephen M.; Liu, Shih -Chieh; Dufresne, Eric M.; Li, Yuelin; Wen, Haidan


    Pump–probe studies at synchrotrons using X-ray and laser pulses require accurate determination of the time delay between pulses. This becomes especially important when observing ultrafast responses with lifetimes approaching or even less than the X-ray pulse duration (~100 ps). The standard approach of inspecting the time response of a detector sensitive to both types of pulses can have limitations due to dissimilar pulse profiles and other experimental factors. Here, a simple alternative is presented, where the frequency response of the detector is monitored versus time delay. Measurements readily demonstrate a time resolution of ~1 ps. Improved precision is possible by simply extending the data acquisition time.

  17. Code for Calculating Regional Seismic Travel Time

    Energy Science and Technology Software Center (OSTI)


    The RSTT software computes predictions of the travel time of seismic energy traveling from a source to a receiver through 2.5D models of the seismic velocity distribution within the Earth. The two primary applications for the RSTT library are tomographic inversion studies and seismic event location calculations. In tomographic inversions studies, a seismologist begins with number of source-receiver travel time observations and an initial starting model of the velocity distribution within the Earth. A forwardmore » travel time calculator, such as the RSTT library, is used to compute predictions of each observed travel time and all of the residuals (observed minus predicted travel time) are calculated. The Earth model is then modified in some systematic way with the goal of minimizing the residuals. The Earth model obtained in this way is assumed to be a better model than the starting model if it has lower residuals. The other major application for the RSTT library is seismic event location. Given an Earth model, an initial estimate of the location of a seismic event, and some number of observations of seismic travel time thought to have originated from that event, location codes systematically modify the estimate of the location of the event with the goal of minimizing the difference between the observed and predicted travel times. The second application, seismic event location, is routinely implemented by the military as part of its effort to monitor the Earth for nuclear tests conducted by foreign countries.« less

  18. Precision timing measurements for high energy photons

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Anderson, Dustin; Apreysan, Artur; Bornheim, Adi; Duarte, Javier; Newman, Harvey; Pena, Cristian; Ronzhin, Anatoly; Spiropulu, Maria; Trevor, Jason; Xie, Si; et al


    Particle colliders operating at high luminosities present challenging environments for high energy physics event reconstruction and analysis. We discuss how timing information, with a precision on the order of 10 ps, can aid in the reconstruction of physics events under such conditions. We present calorimeter based timing measurements from test beam experiments in which we explore the ultimate timing precision achievable for high energy photons or electrons of 10 GeV and above. Using a prototype calorimeter consisting of a cm3 lutetiumyttrium oxyortho-silicate (LYSO) crystal cube, read out by micro-channel plate photomultipliers, we demonstrate a time resolution of 33.52.1 psmorefor an incoming beam energy of 32 GeV. In a second measurement, using a 2.52.520 cm3 LYSO crystal placed perpendicularly to the electron beam, we achieve a time resolution of 5911 ps using a beam energy of 4 GeV. We also present timing measurements made using a shashlik-style calorimeter cell made of LYSO and tungsten plates, and demonstrate that the apparatus achieves a time resolution of 545 ps for an incoming beam energy of 32 GeV.less

  19. Time to Start Getting Ready for Cori

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Time to Start Getting Ready for Cori Time to Start Getting Ready for Cori February 4, 2015 by Richard Gerber Cori is coming and it's time to start getting ready. Yes, NERSC's Intel Xeon Phi-based system is still more than a year away, but if you're not already thinking about how you're going to use it, you need to get started. That's because to get your codes to run well (or maybe at all) on NERSC's first "many-core" system it is going to take more than a simple recompile. It's no

  20. Real time sensor for therapeutic radiation delivery

    DOE Patents [OSTI]

    Bliss, Mary; Craig, Richard A.; Reeder, Paul L.


    The invention is a real time sensor for therapeutic radiation. A probe is placed in or near the patient that senses in real time the dose at the location of the probe. The strength of the dose is determined by either an insertion or an exit probe. The location is determined by a series of vertical and horizontal sensing elements that gives the operator a real time read out dose location relative to placement of the patient. The increased accuracy prevents serious tissue damage to the patient by preventing overdose or delivery of a dose to a wrong location within the body.

  1. Real time sensor for therapeutic radiation delivery

    DOE Patents [OSTI]

    Bliss, M.; Craig, R.A.; Reeder, P.L.


    The invention is a real time sensor for therapeutic radiation. A probe is placed in or near the patient that senses in real time the dose at the location of the probe. The strength of the dose is determined by either an insertion or an exit probe. The location is determined by a series of vertical and horizontal sensing elements that gives the operator a real time read out dose location relative to placement of the patient. The increased accuracy prevents serious tissue damage to the patient by preventing overdose or delivery of a dose to a wrong location within the body. 14 figs.

  2. Graduate Program Time Limits and Work Schedules

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Time Limits and Work Schedules Graduate Program Time Limits and Work Schedules Point your career towards Los Alamos Lab: work with the best minds on the planet in an inclusive environment that is rich in intellectual vitality and opportunities for growth. Contact Student Programs (505) 665-0987 Email Time Limits The length of participation in the graduate program is limited as follows: With a bachelor's pursuing a master's degree: 4 years With a bachelor's pursuing a PhD: 7 years With a master's


    SciTech Connect (OSTI)

    Petrucci, R.; Schwartz, M.; Buccino, A. P.; Mauas, P. J. D.; Jofr, E.; Cneo, V.; Gmez, M.; Martnez, C.


    We present six new transits of the system WASP-4. Together with 28 light curves published in the literature, we perform a homogeneous study of its parameters and search for variations in the transits' central times. The final values agree with those previously reported, except for a slightly lower inclination. We find no significant long-term variations in i or R{sub P} /R {sub *}. The O-C mid-transit times do not show signs of transit timing variations greater than 54s.

  4. Topic 5: Time-Dependent Behavior

    SciTech Connect (OSTI)

    Pfeiffer, P.A. [Argonne National Lab., IL (United States); Tanabe, Tada-aki [Nagoya Univ. (Japan). Dept. of Civil Engineering


    This chapter is a report of the material presented at the International Workshop on Finite Element Analysis of Reinforced Concrete, Session 4 -- Time Dependent Behavior, held at Columbia University, New York on June 3--6, 1991. Dr. P.A. Pfeiffer presented recent developments in time-dependent behavior of concrete and Professor T. Tanabe presented a review of research in Japan on time-dependent behavior of concrete. The chapter discusses the recent research of time-dependent behavior of concrete in the past few years in both the USA-European and Japanese communities. The author appreciates the valuable information provided by Zdenek P. Bazant in preparing the USA-European Research section.

  5. Date centerdTimes New Roman

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Under the Recovery Act and the Department's ... Under a Department approved plan in place at the time of our ... the project officer will check for gas leaks and verify ...

  6. Time-Resolved Photoluminescence and Photovoltaics

    SciTech Connect (OSTI)

    Metzger, W. K.; Ahrenkiel, R. K.; Dippo, P.; Geisz, J.; Wanlass, M. W.; Kurtz, S.


    The time-resolved photoluminescence (TRPL) technique and its ability to characterize recombination in bulk photovoltaic semiconductor materials are reviewed. Results from a variety of materials and a few recent studies are summarized and compared.

  7. Timing control by redundant inhibitory neuronal circuits

    SciTech Connect (OSTI)

    Tristan, I. Rulkov, N. F.; Huerta, R.; Rabinovich, M.


    Rhythms and timing control of sequential activity in the brain is fundamental to cognition and behavior. Although experimental and theoretical studies support the understanding that neuronal circuits are intrinsically capable of generating different time intervals, the dynamical origin of the phenomenon of functionally dependent timing control is still unclear. Here, we consider a new mechanism that is related to the multi-neuronal cooperative dynamics in inhibitory brain motifs consisting of a few clusters. It is shown that redundancy and diversity of neurons within each cluster enhances the sensitivity of the timing control with the level of neuronal excitation of the whole network. The generality of the mechanism is shown to work on two different neuronal models: a conductance-based model and a map-based model.

  8. Date Time Event Description/Participants Location

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updated: 06112015 Date Time Event DescriptionParticipants Location Point of Contact 11 thru 12 All Day Meeting Todd Allen, deputy director of Science and Technology at INL, has...

  9. Minimum Day Time Load Calculation and Screening

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... It says that total harmonic distortion was not mentioned. Is it measured and is it ... small and the impact on, the impact on the grid is very minor so we spend less time on ...

  10. Real-time and imaginary-time quantum hierarchal Fokker-Planck equations

    Office of Scientific and Technical Information (OSTI)

    (Journal Article) | SciTech Connect Real-time and imaginary-time quantum hierarchal Fokker-Planck equations Citation Details In-Document Search Title: Real-time and imaginary-time quantum hierarchal Fokker-Planck equations We consider a quantum mechanical system represented in phase space (referred to hereafter as "Wigner space"), coupled to a harmonic oscillator bath. We derive quantum hierarchal Fokker-Planck (QHFP) equations not only in real time but also in imaginary time,


    SciTech Connect (OSTI)

    Eto, Joseph H.; Parashar, Manu; Lewis, Nancy Jo


    The Real Time System Operations (RTSO) 2006-2007 project focused on two parallel technical tasks: (1) Real-Time Applications of Phasors for Monitoring, Alarming and Control; and (2) Real-Time Voltage Security Assessment (RTVSA) Prototype Tool. The overall goal of the phasor applications project was to accelerate adoption and foster greater use of new, more accurate, time-synchronized phasor measurements by conducting research and prototyping applications on California ISO's phasor platform - Real-Time Dynamics Monitoring System (RTDMS) -- that provide previously unavailable information on the dynamic stability of the grid. Feasibility assessment studies were conducted on potential application of this technology for small-signal stability monitoring, validating/improving existing stability nomograms, conducting frequency response analysis, and obtaining real-time sensitivity information on key metrics to assess grid stress. Based on study findings, prototype applications for real-time visualization and alarming, small-signal stability monitoring, measurement based sensitivity analysis and frequency response assessment were developed, factory- and field-tested at the California ISO and at BPA. The goal of the RTVSA project was to provide California ISO with a prototype voltage security assessment tool that runs in real time within California ISO?s new reliability and congestion management system. CERTS conducted a technical assessment of appropriate algorithms, developed a prototype incorporating state-of-art algorithms (such as the continuation power flow, direct method, boundary orbiting method, and hyperplanes) into a framework most suitable for an operations environment. Based on study findings, a functional specification was prepared, which the California ISO has since used to procure a production-quality tool that is now a part of a suite of advanced computational tools that is used by California ISO for reliability and congestion management.

  12. Enabling time travel for the scholarly web

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Enabling time travel for the scholarly web Enabling time travel for the scholarly web An international team of information scientists has begun a study to investigate how web links in scientific and other academic articles fail to lead to the resources being referenced. July 16, 2013 Herbert Van de Sompel, a Los Alamos National Laboratory information scientist, describes the information pathway involved in preventing "reference rot" in scientific material linked to the web. Herbert Van

  13. Component Repair Times Obtained from MSPI Data

    SciTech Connect (OSTI)

    Eide, Steven A.


    Information concerning times to repair or restore equipment to service given a failure is valuable to probabilistic risk assessments (PRAs). Examples of such uses in modern PRAs include estimation of the probability of failing to restore a failed component within a specified time period (typically tied to recovering a mitigating system before core damage occurs at nuclear power plants) and the determination of mission times for support system initiating event (SSIE) fault tree models. Information on equipment repair or restoration times applicable to PRA modeling is limited and dated for U.S. commercial nuclear power plants. However, the Mitigating Systems Performance Index (MSPI) program covering all U.S. commercial nuclear power plants provides up-to-date information on restoration times for a limited set of component types. This paper describes the MSPI program data available and analyzes the data to obtain median and mean component restoration times as well as non-restoration cumulative probability curves. The MSPI program provides guidance for monitoring both planned and unplanned outages of trains of selected mitigating systems deemed important to safety. For systems included within the MSPI program, plants monitor both train UA and component unreliability (UR) against baseline values. If the combined system UA and UR increases sufficiently above established baseline results (converted to an estimated change in core damage frequency or CDF), a “white” (or worse) indicator is generated for that system. That in turn results in increased oversight by the US Nuclear Regulatory Commission (NRC) and can impact a plant’s insurance rating. Therefore, there is pressure to return MSPI program components to service as soon as possible after a failure occurs. Three sets of unplanned outages might be used to determine the component repair durations desired in this article: all unplanned outages for the train type that includes the component of interest, only unplanned outages associated with failures of the component of interest, and only unplanned outages associated with PRA failures of the component of interest. The paper will describe how component repair times can be generated from each set and which approach is most applicable. Repair time information will be summarized for MSPI pumps and diesel generators using data over 2003 – 2007. Also, trend information over 2003 – 2012 will be presented to indicate whether the 2003 – 2007 repair time information is still considered applicable. For certain types of pumps, mean repair times are significantly higher than the typically assumed 24 h duration.

  14. Solar Real-Time Pricing: Is Real-Time Electricity Pricing Beneficial...

    Broader source: (indexed) [DOE]

    PDF icon Solar Real-Time Pricing: Is Real-Time Electriciy Pricing Beneficial to Solar PV in New York City? More Documents & Publications FERC Presendation: Demand Response as Power ...

  15. Use of a large time-compensated scintillation detector in neutron time-of-flight measurements

    DOE Patents [OSTI]

    Goodman, Charles D.


    A scintillator for neutron time-of-flight measurements is positioned at a desired angle with respect to the neutron beam, and as a function of the energy thereof, such that the sum of the transit times of the neutrons and photons in the scintillator are substantially independent of the points of scintillations within the scintillator. Extrapolated zero timing is employed rather than the usual constant fraction timing. As a result, a substantially larger scintillator can be employed that substantially increases the data rate and shortens the experiment time.

  16. Time reversal signal processing for communication.

    SciTech Connect (OSTI)

    Young, Derek P.; Jacklin, Neil; Punnoose, Ratish J.; Counsil, David T.


    Time-reversal is a wave focusing technique that makes use of the reciprocity of wireless propagation channels. It works particularly well in a cluttered environment with associated multipath reflection. This technique uses the multipath in the environment to increase focusing ability. Time-reversal can also be used to null signals, either to reduce unintentional interference or to prevent eavesdropping. It does not require controlled geometric placement of the transmit antennas. Unlike existing techniques it can work without line-of-sight. We have explored the performance of time-reversal focusing in a variety of simulated environments. We have also developed new algorithms to simultaneously focus at a location while nulling at an eavesdropper location. We have experimentally verified these techniques in a realistic cluttered environment.

  17. Time-temperature equivalence in Martensite tempering

    SciTech Connect (OSTI)

    Hackenberg, Robert E.; Thomas, Grant A.; Speer, John G.; Matlock, David K.; Krauss, George


    The relationship between time and temperature is of great consequence in many materials-related processes including the tempering of martensite. In 1945, Hollomon and Jaffe quantified the 'degree of tempering' as a function of both tempering time, t, and tempering temperature, T, using the expression, T(log t + c). Here, c is thought to be a material constant and appears to decrease linearly with increasing carbon content. The Hollomon-Jaffe tempering parameter is frequently cited in the literature. This work reviews the original derivation of the tempering parameter concept, and presents the use of the characteristics diffusion distance as an alternative time-temperature relationship during martensite tempering. During the tempering of martensite, interstitial carbon atoms diffuse to form carbides. In addition, austenite decomposes, dislocations and grain boundaries rearrange, associated with iron self diffusion. Since these are all diffusional processes, it is reasonable to expect the degree of tempering to relate to the extent of diffusion.

  18. Real time gamma-ray signature identifier

    DOE Patents [OSTI]

    Rowland, Mark; Gosnell, Tom B.; Ham, Cheryl; Perkins, Dwight; Wong, James


    A real time gamma-ray signature/source identification method and system using principal components analysis (PCA) for transforming and substantially reducing one or more comprehensive spectral libraries of nuclear materials types and configurations into a corresponding concise representation/signature(s) representing and indexing each individual predetermined spectrum in principal component (PC) space, wherein an unknown gamma-ray signature may be compared against the representative signature to find a match or at least characterize the unknown signature from among all the entries in the library with a single regression or simple projection into the PC space, so as to substantially reduce processing time and computing resources and enable real-time characterization and/or identification.

  19. Continuous, real time microwave plasma element sensor

    DOE Patents [OSTI]

    Woskov, P.P.; Smatlak, D.L.; Cohn, D.R.; Wittle, J.K.; Titus, C.H.; Surma, J.E.


    Microwave-induced plasma is described for continuous, real time trace element monitoring under harsh and variable conditions. The sensor includes a source of high power microwave energy and a shorted waveguide made of a microwave conductive, refractory material communicating with the source of the microwave energy to generate a plasma. The high power waveguide is constructed to be robust in a hot, hostile environment. It includes an aperture for the passage of gases to be analyzed and a spectrometer is connected to receive light from the plasma. Provision is made for real time in situ calibration. The spectrometer disperses the light, which is then analyzed by a computer. The sensor is capable of making continuous, real time quantitative measurements of desired elements, such as the heavy metals lead and mercury. 3 figs.

  20. Continuous, real time microwave plasma element sensor

    DOE Patents [OSTI]

    Woskov, Paul P.; Smatlak, Donna L.; Cohn, Daniel R.; Wittle, J. Kenneth; Titus, Charles H.; Surma, Jeffrey E.


    Microwave-induced plasma for continuous, real time trace element monitoring under harsh and variable conditions. The sensor includes a source of high power microwave energy and a shorted waveguide made of a microwave conductive, refractory material communicating with the source of the microwave energy to generate a plasma. The high power waveguide is constructed to be robust in a hot, hostile environment. It includes an aperture for the passage of gases to be analyzed and a spectrometer is connected to receive light from the plasma. Provision is made for real time in situ calibration. The spectrometer disperses the light, which is then analyzed by a computer. The sensor is capable of making continuous, real time quantitative measurements of desired elements, such as the heavy metals lead and mercury.

  1. Dead-time Corrected Disdrometer Data

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Bartholomew, Mary Jane


    Original and dead-time corrected disdrometer results for observations made at SGP and TWP. The correction is based on the technique discussed in Sheppard and Joe, 1994. In addition, these files contain calculated radar reflectivity factor, mean Doppler velocity and attenuation for every measurement for both the original and dead-time corrected data at the following wavelengths: 0.316, 0.856, 3.2, 5, and 10cm (W,K,X,C,S bands). Pavlos Kollias provided the code to do these calculations.

  2. Statistical analysis of random duration times

    SciTech Connect (OSTI)

    Engelhardt, M.E.


    This report presents basic statistical methods for analyzing data obtained by observing random time durations. It gives nonparametric estimates of the cumulative distribution function, reliability function and cumulative hazard function. These results can be applied with either complete or censored data. Several models which are commonly used with time data are discussed, and methods for model checking and goodness-of-fit tests are discussed. Maximum likelihood estimates and confidence limits are given for the various models considered. Some results for situations where repeated durations such as repairable systems are also discussed.

  3. Investigations of Low Temperature Time Dependent Cracking

    SciTech Connect (OSTI)

    Van der Sluys, W A; Robitz, E S; Young, B A; Bloom, J


    The objective of this project was to investigate metallurgical and mechanical phenomena associated with time dependent cracking of cold bent carbon steel piping at temperatures between 327 C and 360 C. Boiler piping failures have demonstrated that understanding the fundamental metallurgical and mechanical parameters controlling these failures is insufficient to eliminate it from the field. The results of the project consisted of the development of a testing methodology to reproduce low temperature time dependent cracking in laboratory specimens. This methodology was used to evaluate the cracking resistance of candidate heats in order to identify the factors that enhance cracking sensitivity. The resultant data was integrated into current available life prediction tools.

  4. Short rise time intense electron beam generator

    DOE Patents [OSTI]

    Olson, Craig L.


    A generator for producing an intense relativistic electron beam having a subnanosecond current rise time includes a conventional generator of intense relativistic electrons feeding into a short electrically conductive drift tube including a cavity containing a working gas at a low enough pressure to prevent the input beam from significantly ionizing the working gas. Ionizing means such as a laser simultaneously ionize the entire volume of working gas in the cavity to generate an output beam having a rise time less than one nanosecond.

  5. Short rise time intense electron beam generator

    DOE Patents [OSTI]

    Olson, C.L.


    A generator for producing an intense relativisitc electron beam having a subnanosecond current rise time includes a conventional generator of intense relativistic electrons feeding into a short electrically conductive drift tube including a cavity containing a working gas at a low enough pressure to prevent the input beam from significantly ionizing the working gas. Ionizing means such as a laser simultaneously ionize the entire volume of working gas in the cavity to generate an output beam having a rise time less than one nanosecond.

  6. Construction of Discrete Time Shadow Price

    SciTech Connect (OSTI)

    Rogala, Tomasz Stettner, Lukasz


    In the paper expected utility from consumption over finite time horizon for discrete time markets with bid and ask prices and strictly concave utility function is considered. The notion of weak shadow price, i.e. an illiquid price, depending on the portfolio, under which the model without bid and ask price is equivalent to the model with bid and ask price is introduced. Existence and the form of weak shadow price is shown. Using weak shadow price usual (called in the paper strong) shadow price is then constructed.

  7. Real-Time Occupancy Change Analyzer

    Energy Science and Technology Software Center (OSTI)


    The Real-Time Occupancy Change Analyzer (ROCA) produces an occupancy grid map of an environment around the robot, scans the environment to generate a current obstacle map relative to a current robot position, and converts the current obstacle map to a current occupancy grid map. Changes in the occupancy grid can be reported in real time to support a number of tracking capabilities. The benefit of ROCA is that rather than only providing a vector tomore » the detected change, it provides the actual x,y position of the change.« less

  8. Real Time Grid Reliability Management 2005

    SciTech Connect (OSTI)

    Eto, Joe; Eto, Joe; Lesieutre, Bernard; Lewis, Nancy Jo; Parashar, Manu


    The increased need to manage California?s electricity grid in real time is a result of the ongoing transition from a system operated by vertically-integrated utilities serving native loads to one operated by an independent system operator supporting competitive energy markets. During this transition period, the traditional approach to reliability management -- construction of new transmission lines -- has not been pursued due to unresolved issues related to the financing and recovery of transmission project costs. In the absence of investments in new transmission infrastructure, the best strategy for managing reliability is to equip system operators with better real-time information about actual operating margins so that they can better understand and manage the risk of operating closer to the edge. A companion strategy is to address known deficiencies in offline modeling tools that are needed to ground the use of improved real-time tools. This project: (1) developed and conducted first-ever demonstrations of two prototype real-time software tools for voltage security assessment and phasor monitoring; and (2) prepared a scoping study on improving load and generator response models. Additional funding through two separate subsequent work authorizations has already been provided to build upon the work initiated in this project.

  9. Real-time distributed multimedia systems

    SciTech Connect (OSTI)

    Rahurkar, S.S.; Bourbakis, N.G.


    This paper presents a survey on distributed multimedia systems and discusses real-time issues. In particular, different subsystems are reviewed that impact on multimedia networking, the networking for multimedia, the networked multimedia systems, and the leading edge research and developments efforts and issues in networking.

  10. Light gas gun with reduced timing jitter

    SciTech Connect (OSTI)

    Laabs, Gary W.; Funk, David J.; Asay, Blaine W.


    A gas gun having a prepressurized projectile held in place with a glass rod in compression is described. The glass rod is destroyed with an explosive at a precise time which allows a restraining pin to be moved by pneumatic means and free the projectile.

  11. Time-stretch microscopy based on time-wavelength sequence reconstruction from wideband incoherent source

    SciTech Connect (OSTI)

    Zhang, Chi Xu, Yiqing; Wei, Xiaoming; Tsia, Kevin K.; Wong, Kenneth K. Y.


    Time-stretch microscopy has emerged as an ultrafast optical imaging concept offering the unprecedented combination of the imaging speed and sensitivity. However, dedicated wideband and coherence optical pulse source with high shot-to-shot stability has been mandated for time-wavelength mappingthe enabling process for ultrahigh speed wavelength-encoded image retrieval. From the practical point of view, exploiting methods to relax the stringent requirements (e.g., temporal stability and coherence) for the source of time-stretch microscopy is thus of great value. In this paper, we demonstrated time-stretch microscopy by reconstructing the time-wavelength mapping sequence from a wideband incoherent source. Utilizing the time-lens focusing mechanism mediated by a narrow-band pulse source, this approach allows generation of a wideband incoherent source, with the spectral efficiency enhanced by a factor of 18. As a proof-of-principle demonstration, time-stretch imaging with the scan rate as high as MHz and diffraction-limited resolution is achieved based on the wideband incoherent source. We note that the concept of time-wavelength sequence reconstruction from wideband incoherent source can also be generalized to any high-speed optical real-time measurements, where wavelength is acted as the information carrier.

  12. LHC RF System Time-Domain Simulation

    SciTech Connect (OSTI)

    Mastorides, T.; Rivetta, C.


    Non-linear time-domain simulations have been developed for the Positron-Electron Project (PEP-II) and the Large Hadron Collider (LHC). These simulations capture the dynamic behavior of the RF station-beam interaction and are structured to reproduce the technical characteristics of the system (noise contributions, non-linear elements, and more). As such, they provide useful results and insight for the development and design of future LLRF feedback systems. They are also a valuable tool for the study of diverse longitudinal beam dynamics effects such as coupled-bunch impedance driven instabilities and single bunch longitudinal emittance growth. Results from these studies and related measurements from PEP-II and LHC have been presented in multiple places. This report presents an example of the time-domain simulation implementation for the LHC.

  13. Timing discriminator using leading-edge extrapolation

    DOE Patents [OSTI]

    Gottschalk, Bernard


    A discriminator circuit to recover timing information from slow-rising pulses by means of an output trailing edge, a fixed time after the starting corner of the input pulse, which is nearly independent of risetime and threshold setting. This apparatus comprises means for comparing pulses with a threshold voltage; a capacitor to be charged at a certain rate when the input signal is one-third threshold voltage, and at a lower rate when the input signal is two-thirds threshold voltage; current-generating means for charging the capacitor; means for comparing voltage capacitor with a bias voltage; a flip-flop to be set when the input pulse reaches threshold voltage and reset when capacitor voltage reaches the bias voltage; and a clamping means for discharging the capacitor when the input signal returns below one-third threshold voltage.

  14. Method and apparatus for measuring response time

    DOE Patents [OSTI]

    Johanson, Edward W.; August, Charles


    A method of measuring the response time of an electrical instrument which generates an output signal in response to the application of a specified input, wherein the output signal varies as a function of time and when subjected to a step input approaches a steady-state value, comprises the steps of: (a) applying a step input of predetermined value to the electrical instrument to generate an output signal; (b) simultaneously starting a timer; (c) comparing the output signal to a reference signal to generate a stop signal when the output signal is substantially equal to the reference signal, the reference signal being a specified percentage of the steady-state value of the output signal corresponding to the predetermined value of the step input; and (d) applying the stop signal when generated to stop the timer.

  15. Method and apparatus for measuring response time

    DOE Patents [OSTI]

    Johanson, E.W.; August, C.


    A method of measuring the response time of an electrical instrument which generates an output signal in response to the application of a specified input, wherein the output signal varies as a function of time and when subjected to a step input approaches a steady-state value, comprises the steps of: (a) applying a step input of predetermined value to the electrical instrument to generate an output signal; (b) simultaneously starting a timer; (c) comparing the output signal to a reference signal to generate a stop signal when the output signal is substantially equal to the reference signal, the reference signal being a specified percentage of the steady-state value of the output signal corresponding to the predetermined value of the step input; and (d) applying the stop signal when generated to stop the timer.

  16. Timing discriminator using leading-edge extrapolation

    DOE Patents [OSTI]

    Gottschalk, B.


    A discriminator circuit to recover timing information from slow-rising pulses by means of an output trailing edge, a fixed time after the starting corner of the input pulse, which is nearly independent of risetime and threshold setting is described. This apparatus comprises means for comparing pulses with a threshold voltage; a capacitor to be charged at a certain rate when the input signal is one-third threshold voltage, and at a lower rate when the input signal is two-thirds threshold voltage; current-generating means for charging the capacitor; means for comparing voltage capacitor with a bias voltage; a flip-flop to be set when the input pulse reaches threshold voltage and reset when capacitor voltage reaches the bias voltage; and a clamping means for discharging the capacitor when the input signal returns below one-third threshold voltage.

  17. Time varying arctic climate change amplification

    SciTech Connect (OSTI)

    Chylek, Petr [Los Alamos National Laboratory; Dubey, Manvendra K [Los Alamos National Laboratory; Lesins, Glen [DALLHOUSIE U; Wang, Muyin [NOAA/JISAO


    During the past 130 years the global mean surface air temperature has risen by about 0.75 K. Due to feedbacks -- including the snow/ice albedo feedback -- the warming in the Arctic is expected to proceed at a faster rate than the global average. Climate model simulations suggest that this Arctic amplification produces warming that is two to three times larger than the global mean. Understanding the Arctic amplification is essential for projections of future Arctic climate including sea ice extent and melting of the Greenland ice sheet. We use the temperature records from the Arctic stations to show that (a) the Arctic amplification is larger at latitudes above 700 N compared to those within 64-70oN belt, and that, surprisingly; (b) the ratio of the Arctic to global rate of temperature change is not constant but varies on the decadal timescale. This time dependence will affect future projections of climate changes in the Arctic.

  18. Visualizations for Real-time Pricing Demonstration

    SciTech Connect (OSTI)

    Marinovici, Maria C.; Hammerstrom, Janelle L.; Widergren, Steven E.; Dayley, Greg K.


    In this paper, the visualization tools created for monitoring the operations of a real-time pricing demonstration system that runs at a distribution feeder level are presented. The information these tools provide gives insights into demand behavior from automated price responsive devices, distribution feeder characteristics, impact of weather on system’s development, and other significant dynamics. Given the large number of devices that bid into a feeder-level real-time electricity market, new techniques are explored to summarize the present state of the system and contrast that with previous trends as well as future projections. To better understand the system behavior and correctly inform decision-making procedures, effective visualization of the data is imperative.

  19. In-Situ, Real Time Measurement of Elemental Constituents | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    In-Situ, Real Time Measurement of Elemental Constituents In-Situ, Real Time Measurement of Elemental Constituents New Laser System Provides Real-Time Measurements for Improved ...

  20. How many times can LANL reuse water?

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    How it Works How it Works How Does Hydroelectricity Work? Types of Hydropower Facilities Impoundment Hydropower: Uses a dam to store water. Water may be released either to meet changing electricity needs or to maintain a constant reservoir level. Diversion Hydropower: Channels a portion of the river through a canal or a penstock but may require a dam. Pumped Storage: Pumps water from a lower reservoir to an upper reservoir at times when demand for electricity is low. During periods of high

  1. Time Variant Floating Mean Counting Algorithm

    Energy Science and Technology Software Center (OSTI)


    This software was written to test a time variant floating mean counting algorithm. The algorithm was developed by Westinghouse Savannah River Company and a provisional patent has been filed on the algorithm. The test software was developed to work with the Val Tech model IVB prototype version II count rate meter hardware. The test software was used to verify the algorithm developed by WSRC could be correctly implemented with the vendor''s hardware.

  2. Multiplexer and time duration measuring circuit

    DOE Patents [OSTI]

    Gray, Jr., James


    A multiplexer device is provided for multiplexing data in the form of randomly developed, variable width pulses from a plurality of pulse sources to a master storage. The device includes a first multiplexer unit which includes a plurality of input circuits each coupled to one of the pulse sources, with all input circuits being disabled when one input circuit receives an input pulse so that only one input pulse is multiplexed by the multiplexer unit at any one time.

  3. Rugged calorimeter with a fast rise time

    SciTech Connect (OSTI)

    McMurtry, W.M.; Dolce, S.R.


    An intrinsic 1-mil-thick gold foil calorimeter has been developed which rises to 95% of the energy deposited in less than 2 microseconds. This calorimeter is very rugged, and can withstand rough handling without damage. The time constant is long, in the millisecond range, because of its unique construction. Use of this calorimeter has produced 100% data recovery, and agreement with true deposition to less than 10%.

  4. Minimum Day Time Load Calculation and Screening

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Minimum Day Time Load Calculation and Screening" Dora Nakafuji and Anthony Hong, Hawaiian Electric Co. Babak Enayati, DG Techincal Standards Review Group April 30, 2014 2 Speakers Babak Enayati Chair of Massachusetts DG Technical Standards Review Group Dora Nakafuji Director of Renewable Energy Planning Hawaiian Electric Company (HECO) Kristen Ardani Solar Analyst, (today's moderator) NREL Anthony Hong Director of Distribution Planning Hawaiian Electric Company (HECO) Standardization of

  5. Strategic Public Involvement … Tool Time!

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Liz Mattson, Hanford Challenge Engage the public early and often. Educate the public by providing timely, accurate, and understandable information. Incorporate public values in the decision making process and in the decisions made. Prepare future generations for informed engagement and participation. Ice Cream Socials Build a sense of community around Hanford (locally, regionally, and beyond). Ice Cream Socials  Organize Event: › Located in a place people are already gathering › Provide

  6. Time Dispersive Spectrometer Using Digital Switching Means

    DOE Patents [OSTI]

    Tarver, III, Edward E.; Siems, William F.


    Methods and apparatus are described for time dispersive spectroscopy. In particular, a modulated flow of ionized molecules of a sample are introduced into a drift region of an ion spectrometer. The ions are subsequently detected by an ion detector to produce an ion detection signal. The ion detection signal can be modulated to obtain a signal useful in assaying the chemical constituents of the sample.

  7. Method and apparatus for time dispersive spectroscopy

    DOE Patents [OSTI]

    Tarver, III, Edward E.; Siems, William F.


    Methods and apparatus are described for time dispersive spectroscopy. In particular, a modulated flow of ionized molecules of a sample are introduced into a drift region of an ion spectrometer. The ions are subsequently detected by an ion detector to produce an ion detection signal. The ion detection signal can be modulated to obtain a signal useful in assaying the chemical constituents of the sample.

  8. Late-time cosmological phase transitions

    SciTech Connect (OSTI)

    Schramm, D.N. Fermi National Accelerator Lab., Batavia, IL )


    It is shown that the potential galaxy formation and large-scale structure problems of objects existing at high redshifts (Z {approx gt} 5), structures existing on scales of 100M pc as well as velocity flows on such scales, and minimal microwave anisotropies ({Delta}T/T) {approx lt} 10{sup {minus}5} can be solved if the seeds needed to generate structure form in a vacuum phase transition after decoupling. It is argued that the basic physics of such a phase transition is no more exotic than that utilized in the more traditional GUT scale phase transitions, and that, just as in the GUT case, significant random gaussian fluctuations and/or topological defects can form. Scale lengths of {approximately}100M pc for large-scale structure as well as {approximately}1 M pc for galaxy formation occur naturally. Possible support for new physics that might be associated with such a late-time transition comes from the preliminary results of the SAGE solar neutrino experiment, implying neutrino flavor mixing with values similar to those required for a late-time transition. It is also noted that a see-saw model for the neutrino masses might also imply a tau neutrino mass that is an ideal hot dark matter candidate. However, in general either hot or cold dark matter can be consistent with a late-time transition. 47 refs., 2 figs.

  9. Real Time Simulation of Power Grid Disruptions

    SciTech Connect (OSTI)

    Chinthavali, Supriya; Dimitrovski, Aleksandar D; Fernandez, Steven J; Groer, Christopher S; Nutaro, James J; Olama, Mohammed M; Omitaomu, Olufemi A; Shankar, Mallikarjun; Spafford, Kyle L; Vacaliuc, Bogdan


    DOE-OE and DOE-SC workshops (Reference 1-3) identified the key power grid problem that requires insight addressable by the next generation of exascale computing is coupling of real-time data streams (1-2 TB per hour) as the streams are ingested to dynamic models. These models would then identify predicted disruptions in time (2-4 seconds) to trigger the smart grid s self healing functions. This project attempted to establish the feasibility of this approach and defined the scientific issues, and demonstrated example solutions to important smart grid simulation problems. These objectives were accomplished by 1) using the existing frequency recorders on the national grid to establish a representative and scalable real-time data stream; 2) invoking ORNL signature identification algorithms; 3) modeling dynamically a representative region of the Eastern interconnect using an institutional cluster, measuring the scalability and computational benchmarks for a national capability; and 4) constructing a prototype simulation for the system s concept of smart grid deployment. The delivered ORNL enduring capability included: 1) data processing and simulation metrics to design a national capability justifying exascale applications; 2) Software and intellectual property built around the example solutions; 3) demonstrated dynamic models to design few second self-healing.


    SciTech Connect (OSTI)

    Lee, Eve J.; Chang, Philip; Murray, Norman


    We present numerical evidence of dynamic star formation in which the accreted stellar mass grows superlinearly with time, roughly as t {sup 2}. We perform simulations of star formation in self-gravitating hydrodynamic and magnetohydrodynamic turbulence that is continuously driven. By turning the self-gravity of the gas in the simulations on or off, we demonstrate that self-gravity is the dominant physical effect setting the mass accretion rate at early times before feedback effects take over, contrary to theories of turbulence-regulated star formation. We find that gravitational collapse steepens the density profile around stars, generating the power-law tail on what is otherwise a lognormal density probability distribution function. Furthermore, we find turbulent velocity profiles to flatten inside collapsing regions, altering the size-line width relation. This local flattening reflects enhancements of turbulent velocity on small scales, as verified by changes to the velocity power spectra. Our results indicate that gas self-gravity dynamically alters both density and velocity structures in clouds, giving rise to a time-varying star formation rate. We find that a substantial fraction of the gas that forms stars arrives via low-density flows, as opposed to accreting through high-density filaments.


    SciTech Connect (OSTI)

    Welsch, B. T.; Kusano, K.; Yamamoto, T. T.; Muglach, K.


    We use autocorrelation to investigate evolution in flow fields inferred by applying Fourier local correlation tracking (FLCT) to a sequence of high-resolution (0.''3), high-cadence ({approx_equal} 2 minute) line-of-sight magnetograms of NOAA active region (AR) 10930 recorded by the narrowband filter imager of the Solar Optical Telescope aboard the Hinode satellite over 2006 December 12 and 13. To baseline the timescales of flow evolution, we also autocorrelated the magnetograms, at several spatial binnings, to characterize the lifetimes of active region magnetic structures versus spatial scale. Autocorrelation of flow maps can be used to optimize tracking parameters, to understand tracking algorithms' susceptibility to noise, and to estimate flow lifetimes. Tracking parameters varied include: time interval {Delta}t between magnetogram pairs tracked, spatial binning applied to the magnetograms, and windowing parameter {sigma} used in FLCT. Flow structures vary over a range of spatial and temporal scales (including unresolved scales), so tracked flows represent a local average of the flow over a particular range of space and time. We define flow lifetime to be the flow decorrelation time, {tau}. For {Delta}t > {tau}, tracking results represent the average velocity over one or more flow lifetimes. We analyze lifetimes of flow components, divergences, and curls as functions of magnetic field strength and spatial scale. We find a significant trend of increasing lifetimes of flow components, divergences, and curls with field strength, consistent with Lorentz forces partially governing flows in the active photosphere, as well as strong trends of increasing flow lifetime and decreasing magnitudes with increases in both spatial scale and {Delta}t.

  12. Controlled short residence time coal liquefaction process

    DOE Patents [OSTI]

    Anderson, Raymond P.; Schmalzer, David K.; Wright, Charles H.


    Normally solid dissolved coal product and a distillate liquid product are produced by continuously passing a feed slurry comprising raw feed coal and a recycle solvent oil and/or slurry together with hydrogen to a preheating-reaction zone (26, alone, or 26 together with 42), the hydrogen pressure in the preheating-reaction zone being at least 1500 psig (105 kg/cm.sup.2), reacting the slurry in the preheating-reaction zone (26, or 26 with 42) at a temperature in the range of between about and about C. to dissolve the coal to form normally liquid coal and normally solid dissolved coal. A total slurry residence time is maintained in the reaction zone ranging from a finite value from about 0 to about 0.2 hour, and reaction effluent is continuously and directly contacted with a quenching fluid (40, 68) to substantially immediately reduce the temperature of the reaction effluent to below C. to substantially inhibit polymerization so that the yield of insoluble organic matter comprises less than 9 weight percent of said feed coal on a moisture-free basis. The reaction is performed under conditions of temperature, hydrogen pressure and residence time such that the quantity of distillate liquid boiling within the range C.sub.5 C. is an amount at least equal to that obtainable by performing the process under the same conditions except for a longer total slurry residence time, e.g., 0.3 hour. Solvent boiling range liquid is separated from the reaction effluent and recycled as process solvent.

  13. Time varying, multivariate volume data reduction

    SciTech Connect (OSTI)

    Ahrens, James P; Fout, Nathaniel; Ma, Kwan - Liu


    Large-scale supercomputing is revolutionizing the way science is conducted. A growing challenge, however, is understanding the massive quantities of data produced by large-scale simulations. The data, typically time-varying, multivariate, and volumetric, can occupy from hundreds of gigabytes to several terabytes of storage space. Transferring and processing volume data of such sizes is prohibitively expensive and resource intensive. Although it may not be possible to entirely alleviate these problems, data compression should be considered as part of a viable solution, especially when the primary means of data analysis is volume rendering. In this paper we present our study of multivariate compression, which exploits correlations among related variables, for volume rendering. Two configurations for multidimensional compression based on vector quantization are examined. We emphasize quality reconstruction and interactive rendering, which leads us to a solution using graphics hardware to perform on-the-fly decompression during rendering. In this paper we present a solution which addresses the need for data reduction in large supercomputing environments where data resulting from simulations occupies tremendous amounts of storage. Our solution employs a lossy encoding scheme to acrueve data reduction with several options in terms of rate-distortion behavior. We focus on encoding of multiple variables together, with optional compression in space and time. The compressed volumes can be rendered directly with commodity graphics cards at interactive frame rates and rendering quality similar to that of static volume renderers. Compression results using a multivariate time-varying data set indicate that encoding multiple variables results in acceptable performance in the case of spatial and temporal encoding as compared to independent compression of variables. The relative performance of spatial vs. temporal compression is data dependent, although temporal compression has the advantage of offering smooth animations, while spatial compression can handle volumes of larger dimensions.

  14. Elementary wideband timing of radio pulsars

    SciTech Connect (OSTI)

    Pennucci, Timothy T.; Demorest, Paul B.; Ransom, Scott M. E-mail:


    We present an algorithm for the simultaneous measurement of a pulse time-of-arrival (TOA) and dispersion measure (DM) from folded wideband pulsar data. We extend the prescription from Taylor's 1992 work to accommodate a general two-dimensional template 'portrait', the alignment of which can be used to measure a pulse phase and DM. We show that there is a dedispersion reference frequency that removes the covariance between these two quantities and note that the recovered pulse profile scaling amplitudes can provide useful information. We experiment with pulse modeling by using a Gaussian-component scheme that allows for independent component evolution with frequency, a 'fiducial component', and the inclusion of scattering. We showcase the algorithm using our publicly available code on three years of wideband data from the bright millisecond pulsar J18242452A (M28A) from the Green Bank Telescope, and a suite of Monte Carlo analyses validates the algorithm. By using a simple model portrait of M28A, we obtain DM trends comparable to those measured by more standard methods, with improved TOA and DM precisions by factors of a few. Measurements from our algorithm will yield precisions at least as good as those from traditional techniques, but is prone to fewer systematic effects and is without ad hoc parameters. A broad application of this new method for dispersion measure tracking with modern large-bandwidth observing systems should improve the timing residuals for pulsar timing array experiments, such as the North American Nanohertz Observatory for Gravitational Waves.

  15. January 2009 The Y-12 Times

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    January 2009 P.O. Box 2009 Oak Ridge, TN 37831-8245 Managing Editors Amy Alley: Heidi Spurling: Layout/Design Lisa Harris Contributors Ellen Boatner Ken Davis Beth Eckerman Kathy Fahey John Holbrook Jamie Loveday Brett Pate I N S I D E Pages 2 and 3 Employees ask; Kohlhorst answers Pages 4 and 5 Your benefi ts, your rights Page 6 The ties that bind: Mentor-Protégé partnership strengthens Page 7 A 'towering' project

  16. The Y-12 Times, February 2008

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Volume 8, No. 2 February 2008 P.O. Box 2009 Oak Ridge, TN 37831-8245 Managing Editor Melissa Leinart 865-574-1621 (6ml) Associate Editors Amy Alley Heidi Spurling Layout/Design Lisa Harris Contributors Ken Davis Karen Dixon Beth Eckerman Kathy Fahey Amanda Forrester Stuart Hames Kathryn King-Jones Jamie Loveday Brett Pate I N S I D E Page 2 Y-12 employee rows his way to a bronze medal Page 2 Seasonal Affective Disorder: It is real Page 3 Y-12 is crime-solving

  17. Real Time Telemetry Data Capture and Storage

    Energy Science and Technology Software Center (OSTI)


    This program is used to capture telemetry data from remote instrumentation systems. The data can be captured at the rate of 1M bit per second. The data can come in one of several formats, NRZ, RZ, and Bi-Phase. The DECOM software takes the serial data stream and locks on to a unique code word. By tracking the code word the software can strip out the information. Thus the program can display the incoming data realmore » time while saving the data to disk.« less

  18. New Siemens Research Turbine - time lapse

    SciTech Connect (OSTI)


    The National Renewable Energy Laboratory (NREL) and Siemens Energy Inc. recently commissioned a new 2.3 megawatt Siemens wind turbine at NREL's National Wind Technology Center. This video shows a time lapse of the installation. The turbine is the centerpiece of a multi-year project to study the performance and aerodynamics of a new class of large, land-based machines — in what will be the biggest government-industry research partnership for wind power generation ever undertaken in the U.S.

  19. Making web annotations persistent over time

    SciTech Connect (OSTI)

    Sanderson, Robert; Van De Sompel, Herbert


    As Digital Libraries (DL) become more aligned with the web architecture, their functional components need to be fundamentally rethought in terms of URIs and HTTP. Annotation, a core scholarly activity enabled by many DL solutions, exhibits a clearly unacceptable characteristic when existing models are applied to the web: due to the representations of web resources changing over time, an annotation made about a web resource today may no longer be relevant to the representation that is served from that same resource tomorrow. We assume the existence of archived versions of resources, and combine the temporal features of the emerging Open Annotation data model with the capability offered by the Memento framework that allows seamless navigation from the URI of a resource to archived versions of that resource, and arrive at a solution that provides guarantees regarding the persistence of web annotations over time. More specifically, we provide theoretical solutions and proof-of-concept experimental evaluations for two problems: reconstructing an existing annotation so that the correct archived version is displayed for all resources involved in the annotation, and retrieving all annotations that involve a given archived version of a web resource.

  20. Statistics of particle time-temperature histories.

    SciTech Connect (OSTI)

    Hewson, John C.; Lignell, David O.; Sun, Guangyuan


    Particles in non - isothermal turbulent flow are subject to a stochastic environment tha t produces a distribution of particle time - temperature histories. This distribution is a function of the dispersion of the non - isothermal (continuous) gas phase and the distribution of particles relative to that gas phase. In this work we extend the one - dimensional turbulence (ODT) model to predict the joint dispersion of a dispersed particle phase and a continuous phase. The ODT model predicts the turbulent evolution of continuous scalar fields with a model for the cascade of fluctuations to smaller sc ales (the 'triplet map') at a rate that is a function of the fully resolved one - dimens ional velocity field . Stochastic triplet maps also drive Lagrangian particle dispersion with finite Stokes number s including inertial and eddy trajectory - crossing effect s included. Two distinct approaches to this coupling between triplet maps and particle dispersion are developed and implemented along with a hybrid approach. An 'instantaneous' particle displacement model matches the tracer particle limit and provide s an accurate description of particle dispersion. A 'continuous' particle displacement m odel translates triplet maps into a continuous velocity field to which particles respond. Particles can alter the turbulence, and modifications to the stochastic rate expr ession are developed for two - way coupling between particles and the continuous phase. Each aspect of model development is evaluated in canonical flows (homogeneous turbulence, free - shear flows and wall - bounded flows) for which quality measurements are ava ilable. ODT simulations of non - isothermal flows provide statistics for particle heating. These simulations show the significance of accurately predicting the joint statistics of particle and fluid dispersion . Inhomogeneous turbulence coupled with the in fluence of the mean flow fields on particles of varying properties alter s particle dispersion. The joint particle - temperature dispersion leads to a distribution of temperature histories predicted by the ODT . Predictions are shown for the lower moments an d the full distributions of the particle positions, particle - observed gas temperatures and particle temperatures. An analysis of the time scales affecting particle - temperature interactions covers Lagrangian integral time scales based on temperature autoco rrelations, rates of temperature change associated with particle motion relative to the temperature field and rates of diffusional change of temperatures. These latter two time scales have not been investigated previously; they are shown to be strongly in termittent having peaked distributions with long tails. The logarithm of the absolute value of these time scales exhibits a distribution closer to normal. A cknowledgements This work is supported by the Defense Threat Reduction Agency (DTRA) under their Counter - Weapons of Mass Destruction Basic Research Program in the area of Chemical and Biological Agent Defeat under award number HDTRA1 - 11 - 4503I to Sandia National Laboratories. The authors would like to express their appreciation for the guidance provi ded by Dr. Suhithi Peiris to this project and to the Science to Defeat Weapons of Mass Destruction program.

  1. Real-time and imaginary-time quantum hierarchal Fokker-Planck...

    Office of Scientific and Technical Information (OSTI)

    space (referred to hereafter as "Wigner space"), coupled to a harmonic oscillator bath. ... Through numerical integration of the real-time QHFP for a harmonic system, we obtain the ...

  2. Time Reversal in Solids (Linear and Nonlinear Elasticity): Multimedia Resources in Time Reversal

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Dynamic nonlinear elastic behavior, nonequilibrium dynamics, first observed as a curiosity in earth materials has now been observed in a great variety of solids. The primary manifestations of the behavior are characteristic wave distortion, and slow dynamics, a recovery process to equilibrium that takes place linearly with the logarithm of time, over hours to days after a wave disturbance. The link between the diverse materials that exhibit nonequilibrium dynamics appears to be the presence of soft regions, thought to be 'damage' at many scales, ranging from order 10-9 m to 10-1 m at least. The regions of soft matter may be distributed as in a rock sample, or isolated, as in a sample with a single crack [LANL]. The Geophysics Group (EES-11) at Los Alamos National Laboratory has posted two or more multimedia items under each of the titles below to demonstrate aspects of their work: 1) Source Reconstruction Using Time Reversal; 2) Robustness and Efficiency of Time Reversal Acoustics in Solid Media; 3) Audio Example of Time Reversal - Speech Privacy; 4) Crack Imagining with Time Reversal - Experimental Results; 5) Time Reversal of the 2004 (M9.0) Sumatra Earthquake.

  3. The Y-12 Times, May 2009

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 May 2009 P.O. Box 2009 Oak Ridge, TN 37831-8245 Managing Editors Amy Alley: Heidi Spurling: Layout/Design Lisa Harris Contributors Ellen Boatner Ken Davis Cynthia Ensor Kathy Fahey Vicki Hinkel Jamie Loveday W H A T ' S I N S I D E W H A T ' S I N S I D E Page 2 Page 2 Tech Transfer rolls out container technology Page 2 Page 2 Take the test that could save your life Page 3 Page 3 Partnering, preparing and confronting

  4. In-line real time air monitor

    DOE Patents [OSTI]

    Wise, Marcus B.; Thompson, Cyril V.


    An in-line gas monitor capable of accurate gas composition analysis in a continuous real time manner even under strong applied vacuum conditions operates by mixing an air sample with helium forming a sample gas in two complementary sample loops embedded in a manifold which includes two pairs of 3-way solenoid valves. The sample gas is then analyzed in an ion trap mass spectrometer on a continuous basis. Two valve drivers actuate the two pairs of 3-way valves in a reciprocating fashion, so that there is always flow through the in-line gas monitor via one or the other of the sample loops. The duty cycle for the two pairs of 3-way valves is varied by tuning the two valve drivers to a duty cycle typically between 0.2 to 0.7 seconds.


    SciTech Connect (OSTI)



    Health physicists from the CH2M HILL Plateau Remediation Company collaborated with Berkeley Nucleonics Corporation to modify the SAM 940 isotope identifier instrument to be used for nuclear waste remediation. These modifications coupled with existing capabilities of the SAM 940 have proven to be invaluable during remediation activities, reducing disposal costs by allowing swift remediation of targeted areas that have been identified as having isotopes of concern (IOC), and eliminating multiple visits to sites by declaring an excavation site clear of IOCs before demobilizing from the site. These advantages are enabled by accumulating spectral data for specific isotopes that is nearly 100 percent free of false positives, which are filtered out in 'real time.'

  6. Real time speech formant analyzer and display

    DOE Patents [OSTI]

    Holland, G.E.; Struve, W.S.; Homer, J.F.


    A speech analyzer for interpretation of sound includes a sound input which converts the sound into a signal representing the sound. The signal is passed through a plurality of frequency pass filters to derive a plurality of frequency formants. These formants are converted to voltage signals by frequency-to-voltage converters and then are prepared for visual display in continuous real time. Parameters from the inputted sound are also derived and displayed. The display may then be interpreted by the user. The preferred embodiment includes a microprocessor which is interfaced with a television set for displaying of the sound formants. The microprocessor software enables the sound analyzer to present a variety of display modes for interpretive and therapeutic used by the user. 19 figs.

  7. Real time speech formant analyzer and display

    DOE Patents [OSTI]

    Holland, George E.; Struve, Walter S.; Homer, John F.


    A speech analyzer for interpretation of sound includes a sound input which converts the sound into a signal representing the sound. The signal is passed through a plurality of frequency pass filters to derive a plurality of frequency formants. These formants are converted to voltage signals by frequency-to-voltage converters and then are prepared for visual display in continuous real time. Parameters from the inputted sound are also derived and displayed. The display may then be interpreted by the user. The preferred embodiment includes a microprocessor which is interfaced with a television set for displaying of the sound formants. The microprocessor software enables the sound analyzer to present a variety of display modes for interpretive and therapeutic used by the user.

  8. Real-time airborne particle analyzer

    DOE Patents [OSTI]

    Reilly, Peter T.A.


    An aerosol particle analyzer includes a laser ablation chamber, a gas-filled conduit, and a mass spectrometer. The laser ablation chamber can be operated at a low pressure, which can be from 0.1 mTorr to 30 mTorr. The ablated ions are transferred into a gas-filled conduit. The gas-filled conduit reduces the electrical charge and the speed of ablated ions as they collide and mix with buffer gases in the gas-filled conduit. Preferably, the gas filled-conduit includes an electromagnetic multipole structure that collimates the nascent ions into a beam, which is guided into the mass spectrometer. Because the gas-filled conduit allows storage of vast quantities of the ions from the ablated particles, the ions from a single ablated particle can be analyzed multiple times and by a variety of techniques to supply statistically meaningful analysis of composition and isotope ratios.

  9. In-line real time air monitor

    DOE Patents [OSTI]

    Wise, M.B.; Thompson, C.V.


    An in-line gas monitor capable of accurate gas composition analysis in a continuous real time manner even under strong applied vacuum conditions operates by mixing an air sample with helium forming a sample gas in two complementary sample loops embedded in a manifold which includes two pairs of 3-way solenoid valves. The sample gas is then analyzed in an ion trap mass spectrometer on a continuous basis. Two valve drivers actuate the two pairs of 3-way valves in a reciprocating fashion, so that there is always flow through the in-line gas monitor via one or the other of the sample loops. The duty cycle for the two pairs of 3-way valves is varied by tuning the two valve drivers to a duty cycle typically between 0.2 to 0.7 seconds. 3 figs.

  10. Real time viability detection of bacterial spores

    DOE Patents [OSTI]

    Vanderberg, Laura A.; Herdendorf, Timothy J.; Obiso, Richard J.


    This invention relates to a process for detecting the presence of viable bacterial spores in a sample and to a spore detection system, the process including placing a sample in a germination medium for a period of time sufficient for commitment of any present viable bacterial spores to occur, mixing the sample with a solution of a lanthanide capable of forming a fluorescent complex with dipicolinic acid, and, measuring the sample for the presence of dipicolinic acid, and the system including a germination chamber having inlets from a sample chamber, a germinant chamber and a bleach chamber, the germination chamber further including an outlet through a filtering means, the outlet connected to a detection chamber, the detection chamber having an inlet from a fluorescence promoting metal chamber and the detection chamber including a spectral excitation source and a means of measuring emission spectra from a sample, the detection chamber further connected to a waste chamber. A germination reaction mixture useful for promoting commitment of any viable bacterial spores in a sample including a combination of L-alanine, L-asparagine and D-glucose is also described.

  11. Real-time and imaginary-time quantum hierarchal Fokker-Planck equations

    SciTech Connect (OSTI)

    Tanimura, Yoshitaka


    We consider a quantum mechanical system represented in phase space (referred to hereafter as “Wigner space”), coupled to a harmonic oscillator bath. We derive quantum hierarchal Fokker-Planck (QHFP) equations not only in real time but also in imaginary time, which represents an inverse temperature. This is an extension of a previous work, in which we studied a spin-boson system, to a Brownian system. It is shown that the QHFP in real time obtained from a correlated thermal equilibrium state of the total system possesses the same form as those obtained from a factorized initial state. A modified terminator for the hierarchal equations of motion is introduced to treat the non-Markovian case more efficiently. Using the imaginary-time QHFP, numerous thermodynamic quantities, including the free energy, entropy, internal energy, heat capacity, and susceptibility, can be evaluated for any potential. These equations allow us to treat non-Markovian, non-perturbative system-bath interactions at finite temperature. Through numerical integration of the real-time QHFP for a harmonic system, we obtain the equilibrium distributions, the auto-correlation function, and the first- and second-order response functions. These results are compared with analytically exact results for the same quantities. This provides a critical test of the formalism for a non-factorized thermal state and elucidates the roles of fluctuation, dissipation, non-Markovian effects, and system-bath coherence. Employing numerical solutions of the imaginary-time QHFP, we demonstrate the capability of this method to obtain thermodynamic quantities for any potential surface. It is shown that both types of QHFP equations can produce numerical results of any desired accuracy. The FORTRAN source codes that we developed, which allow for the treatment of Wigner space dynamics with any potential form (TanimuranFP15 and ImTanimuranFP15), are provided as the supplementary material.

  12. Is space-time symmetry a suitable generalization of parity-time symmetry?

    SciTech Connect (OSTI)

    Amore, Paolo; Fernández, Francisco M.; Garcia, Javier


    We discuss space-time symmetric Hamiltonian operators of the form H=H{sub 0}+igH{sup ′}, where H{sub 0} is Hermitian and g real. H{sub 0} is invariant under the unitary operations of a point group G while H{sup ′} is invariant under transformation by elements of a subgroup G{sup ′} of G. If G exhibits irreducible representations of dimension greater than unity, then it is possible that H has complex eigenvalues for sufficiently small nonzero values of g. In the particular case that H is parity-time symmetric then it appears to exhibit real eigenvalues for all 00. We illustrate the main theoretical results and conclusions of this paper by means of two- and three-dimensional Hamiltonians exhibiting a variety of different point-group symmetries. - Highlights: • Space-time symmetry is a generalization of PT symmetry. • The eigenvalues of a space-time Hamiltonian are either real or appear as pairs of complex conjugate numbers. • In some cases all the eigenvalues are real for some values of a potential-strength parameter g. • At some value of g space-time symmetry is broken and complex eigenvalues appear. • Some multidimensional oscillators exhibit broken space-time symmetry for all values of g.

  13. Time, Dynamics and Chaos: Integrating Poincare's 'Non-Integrable Systems'

    DOE R&D Accomplishments [OSTI]

    Prigogine, I.


    This report discusses the nature of time. The author attempts to resolve the conflict between the concept of time reversibility in classical and quantum mechanics with the macroscopic world's irreversibility of time. (LSP)

  14. Tips: Time-Based Electricity Rates | Department of Energy

    Broader source: (indexed) [DOE]

    Time-based electricity programs encourage you to use energy when the demand is low by giving you a lower price for electricity during those times. Time-based electricity programs...

  15. Looking at Transistor Gate Oxide Formation in Real Time

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Looking at Transistor Gate Oxide Formation in Real Time Print The oxide gate layer is ... Now, for the first time, a group of researchers has obtained real-time oxidation results ...

  16. Real time PV manufacturing diagnostic system

    SciTech Connect (OSTI)

    Kochergin, Vladimir; Crawford, Michael A.


    The main obstacle Photovoltaic (PV) industry is facing at present is the higher cost of PV energy compared to that of fossil energy. While solar cell efficiencies continue to make incremental gains these improvements are so far insufficient to drive PV costs down to match that of fossil energy. Improved in-line diagnostics however, has the potential to significantly increase the productivity and reduce cost by improving the yield of the process. On this Phase I/Phase II SBIR project MicroXact developed and demonstrated at CIGS pilot manufacturing line a high-throughput in-line PV manufacturing diagnostic system, which was verified to provide fast and accurate data on the spatial uniformity of thickness, an composition of the thin films comprising the solar cell as the solar cell is processed reel-to-reel. In Phase II project MicroXact developed a stand-alone system prototype and demonstrated the following technical characteristics: 1) ability of real time defect/composition inconsistency detection over 60cm wide web at web speeds up to 3m/minute; 2) Better than 1mm spatial resolution on 60cm wide web; 3) an average better than 20nm spectral resolution resulting in more than sufficient sensitivity to composition imperfections (copper-rich and copper-poor regions were detected). The system was verified to be high vacuum compatible. Phase II results completely validated both technical and economic feasibility of the proposed concept. MicroXact’s solution is an enabling technique for in-line PV manufacturing diagnostics to increase the productivity of PV manufacturing lines and reduce the cost of solar energy, thus reducing the US dependency on foreign oil while simultaneously reducing emission of greenhouse gasses.

  17. Physics of Intrinsic Plasma Rotation Explained for First Time

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Physics of Intrinsic Plasma Rotation Explained for First Time Physics of Intrinsic Plasma Rotation Explained for First Time Key understanding for modeling future fusion reactors ...

  18. LCLS Femto-Second Timing and Synchronization System Update (Conference...

    Office of Scientific and Technical Information (OSTI)

    Conference: LCLS Femto-Second Timing and Synchronization System Update Citation Details In-Document Search Title: LCLS Femto-Second Timing and Synchronization System Update...

  19. LCLS Femto-Second Timing and Synchronization System Update (Conference...

    Office of Scientific and Technical Information (OSTI)

    Conference: LCLS Femto-Second Timing and Synchronization System Update Citation Details In-Document Search Title: LCLS Femto-Second Timing and Synchronization System Update You...

  20. Problems with propagation and time evolution in f ( T ) gravity...

    Office of Scientific and Technical Information (OSTI)

    Problems with propagation and time evolution in f ( T ) gravity Citation Details In-Document Search Title: Problems with propagation and time evolution in f ( T ) gravity Authors: ...

  1. National Preparedness Month: A Good Time to Review Community...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    National Preparedness Month: A Good Time to Review Community Guidelines for Energy Emergencies National Preparedness Month: A Good Time to Review Community Guidelines for Energy ...

  2. Chicago Solar Express Reduces Costs, Wait Times | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Chicago Solar Express Reduces Costs, Wait Times Chicago Solar Express Reduces Costs, Wait Times October 28, 2014 - 10:48am Addthis The Solar Express program in Chicago, ...

  3. Time-reversal symmetric hierarchy of fractional incompressible...

    Office of Scientific and Technical Information (OSTI)

    Time-reversal symmetric hierarchy of fractional incompressible liquids Title: Time-reversal symmetric hierarchy of fractional incompressible liquids Authors: Santos, Luiz ; ...

  4. Real-Time Chemical Imaging of Bacterial Biofilm Development

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Real-Time Chemical Imaging of Bacterial Biofilm Development Real-Time Chemical Imaging of Bacterial Biofilm Development Print Wednesday, 25 August 2010 00:00 Scientists have ...

  5. Time-resolved carrier distributions in graphene (Conference)...

    Office of Scientific and Technical Information (OSTI)

    Time-resolved carrier distributions in graphene Citation Details In-Document Search Title: Time-resolved carrier distributions in graphene You are accessing a document from the ...

  6. BIOMAP Time-Enabled Mapping and Dissemination Tool for Biofuels...

    Open Energy Info (EERE)

    BIOMAP Time-Enabled Mapping and Dissemination Tool for Biofuels Projects Jump to: navigation, search Tool Summary LAUNCH TOOL Name: BIOMAP Time-Enabled Mapping and Dissemination...

  7. ARM - Time in ARM NetCDF Files

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    govDataTime in ARM NetCDF Files Page Contents Introduction Time Zones Epoch Time Time Variables Conversion Examples and Hints Perl Example C Example Fortran Example IDL Example Notes on Generating Epoch Times Contact Information Time in ARM NetCDF Files Introduction This document explains most of the issues related to the use of time in ARM netCDF data files. Time Zones All ARM netCDF files are in UTC. Note that this has some implications for solar-based data; we tend to split our files at

  8. Department of Energy to Provide Supercomputing Time to Run NOAA...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy to Provide Supercomputing Time to Run NOAA's Climate Change Models Department of Energy to Provide Supercomputing Time to Run NOAA's Climate Change Models ...

  9. Regional Projections of Climate on Decadal Time Scales: High...

    Office of Scientific and Technical Information (OSTI)

    Regional Projections of Climate on Decadal Time Scales: High resolution global predictions ... Citation Details In-Document Search Title: Regional Projections of Climate on Decadal Time ...

  10. Time-Domain Electromagnetics At Soda Lake Area (Combs 2006) ...

    Open Energy Info (EERE)

    Time-Domain Electromagnetics At Soda Lake Area (Combs 2006) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Time-Domain Electromagnetics At Soda...

  11. Category:Time-Domain Electromagnetics | Open Energy Information

    Open Energy Info (EERE)

    Time-Domain Electromagnetics Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Geothermalpower.jpg Looking for the Time-Domain Electromagnetics page? For detailed...

  12. Fractional Topological Phases and Broken Time-Reversal Symmetry...

    Office of Scientific and Technical Information (OSTI)

    Fractional Topological Phases and Broken Time-Reversal Symmetry in Strained Graphene Title: Fractional Topological Phases and Broken Time-Reversal Symmetry in Strained Graphene ...

  13. Turbo Compounding: A Technology Whose Time Has Come | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Turbo Compounding: A Technology Whose Time Has Come Turbo Compounding: A Technology Whose Time Has Come 2005 Diesel Engine Emissions Reduction (DEER) Conference Presentations and ...

  14. Breakthrough Time and Mechanical Properties of Edge Sealing in...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Breakthrough Time and Mechanical Properties of Edge Sealing in Different Environmental Conditions Breakthrough Time and Mechanical Properties of Edge Sealing in Different ...

  15. EIS-0287: Notice of Extension for Time for Comments | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Extension for Time for Comments EIS-0287: Notice of Extension for Time for Comments Preferred Sodium Bearing Waste Treatment Technology In response to a public request, the...

  16. Ultrafast chirped optical waveform recorder using a time microscope...

    Office of Scientific and Technical Information (OSTI)

    Data Explorer Search Results Ultrafast chirped optical waveform recorder using a time microscope Title: Ultrafast chirped optical waveform recorder using a time microscope A new ...

  17. Steps to Establish a Real-Time Transmission Monitoring System...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Steps to Establish a Real-Time Transmission Monitoring System for Transmission Owners and Operators within the Eastern and Western Interconnections Steps to Establish a Real-Time ...

  18. Ultrafast chirped optical waveform recorder using a time microscope...

    Office of Scientific and Technical Information (OSTI)

    Ultrafast chirped optical waveform recorder using a time microscope Title: Ultrafast chirped optical waveform recorder using a time microscope A new technique for capturing both ...

  19. Eigenfunction Expansion of the Space-Time Dependent Neutron Survival...

    Office of Scientific and Technical Information (OSTI)

    Eigenfunction Expansion of the Space-Time Dependent Neutron Survival Probability. Citation Details In-Document Search Title: Eigenfunction Expansion of the Space-Time Dependent ...

  20. Spectral characteristics of time resolved magnonic spin Seebeck...

    Office of Scientific and Technical Information (OSTI)

    Spectral characteristics of time resolved magnonic spin Seebeck effect Citation Details In-Document Search Title: Spectral characteristics of time resolved magnonic spin Seebeck ...

  1. Eigenfunction Expansion of the Space-Time Dependent Neutron Survival...

    Office of Scientific and Technical Information (OSTI)

    Expansion of the Space-Time Dependent Neutron Survival Probability. Citation Details In-Document Search Title: Eigenfunction Expansion of the Space-Time Dependent Neutron ...

  2. Constant time worker thread allocation via configuration caching...

    Office of Scientific and Technical Information (OSTI)

    Constant time worker thread allocation via configuration caching Citation Details In-Document Search Title: Constant time worker thread allocation via configuration caching ...

  3. Impact of Extended Daylight Saving Time on National Energy Consumption...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Technical Documentation Impact of Extended Daylight Saving Time on National Energy ... of Extended Daylight Saving Time on the national energy consumption in the United States. ...

  4. Time-reversal-invariant topological superconductivity in n -doped...

    Office of Scientific and Technical Information (OSTI)

    Time-reversal-invariant topological superconductivity in n -doped BiH Citation Details In-Document Search Title: Time-reversal-invariant topological superconductivity in n -doped ...

  5. Genetically encoded sensors enable real-time observation of metabolite...

    Office of Scientific and Technical Information (OSTI)

    Genetically encoded sensors enable real-time observation of metabolite production Citation ... Title: Genetically encoded sensors enable real-time observation of metabolite production ...

  6. Correlated electron dynamics with time-dependent quantum Monte...

    Office of Scientific and Technical Information (OSTI)

    Correlated electron dynamics with time-dependent quantum Monte Carlo: Three-dimensional helium Citation Details In-Document Search Title: Correlated electron dynamics with time-dep...

  7. Development of Real-Time, Gas Quality Sensor Technology - Fact...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Real-Time, Gas Quality Sensor Technology - Fact Sheet 2015 Development of Real-Time, Gas Quality Sensor Technology - Fact Sheet 2015 The Gas Technology Institute, in collaboration ...

  8. Towards time-resolved serial crystallography in a microfluidic...

    Office of Scientific and Technical Information (OSTI)

    Towards time-resolved serial crystallography in a microfluidic device Citation Details In-Document Search Title: Towards time-resolved serial crystallography in a microfluidic ...

  9. Fragment Yields Calculated in a Time-Dependent Microscopic Theory...

    Office of Scientific and Technical Information (OSTI)

    Fragment Yields Calculated in a Time-Dependent Microscopic Theory of Fission Citation Details In-Document Search Title: Fragment Yields Calculated in a Time-Dependent Microscopic ...

  10. Real-Time Chemical Imaging of Bacterial Biofilm Development

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Real-Time Chemical Imaging of Bacterial Biofilm Development Print Scientists have ... The ability to image the chemical reactions in living cells in real time, especially in ...

  11. Tracking Living Cells as They Differentiate in Real Time

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Tracking Living Cells as They Differentiate in Real Time Print Protein phosphorylation ... cells, enabling them to follow cellular chemical changes in real time, without bias. ...

  12. Real Time Diagnostics for Algae-final-sm

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Real-time Monitoring And Diagnostics Detecting pathogens and predators to quickly recover ... Real-time Monitoring With Online Algal Reflectance Monitor System Researchers have ...

  13. Tracking Living Cells as They Differentiate in Real Time

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Tracking Living Cells as They Differentiate in Real Time Tracking Living Cells as They Differentiate in Real Time Print Thursday, 27 September 2012 00:00 Protein phosphorylation ...

  14. Wireless technology collects real-time information from oil and...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Wireless technology collects real-time information from oil and gas wells Wireless technology collects real-time information from oil and gas wells The patented system delivers ...

  15. Distributed Intelligence Architecture for Real-Time Control,...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Distributed Intelligence Architecture for Real-Time Control, Protection and Instrumentation Systems Architecture of complex, high-speed, Real-Time Instrumentation, Acquisition, Control ...


    SciTech Connect (OSTI)

    Lee, S.; Leishear, R.; Poirier, M.


    The Salt Disposition Integration (SDI) portfolio of projects provides the infrastructure within existing Liquid Waste facilities to support the startup and long term operation of the Salt Waste Processing Facility (SWPF). Within SDI, the Blend and Feed Project will equip existing waste tanks in the Tank Farms to serve as Blend Tanks where salt solutions of up to 1.2 million gallons will be blended in 1.3 million gallon tanks and qualified for use as feedstock for SWPF. In particular, Tanks 21 and 24 are planned to be used for blending and transferring to the SDI feed tank. These tanks were evaluated here to determine blending times, to determine a range of settling times for disturbed sludge, and to determine that the SWPF Waste Acceptance Criteria that less than 1200 mg/liter of solids will be entrained in salt solutions during transfers from the Tank 21 and Tank 24 will be met. Overall conclusions for Tank 21 and Tank 24 operations include: (1) Experimental correction factors were applied to CFD (computational fluid dynamics) models to establish blending times between approximately two and five hours. As shown in Phase 2 research, blending times may be as much as ten times greater, or more, if lighter fluids are added to heavier fluids (i.e., water added to salt solution). As the densities of two salt solutions converge this effect may be minimized, but additional confirmatory research was not performed. (2) At the current sludge levels and the presently planned operating heights of the transfer pumps, solids entrainment will be less than 1200 mg/liter, assuming a conservative, slow settling sludge simulant. (3) Based on theoretical calculations, particles in the density range of 2.5 to 5.0 g/mL must be greater than 2-4 {micro}m in diameter to ensure they settle adequately in 30-60 days to meet the SWPF feed criterion (<1200 mg/l). (4) Experimental tests with sludge batch 6 simulant and field turbidity data from a recent Tank 21 mixing evolution suggest the solid particles have higher density and/or larger size than indicated by previous analysis of SRS sludge and sludge simulants. (5) Tank 21 waste characterization, laboratory settling tests, and additional field turbidity measurements during mixing evolutions are recommended to better understand potential risk for extended (> 60 days) settling times in Tank 21.

  17. Real Time Flux Control in PM Motors

    SciTech Connect (OSTI)

    Otaduy, P.J.


    Significant research at the Oak Ridge National Laboratory (ORNL) Power Electronics and Electric Machinery Research Center (PEEMRC) is being conducted to develop ways to increase (1) torque, (2) speed range, and (3) efficiency of traction electric motors for hybrid electric vehicles (HEV) within existing current and voltage bounds. Current is limited by the inverter semiconductor devices' capability and voltage is limited by the stator wire insulation's ability to withstand the maximum back-electromotive force (emf), which occurs at the upper end of the speed range. One research track has been to explore ways to control the path and magnitude of magnetic flux while the motor is operating. The phrase, real time flux control (RTFC), refers to this mode of operation in which system parameters are changed while the motor is operating to improve its performance and speed range. RTFC has potential to meet an increased torque demand by introducing additional flux through the main air gap from an external source. It can augment the speed range by diverting flux away from the main air gap to reduce back-emf at high speeds. Conventional RTFC technology is known as vector control [1]. Vector control decomposes the stator current into two components; one that produces torque and a second that opposes (weakens) the magnetic field generated by the rotor, thereby requiring more overall stator current and reducing the efficiency. Efficiency can be improved by selecting a RTFC method that reduces the back-emf without increasing the average current. This favors methods that use pulse currents or very low currents to achieve field weakening. Foremost in ORNL's effort to develop flux control is the work of J. S. Hsu. Early research [2,3] introduced direct control of air-gap flux in permanent magnet (PM) machines and demonstrated it with a flux-controlled generator. The configuration eliminates the problem of demagnetization because it diverts all the flux from the magnets instead of trying to oppose it. It is robust and could be particularly useful for PM generators and electric vehicle drives. Recent efforts have introduced a brushless machine that transfers a magneto-motive force (MMF) generated by a stationary excitation coil to the rotor [4]. Although a conventional PM machine may be field weakened using vector control, the air-gap flux density cannot be effectively enhanced. In Hsu's new machine, the magnetic field generated by the rotor's PM may be augmented by the field from the stationery excitation coil and channeled with flux guides to its desired destination to enhance the air-gap flux that produces torque. The magnetic field can also be weakened by reversing the current in the stationary excitation winding. A patent for advanced technology in this area is pending. Several additional RTFC methods have been discussed in open literature. These include methods of changing the number of poles by magnetizing and demagnetizing the magnets poles with pulses of current corresponding to direct-axis (d-axis) current of vector control [5,6], changing the number of stator coils [7], and controlling the air gap [8]. Test experience has shown that the magnet strengths may vary and weaken naturally as rotor temperature increases suggesting that careful control of the rotor temperature, which is no easy task, could yield another method of RTFC. The purpose of this report is to (1) examine the interaction of rotor and stator flux with regard to RTFC, (2) review and summarize the status of RTFC technology, and (3) compare and evaluate methods for RTFC with respect to maturity, advantages and limitations, deployment difficulty and relative complexity.

  18. NREL Solar Radiation Research Laboratory (SRRL): Baseline Measurement System (BMS); Golden, Colorado (Data)

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Stoffel, T.; Andreas, A.

    The SRRL was established at the Solar Energy Research Institute (now NREL) in 1981 to provide continuous measurements of the solar resources, outdoor calibrations of pyranometers and pyrheliometers, and to characterize commercially available instrumentation. The SRRL is an outdoor laboratory located on South Table Mountain, a mesa providing excellent solar access throughout the year, overlooking Denver. Beginning with the basic measurements of global horizontal irradiance, direct normal irradiance and diffuse horizontal irradiance at 5-minute intervals, the SRRL Baseline Measurement System now produces more than 130 data elements at 1-min intervals that are available from the Measurement & Instrumentation Data Center Web site. Data sources include global horizontal, direct normal, diffuse horizontal (from shadowband and tracking disk), global on tilted surfaces, reflected solar irradiance, ultraviolet, infrared (upwelling and downwelling), photometric and spectral radiometers, sky imagery, and surface meteorological conditions (temperature, relative humidity, barometric pressure, precipitation, snow cover, wind speed and direction at multiple levels). Data quality control and assessment include daily instrument maintenance (M-F) with automated data quality control based on real-time examinations of redundant instrumentation and internal consistency checks using NREL's SERI-QC methodology. Operators are notified of equipment problems by automatic e-mail messages generated by the data acquisition and processing system. Radiometers are recalibrated at least annually with reference instruments traceable to the World Radiometric Reference (WRR).

  19. NREL Solar Radiation Research Laboratory (SRRL): Baseline Measurement System (BMS); Golden, Colorado (Data)

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Stoffel, T.; Andreas, A.


    The SRRL was established at the Solar Energy Research Institute (now NREL) in 1981 to provide continuous measurements of the solar resources, outdoor calibrations of pyranometers and pyrheliometers, and to characterize commercially available instrumentation. The SRRL is an outdoor laboratory located on South Table Mountain, a mesa providing excellent solar access throughout the year, overlooking Denver. Beginning with the basic measurements of global horizontal irradiance, direct normal irradiance and diffuse horizontal irradiance at 5-minute intervals, the SRRL Baseline Measurement System now produces more than 130 data elements at 1-min intervals that are available from the Measurement & Instrumentation Data Center Web site. Data sources include global horizontal, direct normal, diffuse horizontal (from shadowband and tracking disk), global on tilted surfaces, reflected solar irradiance, ultraviolet, infrared (upwelling and downwelling), photometric and spectral radiometers, sky imagery, and surface meteorological conditions (temperature, relative humidity, barometric pressure, precipitation, snow cover, wind speed and direction at multiple levels). Data quality control and assessment include daily instrument maintenance (M-F) with automated data quality control based on real-time examinations of redundant instrumentation and internal consistency checks using NREL's SERI-QC methodology. Operators are notified of equipment problems by automatic e-mail messages generated by the data acquisition and processing system. Radiometers are recalibrated at least annually with reference instruments traceable to the World Radiometric Reference (WRR).


    SciTech Connect (OSTI)

    Voit, G. Mark; Donahue, Megan


    Star formation in the universe's largest galaxiesthe ones at the centers of galaxy clustersdepends critically on the thermodynamic state of their hot gaseous atmospheres. Central galaxies with low-entropy, high-density atmospheres frequently contain multiphase star-forming gas, while those with high-entropy, low-density atmospheres never do. The dividing line between these two populations in central entropy, and therefore central cooling time, is amazingly sharp. Two hypotheses have been proposed to explain the dichotomy. One points out that thermal conduction can prevent radiative cooling of cluster cores above the dividing line. The other holds that cores below the dividing line are subject to thermal instability that fuels the central active galactic nucleus (AGN) through a cold-feedback mechanism. Here we explore those hypotheses with an analysis of the H? properties of ACCEPT galaxy clusters. We find that the two hypotheses are likely to be complementary. Our results support a picture in which cold clouds inevitably precipitate out of cluster cores in which cooling outcompetes thermal conduction and rain down on the central black hole, causing AGN feedback that stabilizes the cluster core. In particular, the observed distribution of the cooling-time to freefall-time ratio is nearly identical to that seen in simulations of this cold-feedback process, implying that cold-phase accretion, and not Bondi-like accretion of hot-phase gas, is responsible for the AGN feedback that regulates star formation in large galaxies.

  1. Time Synchronization in Hierarchical TESLA Wireless Sensor Networks

    SciTech Connect (OSTI)

    Jason L. Wright; Milos Manic


    Time synchronization and event time correlation are important in wireless sensor networks. In particular, time is used to create a sequence events or time line to answer questions of cause and effect. Time is also used as a basis for determining the freshness of received packets and the validity of cryptographic certificates. This paper presents secure method of time synchronization and event time correlation for TESLA-based hierarchical wireless sensor networks. The method demonstrates that events in a TESLA network can be accurately timestamped by adding only a few pieces of data to the existing protocol.

  2. Supplemental Guidance Regarding Compensatory Time Off for Travel |

    Energy Savers [EERE]

    Department of Energy Supplemental Guidance Regarding Compensatory Time Off for Travel Supplemental Guidance Regarding Compensatory Time Off for Travel Questions and answers on issues that supplement the final regulations on compensatory time for travel issued by the Office of Personnel Management. In addition, a sample worksheet is attached to assist travelers in determining and documenting their travel time that may be credited for compensatory time for travel. This information will be

  3. Filing Information | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    We therefore encourage electronic filing of time-sensitive submissions. If you have any questions, please contact Fred Brown, Deputy Director, at (202) 287-1545. Mailing Address ...

  4. NOTICE TO SUPPLIERS Fraudulent Quote Requests/Purchase Order E-Mail Activity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    * The email message may be poorly written, with misspellings and awkward sentence structure. * The sender's email address is not the same as CNS standard email address domain. The email address domain for Y-12:, for Pantex: Email from either site may also be in this form: * The message and purchase order requests shipment/delivery of products to non-CNS facilities. * The message will include an attachment that is designed to look like a purchase

  5. NOTICE TO SUPPLIERS Fraudulent Quote Requests/Purchase Order E-Mail Activity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

     The email message may be poorly written, with misspellings and awkward sentence structure.  The senders email address is not the same as CNS standard email address domain. The email address domain for Y-12:, for Pantex:  The message and purchase order requests shipment/delivery of products to non-CNS facilities.  The message will include an attachment that is designed to look like a purchase order, and includes a logo or other graphic, and a signature

  6. U.S. Postal Service General Mail Facility, San Diego, California...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to easily carry over their "best value" philosophy in considering energy consumption, ... Education: The former National Energy Coordinator for USPS published a paper (see ...


    Energy Savers [EERE]

    health program requirements related to laser and electron beam equipment at SLAC ... principles necessary for safe operation of laser systems and energetic beam equipment. ...

  8. E-Alerts: Environmental pollution and control (solid waste pollution and control). E-mail newsletter

    SciTech Connect (OSTI)


    The paper discusses pollution by solid wastes including garbage, scrap, junked automobiles, spoil, sludge, containers; Disposal methods such as composts or land application, injection wells, incineration, sanitary landfills; Mining wastes; Processing for separation and materials recovery; Solid waste utilization; Recycling; Biological and ecological effects; Superfund (Records of Decision, etc.); SITE technology; Laws, legislation, and regulations; Public administration; Economics; Land use. The discussion includes disposal of concentrated or pure liquids such as brines, oils, chemicals, and hazardous materials.

  9. Via E-Mail Michael Li Electricity Policy Specialist U.S. Department of Energy

    Energy Savers [EERE]

    Veterans Solving Energy Challenges Veterans Solving Energy Challenges August 6, 2014 - 10:31am Addthis Ronald J. (R.J.) McIntosh receives a Certificate of Special Congressional Recognition from Rep. Suzan DelBene of Washington. | Photo courtesy of Rep. Suzan DelBene’s office Ronald J. (R.J.) McIntosh receives a Certificate of Special Congressional Recognition from Rep. Suzan DelBene of Washington. | Photo courtesy of Rep. Suzan DelBene's office Six of the eight FEMP veteran internship

  10. E-Alerts: Combustion, engines, and propellants (reciprocation and rotating combustion engines). E-mail newsletter

    SciTech Connect (OSTI)


    Design, performance, and testing of reciprocating and rotating engines of various configurations for all types of propulsion. Includes internal and external combustion engines; engine exhaust systems; engine air systems components; engine structures; stirling and diesel engines.

  11. Site Office Contracting Officer E-mail address Ames Site Office...

    National Nuclear Security Administration (NNSA) Sandia Site Office Dave Ferguson Savannah River Site Office Carol Elliot Y-12 Site Office Jill ...

  12. C:MydocsMYDOCSHATTIERECS97recsForms97Mail.PDF

    Gasoline and Diesel Fuel Update (EIA)

    ... 06 Coal or Coke 07 Wood 08 Solar Collectors 21 Other Fuel (SPECIFY): ... How do you pay for your air-conditioning costs? 1 We pay directly to the gas or ...

  13. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    of Energy Buying a Car? Find Out What it Will REALLY Cost You Each Year Buying a Car? Find Out What it Will REALLY Cost You Each Year November 9, 2009 - 12:52pm Addthis Allison Casey Senior Communicator, NREL If you're in the market for a new car, you've probably been doing a lot of research. Talking to friends, reading reviews, scoping out other cars on the road, maybe even taking some test drives. You probably have a list of things you want in car, and you should consider all of these

  14. E-Alerts: Energy (engine studies (energy related)). E-mail newsletter

    SciTech Connect (OSTI)


    Operation and design of engines when related to energy conservation and energy use. Covers turbine, rotary, and reciprocating engines.

  15. Cyber in the Cloud -- Lessons Learned from INL's Cloud E-Mail Acquisition

    SciTech Connect (OSTI)

    Troy Hiltbrand; Daniel Jones


    As we look at the cyber security ecosystem, are we planning to fight the battle as we did yesterday, with firewalls and intrusion detection systems (IDS), or are we sensing a change in how security is evolving and planning accordingly? With the technology enablement and possible financial benefits of cloud computing, the traditional tools for establishing and maintaining our cyber security ecosystems are being dramatically altered.

  16. By E-Mail Daniel Cohen Assistant General Counsel for Legislation...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... to incorporate by reference specific clauses from IEC Standard 62301, First Edition. 2 ... verification programs that utilize independent testing laboratories and are developed ...

  17. ORISE: Contact information for REAC/TS - phone numbers, e-mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Radiation Emergency Assistance CenterTraining Site staff contact information Emergency Number 865.576.1005 (Ask for REACTS) Nicholas Dainiak, M.D., FACP Medical and...

  18. Neutron time-of-flight and emission time diagnostics for the National Ignition Facility

    SciTech Connect (OSTI)

    Murphy, T. J.; Jimerson, J. L.; Berggren, R. R.; Faulkner, J. R.; Oertel, J. A.; Walsh, P. J.


    Current plans call for a system of current mode neutron detectors for the National Ignition Facility for extending the range of neutron yields below that of the neutron activation system, for ion-temperature measurements over a wide yield range, and for determining the average neutron emission time. The system will need to operate over a yield range of 10{sup 6} for the lowest-yield experiments to 10{sup 19} for high-yield ignited targets. The requirements will be satisfied using several detectors located at different distances from the target. This article presents a conceptual design for the NIF nToF system.

  19. Tips: Time-Based Electricity Rates | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Tips: Time-Based Electricity Rates Tips: Time-Based Electricity Rates Time-based electricity programs encourage you to use energy when the demand is low by giving you a lower price for electricity during those times. Time-based electricity programs encourage you to use energy when the demand is low by giving you a lower price for electricity during those times. To help reduce their peak power demands and save money, many utilities are introducing programs that encourage their customers to use

  20. Modeling an Application's Theoretical Minimum and Average Transactional Response Times

    SciTech Connect (OSTI)

    Paiz, Mary Rose


    The theoretical minimum transactional response time of an application serves as a ba- sis for the expected response time. The lower threshold for the minimum response time represents the minimum amount of time that the application should take to complete a transaction. Knowing the lower threshold is beneficial in detecting anomalies that are re- sults of unsuccessful transactions. On the converse, when an application's response time falls above an upper threshold, there is likely an anomaly in the application that is causing unusual performance issues in the transaction. This report explains how the non-stationary Generalized Extreme Value distribution is used to estimate the lower threshold of an ap- plication's daily minimum transactional response time. It also explains how the seasonal Autoregressive Integrated Moving Average time series model is used to estimate the upper threshold for an application's average transactional response time.

  1. High time-resolution photodetectors for PET applications

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Ronzhin, Anatoly


    This paper describes recent developments aiming at the improvement of the time resolution of photodetectors used in positron emission tomography (PET). Promising photodetector candidates for future PET-time-of-flight (TOF) applications are also discussed.

  2. Time at the beginning (Conference) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Time at the beginning Citation Details In-Document Search Title: Time at the beginning You are accessing a document from the Department of Energy's (DOE) SciTech Connect. This ...

  3. Time at the beginning (Conference) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Time at the beginning Citation Details In-Document Search Title: Time at the beginning Age consistency for the Universe today has been an important cosmological test. Even more ...

  4. Out of time? Use scavenger queue on Hopper

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Out of time? Use scavenger queue on Hopper Out of time? Use scavenger queue on Hopper September 18, 2015 by Katie Antypas NERSC is now allowing projects and users who have fewer...

  5. ARS 41-1072 Licensing Time Frames | Open Energy Information

    Open Energy Info (EERE)

    1-1072 Licensing Time Frames Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- StatuteStatute: ARS 41-1072 Licensing Time FramesLegal Abstract...

  6. Nevada Application for Extensions of Time (Water Right) | Open...

    Open Energy Info (EERE)

    Extensions of Time (Water Right) Jump to: navigation, search OpenEI Reference LibraryAdd to library Form: Nevada Application for Extensions of Time (Water Right) Form Type...

  7. Effect of Cusps in Time-Dependent Quantum Mechanics (Journal...

    Office of Scientific and Technical Information (OSTI)

    Effect of Cusps in Time-Dependent Quantum Mechanics Title: Effect of Cusps in Time-Dependent Quantum Mechanics Authors: Yang, Zeng-hui ; Maitra, Neepa T. ; Burke, Kieron ...

  8. Removing nuclear waste, one shipment at a time

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Removing nuclear waste, one shipment at a time Removing nuclear waste, one shipment at a time The Lab's 1,000th shipment of transuranic waste recently left Los Alamos, on its way...

  9. Ames Lab 101: Real-Time 3D Imaging

    ScienceCinema (OSTI)

    Zhang, Song


    Ames Laboratory scientist Song Zhang explains his real-time 3-D imaging technology. The technique can be used to create high-resolution, real-time, precise, 3-D images for use in healthcare, security, and entertainment applications.

  10. Time dependence of Bragg forward scattering and self-seeding...

    Office of Scientific and Technical Information (OSTI)

    Journal Article: Time dependence of Bragg forward scattering and self-seeding of hard x-ray free-electron lasers Citation Details In-Document Search Title: Time dependence of Bragg ...

  11. It's Finally Time to Think about the Holidays! | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    It's Finally Time to Think about the Holidays It's Finally Time to Think about the Holidays December 5, 2012 - 12:13pm Addthis Using LED holiday lights is just one of the ways...

  12. New "Cool Roof Time Machine" Will Accelerate Cool Roof Deployment...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    "Cool Roof Time Machine" Will Accelerate Cool Roof Deployment New "Cool Roof Time Machine" Will Accelerate Cool Roof Deployment April 24, 2015 - 4:21pm Addthis Berkeley Lab...

  13. Forming rotated SAR images by real-time motion compensation....

    Office of Scientific and Technical Information (OSTI)

    Forming rotated SAR images by real-time motion compensation. Citation Details In-Document Search Title: Forming rotated SAR images by real-time motion compensation. Proper waveform...

  14. Autonomous global sky monitoring with real-time robotic follow...

    Office of Scientific and Technical Information (OSTI)

    Conference: Autonomous global sky monitoring with real-time robotic follow-up Citation Details In-Document Search Title: Autonomous global sky monitoring with real-time robotic...


    Office of Scientific and Technical Information (OSTI)


  16. Gasoline prices decrease nationally for first time in 4 weeks...

    U.S. Energy Information Administration (EIA) Indexed Site

    Gasoline prices decrease nationally for first time in 4 weeks (short version) The U.S. average retail price for regular gasoline fell for the first time in 4 weeks to 3.33 a ...

  17. Impact of Extended Daylight Saving Time on National Energy Consumption...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Report to Congress Impact of Extended Daylight Saving Time on National Energy Consumption, ... on the impacts of Extended Daylight Saving Time on the U.S. national energy consumption. ...

  18. Gasoline prices decrease nationally for first time in 4 weeks...

    U.S. Energy Information Administration (EIA) Indexed Site

    June 9, 2014 U.S. gasoline prices decrease for first time in three weeks (long version) The U.S. average retail price for regular gasoline fell for the first time in three weeks to ...

  19. Real-Time Quantitative Imaging of Failure Events in Materials...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Real-Time Quantitative Imaging of Failure Events in Materials Under Load at Temperatures Above 1,600 C Real-Time Quantitative Imaging of Failure Events in Materials Under Load at ...

  20. Variation in Hydraulic Conductivity Over Time at the Monticello Permeable

    Energy Savers [EERE]

    Reactive Barrier | Department of Energy Variation in Hydraulic Conductivity Over Time at the Monticello Permeable Reactive Barrier Variation in Hydraulic Conductivity Over Time at the Monticello Permeable Reactive Barrier Variation in Hydraulic Conductivity Over Time at the Monticello Permeable Reactive Barrier PDF icon Variation in Hydraulic Conductivity Over Time at the Monticello Permeable Reactive Barrier More Documents & Publications Hydraulic Conductivity of the Monticello

  1. Funding Opportunity Announcement: Enabling Extreme Real-Time Grid

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Integration of Solar Energy (ENERGISE) | Department of Energy Enabling Extreme Real-Time Grid Integration of Solar Energy (ENERGISE) Funding Opportunity Announcement: Enabling Extreme Real-Time Grid Integration of Solar Energy (ENERGISE) Funding Opportunity Announcement: Enabling Extreme Real-Time Grid Integration of Solar Energy (ENERGISE) Funding Number: DE-FOA-0001495 Funding Amount: $25,000,000 Description The Enabling Extreme Real-Time Grid Integration of Solar Energy (ENERGISE) funding

  2. On timing properties of LYSO-based calorimeters

    SciTech Connect (OSTI)

    Anderson, D.; Apresyan, A.; Bornheim, A.; Duarte, J.; Pena, C.; Ronzhin, A.; Spiropulu, M.; Trevor, J.; Xie, S.


    We present test beam studies and results on the timing performance and characterization of the time resolution of Lutetium–Yttrium Orthosilicate (LYSO)-based calorimeters. We also demonstrate that a time resolution of 30 ps is achievable for a particular design. Additionally, we discuss precision timing calorimetry as a tool for the mitigation of physics object performance degradation effects due to the large number of simultaneous interactions in the high luminosity environment foreseen at the Large Hadron Collider.

  3. Beam Time Request - Radiation Effects Facility / Cyclotron Institute /

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Texas A&M University Beam-Time Request Information about scheduling beam-time: HOURLY RATE: Contact Henry Clark, 979-845-1411 or MINIMUM BILLING: There is an eight hour minimum billing, after that you are billed for time used including tuning time. CANCELLATION POLICY: If you schedule cyclotron time and need to cancel at a later date, you must notify Henry Clark two weeks prior to the start date to avoid the cancellation fee. The fee is in the amount of one half of

  4. Dead-time compensation for a logarithmic display rate meter

    DOE Patents [OSTI]

    Larson, John A.; Krueger, Frederick P.


    An improved circuit is provided for application to a radiation survey meter that uses a detector that is subject to dead time. The circuit compensates for dead time over a wide range of count rates by producing a dead-time pulse for each detected event, a live-time pulse that spans the interval between dead-time pulses, and circuits that average the value of these pulses over time. The logarithm of each of these values is obtained and the logarithms are subtracted to provide a signal that is proportional to a count rate that is corrected for the effects of dead time. The circuit produces a meter indication and is also capable of producing an audible indication of detected events.

  5. Dead-time compensation for a logarithmic display rate meter

    DOE Patents [OSTI]

    Larson, J.A.; Krueger, F.P.


    An improved circuit is provided for application to a radiation survey meter that uses a detector that is subject to dead time. The circuit compensates for dead time over a wide range of count rates by producing a dead-time pulse for each detected event, a live-time pulse that spans the interval between dead-time pulses, and circuits that average the value of these pulses over time. The logarithm of each of these values is obtained and the logarithms are subtracted to provide a signal that is proportional to a count rate that is corrected for the effects of dead time. The circuit produces a meter indication and is also capable of producing an audible indication of detected events. 5 figs.

  6. Petroleum Marketing Annual

    U.S. Energy Information Administration (EIA) Indexed Site

    Government Printing Office Farragut Bookstore 1510 H Street, NW Washington, DC 20005 (202) 653-2050 FAX (202) 376-5055 9 a.m. to 5 p.m., eastern time, M-F Superintendent of...

  7. System and method for time synchronization in a wireless network

    DOE Patents [OSTI]

    Gonia, Patrick S.; Kolavennu, Soumitri N.; Mahasenan, Arun V.; Budampati, Ramakrishna S.


    A system includes multiple wireless nodes forming a cluster in a wireless network, where each wireless node is configured to communicate and exchange data wirelessly based on a clock. One of the wireless nodes is configured to operate as a cluster master. Each of the other wireless nodes is configured to (i) receive time synchronization information from a parent node, (ii) adjust its clock based on the received time synchronization information, and (iii) broadcast time synchronization information based on the time synchronization information received by that wireless node. The time synchronization information received by each of the other wireless nodes is based on time synchronization information provided by the cluster master so that the other wireless nodes substantially synchronize their clocks with the clock of the cluster master.

  8. Characterizing and Mitigating Work Time Inflation in Task Parallel Programs

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Olivier, Stephen L.; de Supinski, Bronis R.; Schulz, Martin; Prins, Jan F.


    Task parallelism raises the level of abstraction in shared memory parallel programming to simplify the development of complex applications. However, task parallel applications can exhibit poor performance due to thread idleness, scheduling overheads, and work time inflation – additional time spent by threads in a multithreaded computation beyond the time required to perform the same work in a sequential computation. We identify the contributions of each factor to lost efficiency in various task parallel OpenMP applications and diagnose the causes of work time inflation in those applications. Increased data access latency can cause significant work time inflation in NUMAmore » systems. Our locality framework for task parallel OpenMP programs mitigates this cause of work time inflation. Our extensions to the Qthreads library demonstrate that locality-aware scheduling can improve performance up to 3X compared to the Intel OpenMP task scheduler.« less

  9. Multi-time wave functions for quantum field theory

    SciTech Connect (OSTI)

    Petrat, Sren; Tumulka, Roderich


    Multi-time wave functions such as ?(t{sub 1},x{sub 1},,t{sub N},x{sub N}) have one time variable t{sub j} for each particle. This type of wave function arises as a relativistic generalization of the wave function ?(t,x{sub 1},,x{sub N}) of non-relativistic quantum mechanics. We show here how a quantum field theory can be formulated in terms of multi-time wave functions. We mainly consider a particular quantum field theory that features particle creation and annihilation. Starting from the particleposition representation of state vectors in Fock space, we introduce multi-time wave functions with a variable number of time variables, set up multi-time evolution equations, and show that they are consistent. Moreover, we discuss the relation of the multi-time wave function to two other representations, the TomonagaSchwinger representation and the Heisenberg picture in terms of operator-valued fields on spacetime. In a certain sense and under natural assumptions, we find that all three representations are equivalent; yet, we point out that the multi-time formulation has several technical and conceptual advantages. -- Highlights: Multi-time wave functions are manifestly Lorentz-covariant objects. We develop consistent multi-time equations with interaction for quantum field theory. We discuss in detail a particular model with particle creation and annihilation. We show how multi-time wave functions are related to the TomonagaSchwinger approach. We show that they have a simple representation in terms of operator valued fields.

  10. Events in time: Basic analysis of Poisson data

    SciTech Connect (OSTI)

    Engelhardt, M.E.


    The report presents basic statistical methods for analyzing Poisson data, such as the member of events in some period of time. It gives point estimates, confidence intervals, and Bayesian intervals for the rate of occurrence per unit of time. It shows how to compare subsets of the data, both graphically and by statistical tests, and how to look for trends in time. It presents a compound model when the rate of occurrence varies randomly. Examples and SAS programs are given.

  11. Vector processing enhancements for real-time image analysis.

    SciTech Connect (OSTI)

    Shoaf, S.; APS Engineering Support Division


    A real-time image analysis system was developed for beam imaging diagnostics. An Apple Power Mac G5 with an Active Silicon LFG frame grabber was used to capture video images that were processed and analyzed. Software routines were created to utilize vector-processing hardware to reduce the time to process images as compared to conventional methods. These improvements allow for more advanced image processing diagnostics to be performed in real time.

  12. Impact of Extended Daylight Saving Time on National Energy Consumption,

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Report to Congress | Department of Energy Report to Congress Impact of Extended Daylight Saving Time on National Energy Consumption, Report to Congress This report presents the detailed results, data, and analytical methods used in the DOE Report to Congress on the impacts of Extended Daylight Saving Time on the U.S. national energy consumption. PDF icon Report to Congress More Documents & Publications Impact of Extended Daylight Saving Time on National Energy Consumption, Technical

  13. Correlated electron dynamics with time-dependent quantum Monte Carlo:

    Office of Scientific and Technical Information (OSTI)

    Three-dimensional helium (Journal Article) | SciTech Connect Correlated electron dynamics with time-dependent quantum Monte Carlo: Three-dimensional helium Citation Details In-Document Search Title: Correlated electron dynamics with time-dependent quantum Monte Carlo: Three-dimensional helium Here the recently proposed time-dependent quantum Monte Carlo method is applied to three dimensional para- and ortho-helium atoms subjected to an external electromagnetic field with amplitude sufficient

  14. Continuous-time quantum walks on star graphs

    SciTech Connect (OSTI)

    Salimi, S.


    In this paper, we investigate continuous-time quantum walk on star graphs. It is shown that quantum central limit theorem for a continuous-time quantum walk on star graphs for N-fold star power graph, which are invariant under the quantum component of adjacency matrix, converges to continuous-time quantum walk on K{sub 2} graphs (complete graph with two vertices) and the probability of observing walk tends to the uniform distribution.

  15. ASCR Leadership Computing Challenge Requests for Time Due February 14

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Requests for Time Due February 14 ASCR Leadership Computing Challenge Requests for Time Due February 14 November 17, 2011 by Francesca Verdier The ASCR Leadership Computing Challenge (ALCC) program is open to scientists from the research community in national laboratories, academia and industry. This program allocates time at NERSC and the Leadership Computing Facilities at Argonne and Oak Ridge. Areas of interest are: Advancing the clean energy agenda. Understanding the environmental impacts of

  16. Historical Time Line and Information About the Hanford Site

    SciTech Connect (OSTI)

    Briggs, James D.


    Historical time line of the Hanford Site spanning from 1940 through 1997, including photographs and other information regarding the town sites and living conditions.

  17. Hunan CSR Times Electric Automobile | Open Energy Information

    Open Energy Info (EERE)

    Electric Automobile Jump to: navigation, search Name: Hunan CSR Times Electric Automobile Place: Hunan Province, China Product: Hunan-based electric automobile maker References:...

  18. Sandia National Laboratories: Working with Sandia: Just in Time...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)


  19. Reserving and Scheduling Transmission over the Time Change -...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Customer Training Interconnection Notices Rates Standards of Conduct Tariff TF Web Based Training Notice: Reserving & Scheduling Transmission over the Time Change Posted Date: 10...

  20. Reminder Reserving and Scheduling Transmission over the Time...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Customer Training Interconnection Notices Rates Standards of Conduct Tariff TF Web Based Training Notice: Reminder - Reserving & Scheduling Transmission over the Time Change...

  1. Reserving and Scheduling Transmission over the Time Change -...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Customer Training Interconnection Notices Rates Standards of Conduct Tariff TF Web Based Training Notice: Reserving & Scheduling Transmission over the Time Change Reminder Posted...

  2. Reserving and Scheduling Transmission over the Time Change -...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Customer Training Interconnection Notices Rates Standards of Conduct Tariff TF Web Based Training Notice: Reserving & Scheduling Transmission over the Time Change Posted Date: 2...

  3. Nanosecond Time Resolved and Steady State Infrared Studies of...

    Office of Scientific and Technical Information (OSTI)

    Nanosecond Time Resolved and Steady State Infrared Studies of Photoinduced Decomposition of TATB at Ambient and Elevated Pressures Citation Details In-Document Search Title: ...

  4. Real Time Tailpipe Emission Measurements | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    More Documents & Publications Real-Time Simultaneous Measurements of Size, Density, and Composition of Single Ultrafine Diesel Tailpipe Particles Microsoft PowerPoint - 4. ORNL- ...

  5. Real-Time Simultaneous Measurements of Size, Density, and Composition...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Simultaneous Measurements of Size, Density, and Composition of Single Ultrafine Diesel Tailpipe Particles Real-Time Simultaneous Measurements of Size, Density, and Composition of ...

  6. Multivariate Spatio-Temporal Clustering of Times-Series Data...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... The area change graph in Figure 2 could show trends in cloud and climate states from Atmospheric Radiation Measurements (ARMs) long time series measurements. When measurements are ...

  7. OMEGA EP Laser Integration Time Lapse Movie Gallery - Laboratory...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Integration Time Lapse Movie Gallery - Laboratory for Laser Energetics Laboratory for Laser Energetics Logo Search Home Around the Lab Past Issues Past Quick Shots About Office of ...

  8. OMEGA EP Building Construction Time Lapse Movie Gallery - Laboratory...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Building Construction Time Lapse Movie Gallery - Laboratory for Laser Energetics Laboratory for Laser Energetics Logo Search Home Around the Lab Past Issues Past Quick Shots About ...

  9. Real-time Optical Network for Accelerator Control

    SciTech Connect (OSTI)

    Lee, Keun


    The timing requirements of a modern accelerator complex call for several features. The first is a system for high precision relative timing among accelerator components. Stabilized fiber links have already been demonstrated to achieve sub-10 femtoseconds relative timing precision. The second is a system for timing distribution of absolute time with sufficient precision to identify a specific RF bucket. The White Rabbit technology is a promising candidate to deliver the absolute time that is linked to the GPS clock. In this study we demonstrated that these two technologies can be combined in a way that the absolute time information can be delivered to the stabilized fiber link system. This was accomplished by researching the design of the stabilized fiber and White Rabbit systems and devising adaptation modules that facilitate co-existence of both systems in the same FPGA environment. We built a prototype system using off-the-shelf products and implemented a proof-of-concept version of the FPGA firmware. The test verified that the White Rabbit features operate correctly under the stabilized fiber system environment. This work demonstrates that turn-key femtosecond timing systems with absolute time information can be built cost effectively and deployed in various accelerator environments. This will lead to many new applications in chemistry, biology and surface dynamics, to name a few.

  10. Two linear time, low overhead algorithms for graph layout

    Energy Science and Technology Software Center (OSTI)


    The software comprises two algorithms designed to perform a 2D layout of a graph structure in time linear with respect to the vertices and edges in the graph, whereas most other layout algorithms have a running time that is quadratic with respect to the number of vertices or greater. Although these layout algorithms run in a fraction of the time as their competitors, they provide competitive results when applied to most real-world graphs. These algorithmsmore » also have a low constant running time and small memory footprint, making them useful for small to large graphs.« less

  11. Fast timing detectors for forward protons at the LHC

    SciTech Connect (OSTI)

    Albrow, Michael; /Fermilab


    The author discusses the development of high precision timing detectors for high momentum protons at the LHC, and their application in studying exclusive Higgs boson production.

  12. Integrated MARKAL-EFOM System (TIMES) | Open Energy Information

    Open Energy Info (EERE)

    Program ComplexityEase of Use: Advanced Website: iea-etsap.orgwebTimes.asp Cost: Free Related Tools TEEMP Intertemporal Computable Equilibrium System (ICES) MCA4Climate -...

  13. Funding Opportunity Announcement: Enabling Extreme Real-Time...

    Office of Environmental Management (EM)

    Funding Opportunity Announcement: Enabling Extreme Real-Time Grid Integration of Solar Energy ... These software and hardware solutions will be highly scalable, data-driven, and capable ...

  14. Real-Time Chemical Imaging of Bacterial Biofilm Development

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Real-Time Chemical Imaging of Bacterial Biofilm Development Print Scientists have developed a robust and label-free method to probe the chemical underpinnings of developing bacterial ...

  15. Real-time nonlinear optimization as a generalized equation.

    SciTech Connect (OSTI)

    Zavala, V. M.; Anitescu, M. (Mathematics and Computer Science)


    We establish results for the problem of tracking a time-dependent manifold arising in real-time optimization by casting this as a parametric generalized equation. We demonstrate that if points along a solution manifold are consistently strongly regular, it is possible to track the manifold approximately by solving a single linear complementarity problem (LCP) at each time step. We derive sufficient conditions guaranteeing that the tracking error remains bounded to second order with the size of the time step even if the LCP is solved only approximately. We use these results to derive a fast, augmented Lagrangian tracking algorithm and demonstrate the developments through a numerical case study.

  16. Approaching Problems in Particle and Nuclear Physics with Time...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Approaching Problems in Particle and Nuclear Physics with Time-Dependent Quantum Mechanics (Wednesday, Jan 20) Approaching Problems in Particle and Nuclear Physics with...

  17. Maintaining nuclear stability in times of transition focus of...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Maintaining nuclear stability in times of transition focus of talk at Bradbury Science Museum Houston "Terry" Hawkins talks about the role that the nation's nuclear weapons ...

  18. Nonlinear Time Domain Modeling and Simulation of Surface and...

    Office of Environmental Management (EM)

    Jose Abell, Kohei Watanabe, Chao Luo University of California, Davis Lawrence Berkeley National Laboratory, Berkeley DOE NPH, October 2014 PDF icon Nonlinear Time Domain...

  19. Time-Domain Electromagnetics At Kilauea East Rift Geothermal...

    Open Energy Info (EERE)

    At Kilauea East Rift Geothermal Area (FURUMOTO, 1976) Exploration Activity Details Location Kilauea East Rift Geothermal Area Exploration Technique Time-Domain...

  20. Scientists detect methane levels three times larger than expected...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Methane levels larger over Four Corners region Scientists detect methane levels three times larger than expected over Four Corners region Study is first to show space-based...

  1. SF 6432-TM (xx-xx-xx) Time Material

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    costs are consistent with subparagraph (3) below. Control : SF 6432-TM Title: Standard Terms and Conditions for Time and Materials Labor-Hour Contracts Owner: Procurement Policy &...

  2. SF 6432-TM (xx-xx-xx) Time Material

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    costs are comprised of indirect costs, including Control : SF 6432-TM Title: Standard Terms and Conditions for Time and Materials Labor-Hour Contracts Owner: Procurement Policy...

  3. Time-Domain Electromagnetics At Kilauea East Rift Geothermal...

    Open Energy Info (EERE)

    Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Time-Domain Electromagnetics At Kilauea East Rift Geothermal Area (Thomas, 1986) Exploration...

  4. Time-Domain Electromagnetics At Kilauea East Rift Geothermal...

    Open Energy Info (EERE)

    Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Time-Domain Electromagnetics At Kilauea East Rift Geothermal Area (Skokan, 1974) Exploration...

  5. Time-Domain Electromagnetics At Kilauea Southwest Rift And South...

    Open Energy Info (EERE)

    Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Time-Domain Electromagnetics At Kilauea Southwest Rift And South Flank Area (Thomas, 1986)...

  6. Time-Domain Electromagnetics At Hualalai Northwest Rift Area...

    Open Energy Info (EERE)

    Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Time-Domain Electromagnetics At Hualalai Northwest Rift Area (Thomas, 1986) Exploration...

  7. Time-Domain Electromagnetics At Mauna Loa Northeast Rift Area...

    Open Energy Info (EERE)

    Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Time-Domain Electromagnetics At Mauna Loa Northeast Rift Area (Thomas, 1986) Exploration...

  8. Time-Dependent Seismic Tomography of the Coso Geothermal Area...

    Open Energy Info (EERE)

    to: navigation, search OpenEI Reference LibraryAdd to library Conference Proceedings: Time-Dependent Seismic Tomography of the Coso Geothermal Area, 1996-2004 Abstract...

  9. Time-dependent seismic tomography of the Coso geothermal area...

    Open Energy Info (EERE)

    to: navigation, search OpenEI Reference LibraryAdd to library Conference Proceedings: Time-dependent seismic tomography of the Coso geothermal area, 1996-2004 Abstract...

  10. Time-Domain Electromagnetics At Glass Mountain Area (Cumming...

    Open Energy Info (EERE)

    Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Time-Domain Electromagnetics At Glass Mountain Area (Cumming And Mackie, 2007) Exploration...

  11. Time-Domain Electromagnetics At Haleakala Volcano Area (Thomas...

    Open Energy Info (EERE)

    Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Time-Domain Electromagnetics At Haleakala Volcano Area (Thomas, 1986) Exploration Activity...

  12. Time-Domain Electromagnetics At Truckhaven Area (Warpinski, Et...

    Open Energy Info (EERE)

    Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Time-Domain Electromagnetics At Truckhaven Area (Warpinski, Et Al., 2004) Exploration...

  13. Time-Domain Electromagnetics At Dixie Hot Springs Area (Combs...

    Open Energy Info (EERE)

    Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Time-Domain Electromagnetics At Dixie Hot Springs Area (Combs 2006) Exploration Activity...

  14. Time-dependent seismic tomography and its application to the...

    Open Energy Info (EERE)

    changes in Earth structure are commonly determined using local earthquake tomography computer programs that invert multiple seismic-wave arrival time data sets separately and...

  15. Exploration Cost and Time Metric | Open Energy Information

    Open Energy Info (EERE)

    lt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":"" Hide Map Language: English Exploration Cost and Time Metric Screenshot References: Conference Paper1...

  16. A time-dependent formulation of multi-reference perturbation...

    Office of Scientific and Technical Information (OSTI)

    Title: A time-dependent formulation of multi-reference perturbation theory Authors: Sokolov, Alexander Yu. 1 ; Chan, Garnet Kin-Lic 1 + Show Author Affiliations Department of ...

  17. Autonomous global sky monitoring with real-time robotic follow...

    Office of Scientific and Technical Information (OSTI)

    anomalous behavior, selecting targets for detailed investigation, and making real-time anomaly detection to enable rapid recognition and a swift response to transients as...

  18. ASCR Leadership Computing Challenge Requests for Time Due February...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    laboratories, academia and industry. This program allocates time at NERSC and the Leadership Computing Facilities at Argonne and Oak Ridge. Areas of interest are: Advancing...

  19. Verification of the Time Evolution of Cosmological Simulations...

    Office of Scientific and Technical Information (OSTI)

    Journal Article: Verification of the Time Evolution of Cosmological Simulations via Hypothesis-Driven Comparative and Quantitative Visualization Citation Details In-Document Search...

  20. Prospects for Electron Imaging with Ultrafast Time Resolution...

    Office of Scientific and Technical Information (OSTI)

    Service, Springfield, VA at Many pivotal aspects of material science, biomechanics, and chemistry would benefit from nanometer imaging with ultrafast time resolution....

  1. Scalable Run Time Data Collection Analysis and Visualization...

    Office of Scientific and Technical Information (OSTI)

    Data Collection Analysis and Visualization (Presentation). Citation Details In-Document Search Title: Scalable Run Time Data Collection Analysis and Visualization (Presentation). ...

  2. Acquisition Letter on the Implications of Time-Limited Funds

    Broader source: [DOE]

    The attached Acquisition Letter has been issued to provide guidance to Contracting Officers on the implications of time-limited funding on contract planning, award, and administration.

  3. Provably secure time distribution for the electric grid

    SciTech Connect (OSTI)

    Smith IV, Amos M; Evans, Philip G; Williams, Brian P; Grice, Warren P


    We demonstrate a quantum time distribution (QTD) method that combines the precision of optical timing techniques with the integrity of quantum key distribution (QKD). Critical infrastructure is dependent on microprocessor- and programmable logic-based monitoring and control systems. The distribution of timing information across the electric grid is accomplished by GPS signals which are known to be vulnerable to spoofing. We demonstrate a method for synchronizing remote clocks based on the arrival time of photons in a modifed QKD system. This has the advantage that the signal can be veried by examining the quantum states of the photons similar to QKD.

  4. Tracking Living Cells as They Differentiate in Real Time

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Tracking Living Cells as They Differentiate in Real Time Print Protein phosphorylation regulates protein function in a cell, either activating or inactivating the proteins...

  5. Scientists Probe Lithium-Sulfur Batteries in Real Time - Joint...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7, 2012, Videos Scientists Probe Lithium-Sulfur Batteries in Real Time Lithium-sulfur batteries are a promising technology that could some day power electric vehicles. Scientists ...

  6. DOE Announces Webinars on Real Time Energy Management, Solar Forecasting

    Broader source: (indexed) [DOE]

    Metrics, and More | Department of Energy February 4: Live Webinar on Real Time Energy Management Webinar Sponsor: Better Buildings Challenge The Energy Department will present a live webinar titled "Real-time Energy Management: Improving Energy Efficiency Every 15 Minutes" on Tuesday, February 4, from 3:00 p.m. to 4:00 p.m. Eastern Standard Time. This webinar will feature three Better Buildings Challenge partners that are employing real-time energy management to achieve their

  7. Time-Resolved Optical Measurements of Shock-Induced Chemistry...

    Office of Scientific and Technical Information (OSTI)

    Title: Time-Resolved Optical Measurements of Shock-Induced Chemistry in Energetic Materials. Abstract not provided. Authors: Wixom, Ryan R. ; Knepper, Robert ; Tappan, Alexander S. ...

  8. Towards a Real-Time Cluster Computing Infrastructure

    SciTech Connect (OSTI)

    Hui, Peter SY; Chikkagoudar, Satish; Chavarría-Miranda, Daniel; Johnston, Mark R.


    Real-time computing has traditionally been considered largely in the context of single-processor and embedded systems, and indeed, the terms real-time computing, embedded systems, and control systems are often mentioned in closely related contexts. However, real-time computing in the context of multinode systems, specifically high-performance, cluster-computing systems, remains relatively unexplored, largely due to the fact that until now, there has not been a need for such an environment. In this paper, we motivate the need for a cluster computing infrastructure capable of supporting computation over large datasets in real-time. Our motivating example is an analytical framework to support the next generation North American power grid, which is growing both in size and complexity. With streaming sensor data in the future power grid potentially reaching rates on the order of terabytes per day, the task of analyzing this data subject to real-time guarantees becomes a daunting task which will require the power of high-performance cluster computing capable of functioning under real-time constraints. One specific challenge that such an environment presents is the need for real-time networked communication between cluster nodes. In this paper, we discuss the need for real-time high-performance cluster computation, along with our work-in-progress towards an infrastructure which will ultimately enable such an environment.

  9. Uranium Processing Facility Site Readiness Subproject Completed on Time and

    National Nuclear Security Administration (NNSA)

    Under Budget | National Nuclear Security Administration Uranium Processing Facility Site Readiness Subproject Completed on Time and Under Budget March 13, 2015 The Uranium Processing Facility (UPF) project celebrates its first major milestone with the completion of site readiness work, delivered on time and under budget. File 2015-03-13

  10. Real-time hydro coordination and economic hydro optimization

    SciTech Connect (OSTI)

    Dasigenis, A.T.; Garcia-San Pedro, A.R.


    This paper addresses the real-time aspects of the Hydro-Thermal Coordination problem. It describes the real-time modeling and monitoring of hydro resources, and the use of the resulting real-time hydraulic data in the on-line Economic Dispatch algorithm. A variable head, hydro loss model is incorporated that allows for on-line changes to the hydro topology. The method presented provides the operator with a current view of the available water resources, enables the validation of the real-time hydro data received from the field, and enables real-time optimization of the Hydro-Thermal Unit Commitment plan. The implementation of this approach on the Iberdrola system in Spain is described.

  11. Translation invariant time-dependent solutions to massive gravity II

    SciTech Connect (OSTI)

    Mourad, J.; Steer, D.A. E-mail:


    This paper is a sequel to JCAP 12 (2013) 004 and is also devoted to translation-invariant solutions of ghost-free massive gravity in its moving frame formulation. Here we consider a mass term which is linear in the vielbein (corresponding to a ?{sub 3} term in the 4D metric formulation) in addition to the cosmological constant. We determine explicitly the constraints, and from the initial value formulation show that the time-dependent solutions can have singularities at a finite time. Although the constraints give, as in the ?{sub 1} case, the correct number of degrees of freedom for a massive spin two field, we show that the lapse function can change sign at a finite time causing a singular time evolution. This is very different to the ?{sub 1} case where time evolution is always well defined. We conclude that the ?{sub 3} mass term can be pathological and should be treated with care.

  12. Sublinear scaling for time-dependent stochastic density functional theory

    SciTech Connect (OSTI)

    Gao, Yi; Neuhauser, Daniel; Baer, Roi; Rabani, Eran


    A stochastic approach to time-dependent density functional theory is developed for computing the absorption cross section and the random phase approximation (RPA) correlation energy. The core idea of the approach involves time-propagation of a small set of stochastic orbitals which are first projected on the occupied space and then propagated in time according to the time-dependent Kohn-Sham equations. The evolving electron density is exactly represented when the number of random orbitals is infinite, but even a small number (≈16) of such orbitals is enough to obtain meaningful results for absorption spectrum and the RPA correlation energy per electron. We implement the approach for silicon nanocrystals using real-space grids and find that the overall scaling of the algorithm is sublinear with computational time and memory.

  13. Time varying voltage combustion control and diagnostics sensor

    DOE Patents [OSTI]

    Chorpening, Benjamin T.; Thornton, Jimmy D.; Huckaby, E. David; Fincham, William


    A time-varying voltage is applied to an electrode, or a pair of electrodes, of a sensor installed in a fuel nozzle disposed adjacent the combustion zone of a continuous combustion system, such as of the gas turbine engine type. The time-varying voltage induces a time-varying current in the flame which is measured and used to determine flame capacitance using AC electrical circuit analysis. Flame capacitance is used to accurately determine the position of the flame from the sensor and the fuel/air ratio. The fuel and/or air flow rate (s) is/are then adjusted to provide reduced flame instability problems such as flashback, combustion dynamics and lean blowout, as well as reduced emissions. The time-varying voltage may be an alternating voltage and the time-varying current may be an alternating current.

  14. Confined quantum time of arrival for the vanishing potential

    SciTech Connect (OSTI)

    Galapon, Eric A.; Caballar, Roland F.; Bahague, Ricardo


    We give full account of our recent report in E. A. Galapon, R. Caballar, and R. Bahague, Phys. Rev. Lett. 93, 180406 (2004), where it is shown that formulating the free quantum time of arrival problem in a segment of the real line suggests rephrasing the quantum time of arrival problem to finding a complete set of states that evolve to unitarily arrive at a given point at a definite time. For a spatially confined particle, here it is shown explicitly that the problem admits a solution in the form of an eigenvalue problem of a class of compact and self-adjoint time of arrival operators derived by a quantization of the classical time of arrival. The eigenfunctions of these operators are numerically demonstrated to unitarily arrive at the origin at their respective eigenvalues.

  15. Transit light curves with finite integration time: Fisher information analysis

    SciTech Connect (OSTI)

    Price, Ellen M.; Rogers, Leslie A.


    Kepler has revolutionized the study of transiting planets with its unprecedented photometric precision on more than 150,000 target stars. Most of the transiting planet candidates detected by Kepler have been observed as long-cadence targets with 30 minute integration times, and the upcoming Transiting Exoplanet Survey Satellite will record full frame images with a similar integration time. Integrations of 30 minutes affect the transit shape, particularly for small planets and in cases of low signal to noise. Using the Fisher information matrix technique, we derive analytic approximations for the variances and covariances on the transit parameters obtained from fitting light curve photometry collected with a finite integration time. We find that binning the light curve can significantly increase the uncertainties and covariances on the inferred parameters when comparing scenarios with constant total signal to noise (constant total integration time in the absence of read noise). Uncertainties on the transit ingress/egress time increase by a factor of 34 for Earth-size planets and 3.4 for Jupiter-size planets around Sun-like stars for integration times of 30 minutes compared to instantaneously sampled light curves. Similarly, uncertainties on the mid-transit time for Earth and Jupiter-size planets increase by factors of 3.9 and 1.4. Uncertainties on the transit depth are largely unaffected by finite integration times. While correlations among the transit depth, ingress duration, and transit duration all increase in magnitude with longer integration times, the mid-transit time remains uncorrelated with the other parameters. We provide code in Python and Mathematica for predicting the variances and covariances at

  16. Multi-time Schrdinger equations cannot contain interaction potentials

    SciTech Connect (OSTI)

    Petrat, Sren; Tumulka, Roderich


    Multi-time wave functions are wave functions that have a time variable for every particle, such as ?(t{sub 1},x{sub 1},...,t{sub N},x{sub N}). They arise as a relativistic analog of the wave functions of quantum mechanics but can be applied also in quantum field theory. The evolution of a wave function with N time variables is governed by N Schrdinger equations, one for each time variable. These Schrdinger equations can be inconsistent with each other, i.e., they can fail to possess a joint solution for every initial condition; in fact, the N Hamiltonians need to satisfy a certain commutator condition in order to be consistent. While this condition is automatically satisfied for non-interacting particles, it is a challenge to set up consistent multi-time equations with interaction. We prove for a wide class of multi-time Schrdinger equations that the presence of interaction potentials (given by multiplication operators) leads to inconsistency. We conclude that interaction has to be implemented instead by creation and annihilation of particles, which, in fact, can be done consistently [S. Petrat and R. Tumulka, Multi-time wave functions for quantum field theory, Ann. Physics (to be published)]. We also prove the following result: When a cut-off length ? > 0 is introduced (in the sense that the multi-time wave function is defined only on a certain set of spacelike configurations, thereby breaking Lorentz invariance), then the multi-time Schrdinger equations with interaction potentials of range ? are consistent; however, in the desired limit ? ? 0 of removing the cut-off, the resulting multi-time equations are interaction-free, which supports the conclusion expressed in the title.

  17. A distributed timing system for sychronizing control and data correlation

    SciTech Connect (OSTI)

    Stettler, M.; Thout, M.; Dalesio, L.R.; Cole, R.; Fite, C.; Slentz, G.; Warren, D.


    Synchronization is necessary in experimental physics machines to provide positive control over related events. The Ground Test Accelerator (GTA) timing system provides this function through a distributed control system, known as the Experimental Physics and Industrial Control System (EPICS). The EPICS timing system was designed to take advantage of a distributed architecture, and provides time stamping for synchronous data correlation as well as event control. The system has been successfully demonstrated on over a dozen controller nodes for operation and data analysis. The design of the hardware, software, and operational results are discussed.

  18. A new method for measurement of safety rod drop times

    SciTech Connect (OSTI)

    Pesic, M.; Stefanovic, D. ); Marinkovic, P. )


    In this paper, a new method for the accurate measurement of safety rod drop times is proposed. It is based on a fast electromagnetic transducer and an analog-to-digital converter (ADC) conected to a computer system. Evaluation of recorded data is conducted by a developed computer code. The first measurements performed at the HERBE fast-thermal RB reactor show that a relative uncertainty (confidence level 95%) of less than 6% can be achieved in determination of rod drop time (with time intervals ranging from 0.4-10.0 s). Further improvements in accuracy are possible.

  19. Continuous time-of-flight ion mass spectrometer

    DOE Patents [OSTI]

    Funsten, Herbert O.; Feldman, William C.


    A continuous time-of-flight mass spectrometer having an evacuated enclosure with means for generating an electric field located in the evacuated enclosure and means for injecting a sample material into the electric field. A source of continuous ionizing radiation injects ionizing radiation into the electric field to ionize atoms or molecules of the sample material, and timing means determine the time elapsed between arrival of a secondary electron out of said ionized atoms or molecules at a first predetermined location and arrival of a sample ion out of said ionized atoms or molecules at a second predetermined location.

  20. Domain decomposition in time for PDE-constrained optimization

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Barker, Andrew T.; Stoll, Martin


    Here, PDE-constrained optimization problems have a wide range of applications, but they lead to very large and ill-conditioned linear systems, especially if the problems are time dependent. In this paper we outline an approach for dealing with such problems by decomposing them in time and applying an additive Schwarz preconditioner in time, so that we can take advantage of parallel computers to deal with the very large linear systems. We then illustrate the performance of our method on a variety of problems.

  1. The Origin of the Universe and the Arrow of Time

    ScienceCinema (OSTI)

    Carroll, Sean


    Over a century ago, Boltzmann and others provided a microscopic understanding for the tendency of entropy to increase. But this understanding relies ultimately on an empirical fact about cosmology: the early universe had very low entropy. Why was it like that? Cosmologist aspire to provide a dynamical explanation for the observed state of the universe, but have had very little to say about the dramatic asymmetry between early times and late times. I will argue that the search for a natural explanation for the observed breakdown of time-reversal symmetry in cosmology leads us directly to interesting conclusions about inflation, quantum gravity, and the multiverse.

  2. Rise Time Measurement for Ultrafast X-Ray Pulses

    DOE Patents [OSTI]

    Celliers, Peter M.; Weber, Franz A.; Moon, Stephen J.


    A pump-probe scheme measures the rise time of ultrafast x-ray pulses. Conventional high speed x-ray diagnostics (x-ray streak cameras, PIN diodes, diamond PCD devices) do not provide sufficient time resolution to resolve rise times of x-ray pulses on the order of 50 fs or less as they are being produced by modern fast x-ray sources. Here, we are describing a pump-probe technique that can be employed to measure events where detector resolution is insufficient to resolve the event. The scheme utilizes a diamond plate as an x-ray transducer and a p-polarized probe beam.

  3. Rise time measurement for ultrafast X-ray pulses

    DOE Patents [OSTI]

    Celliers, Peter M.; Weber, Franz A.; Moon, Stephen J.


    A pump-probe scheme measures the rise time of ultrafast x-ray pulses. Conventional high speed x-ray diagnostics (x-ray streak cameras, PIN diodes, diamond PCD devices) do not provide sufficient time resolution to resolve rise times of x-ray pulses on the order of 50 fs or less as they are being produced by modern fast x-ray sources. Here, we are describing a pump-probe technique that can be employed to measure events where detector resolution is insufficient to resolve the event. The scheme utilizes a diamond plate as an x-ray transducer and a p-polarized probe beam.

  4. Property:EstimatedTimeMedian | Open Energy Information

    Open Energy Info (EERE)

    week,w,Week,Weeks,W,WEEK,WEEKS 12 months,month,m,Month,Months,M,MONTH,MONTHS 1 years,year,y,Year,Years,Y,YEAR,YEARS Pages using the property "EstimatedTimeMedian" Showing 25 pages...

  5. Property:EstimatedTimeLow | Open Energy Information

    Open Energy Info (EERE)

    week,w,Week,Weeks,W,WEEK,WEEKS 12 months,month,m,Month,Months,M,MONTH,MONTHS 1 years,year,y,Year,Years,Y,YEAR,YEARS Pages using the property "EstimatedTimeLow" Showing 25 pages...

  6. Property:EstimatedTimeHigh | Open Energy Information

    Open Energy Info (EERE)

    week,w,Week,Weeks,W,WEEK,WEEKS 12 months,month,m,Month,Months,M,MONTH,MONTHS 1 years,year,y,Year,Years,Y,YEAR,YEARS Pages using the property "EstimatedTimeHigh" Showing 25 pages...

  7. Time Domain Partitioning of Electricity Production Cost Simulations

    SciTech Connect (OSTI)

    Barrows, C.; Hummon, M.; Jones, W.; Hale, E.


    Production cost models are often used for planning by simulating power system operations over long time horizons. The simulation of a day-ahead energy market can take several weeks to compute. Tractability improvements are often made through model simplifications, such as: reductions in transmission modeling detail, relaxation of commitment variable integrality, reductions in cost modeling detail, etc. One common simplification is to partition the simulation horizon so that weekly or monthly horizons can be simulated in parallel. However, horizon partitions are often executed with overlap periods of arbitrary and sometimes zero length. We calculate the time domain persistence of historical unit commitment decisions to inform time domain partitioning of production cost models. The results are implemented using PLEXOS production cost modeling software in an HPC environment to improve the computation time of simulations while maintaining solution integrity.

  8. Impact of Extended Daylight Saving Time on national energy consumption

    SciTech Connect (OSTI)

    Belzer, David B.; Hadley, Stanton W.; Chin, Shih -Miao


    This report presents the detailed results, data, and analytical methods used in the DOE Report to Congress on the impacts of Extended Daylight Saving Time on the U.S. national energy consumption.

  9. Impact of Extended Daylight Saving Time on national energy consumption

    SciTech Connect (OSTI)

    Belzer, David B.; Hadley, Stanton W.; Chin, Shih -Miao


    This report presents the detailed results, data, and analytical methods used in the DOE Report to Congress on the impacts of Extended Daylight Saving Time on the national energy consumption.

  10. The PDV Velocity History and Shock Arrival Time Analyzer

    Energy Science and Technology Software Center (OSTI)


    This software allows the user to analyze heterodyne beat signals generated when a Doppler-shifted laser light interacts with un-shifted laser light. The software analyzes the data in a joint time frequency domain to extract instantaneous velocity.

  11. Privacy Act Fees and Time Limits | National Nuclear Security...

    National Nuclear Security Administration (NNSA)

    of the DOE to provide an individual with one copy of his or her requested records free of charge. The Act does not stipulate a time frame for an agency to provide access to...

  12. Femtosecond Time-Delay X-ray Holography

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Time-Delay X-ray Holography X-ray free-electron lasers (XFELs) will produce photon pulses with a unique and desirable combination of properties. Their short X-ray wavelengths allow...

  13. Nanosecond Time Resolved and Steady State Infrared Studies of...

    Office of Scientific and Technical Information (OSTI)

    Ultrafast time-resolved infrared and steady state Fourier transform IR (FTIR) spectroscopies were used to probe TATB and its products after photoexcitation with a 5 ns pulse of 532 ...

  14. Time-Resolved Study of Bonding in Liquid Carbon

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Lindenberg, O.R. Monteiro, Z. Chang, R.W. Lee, and R.W. Falcone, "Bonding in liquid carbon studied by time-resolved x-ray absorption spectroscopy," Phys. Rev. Lett. 94 057407 (2005...

  15. On timing properties of LYSO-based calorimeters (Journal Article...

    Office of Scientific and Technical Information (OSTI)

    Journal Article: On timing properties of LYSO-based calorimeters Citation Details ... Report Number(s): FERMILAB-PUB--15-243-PPD Journal ID: ISSN 0168-9002; PII: ...

  16. Effect of noise on time-dependent quantum chaos

    SciTech Connect (OSTI)

    Ott, E.; Antonsen T.M. Jr.; Hanson, J.D.


    The dynamics of a time-dependent quantum system can be qualitatively different from that of its classical counterpart when the latter is chaotic. It is shown that small noise can strongly alter this situation.

  17. Time-delayed directional beam phased array antenna

    DOE Patents [OSTI]

    Fund, Douglas Eugene; Cable, John William; Cecil, Tony Myron


    An antenna comprising a phased array of quadrifilar helix or other multifilar antenna elements and a time-delaying feed network adapted to feed the elements. The feed network can employ a plurality of coaxial cables that physically bridge a microstrip feed circuitry to feed power signals to the elements. The cables provide an incremental time delay which is related to their physical lengths, such that replacing cables having a first set of lengths with cables having a second set of lengths functions to change the time delay and shift or steer the antenna's main beam. Alternatively, the coaxial cables may be replaced with a programmable signal processor unit adapted to introduce the time delay using signal processing techniques applied to the power signals.

  18. Measurement of the cosmic ray spectrum above 4 $\\times$ 10$^...

    Office of Scientific and Technical Information (OSTI)

    Journal Article: Measurement of the cosmic ray spectrum above 4 times 1018 eV using inclined events detected with the Pierre Auger Observatory Citation Details In-Document...

  19. New Real-Time Quantum Efficiency Measurement System: Preprint

    SciTech Connect (OSTI)

    Young, D. L.; Egaas, B.; Pinegar, S.; Stradins, P.


    This paper describes a newly developed technique for measuring the quantum eficiiency in solar cells in real-time using a unique, electronically controlled, full-spectrum light source.

  20. Time phased alternate blending of feed coals for liquefaction

    DOE Patents [OSTI]

    Schweigharett, Frank; Hoover, David S.; Garg, Diwaker


    The present invention is directed to a method for reducing process performance excursions during feed coal or process solvent changeover in a coal hydroliquefaction process by blending of feedstocks or solvents over time. ,

  1. ARM - PI Product - Dead-time Corrected Disdrometer Data

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ProductsDead-time Corrected Disdrometer Data ARM Data Discovery Browse Data Comments? We would love to hear from you Send us a note below or call us at 1-888-ARM-DATA. Send PI...

  2. Statistical Stability and Time-Reversal Imgaing in Random Media

    SciTech Connect (OSTI)

    Berryman, J; Borcea, L; Papanicolaou, G; Tsogka, C


    Localization of targets imbedded in a heterogeneous background medium is a common problem in seismic, ultrasonic, and electromagnetic imaging problems. The best imaging techniques make direct use of the eigenfunctions and eigenvalues of the array response matrix, as recent work on time-reversal acoustics has shown. Of the various imaging functionals studied, one that is representative of a preferred class is a time-domain generalization of MUSIC (MUltiple Signal Classification), which is a well-known linear subspace method normally applied only in the frequency domain. Since statistical stability is not characteristic of the frequency domain, a transform back to the time domain after first diagonalizing the array data in the frequency domain takes optimum advantage of both the time-domain stability and the frequency-domain orthogonality of the relevant eigenfunctions.

  3. Electrodynamics on {kappa}-Minkowski space-time

    SciTech Connect (OSTI)

    Harikumar, E.; Juric, T.; Meljanac, S.


    In this paper, we derive Lorentz force and Maxwell's equations on kappa-Minkowski space-time up to the first order in the deformation parameter. This is done by elevating the principle of minimal coupling to noncommutative space-time. We also show the equivalence of minimal coupling prescription and Feynman's approach. It is shown that the motion in kappa space-time can be interpreted as motion in a background gravitational field, which is induced by this noncommutativity. In the static limit, the effect of kappa deformation is to scale the electric charge. We also show that the laws of electrodynamics depend on the mass of the charged particle, in kappa space-time.

  4. Gasoline Compression Ignition - Start of Injection Timing Sweep...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us For more information, contact Greg Cunningham at (630) 252-8232 or Gasoline Compression Ignition - Start of Injection Timing Sweep (VERIFI) Share Topic...

  5. Looking at Transistor Gate Oxide Formation in Real Time

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Looking at Transistor Gate Oxide Formation in Real Time Print The oxide gate layer is critical to every transistor, and present-day layer thicknesses are in the 10-20 range (1-2...

  6. Real-Time Dynamics Monitoring System with Synchronized Phasor Measurements

    Energy Science and Technology Software Center (OSTI)


    The Real-Time Dynamics Monitoring System is designed to monitor the dynamics within the power grid and assess the system behavior during normal and disturbance conditions. The RTDMS application was built on the Grid-3P technology platform and takes real-time information collected by Synchronized Phasor Measurement Units (PMU5) or other collection devices and transmitted to a central Phasor Data Concentrator (PDC) for monitoring grid dynamics. The data is sampled 30 times per second and is time-synchronized. Thismore » data is processed to create graphical and geographical displays to provide visualization for frequency/frequency response, voltage magnitudes and angles, voltage angle differences across critical paths as well as real and reactive power-flows on a sub-second and second basis. Software allows for monitoring, tracking, historical data archiving and electric system troubleshooting for reliability management.« less

  7. Tiered time-of-use rates | OpenEI Community

    Open Energy Info (EERE)

    Tiered time-of-use rates Home > Groups > Utility Rate Hello Last year, I found OpenEI via NREL's System Advisor Model, when I was considering a PV system for my home in PG&E's...

  8. Time-Resolved Study of Bonding in Liquid Carbon

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Time-Resolved Study of Bonding in Liquid Carbon Print We are accustomed to observing carbon in its elemental form as a solid, ranging from the soft "lead" in pencils to the...

  9. Gasoline prices fall for first time this year (short version...

    U.S. Energy Information Administration (EIA) Indexed Site

    short version) The U.S. average retail price for regular gasoline fell for the first time this year to 3.76 a gallon on Monday. That's down 2 12 cents from a week ago, based on ...

  10. Gasoline prices increase for first time since February (short...

    U.S. Energy Information Administration (EIA) Indexed Site

    (short version) The U.S. average retail price for regular gasoline rose for the first time since February to 3.54 a gallon on Monday. That's up 1.8 cents from a week ago, based ...

  11. Gasoline prices decrease nationally for first time in 4 weeks...

    U.S. Energy Information Administration (EIA) Indexed Site

    (short version) The U.S. average retail price for regular gasoline fell for the first time in three weeks to 3.67 a gallon on Monday. That's down 1.6 cents from a week ago, ...

  12. Gasoline prices increase for first time since February (long...

    U.S. Energy Information Administration (EIA) Indexed Site

    (long version) The U.S. average retail price for regular gasoline rose for the first time since February to 3.54 a gallon on Monday. That's up 1.8 cents from a week ago, based on ...

  13. Gasoline prices fall for first time this year (long version)

    U.S. Energy Information Administration (EIA) Indexed Site

    long version) The U.S. average retail price for regular gasoline fell for the first time this year to 3.76 a gallon on Monday. That's down 2 12 cents from a week ago, based on ...

  14. Meaningful Money Gifts at Holiday Time | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Meaningful Money Gifts at Holiday Time Give a small child a gift of money and they'll give you a sideways look and sheepish, "Thanks." They usually prefer boxes with big bows that...

  15. Idaho Instruction for Filing a Request for Extension of Time...

    Open Energy Info (EERE)

    Instruction for Filing a Request for Extension of Time to Submit Proof of Beneficial Use Jump to: navigation, search OpenEI Reference LibraryAdd to library PermittingRegulatory...

  16. Accessing Your Account for the First Time.............................................................................................................2

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Responding to an RFQ Table of Contents Accessing Your Account for the First Time.............................................................................................................2 How to View Open RFQs...........................................................................................................................................3 How to Download Attachments from the RFQ......................................................................................................4

  17. Financial Times-World Energy Council Energy Leaders Summit |...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Financial Times-World Energy Council Energy Leaders Summit September 16, 2008 - 3:43pm Addthis Remarks for (Acting) Deputy Energy Secretary Jeffrey F. Kupfer Thank you very much. ...

  18. Pulsar timing signal from ultralight scalar dark matter

    SciTech Connect (OSTI)

    Khmelnitsky, Andrei; Rubakov, Valery E-mail:


    An ultralight free scalar field with mass around 10{sup ?23}?10{sup ?22} eV is a viable dark mater candidate, which can help to resolve some of the issues of the cold dark matter on sub-galactic scales. We consider the gravitational field of the galactic halo composed out of such dark matter. The scalar field has oscillating in time pressure, which induces oscillations of gravitational potential with amplitude of the order of 10{sup ?15} and frequency in the nanohertz range. This frequency is in the range of pulsar timing array observations. We estimate the magnitude of the pulse arrival time residuals induced by the oscillating gravitational potential. We find that for a range of dark matter masses, the scalar field dark matter signal is comparable to the stochastic gravitational wave signal and can be detected by the planned SKA pulsar timing array experiment.

  19. Green's function analysis of homogeneous slab time eigenvalues

    SciTech Connect (OSTI)

    Kornreich, D. E.; Parsons, Donald Kent


    Several recent papers have examined higher mode eigenvalues and eigenfunctions for multiplying systems. One of the goals of these analyses was to produce benchmark-quality results of the fundamental multiplication eigenvalue along with associated higher mode eigenvalues. The Green's Function Method (GFM) was found to be quite useful in these analyses. In this paper we extend our use of the GFM to include the calculation of real time eigenvalues. Many large-scale transport codes have difficulty calculating negative time eigenvalues, and the availability of benchmark-quality positive time eigenvalues is also scarce. Thus, we enhance the suite of benchmark-quality results for nuclear code developers by adding some time eigenvalue results.

  20. Eigenfunction Expansion of the Space-Time Dependent Neutron Survival

    Office of Scientific and Technical Information (OSTI)

    Probability. (Conference) | SciTech Connect Eigenfunction Expansion of the Space-Time Dependent Neutron Survival Probability. Citation Details In-Document Search Title: Eigenfunction Expansion of the Space-Time Dependent Neutron Survival Probability. Abstract not provided. Authors: Kamm, Ryan James ; Prinja, Anil K. Publication Date: 2013-10-01 OSTI Identifier: 1117182 Report Number(s): SAND2013-9422C 480812 DOE Contract Number: AC04-94AL85000 Resource Type: Conference Resource Relation:

  1. Eigenfunction Expansion of the Space-Time Dependent Neutron Survival

    Office of Scientific and Technical Information (OSTI)

    Probability. (Journal Article) | SciTech Connect Journal Article: Eigenfunction Expansion of the Space-Time Dependent Neutron Survival Probability. Citation Details In-Document Search Title: Eigenfunction Expansion of the Space-Time Dependent Neutron Survival Probability. Abstract not provided. Authors: Kamm, Ryan James ; Prinja, Anil K. Publication Date: 2013-07-01 OSTI Identifier: 1106880 Report Number(s): SAND2013-5731J 465496 DOE Contract Number: AC04-94AL85000 Resource Type: Journal

  2. Experimental signatures of phase interference and subfemtosecond time

    Office of Scientific and Technical Information (OSTI)

    dynamics on the incident energy axis of resonant inelastic x-ray scattering (Journal Article) | SciTech Connect Experimental signatures of phase interference and subfemtosecond time dynamics on the incident energy axis of resonant inelastic x-ray scattering Citation Details In-Document Search Title: Experimental signatures of phase interference and subfemtosecond time dynamics on the incident energy axis of resonant inelastic x-ray scattering Authors: Wray, L. Andrew ; Huang, Shih-Wen ; Xia,

  3. Genetically encoded sensors enable real-time observation of metabolite

    Office of Scientific and Technical Information (OSTI)

    production (Journal Article) | SciTech Connect Genetically encoded sensors enable real-time observation of metabolite production Citation Details In-Document Search This content will become publicly available on August 8, 2016 Title: Genetically encoded sensors enable real-time observation of metabolite production Authors: Rogers, Jameson K. ; Church, George M. Publication Date: 2016-02-08 OSTI Identifier: 1237386 Type: Published Article Journal Name: Proceedings of the National Academy of

  4. Fueling Innovation -- 100 MPGe at a Time | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Innovation -- 100 MPGe at a Time Fueling Innovation -- 100 MPGe at a Time August 4, 2010 - 2:48pm Addthis X Prize contenders take part in on-track testing at Michigan International Speedway | Courtesy of Progressive Automotive X Prize X Prize contenders take part in on-track testing at Michigan International Speedway | Courtesy of Progressive Automotive X Prize John Schueler John Schueler Former New Media Specialist, Office of Public Affairs What does this project do? Develops the next

  5. Tracking Living Cells as They Differentiate in Real Time

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Tracking Living Cells as They Differentiate in Real Time Tracking Living Cells as They Differentiate in Real Time Print Thursday, 27 September 2012 00:00 Protein phosphorylation regulates protein function in a cell, either activating or inactivating the proteins responsible for many cell functions ranging from cell proliferation to differentiation to metabolism to signaling, and even programmed cell death. This chemical process has been studied intensively, but until now it has been impossible

  6. Optimal observation time window for forecasting the next earthquake

    SciTech Connect (OSTI)

    Omi, Takahiro; Shinomoto, Shigeru; Kanter, Ido


    We report that the accuracy of predicting the occurrence time of the next earthquake is significantly enhanced by observing the latest rate of earthquake occurrences. The observation period that minimizes the temporal uncertainty of the next occurrence is on the order of 10 hours. This result is independent of the threshold magnitude and is consistent across different geographic areas. This time scale is much shorter than the months or years that have previously been considered characteristic of seismic activities.

  7. PPPL physicists win supercomputing time to simulate key energy and

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    astrophysical phenomena | Princeton Plasma Physics Lab physicists win supercomputing time to simulate key energy and astrophysical phenomena By John Greenwald January 8, 2013 Tweet Widget Google Plus One Share on Facebook Gallery: Three teams led by scientists at the U.S. Department of Energy's (DOE) Princeton Plasma Physics Laboratory (PPPL) have won major blocks of time on two of the world's most powerful supercomputers. Two of the projects seek to advance the development of nuclear fusion

  8. Simplicity of first passage time distributions for common complex

    Office of Scientific and Technical Information (OSTI)

    biochemical processes (Conference) | SciTech Connect Conference: Simplicity of first passage time distributions for common complex biochemical processes Citation Details In-Document Search Title: Simplicity of first passage time distributions for common complex biochemical processes No abstract prepared. Authors: Bell, Golan [1] ; Munsky, Brian [1] ; Nemenman, Iiya [1] + Show Author Affiliations Los Alamos National Laboratory Publication Date: 2009-04-07 OSTI Identifier: 988321 Report

  9. Simplicity of first passage time distributions for common complex

    Office of Scientific and Technical Information (OSTI)

    biochemical processes (Conference) | SciTech Connect Conference: Simplicity of first passage time distributions for common complex biochemical processes Citation Details In-Document Search Title: Simplicity of first passage time distributions for common complex biochemical processes × You are accessing a document from the Department of Energy's (DOE) SciTech Connect. This site is a product of DOE's Office of Scientific and Technical Information (OSTI) and is provided as a public service.

  10. Specificity and completion time distributions of biochemical processes

    Office of Scientific and Technical Information (OSTI)

    (Journal Article) | SciTech Connect Journal Article: Specificity and completion time distributions of biochemical processes Citation Details In-Document Search Title: Specificity and completion time distributions of biochemical processes In order to produce specific complex structures from a large set of similar biochemical building blocks, many biochemical systems require high sensitivity to small molecular differences. The first and most common mqdel used to explain this high specificity

  11. Specificity and completion time distributions of biochemical processes

    Office of Scientific and Technical Information (OSTI)

    (Journal Article) | SciTech Connect Journal Article: Specificity and completion time distributions of biochemical processes Citation Details In-Document Search Title: Specificity and completion time distributions of biochemical processes × You are accessing a document from the Department of Energy's (DOE) SciTech Connect. This site is a product of DOE's Office of Scientific and Technical Information (OSTI) and is provided as a public service. Visit OSTI to utilize additional information

  12. Geometric multigrid for an implicit-time immersed boundary method

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Guy, Robert D.; Philip, Bobby; Griffith, Boyce E.


    The immersed boundary (IB) method is an approach to fluid-structure interaction that uses Lagrangian variables to describe the deformations and resulting forces of the structure and Eulerian variables to describe the motion and forces of the fluid. Explicit time stepping schemes for the IB method require solvers only for Eulerian equations, for which fast Cartesian grid solution methods are available. Such methods are relatively straightforward to develop and are widely used in practice but often require very small time steps to maintain stability. Implicit-time IB methods permit the stable use of large time steps, but efficient implementations of such methodsmore » require significantly more complex solvers that effectively treat both Lagrangian and Eulerian variables simultaneously. Moreover, several different approaches to solving the coupled Lagrangian-Eulerian equations have been proposed, but a complete understanding of this problem is still emerging. This paper presents a geometric multigrid method for an implicit-time discretization of the IB equations. This multigrid scheme uses a generalization of box relaxation that is shown to handle problems in which the physical stiffness of the structure is very large. Numerical examples are provided to illustrate the effectiveness and efficiency of the algorithms described herein. Finally, these tests show that using multigrid as a preconditioner for a Krylov method yields improvements in both robustness and efficiency as compared to using multigrid as a solver. They also demonstrate that with a time step 100–1000 times larger than that permitted by an explicit IB method, the multigrid-preconditioned implicit IB method is approximately 50–200 times more efficient than the explicit method.« less

  13. Time differentiated nuclear resonance spectroscopy coupled with pulsed

    Office of Scientific and Technical Information (OSTI)

    laser heating in diamond anvil cells (Journal Article) | SciTech Connect Time differentiated nuclear resonance spectroscopy coupled with pulsed laser heating in diamond anvil cells Citation Details In-Document Search Title: Time differentiated nuclear resonance spectroscopy coupled with pulsed laser heating in diamond anvil cells Developments in pulsed laser heating applied to nuclear resonance techniques are presented together with their applications to studies of geophysically relevant

  14. Ultrafast chirped optical waveform recorder using a time microscope

    Office of Scientific and Technical Information (OSTI)

    (Patent) | DOEPatents Data Explorer Search Results Ultrafast chirped optical waveform recorder using a time microscope Title: Ultrafast chirped optical waveform recorder using a time microscope A new technique for capturing both the amplitude and phase of an optical waveform is presented. This technique can capture signals with many THz of bandwidths in a single shot (e.g., temporal resolution of about 44 fs), or be operated repetitively at a high rate. That is, each temporal window (or

  15. Impact of Extended Daylight Saving Time on National Energy Consumption,

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Technical Documentation | Department of Energy Technical Documentation Impact of Extended Daylight Saving Time on National Energy Consumption, Technical Documentation This report presents the detailed results, data, and analytical methods used in the DOE Report to Congress on the impacts of Extended Daylight Saving Time on the national energy consumption in the United States. PDF icon Technical Documentation for Report to Congress More Documents & Publications Impact of Extended Daylight

  16. National labs offer computing time to Japanese physicists | Jefferson Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    National labs offer computing time to Japanese physicists National labs offer computing time to Japanese physicists May 23, 2011 - Computational power from facilities at three U.S. Department of Energy national laboratories is aiding Japanese physicists in their quest to understand the interactions that lie at the heart of matter. From now until the end of 2011, while computing facilities in eastern Japan face continuing electricity shortages, a percentage of the computing power at Brookhaven

  17. Cooling by Time Reversal of Atomic Matter Waves

    SciTech Connect (OSTI)

    Martin, J.; Georgeot, B.; Shepelyansky, D. L. [Laboratoire de Physique Theorique, Universite de Toulouse III, CNRS, 31062 Toulouse (France)


    We propose an experimental scheme which allows us to realized approximate time reversal of matter waves for ultracold atoms in the regime of quantum chaos. We show that a significant fraction of the atoms return back to their original state, being at the same time cooled down by several orders of magnitude. We give a theoretical description of this effect supported by extensive numerical simulations. The proposed scheme can be implemented with existing experimental setups.

  18. OVIS: Scalable Run Time Data Collection Analysis and Visualization

    Office of Scientific and Technical Information (OSTI)

    (Abstract). (Conference) | SciTech Connect OVIS: Scalable Run Time Data Collection Analysis and Visualization (Abstract). Citation Details In-Document Search Title: OVIS: Scalable Run Time Data Collection Analysis and Visualization (Abstract). Abstract not provided. Authors: Chen, Frank Xiaoxiao ; Das, Ananya Publication Date: 2009-07-01 OSTI Identifier: 1141424 Report Number(s): SAND2009-4761C 506638 DOE Contract Number: DE-AC04-94AL85000 Resource Type: Conference Resource Relation:

  19. Real-time condition assessment of RAPTOR telescope systems (Conference) |

    Office of Scientific and Technical Information (OSTI)

    SciTech Connect Conference: Real-time condition assessment of RAPTOR telescope systems Citation Details In-Document Search Title: Real-time condition assessment of RAPTOR telescope systems × You are accessing a document from the Department of Energy's (DOE) SciTech Connect. This site is a product of DOE's Office of Scientific and Technical Information (OSTI) and is provided as a public service. Visit OSTI to utilize additional information resources in energy science and technology. A paper

  20. Real-time condition assessment of RAPTOR telescope systems (Journal

    Office of Scientific and Technical Information (OSTI)

    Article) | SciTech Connect Journal Article: Real-time condition assessment of RAPTOR telescope systems Citation Details In-Document Search Title: Real-time condition assessment of RAPTOR telescope systems × You are accessing a document from the Department of Energy's (DOE) SciTech Connect. This site is a product of DOE's Office of Scientific and Technical Information (OSTI) and is provided as a public service. Visit OSTI to utilize additional information resources in energy science and