Powered by Deep Web Technologies
Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

PIA - Savannah River Nuclear Solutions (SRNS) Human Resource...  

Office of Environmental Management (EM)

Solutions (SRNS) Human Resource Management System (HRMS) PIA - Savannah River Nuclear Solutions (SRNS) Human Resource Management System (HRMS) PIA - Savannah River Nuclear...

2

Department of Energy Cites Savannah River Nuclear Solutions for...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Savannah River Nuclear Solutions for Worker Safety and Health Violations Department of Energy Cites Savannah River Nuclear Solutions for Worker Safety and Health Violations October...

3

FY 2009 Savannah River Nuclear Solutions, LLC, PER Summary |...  

National Nuclear Security Administration (NNSA)

Savannah River Nuclear Solutions, LLC, PER Summary | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing...

4

Department of Energy Cites Savannah River Nuclear Solutions,...  

Energy Savers (EERE)

Solutions, LLC for Worker Safety and Health Violations Department of Energy Cites Savannah River Nuclear Solutions, LLC for Worker Safety and Health Violations November 9, 2012 -...

5

Savannah River Nuclear Solutions awards family scholarships | National  

National Nuclear Security Administration (NNSA)

Savannah River Nuclear Solutions awards family scholarships | National Savannah River Nuclear Solutions awards family scholarships | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Home > NNSA Blog > Savannah River Nuclear Solutions awards family scholarships Savannah River Nuclear Solutions awards family scholarships Posted By Office of Public Affairs Savannah River Nuclear Solutions awards family scholarships

6

PIA - Savannah River Nuclear Solution (SRNS) MedGate Occupational...  

Office of Environmental Management (EM)

Occupational Health and Safety Medical System (OHS) (Includes the Drug and Alcohol Testing System (Assistant)) PIA - Savannah River Nuclear Solution (SRNS) MedGate...

7

PIA - Savannah River Nuclear Solution (SRNS) Procurement Cycle...  

Energy Savers (EERE)

Occupational Health and Safety Medical System (OHS) (Includes the Drug and Alcohol Testing System (Assistant)) PIA - Savannah River Nuclear Solution (SRNS) Energy Employees...

8

PIA - Savannah River Nuclear Solution (SRNS) Energy Employees...  

Energy Savers (EERE)

Occupational Health and Safety Medical System (OHS) (Includes the Drug and Alcohol Testing System (Assistant)) PIA - Savannah River Nuclear Solution (SRNS) Procurement Cycle...

9

Preliminary Notice of Violation, Savannah River Nuclear Solutions, LLC -  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Preliminary Notice of Violation, Savannah River Nuclear Solutions, Preliminary Notice of Violation, Savannah River Nuclear Solutions, LLC - WEA-2010-05 Preliminary Notice of Violation, Savannah River Nuclear Solutions, LLC - WEA-2010-05 October 7, 2010 Preliminary Notice of Violation issued to Savannah River Nuclear Solutions, LLC related to a Nitric Acid Spill Event and an Electrical Arc Flash Injury Event at the Savannah River Site This letter refers to the Office of Health, Safety and Security's Office of Enforcement investigation into the facts and circumstances surrounding the nitric acid spill event that occurred in F Area on August 18, 2009, and the electrical arc flash injury that occurred in the D Area powerhouse on September 23, 2009, at the Savannah River Site. Based on an evaluation of the evidence in this matter, the U.S. Department of Energy (DOE) has

10

Preliminary Notice of Violation,Savannah River Nuclear Solutions, LLC -  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Savannah River Nuclear Solutions, Savannah River Nuclear Solutions, LLC - NEA-2011-02 Preliminary Notice of Violation,Savannah River Nuclear Solutions, LLC - NEA-2011-02 July 22, 2011 Preliminary Notice of Violation issued to Savannah River Nuclear Solutions, LLC related to a Puncture Wound Injury resulting in a Radiological Uptake at the Savannah River Site This letter refers to the Office of Health, Safety and Security's Office of Enforcement and Oversight investigation into the facts and circumstances associated with the June 14, 2010, employee puncture wound injury, which occurred in the F-TRU Remediation Enclosure within the F-Canyon Facility, at the U.S. Department of Energy' s (DOE) Savannah River Site. This occurrence was reported in Noncompliance Tracking System (NTS) report NTS-SRSO--SRNS-CPWM-20IO-0002, Contaminated Puncture Wound During TRU Drum

11

FY 2010 Savannah River Nuclear Solutions, LLC, PER Summary | National  

National Nuclear Security Administration (NNSA)

Savannah River Nuclear Solutions, LLC, PER Summary | National Savannah River Nuclear Solutions, LLC, PER Summary | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog FY 2010 Savannah River Nuclear Solutions, LLC, PER Summary Home > About Us > Our Operations > Acquisition and Project Management > Performance Evaluations > FY 2010 Savannah River Nuclear Solutions, LLC,

12

FY 2012 Savannah River Nuclear Solutions, LLC, PER Summary | National  

National Nuclear Security Administration (NNSA)

Savannah River Nuclear Solutions, LLC, PER Summary | National Savannah River Nuclear Solutions, LLC, PER Summary | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog FY 2012 Savannah River Nuclear Solutions, LLC, PER Summary Home > About Us > Our Operations > Acquisition and Project Management > Performance Evaluations > FY 2012 Savannah River Nuclear Solutions, LLC,

13

Project Management Institute Highlights Savannah River Nuclear Solutions in Publication  

Energy.gov (U.S. Department of Energy (DOE))

AIKEN, S.C. – Project Management Institute (PMI) — the world’s largest not-for-profit membership association for the project management profession — features a story on Savannah River Nuclear Solutions (SRNS).

14

Preliminary Notice of Violation, Savannah River Nuclear Solutions, LLC -  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

2-04 2-04 Preliminary Notice of Violation, Savannah River Nuclear Solutions, LLC - WEA-2012-04 November 9, 2012 Issued to Savannah River Nuclear Solutions (SRNS), LLC, related to a Worker Fall from a Scaffold in the K-Area Complex at the Savannah River Site This letter refers to the U.S. Department of Energy (DOE) Office of Health, Safety and Security's Office of Enforcement and Oversight investigation into the facts and circumstances associated with a worker fall from a Tele-Tower® Adjustable Work Platform in the K-Area Complex at the Savannah River Site on July 1, 2011. The results of DOE's investigation were provided to Savannah River Nuclear Solutions, LLC (SRNS) in an investigation report dated May 8, 2012. An enforcement conference was held on June 27, 2012, with you and members of your staff to discuss the

15

DOE to Extend Savannah River Nuclear Solutions Contract at Savannah River  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

to Extend Savannah River Nuclear Solutions Contract at Savannah to Extend Savannah River Nuclear Solutions Contract at Savannah River Site to September 2016 DOE to Extend Savannah River Nuclear Solutions Contract at Savannah River Site to September 2016 September 6, 2012 - 12:00pm Addthis Media Contact Bill Taylor 803-952-8564 bill.taylor@srs.gov Aiken, SC -- The Department of Energy's (DOE) Savannah River Operations Office today exercised its option to extend the current Savannah River Site Management and Operating contract with Savannah River Nuclear Solutions, LLC (SRNS) for an additional 38 months, from August 1, 2013 to September 2016. The SRNS contract was competatviely awareded January 10, 2008. The total value of the SRNS contract with the extension is approximately $8 billion. The current contract provides for management and operations of Savannah

16

Principal Media Contact: DT Townsend Savannah River Nuclear Solutions, LLC  

NLE Websites -- All DOE Office Websites (Extended Search)

NNSA Honors 41 Savannah River Site Employees with Defense NNSA Honors 41 Savannah River Site Employees with Defense Programs Awards of Excellence AIKEN, S.C. (September 20, 2013) - Forty-one Savannah River Nuclear Solutions employ- ees were honored for excellence in support of the National Nuclear Security Administration's Defense Programs. Doug Dearolph, manager of the NNSA Savannah River Field Office presented NNSA Defense Programs Awards of Excellence to one individual and two teams for their "signif- icant achievement in quality, productivity, cost savings, safety, or creativity in support of NNSA's nuclear weapons program." Honorees included Rick Poland of Savannah River National Laboratory, the Tritium Control Room Operator Training Team, and the B83 Alt 353 Implementation Team. Poland was honored for his multi-year work as Director of the Federal Working Group on

17

Preliminary Notice of Violation, Savannah River Nuclear Solutions, LLC- WEA-2012-04  

Energy.gov (U.S. Department of Energy (DOE))

Issued to Savannah River Nuclear Solutions (SRNS), LLC, related to a Worker Fall from a Scaffold in the K-Area Complex at the Savannah River Site.

18

Preliminary Notice of Violation, Savannah River Nuclear Solutions, LLC- WEA-2010-05  

Energy.gov (U.S. Department of Energy (DOE))

Issued to Savannah River Nuclear Solutions, LLC related to a Nitric Acid Spill Event and an Electrical Arc Flash Injury Event at the Savannah River Site

19

Savannah River Nuclear Solutions, LLC Preliminary Notice of Violation  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

CERTIFIED MAIL CERTIFIED MAIL RETURN RECEIPT REQUESTED Garry W. Flowers President and Chief Executive Officer Savannah River Nuclear Solutions, LLC 6160 Executive Woodside Court Aiken, South Carolina 29803 WEA-2010-05 Dear Mr. Flowers: This letter refers to the Office of Health, Safety and Security's Office of Enforcement investigation into the facts and circumstances surrounding the nitric acid spill event that occurred in F Area on August 18,2009, and the electrical arc flash injury that occurred in the D Area powerhouse on September 23,2009, at the Savannah River Site. Based on an evaluation of the evidence in this matter, the U.S. Department of Energy (DOE) has concluded that violations of 10 C.F.R Part 851, Worker Safety and Health Program, by Savannah River Nuclear Solutions,

20

from Savannah River Nuclear Solutions, LLC NEWS Savannah River Tritium Enterprise Achieves High Marks for  

NLE Websites -- All DOE Office Websites (Extended Search)

Tritium Enterprise Achieves High Marks for Tritium Enterprise Achieves High Marks for Support to Nation's Security Fiscal Year 2012 Performance Prepares Enterprise for Continued Service AIKEN, S.C. (February 7, 2013) - The National Nuclear Security Administration (NNSA) has rated the Savannah River Tritium Enterprise's overall Fiscal Year 2012 performance as "excel- lent," meaning that the Savannah River Site's tritium-related work has once again success- fully met and exceeded NNSA's Defense Programs goals. The Savannah River Tritium Enterprise (SRTE), which is managed for NNSA by Savannah River Nuclear Solutions (SRNS), earned the rating for its successful performance of the four missions it carries out in support of the nation's security: tritium supply, nuclear stockpile maintenance,

Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

Principal Media Contact: DT Townsend Savannah River Nuclear Solutions, LLC  

NLE Websites -- All DOE Office Websites (Extended Search)

Project Management Institute Selects SRNS as Finalist for Project Management Institute Selects SRNS as Finalist for International Award Project Management Institute cites SRS American Recovery and Reinvestment Act cleanup success in naming SRNS finalist for prestigious recognition AIKEN, S.C. (Sept. 4, 2013) - Department of Energy -SR contractor Savannah River Nuclear Solutions, LLC (SRNS) has been named one of three finalists for the "Project Management of the Year" award by the internationally-renowned Project Management Institute (PMI), the world's largest association for project managers. SRNS is being considered for this coveted award due to exceptional project management of the extensive work accomplished through Savannah River Site's $1.4 billion American Recovery and Reinvestment Act (ARRA) clean-

22

from Savannah River Nuclear Solutions, LLC NEWS SRNS's Maciaszek Elected  

NLE Websites -- All DOE Office Websites (Extended Search)

SRNS's Maciaszek Elected SRNS's Maciaszek Elected Fellow of Society of Fire Protection Engineers AIKEN, S.C. (July 11, 2012) - Stan Maciaszek, fire protection engineer for Savannah River Nuclear Solutions' (SRNS) Tritium Programs, was recently inducted as a Fellow of the Society of Fire Protection Engineers (SFPE). A Registered Professional Engineer, Maciaszek has served as a system engineer and design authority for the Savannah River Site tritium facilities for over 11 years, in which he has been responsible for the nu- clear safety related fire suppression systems. He actively supports and promotes fire pro- tection and fire protection engineering through mentoring, National Engineer Week activities and other education outreach programs, which introduce middle and high school students

23

Savannah River Nuclear Solutions Celebrates Nuclear Science Week...  

National Nuclear Security Administration (NNSA)

Celebrates Nuclear Science Week With Students | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing...

24

DOE Selects Savannah River Nuclear Solutions, LLC to Manage and Operate its  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

DOE Selects Savannah River Nuclear Solutions, LLC to Manage and DOE Selects Savannah River Nuclear Solutions, LLC to Manage and Operate its Savannah River Site DOE Selects Savannah River Nuclear Solutions, LLC to Manage and Operate its Savannah River Site January 10, 2007 - 10:24am Addthis WASHINGTON, DC - The U.S. Department of Energy (DOE) today announced that Savannah River Nuclear Solutions (SRNS), LLC has been selected as the management and operating contractor for DOE's Savannah River Site (SRS) in Aiken, South Carolina. The contract is a cost-plus award-fee contract valued at approximately $800 million per year and is for a five-year base period with the option to extend it for up to five additional years. SRNS is a limited liability corporation consisting of Fluor Federal Services, Inc., Honeywell International, Inc., and Newport News

25

DOE Selects Savannah River Nuclear Solutions, LLC to Manage and Operate its  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Savannah River Nuclear Solutions, LLC to Manage and Savannah River Nuclear Solutions, LLC to Manage and Operate its Savannah River Site DOE Selects Savannah River Nuclear Solutions, LLC to Manage and Operate its Savannah River Site January 10, 2007 - 10:24am Addthis WASHINGTON, DC - The U.S. Department of Energy (DOE) today announced that Savannah River Nuclear Solutions (SRNS), LLC has been selected as the management and operating contractor for DOE's Savannah River Site (SRS) in Aiken, South Carolina. The contract is a cost-plus award-fee contract valued at approximately $800 million per year and is for a five-year base period with the option to extend it for up to five additional years. SRNS is a limited liability corporation consisting of Fluor Federal Services, Inc., Honeywell International, Inc., and Newport News

26

Principal Media Contact: DT Townsend Savannah River Nuclear Solutions, LLC  

NLE Websites -- All DOE Office Websites (Extended Search)

Over 7,000 Area Students Attend College Night 2013 Over 7,000 Area Students Attend College Night 2013 Greatly exceeds last year's attendance as $15,000 in scholarships were awarded to area students AAiken, S.C., (Sept. 13, 2013) - Over 7,000 high school students and educators from the greater Aiken-Augusta area recently met with recruiters from more than 150 colleges and universi- ties during this year's CSRA College Night. "We were thrilled with this year's attendance," said Gladys Moore, Program Coordinator, Savannah River Nuclear Solutions, LLC (SRNS). "We broke last year's attendance by more than one thousand students. At times, the arena was packed, wall to wall, with enthusiastic students eager to obtain much needed information." A large number of College Night volun- teers are employees working at the U.S.

27

PIA - Savannah River Nuclear Solution (SRNS) MedGate Occupational Health  

NLE Websites -- All DOE Office Websites (Extended Search)

MedGate Occupational MedGate Occupational Health and Safety Medical System (OHS) (Includes the Drug and Alcohol Testing System (Assistant)) PIA - Savannah River Nuclear Solution (SRNS) MedGate Occupational Health and Safety Medical System (OHS) (Includes the Drug and Alcohol Testing System (Assistant)) PIA - Savannah River Nuclear Solution (SRNS) MedGate Occupational Health and Safety Medical System (OHS) (Includes the Drug and Alcohol Testing System (Assistant)) PIA - Savannah River Nuclear Solution (SRNS) MedGate Occupational Health and Safety Medical System (OHS) (Includes the Drug and Alcohol Testing System (Assistant)) More Documents & Publications PIA - Savannah River Nuclear Solution (SRNS) Procurement Cycle System (PCS) PIA - Savannah River Nuclear Solutions (SRNS) Human Resource Management

28

from Savannah River Nuclear Solutions, LLC NEWS SRS Employees Donate Food to Golden Harvest Food Bank  

NLE Websites -- All DOE Office Websites (Extended Search)

Employees Donate Food to Golden Harvest Food Bank Employees Donate Food to Golden Harvest Food Bank AIKEN, S.C. - (June 7, 2012) Today, the Savannah River Site (SRS) donated $22,000 and 18,000 pounds of food during its annual food drive for the Golden Harvest Food Bank. Several SRS organizations participated in this food drive-Savannah River Nuclear Solutions, Savannah River Remediation, U.S. Forest Service-Savannah River, URS and WSI- Savannah River. The SRS food drive is one of Golden Harvest Food Bank's largest, local fund-raisers. According to Savannah River Nuclear Solutions, LLC President and CEO Dwayne Wilson, the Site's past food drives have collec- tively yielded over 262,475 pounds of food for Golden Harvest. "We're pleased to support Golden Harvest in their highly effective efforts as they strive

29

Department of Energy Cites Savannah River Nuclear Solutions, LLC for Worker  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Solutions, LLC Solutions, LLC for Worker Safety and Health Violations Department of Energy Cites Savannah River Nuclear Solutions, LLC for Worker Safety and Health Violations November 9, 2012 - 5:50pm Addthis News Media Contact (202) 586-4940 WASHINGTON - The U.S. Department of Energy has issued a Preliminary Notice of Violation (PNOV) to Savannah River Nuclear Solutions, LLC (SRNS) for violations of the Department's worker safety and health regulations. The violations are associated with a July 1, 2011, incident that occurred while a worker was using a Tele-Tower® scaffold to perform facility modifications in the Purification Area Vault of Building 105-K in the K-Area Complex at the Savannah River Site (SRS). The SRNS worker fell from the scaffold and was hospitalized with injuries to his head and

30

Preliminary Notice of Violation, Savannah River Nuclear Solutions...  

Office of Environmental Management (EM)

August 18, 2009, and an electrical arc flash event with that occurred in the D Area powerhouse on September 23, 2009, at the Savannah River Site. Preliminary Notice of Violation,...

31

Principal Media Contact: DT Townsend Savannah River Nuclear Solutions...  

NLE Websites -- All DOE Office Websites (Extended Search)

Fluor-led company whose members are Fluor Federal Services, Newport News Nuclear and Honeywell, responsible for the management and operations of the Department of Energy's...

32

Principal Media Contact: DT Townsend Savannah River Nuclear Solutions, LLC  

NLE Websites -- All DOE Office Websites (Extended Search)

Children to Benefit Children to Benefit from SRS "Toys for Tots" Campaign Over two decades of toy collection merit special celebration AIKEN, S.C. (Dec. 12, 2013) - Employees at the Department of Energy's Savannah River Site (SRS) are celebrating more than 20 years of supporting the U.S. Marine Reserves Toys for Tots campaign with the collection of more than 15,000 toys this year alone and over 220,000 toys since the start of SRS Toys for Tots campaigns in 1991. "Many families throughout the Central Savannah River Area have been hit hard by the continu- ing recession," said Julie Kirby, Chair, SRS Toys for Tots Campaign. "Our hearts and now our gifts go out to those in need, many of whom consist of the working poor and single mothers. We hope to brighten Christmas day for their children and lighten the burden they carry day to day."

33

Principal Media Contact: DT Townsend Savannah River Nuclear Solutions, LLC  

NLE Websites -- All DOE Office Websites (Extended Search)

Registration for the 2014 SRS Registration for the 2014 SRS Public Tour Program Begins December 30 AIKEN, S.C. (Dec. 16, 2013) - Registration for the Savannah River Site's 2014 public tour program will begin Monday, Dec. 30. More than 1,000 seats will be available during 22 tours to be held throughout the upcoming year at the Department of Energy site near Aiken, S.C. Driving tours are offered each year at SRS to provide members of the public an opportunity to see many of the site's facilities and learn more about the site's history, current activities and future missions. The first of the tours will be held in January. Each tour starts at the Aiken County Applied Research Center located off Highway 278, near New Ellenton, and begins with an overview pre- sentation about SRS and a safety briefing.

34

from Savannah River Nuclear Solutions, LLC NEWS Mobility Impaired Hunters Seek Trophy Buck at SRS  

NLE Websites -- All DOE Office Websites (Extended Search)

Mobility Impaired Hunters Seek Trophy Buck at SRS Mobility Impaired Hunters Seek Trophy Buck at SRS SRNS manages hunt, providing an opportunity of a lifetime AIKEN, S.C. (Sept. 17, 2012) - Twenty-five physically disabled hunters participated today in the twelfth annual "Deer Hunt for Mobility-Impaired Hunters" at the Savannah River Site, Aiken, S.C. Mobility-impaired hunters from throughout the southeast, and as far as Ohio, met Friday, Nov. 16, at the Savannah River Ecology Lab (SREL) Conference Center to begin the two day hunt. "The Site is a prime location to conduct this type of hunt and we are fortunate to be a part of such a special event," said Ed Spears, Savannah River Nuclear Solutions, LLC (SRNS) Deer Hunt Manager. "This hunt specifically is special because it is a unique opportunity for

35

from Savannah River Nuclear Solutions, LLC NEWS SRNS Partners with Georgialina Physical Therapy Associates to  

NLE Websites -- All DOE Office Websites (Extended Search)

Partners with Georgialina Physical Therapy Associates to Partners with Georgialina Physical Therapy Associates to Bring Services to SRS Employees AIKEN, S.C. - April 25, 2013 - The days of long drives, even longer wait times, and work challenges associated with ongoing physical therapy appointments are drawing to an end for Savannah River Site (SRS) employees thanks to a partnership between Savannah River Nuclear Solutions, LLC (SRNS) and Georgialina Physical Therapy (GPT) Associates. Together, the companies have launched a new program to provide a range of physical therapy services to all SRS employees. "Any SRS employee can schedule an appointment with us at our on-site location," said Brett Brannon, co-owner, Georgialina Physical Therapy Associates. "We provide the same services at our SRS clinic that we do in any of our

36

from Savannah River Nuclear Solutions, LLC NEWS Area High School Teams Compete during DOE's National Science  

NLE Websites -- All DOE Office Websites (Extended Search)

High School Teams Compete during DOE's National Science High School Teams Compete during DOE's National Science Bowl® Regional Championship: Lakeside and Evans High School Finish Second and Third - Dorman Wins AIKEN, S.C. - Feb. 25, 2013 - Using a format similar to the television show "Jeopardy," America's next generation of scientists and engineers put their knowledge to the test at the University of South Carolina Aiken during the DOE National Science Bowl regional compe- tition this past weekend. High School teams from across South Carolina and the greater Augusta, Ga. area relied on their collective knowledge as they participated in one of the coun- try's largest science tournaments. This regional competition, managed by Savannah River Nuclear Solutions, LLC (SRNS), hosted 120 high school students from 12 high schools. It is the only educational event

37

from Savannah River Nuclear Solutions, LLC NEWS D Area Powerhouse Retired after Nearly 60 Years of Service  

NLE Websites -- All DOE Office Websites (Extended Search)

D Area Powerhouse Retired after Nearly 60 Years of Service D Area Powerhouse Retired after Nearly 60 Years of Service Huge, 1950s era, power and steam generating plant nearing end of mission AIKEN, S.C. - (May 22, 2012) - As Savannah River Nuclear Solutions, LLC (SRNS) em- braces new, clean and highly efficient power generation technology, the massive 1950s era powerhouse in D Area has been shut down after decades of service at the Savannah River Site (SRS). At one time, this coal-powered facility was capable of generating 75 million watts of power, enough electricity to support the entire city of Aiken, S.C. However, those days have passed and the 280,000 square-foot, five story building is being prepared for deactivation. "Recent startup of three new wood-chip burning (biomass) steam plants at SRS means we

38

Office of River Protection (ORP) and Washingotn River Protection Solutions,  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Office of River Protection (ORP) and Washingotn River Protection Office of River Protection (ORP) and Washingotn River Protection Solutions, LLC (WRPS) Partnering Agreement for the DOE-EM Tank Operations Project Office of River Protection (ORP) and Washingotn River Protection Solutions, LLC (WRPS) Partnering Agreement for the DOE-EM Tank Operations Project The Mission of the Office of River Protection is to safely retrieve and treat Hanford's tank waste and close the Tank Farms to protect the Columbia River. Office of River Protection (ORP) and Washingotn River Protection Solutions, LLC (WRPS) Partnering Agreement for the DOE-EM Tank Operations Project More Documents & Publications 2011 Annual Workforce Analysis and Staffing Plan Report - Office of River Protection Consent Order, Washington River Protection Solutions, LLC - NCO-2011-01

39

Independent Activity Report, Washington River Protection Solutions -  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Washington River Protection Solutions Washington River Protection Solutions - September 2010 Independent Activity Report, Washington River Protection Solutions - September 2010 September 2010 Participation in the Washington River Protection Solutions, LLC Integrated Safety Management System Annual Review The U.S. Department of Energy, Office of Independent Oversight, within the Office of Health, Safety and Security (HSS), participated in the review of the Washington River Protection Solutions, LLC Integrated Safety Management System Annual Review for 2010. The review was conducted during the period of August 23 to September 2, 2010, and focused on six functional areas: corrective action management, work planning and control, radiological protection, environmental protection, emergency preparedness, and

40

Is Nuclear Energy the Solution?  

E-Print Network (OSTI)

009-0270-y Is Nuclear Energy the Solution? Milton H. Saier &in the last 50 years, nuclear energy subsidies have totaledadministration, the Global Nuclear Energy Partnership (GNEP)

Saier, Milton H.; Trevors, Jack T.

2010-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

Savannah River Nuclear Solutions S A V A N N A H R I V E R S  

NLE Websites -- All DOE Office Websites (Extended Search)

native Jessica Maddocks worked for the Savannah River National Laboratory's (SRNL) Global Security department during her summer vacation from Georgia Tech. Maddocks' internship...

42

Home Office Expenses Submitted by Fluor Federal Services, Inc., on Savannah River Nuclear Solutions, LLC's U.S. Department of Energy Management & Operating (M&O) Contract No. DE-AC09-08SR22470  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Home Office Expenses Submitted by Fluor Home Office Expenses Submitted by Fluor Federal Services, Inc., on Savannah River Nuclear Solutions, LLC's U.S. Department of Energy Management & Operating (M&O) Contract No. DE-AC09-08SR22470 OAS-L-13-08 April 2013 Department of Energy Washington, DC 20585 April 19, 2013 MEMORANDUM FOR THE MANAGER, SAVANNAH RIVER OPERATIONS OFFICE FROM: Rickey R. Hass Deputy Inspector General for Audits and Inspections Office of Inspector General SUBJECT: INFORMATION: Audit Report on "Home Office Expenses Submitted by Fluor Federal Services, Inc., on Savannah River Nuclear Solutions, LLC's U.S. Department of Energy Management & Operating (M&O) Contract No. DE-AC09-08SR22470" BACKGROUND The attached report presents the results of an audit of home office expenses submitted by Fluor

43

Savannah River Nuclear Solutions S A V A N N A H R I V E R S  

NLE Websites -- All DOE Office Websites (Extended Search)

Fluor-led company whose members are Fluor Federal Services, Newport News Nuclear and Honeywell, responsible for the management and operations of the Department of Energy's...

44

Is Nuclear Energy the Solution?  

E-Print Network (OSTI)

10.1007/s11270-009-0270-y Is Nuclear Energy the Solution?MHS) attended a lecture on “Nuclear Responsibility” on theof the Alliance for Nuclear Responsibility. The information

Saier, Milton H.; Trevors, Jack T.

2010-01-01T23:59:59.000Z

45

Washington River Protection Solutions, LLC  

Energy Savers (EERE)

million gallons of radioactive and mixed waste stored in 177 large, aging, underground tanks. This nuclear waste is the result of more than four decades of reactor operations and...

46

Florida Nuclear Profile - Crystal River  

U.S. Energy Information Administration (EIA) Indexed Site

Crystal River1" "Unit","Summer capacity (mw)","Net generation (thousand mwh)","Summer capacity factor (percent)","Type","Commercial operation date","License expiration date"...

47

Savannah River Site | National Nuclear Security Administration  

NLE Websites -- All DOE Office Websites (Extended Search)

Site | National Nuclear Security Administration Site | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Home > About Us > Our Locations > Savannah River Site Savannah River Site http://www.srs.gov/general/srs-home.html Field Office: Located south of Aiken, South Carolina, the Savannah River Field Office (SRFO) is responsible for the NNSA Defense Program missions at

48

Savannah River Site | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

Site | National Nuclear Security Administration Site | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Home > About Us > Our Locations > Savannah River Site Savannah River Site http://www.srs.gov/general/srs-home.html Field Office: Located south of Aiken, South Carolina, the Savannah River Field Office (SRFO) is responsible for the NNSA Defense Program missions at

49

Nuclear waste solutions  

DOE Patents (OSTI)

High efficiency removal of technetium values from a nuclear waste stream is achieved by addition to the waste stream of a precipitant contributing tetraphenylphosphonium cation, such that a substantial portion of the technetium values are precipitated as an insoluble pertechnetate salt.

Walker, Darrel D. (1684 Partridge Dr., Aiken, SC 29801); Ebra, Martha A. (129 Hasty Rd., Aiken, SC 29801)

1987-01-01T23:59:59.000Z

50

Independent Activity Report, Washington River Protection Solutions, LLC -  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Solutions, Solutions, LLC - October 2011 Independent Activity Report, Washington River Protection Solutions, LLC - October 2011 October 2011 Industrial Hygiene Surveillance of the Washington River Protection Solutions, LLC Industrial Hygiene Program Strategy and Implementation of the Hanford Concerns Council Recommendations [HIAR-ORP-2011-10-26] Staff from the U.S. Department of Energy's (DOE) Office of Enforcement and Oversight, within the Office of Health, Safety and Security (HSS), in coordination with the Office of River Protection (ORP), reviewed the status and programmatic health of the Washington River Protection Solutions, LLC (WRPS) industrial hygiene program relative to the Hanford Concerns Council (HCC) Independent Review Panel (IRP) report on Chemical Vapors Industrial

51

Savannah River Remediation Intern Sees Nuclear Industry as Job Opportunity  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Savannah River Remediation Intern Sees Nuclear Industry as Job Savannah River Remediation Intern Sees Nuclear Industry as Job Opportunity Savannah River Remediation Intern Sees Nuclear Industry as Job Opportunity July 9, 2012 - 10:00am Addthis Spencer Isom, second year engineering intern for Savannah River Remediation (SRR) and fourth summer at Savannah River Site (SRS), performs a standard equipment check at Saltstone Production Facility. | Photo courtesy of Savannah River Site Spencer Isom, second year engineering intern for Savannah River Remediation (SRR) and fourth summer at Savannah River Site (SRS), performs a standard equipment check at Saltstone Production Facility. | Photo courtesy of Savannah River Site Maddie M. Blair Public Affairs Intern, Savannah River Remediation Why does she keep coming back? "There are so many fascinating processes, people, and work

52

Savannah River Remediation Intern Sees Nuclear Industry as Job Opportunity  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Savannah River Remediation Intern Sees Nuclear Industry as Job Savannah River Remediation Intern Sees Nuclear Industry as Job Opportunity Savannah River Remediation Intern Sees Nuclear Industry as Job Opportunity July 9, 2012 - 10:00am Addthis Spencer Isom, second year engineering intern for Savannah River Remediation (SRR) and fourth summer at Savannah River Site (SRS), performs a standard equipment check at Saltstone Production Facility. | Photo courtesy of Savannah River Site Spencer Isom, second year engineering intern for Savannah River Remediation (SRR) and fourth summer at Savannah River Site (SRS), performs a standard equipment check at Saltstone Production Facility. | Photo courtesy of Savannah River Site Maddie M. Blair Public Affairs Intern, Savannah River Remediation Why does she keep coming back? "There are so many fascinating processes, people, and work

53

Workforce Statistics - Savannah River Field Office | National Nuclear  

National Nuclear Security Administration (NNSA)

Savannah River Field Office | National Nuclear Savannah River Field Office | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Workforce Statistics - Savannah River Field Office Home > About Us > Our Operations > Management and Budget > Office of Civil Rights > Workforce Statistics > Workforce Statistics - Savannah River Field

54

Is Nuclear Energy the Solution?  

E-Print Network (OSTI)

Savannah River Site (SC), as well as the reprocessing of naval irradiated fuel at the Idaho National Laboratory (

Saier, Milton H.; Trevors, Jack T.

2010-01-01T23:59:59.000Z

55

DOE Selects Washington River Protection Solutions, LLC for Tank Operations  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

DOE Selects Washington River Protection Solutions, LLC for Tank DOE Selects Washington River Protection Solutions, LLC for Tank Operations Contract at Hanford Site DOE Selects Washington River Protection Solutions, LLC for Tank Operations Contract at Hanford Site May 29, 2008 - 12:51pm Addthis WASHINGTON, DC - The U.S. Department of Energy (DOE) today announced that Washington River Protection Solutions (WRPS), LLC has been selected as the tank operations contractor to store, retrieve and treat Hanford tank waste and close the tank farms at DOE's Hanford Site in southeastern Washington State. The contract is a cost-plus award-fee contract valued at approximately $7.1 billion over ten years (a five-year base period with options to extend it for up to five years). WRPS is a limited liability company comprised of Washington Group

56

DOE Selects Washington River Protection Solutions, LLC for Tank Operations  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Selects Washington River Protection Solutions, LLC for Tank Selects Washington River Protection Solutions, LLC for Tank Operations Contract at Hanford Site DOE Selects Washington River Protection Solutions, LLC for Tank Operations Contract at Hanford Site May 29, 2008 - 12:51pm Addthis WASHINGTON, DC - The U.S. Department of Energy (DOE) today announced that Washington River Protection Solutions (WRPS), LLC has been selected as the tank operations contractor to store, retrieve and treat Hanford tank waste and close the tank farms at DOE's Hanford Site in southeastern Washington State. The contract is a cost-plus award-fee contract valued at approximately $7.1 billion over ten years (a five-year base period with options to extend it for up to five years). WRPS is a limited liability company comprised of Washington Group

57

Is Nuclear Energy the Solution?  

Science Journals Connector (OSTI)

In the event of a major radioactive release from a nuclear power plant, public opinion would likely react strongly against nuclear power...

Milton H. Saier; Jack T. Trevors

2010-05-01T23:59:59.000Z

58

Lempke visits Savannah River Site | National Nuclear Security  

National Nuclear Security Administration (NNSA)

visits Savannah River Site | National Nuclear Security visits Savannah River Site | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Home > NNSA Blog > Lempke visits Savannah River Site Lempke visits Savannah River Site Posted By Office of Public Affairs NNSA Associate Principal Deputy Administrator Michael Lempke recently visited the Savannah River Site, getting an up-close look at facilities

59

Independent Activity Report, Washington River Protection Solutions...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Solutions, LLC Industrial Hygiene Program Strategy and Implementation of the Hanford Concerns Council Recommendations HIAR-ORP-2011-10-26 This Independent Activity...

60

Project Management Institute Highlights Savannah River Nuclear...  

Office of Environmental Management (EM)

Site's H Canyon Work Ensures Future Missions for Facility Restoration of a 90-acre powerhouse ash basin at the Savannah River Site, pictured here, is under way as workers remove...

Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

Young Professionals in Nuclear Industry Group Forms at Savannah River Site  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Young Professionals in Nuclear Industry Group Forms at Savannah Young Professionals in Nuclear Industry Group Forms at Savannah River Site Young Professionals in Nuclear Industry Group Forms at Savannah River Site January 1, 2012 - 12:00pm Addthis The Savannah River Chapter of North American – Young Generation in Nuclear is a new group forming at the Savannah River Site. The Savannah River Chapter of North American - Young Generation in Nuclear is a new group forming at the Savannah River Site. AIKEN, S.C. - Supporting the development of young nuclear professionals in the Central Savannah River Area (CSRA) is the purpose behind a new group forming at the Savannah River Site (SRS). The Savannah River Chapter of North American - Young Generation in Nuclear (SR-YGN) will hold a kick-off meeting Jan. 26 in Aiken and all

62

Voluntary Protection Program Onsite Review, Washington River Protection Solutions, LLC, Hanford – Feb 2014  

Energy.gov (U.S. Department of Energy (DOE))

Evaluation to determine whether Washington River Protection Solutions, LLC, Hanford is performing at a level deserving DOE-VPP Star recognition.

63

Media Treatment of`Climate Change' in Shaping Colorado River Problems and Solutions  

E-Print Network (OSTI)

Media Treatment of`Climate Change' in Shaping Colorado River Problems and Solutions WESTERN WATER ASSESSMENT WHITE PAPER Abby Kuranz and Doug Kenney University of Colorado 2014 #12;Western Water Assessment 2 on the hydrology of the Colorado River Basin and those water systems dependent upon the river.1 Among the impacts

Neff, Jason

64

Savannah River Operations Office Interim Management of Nuclear  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

0 0 Federal Register / Vol. 62, No. 70 / Friday, April 11, 1997 / Notices 1 The term ''failed'' means that the cladding on the fuel has been breached. The ROD, 60 Fed. Reg. 65300 (December 19, 1995), stated that failed fuel is indicated by gas releases from a fuel storage canister or visible failure of the cladding or canisters. select samples for specialized surveys for example on children's services or on access for persons with disabilities. [FR Doc. 97-9341 Filed 4-10-97; 8:45 am] BILLING CODE 4000-01-P DEPARTMENT OF ENERGY Savannah River Operations Office Interim Management of Nuclear Materials at the Savannah River Site AGENCY: Department of Energy. ACTION: Supplemental record of decision and supplement analysis determination. SUMMARY: The U.S. Department of Energy (DOE) prepared a final

65

The Savannah River Site is owned by the U.S. Department of Energy  

NLE Websites -- All DOE Office Websites (Extended Search)

Eloy Saldivar, Jr. Acting Director, Business and Workforce Management Savannah River National Laboratory Savannah River Nuclear Solutions, LLC Texas A&M University Bachelor of...

66

The Savannah River Site is owned by the U.S. Department of Energy  

NLE Websites -- All DOE Office Websites (Extended Search)

Steven Wach Strategic Development and Technical Partnerships Savannah River National Laboratory Savannah River Nuclear Solutions, LLC Georgia Institute of Technology Bachelor of...

67

The Savannah River Site is owned by the U.S. Department of Energy  

NLE Websites -- All DOE Office Websites (Extended Search)

Terry A. Michalske, PhD Executive Vice President and Director, Savannah River National Laboratory Savannah River Nuclear Solutions, LLC Alfred University PhD, Ceramic Science...

68

Nuclear Power No Solution to the Climate Crisis  

E-Print Network (OSTI)

Nuclear Power No Solution to the Climate Crisis Michael Mariotte Nuclear Information and Resource-12, 2009 #12;Environmental Statement on Nuclear Power and the Climate Crisis "We do not support emissions than nuclear power." Signed by 483 US organizations, 164 int'l organizations and 10

Laughlin, Robert B.

69

Consent Order, Washington River Protection Solutions, LLC - NCO-2011-01 |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Washington River Protection Solutions, LLC - Washington River Protection Solutions, LLC - NCO-2011-01 Consent Order, Washington River Protection Solutions, LLC - NCO-2011-01 May 27, 2011 Consent Order issued to Washington River Protection Solutions, LLC related to deficiencies in the corrective action management program, radiation control program, and sealed radioactive source accountability and control program The U.S. Department of Energy (DOE) Office of Health, Safety and Security's Office of Enforcement and Oversight has completed its investigation into the facts and circumstances associated with identified deficiencies in the Washington River Protection Solutions, LLC (WRPS) corrective action management program, radiation control program, and sealed radioactive source accountability and control program. DOE views these programs as

70

Savannah River Remediation Donates $10,000 to South Carolina State Nuclear  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Savannah River Remediation Donates $10,000 to South Carolina State Savannah River Remediation Donates $10,000 to South Carolina State Nuclear Engineering Program Savannah River Remediation Donates $10,000 to South Carolina State Nuclear Engineering Program September 28, 2012 - 9:27am Addthis Savannah River Remediation presents a $10,000 to South Carolina State University to support its Nuclear Engineering Program. In the photo, from left: Kayla Miller, Savannah River Remediation Procurement Department and South Carolina State University 2010 graduate; Dr. John Corbitt, Acting Chairman of the South Carolina State University Board of Trustees; Dr. Cynthia Warrick, Interim South Carolina State University President; and Dave Olson, Savannah River Remediation President and Project Manager. Savannah River Remediation presents a $10,000 to South Carolina State

71

PIA - Savannah River Remediation Accreditation Boundary (SRR...  

Office of Environmental Management (EM)

PIA - Savannah River Nuclear Solution IBARS Srs Site Apps. Accreditation Boundary PIA - WEB Physical Security Major Application Occupational Medical Surveillance System (OMSS)...

72

USED NUCLEAR MATERIALS AT SAVANNAH RIVER SITE: ASSET OR WASTE?  

SciTech Connect

The nuclear industry, both in the commercial and the government sectors, has generated large quantities of material that span the spectrum of usefulness, from highly valuable (“assets”) to worthless (“wastes”). In many cases, the decision parameters are clear. Transuranic waste and high level waste, for example, have no value, and is either in a final disposition path today, or – in the case of high level waste – awaiting a policy decision about final disposition. Other materials, though discardable, have intrinsic scientific or market value that may be hidden by the complexity, hazard, or cost of recovery. An informed decision process should acknowledge the asset value, or lack of value, of the complete inventory of materials, and the structure necessary to implement the range of possible options. It is important that informed decisions are made about the asset value for the variety of nuclear materials available. For example, there is a significant quantity of spent fuel available for recycle (an estimated $4 billion value in the Savannah River Site’s (SRS) L area alone); in fact, SRS has already blended down more than 300 metric tons of uranium for commercial reactor use. Over 34 metric tons of surplus plutonium is also on a path to be used as commercial fuel. There are other radiological materials that are routinely handled at the site in large quantities that should be viewed as strategically important and / or commercially viable. In some cases, these materials are irreplaceable domestically, and failure to consider their recovery could jeopardize our technological leadership or national defense. The inventories of nuclear materials at SRS that have been characterized as “waste” include isotopes of plutonium, uranium, americium, and helium. Although planning has been performed to establish the technical and regulatory bases for their discard and disposal, recovery of these materials is both economically attractive and in the national interest.

Magoulas, V.

2013-06-03T23:59:59.000Z

73

DOE Cites Washington TRU Solutions for Nuclear Safety Violations |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Washington TRU Solutions for Nuclear Safety Violations Washington TRU Solutions for Nuclear Safety Violations DOE Cites Washington TRU Solutions for Nuclear Safety Violations December 22, 2005 - 4:53pm Addthis WASHINGTON, D.C. -- The Department of Energy (DOE) today notified Washington TRU Solutions (WTS) that it will fine the company $192,500 for violations of the department's nuclear safety requirements. The Preliminary Notice of Violation (PNOV) issued today cites a number of deficiencies that led to a series of low-level plutonium uptakes by workers at a WTS mobile facility (MOVER) stationed at the Lawrence Livermore National Laboratory (LLNL) in Livermore, Calif. The violations reflected WTS' limited understanding of the design and operational limitations of the MOVER facility, a portable waste processing facility designed to be

74

SRS upgrades helium recovery system | National Nuclear Security...  

National Nuclear Security Administration (NNSA)

detectors employed by the United States Department of Homeland Security to detect neutron activity from nuclear material. Savannah River Nuclear Solutions, LLC, the management...

75

Method for cleaning solution used in nuclear fuel reprocessing  

DOE Patents (OSTI)

Nuclear fuel processing solution consisting of tri-n-butyl phosphate and dodecane, with a complex of uranium, plutonium, or zirconium and with a solvent degradation product such as di-n-butyl phosphate therein, is contacted with an aqueous solution of a salt formed from hydrazine and either a dicarboxylic acid or a hydroxycarboxylic acid, thereby removing the aforesaid complex from the processing solution.

Tallent, O.K.; Crouse, D.J.; Mailen, J.C.

1980-12-17T23:59:59.000Z

76

STRONTIUM AND ACTINIDE SEPARATIONS FROM HIGH LEVEL NUCLEAR WASTE SOLUTIONS USING MONOSODIUM TITANATE 1. SIMULANT TESTING  

SciTech Connect

High-level nuclear waste produced from fuel reprocessing operations at the Savannah River Site (SRS) requires pretreatment to remove {sup 137}Cs, {sup 90}Sr and alpha-emitting radionuclides (i.e., actinides) prior to disposal. Separation processes planned at SRS include caustic side solvent extraction, for {sup 137}Cs removal, and ion exchange/sorption of {sup 90}Sr and alpha-emitting radionuclides with an inorganic material, monosodium titanate (MST). The predominant alpha-emitting radionuclides in the highly alkaline waste solutions include plutonium isotopes {sup 238}Pu, {sup 239}Pu and {sup 240}Pu. This paper provides a summary of data acquired to measure the performance of MST to remove strontium and actinides from simulated waste solutions. These tests evaluated the influence of ionic strength, temperature, solution composition and the oxidation state of plutonium.

HOBBS, D. T.; BARNES, M. J.; PULMANO, R. L.; MARSHALL, K. M.; EDWARDS, T. B.; BRONIKOWSKI, M. G.; FINK, S. D.

2005-04-14T23:59:59.000Z

77

Principal Media Contact: DT Townsend Savannah River Nuclear Solutions...  

NLE Websites -- All DOE Office Websites (Extended Search)

an extensive job shadowing experience for Kazen, Ledbetter also conducts tours for job candidates considering a career at SRNS in the area of engineering. "I love working...

78

Savannah River Nuclear Solutions, LLC Preliminary Notice of Violation  

Office of Environmental Management (EM)

noncompliances, and demonstrated a commitment to improving its work planning and control process. Additionally, SRNS implemented a safety improvement program intended to...

79

CONTROL TESTING OF THE UK NATIONAL NUCLEAR LABORATORY'S RADBALL TECHNOLOGY AT SAVANNAH RIVER NATIONAL LABORATORY  

SciTech Connect

The UK National Nuclear Laboratory (NNL) has developed a remote, non-electrical, radiation-mapping device known as RadBall (patent pending), which offers a means to locate and quantify radiation hazards and sources within contaminated areas of the nuclear industry. To date, the RadBall has been deployed in a number of technology trials in nuclear waste reprocessing plants at Sellafield in the UK. The trials have demonstrated the successful ability of the RadBall technology to be deployed and retrieved from active areas. The positive results from these initial deployment trials and the anticipated future potential of RadBall have led to the NNL partnering with the Savannah River National Laboratory (SRNL) to further underpin and strengthen the technical performance of the technology. RadBall consists of a colander-like outer shell that houses a radiation-sensitive polymer sphere. It has no power requirements and can be positioned in tight or hard-to reach places. The outer shell works to collimate radiation sources and those areas of the polymer sphere that are exposed react, becoming increasingly less transparent, in proportion to the absorbed dose. The polymer sphere is imaged in an optical-CT scanner which produces a high resolution 3D map of optical attenuation coefficients. Subsequent analysis of the optical attenuation maps provides information on the spatial distribution and strength of the sources in a given area forming a 3D characterization of the area of interest. This study completed at SRNL addresses key aspects of the testing of the RadBall technology. The first set of tests was performed at Savannah River Nuclear Solutions Health Physics Instrument Calibration Laboratory (HPICL) using various gamma-ray sources and an x-ray machine with known radiological characteristics. The objective of these preliminary tests was to identify the optimal dose and collimator thickness. The second set of tests involved a highly contaminated hot cell. The objective of this part of the testing was to characterize a hot cell with unknown radiation sources. The RadBall calibration experiments and hot cell deployment completed at SRNL were successful in that for each trial, the technology was able to locate the radiation sources. The NNL believe that the ability of RadBall to be remotely deployed with no electrical supplies into difficult to access areas of plant and locate and quantify radiation hazards is a unique radiation mapping service. The NNL consider there to be significant business potential associated with this innovative technology.

Farfan, E.

2009-11-23T23:59:59.000Z

80

MORTALITY AMONG WORKERS AT THE SAVANNAH RIVER NUCLEAR FUELS PRODUCTION FACILITY  

NLE Websites -- All DOE Office Websites (Extended Search)

MORTALITY AMONG WORKERS AT THE SAVANNAH RIVER NUCLEAR FUELS MORTALITY AMONG WORKERS AT THE SAVANNAH RIVER NUCLEAR FUELS PRODUCTION FACILITY Donna L. Cragle and Janice P. Watkins, Center for Epidemiologic Research; Kathryn Robertson-DeMers, Bechtel Hanford, Inc. Donna Cragle, Oak Ridge Associated Universities, P.O. Box 117, Oak Ridge, TN 37831-0117 Key Words: mortality study, radiation exposure, leukemia, occupational cohort, trend test INTRODUCTION Since 1952 the Savannah River Site (SRS), located in Aiken, South Carolina, has operated as a Department of Energy (DOE) production facility for nuclear fuels and other materials. A previous study 1 through 1980 of 9,860 white males employed at least 90 consecutive days at the SRS between 1952 and 1974 found an increased number of leukemia deaths among

Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

Principal Media Contact: Lindsey Evans Savannah River Nuclear...  

NLE Websites -- All DOE Office Websites (Extended Search)

Fluor-led company whose members are Fluor Federal Services, Newport News Nuclear and Honeywell, responsible for the management and operations of the Department of Energy's...

82

EIS-0220: Interim Management of Nuclear Materials at the Savannah River Site  

Energy.gov (U.S. Department of Energy (DOE))

This environmental impact statement assesses the potential environmental impacts of actions necessary to manage nuclear materials at the Savannah River Site (SRS) in Aiken, South Carolina, until decisions on their ultimate disposition are made and implemented. The Department of Energy has decided to initiate actions which will stabilize certain of the SRS materials that represent environment, safety and health vulnerabilities in their current storage condition or which may represent a vulnerability within the next 10 years.

83

Review of the Implementation Verification Rev iew Processes at the Savannah River Site Environmental Management Nuclear Facilities, September 2011  

NLE Websites -- All DOE Office Websites (Extended Search)

Implementation Verification Review Implementation Verification Review Processes at the Savannah River Site Environmental Management Nuclear Facilities May 2011 September 2011 Office of Safety and Emergency Management Evaluations Office of Health, Safety and Security U.S. Department of Energy i Independent Oversight Review of the Implementation Verification Review Processes at the Savannah River Site Environmental Management Nuclear Facilities Table of Contents 1.0 Purpose ................................................................................................................................................. 1 2.0 Background ........................................................................................................................................... 1

84

Review of the Implementation Verification Rev iew Processes at the Savannah River Site Environmental Management Nuclear Facilities, September 2011  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Implementation Verification Review Implementation Verification Review Processes at the Savannah River Site Environmental Management Nuclear Facilities May 2011 September 2011 Office of Safety and Emergency Management Evaluations Office of Health, Safety and Security U.S. Department of Energy i Independent Oversight Review of the Implementation Verification Review Processes at the Savannah River Site Environmental Management Nuclear Facilities Table of Contents 1.0 Purpose ................................................................................................................................................. 1 2.0 Background ........................................................................................................................................... 1

85

Nuclear incident monitor criticality alarm instrument for the Savannah River Site: Technical manual  

SciTech Connect

The Savannah River Site is a Department of Energy facility. The facility stores, processes, and works with fissionable material at a number of locations. Technical standards and US Department of Energy orders, require these locations to be monitored by criticality alarm systems under certain circumstances. The Savannah River Site calls such instruments Nuclear Incident Monitors or NIMs. The Sole purpose of the Nuclear Incident Monitor is to provide an immediate evacuation signal in the case of an accidental criticality in order to minimize personnel exposure to radiation. The new unit is the third generation Nuclear Incident Monitor at the Savannah River Site. The second generation unit was developed in 1979. It was designed to eliminate vacuum-tube circuits, and was the first solid state NIM at SRS. The major design objectives of the second generation NIM were to improve reliability and reduce maintenance costs. Ten prototype units have been built and tested. This report describes the design of the new NIM and the testing that took place to verify its acceptability.

Jenkins, J.B.

1996-05-21T23:59:59.000Z

86

SRNS signs on as industry partner for Nuclear Engineering Technology...  

National Nuclear Security Administration (NNSA)

Dr. Rick Hall, Vice President of Academic Affairs, Augusta Technical College and Carol Johnson, Savannah River Nuclear Solutions President & CEO, to sign an Agreement of...

87

SAVANNAH RIVER SITE TANK CLEANING: CORROSION RATE FOR ONE VERSUS EIGHT PERCENT OXALIC ACID SOLUTION  

SciTech Connect

Until recently, the use of oxalic acid for chemically cleaning the Savannah River Site (SRS) radioactive waste tanks focused on using concentrated 4 and 8-wt% solutions. Recent testing and research on applicable dissolution mechanisms have concluded that under appropriate conditions, dilute solutions of oxalic acid (i.e., 1-wt%) may be more effective. Based on the need to maximize cleaning effectiveness, coupled with the need to minimize downstream impacts, SRS is now developing plans for using a 1-wt% oxalic acid solution. A technology gap associated with using a 1-wt% oxalic acid solution was a dearth of suitable corrosion data. Assuming oxalic acid's passivation of carbon steel was proportional to the free oxalate concentration, the general corrosion rate (CR) from a 1-wt% solution may not be bound by those from 8-wt%. Therefore, after developing the test strategy and plan, the corrosion testing was performed. Starting with the envisioned process specific baseline solvent, a 1-wt% oxalic acid solution, with sludge (limited to Purex type sludge-simulant for this initial effort) at 75 C and agitated, the corrosion rate (CR) was determined from the measured weight loss of the exposed coupon. Environmental variations tested were: (a) Inclusion of sludge in the test vessel or assuming a pure oxalic acid solution; (b) acid solution temperature maintained at 75 or 45 C; and (c) agitation of the acid solution or stagnant. Application of select electrochemical testing (EC) explored the impact of each variation on the passivation mechanisms and confirmed the CR. The 1-wt% results were then compared to those from the 8-wt%. The immersion coupons showed that the maximum time averaged CR for a 1-wt% solution with sludge was less than 25-mils/yr for all conditions. For an agitated 8-wt% solution with sludge, the maximum time averaged CR was about 30-mils/yr at 50 C, and 86-mils/yr at 75 C. Both the 1-wt% and the 8-wt% testing demonstrated that if the sludge was removed from the testing, there would be a significant increase in the CR. Specifically, the CR for an agitated 1-wt% pure oxalic acid solution at 45 or 75 C was about 4 to 10 times greater than those for a 1-wt% solution with sludge. For 8-wt% at 50 C, the effect was even larger. The lower CRs suggest that the cathodic reactions were altered by the sludge. For both the 1-wt% and 8-wt% solution, increasing the temperature did not result in an increased CR. Although the CR for a 1-wt% acid with sludge was considered to be non-temperature dependent, a stagnant solution with sludge resulted in a CR that was greater at 45 C than at 75 C, suggesting that the oxalate film formed at a higher temperature was better in mitigating corrosion. For both a 1 and an 8-wt% solution, agitation typically resulted in a higher CR. Overall, the testing showed that the general CR to the SRS carbon steel tanks from 1-wt% oxalic acid solution will remain bounded by those from an 8-wt% oxalic acid solution.

Ketusky, E.; Subramanian, K.

2011-01-20T23:59:59.000Z

88

Savannah River Site - Enforcement Documents  

NLE Websites -- All DOE Office Websites (Extended Search)

Enforcement Documents Enforcement Documents Savannah River Site Preliminary Notice of Violation issued to Savannah River Nuclear Solutions, LLC related to a Puncture Wound Injury resulting in a Radiological Uptake at the Savannah River Site, July 22, 2011 (NEA-2011-02) Consent Order issued to Parsons Infrastructure & Technology Group, Inc., related to Nuclear Facility Construction Deficiencies and Subcontractor Oversight at the Salt Waste Processing Facility at the Savannah River Site, April 13, 2010 Enforcement Letter issued to Amer Industrial Technologies, Inc. related to Weld Deficiencies at the Salt Waste Processing Facility at the Savannah River Site, April 13, 2010 Enforcement Letter issued to Parsons Technology Development & Fabrication Complex related to Deficiencies in the Fabrication of Safety Significant Embed Plates at the Salt Waste Processing Facility at the Savannah River Site, April 13, 2010

89

Buildilng America Whole-House Solutions for New Homes: Hood River Passive House- Hood River, Oregon (Fact Sheet)  

Energy.gov (U.S. Department of Energy (DOE))

The Hood River Passive Project incorporates high R-Value assemblies, extremely tight construction, high performance doors and windows, solar thermal DHW, heat recovery ventilation, moveable external shutters and a high performance ductless minisplit heat pump.

90

Building America Whole-House Solutions for New Homes: Hood River Passive House- Hood River, Oregon (Fact Sheet)  

Energy.gov (U.S. Department of Energy (DOE))

The Hood River Passive Project incorporates high R-Value assemblies, extremely tight construction, high performance doors and windows, solar thermal DHW, heat recovery ventilation, moveable external shutters and a high performance ductless minisplit heat pump.

91

Intermediate-Scale Ion Exchange Removal of Technetium from Savannah River Site Tank 44 F Supernate Solution  

SciTech Connect

As part of the Hanford River Protection Project waste Treatment facility design contracted to BNFL, Inc., a sample of Savannah River Site (SRS) Tank 4 F waste solution was treated for the removal of technetium (as pertechnetate ion). Interest in treating the SRS sample for Tc removal resulted from the similarity between the Tank 44 F supernate composition and Hanford Envelope A supernate solutions. The Tank 44 F sample was available as a by-product of tests already conducted at the Savannah River Technology Center (SRTC) as part of the Alternative Salt Disposition Program for treatment of SRS wastes. Testing of the SRS sample resulted in considerable cost-savings since it was not necessary to ship a sample of Hanford supernate to SRS.

King, W.D.

2000-08-23T23:59:59.000Z

92

DOE/EIS-0279; Savannah River Site Spent Nuclear Fuel Management Final Environmental Impact Statement (March 2000)  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

March 2000 Cover Sheet iii COVER SHEET RESPONSIBLE AGENCY: U.S. Department of Energy (DOE) TITLE: Savannah River Site, Spent Nuclear Fuel Management Final Environmental Impact Statement (DOE/EIS-0279) CONTACT: For additional information on this environmental impact statement, write or call: Andrew R. Grainger, NEPA Compliance Officer U.S. Department of Energy, Savannah River Operations Office, Building 742A, Room 183

93

Environmental assessment for DOE permission for off-loading activities to support the movement of commercial low level nuclear waste across the Savannah River Site  

SciTech Connect

This environmental assessment investigates the potential environmental and safety effects which could result from the land transport of low level radioactive wastes across the Savannah River Plant. Chem-Nuclear Systems operates a low level radioactive waste burial facility adjacent to the Savannah River Plant and is seeking permission from the DOE to transport the waste across Savannah River Plant.

NONE

1995-02-01T23:59:59.000Z

94

Nuclear magnetic resonance studies of drug-nucleic acid interactions at the synthetic DNA level in solution  

Science Journals Connector (OSTI)

Nuclear magnetic resonance studies of drug-nucleic acid interactions at the synthetic DNA level in solution ...

Dinshaw J. Patel

1979-04-01T23:59:59.000Z

95

Dose reconstruction for an occupational cohort at the Savannah River nuclear facility: evaluation of a hybrid method  

Science Journals Connector (OSTI)

......tritium dose estimation methods, including International...workers at a nuclear fuels production facility. Am. J...evaluation of a hybrid method. | The Savannah River...radioactive isotope of hydrogen. The purpose of the...matrix. The proposed method is unique in that along......

Ghassan Hamra; Leena A. Nylander-French; David Richardson

2008-08-01T23:59:59.000Z

96

Treatment of Nuclear Waste Solutions Using a New Class of Extractants: Pentaalkyl Propane Diamides  

Science Journals Connector (OSTI)

A new class of bifunctional extractants pentaalkyl propane diamides is studied in order to extract trivalent cations (Am3+, Cm3+…) and other actinides contained in waste solutions of nuclear industry. These solve...

C. Cuillerdier; C. Musikas; P. Hoel

1991-01-01T23:59:59.000Z

97

Surfactant based imbibition and induced solution gas drive process: investigation by nuclear magnetic resonance  

E-Print Network (OSTI)

SURFACTANT BASED IMBIBITION AND INDUCED SOLUTION GAS DRIVE PROCESS: INVESTIGATION BY NUCLEAR MAGNETIC RESONANCE A Thesis by JAMES CALVIN COX Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment.... of the requirements for the degree of MASTER OF SCIENCE August 1993 Major Subject: Chemical Engineering SURFACTANT BASED IMBIBITION AND INDUCED SOLUTION GAS DRIVE PROCESS: INVESTIGATION BY NUCLEAR MAGNETIC RESONANCE A Thesis by JAMES CALVIN COX Approved...

Cox, James Calvin

2012-06-07T23:59:59.000Z

98

Savannah River National Laboratory  

NLE Websites -- All DOE Office Websites (Extended Search)

Savannah River National Laboratory Savannah River National Laboratory srnl.doe.gov SRNL is a DOE National Laboratory operated by Savannah River Nuclear Solutions. At a glance Additive Manufacturing (3D Printing): Selectively Printed Conductive Pathways Researchers at the Savannah River National Laboratory (SRNL) have developed a rapid prototype conductive material that can be used for electrical shielding or circuit fabrication. Background Several rapid prototype technologies currently exist. A few of the technologies produce metallic parts, but the majority produce nonconductive parts made from various grades of plastic. In all of these technologies however, only conductive material or nonconductive material can be used within one part created. There is no known option for 3D printing conductive material for

99

SAVANNAH RIVER SITE INCIPIENT SLUDGE MIXING IN RADIOACTIVE LIQUID WASTE STORAGE TANKS DURING SALT SOLUTION BLENDING  

SciTech Connect

This paper is the second in a series of four publications to document ongoing pilot scale testing and computational fluid dynamics (CFD) modeling of mixing processes in 85 foot diameter, 1.3 million gallon, radioactive liquid waste, storage tanks at Savannah River Site (SRS). Homogeneous blending of salt solutions is required in waste tanks. Settled solids (i.e., sludge) are required to remain undisturbed on the bottom of waste tanks during blending. Suspension of sludge during blending may potentially release radiolytically generated hydrogen trapped in the sludge, which is a safety concern. The first paper (Leishear, et. al. [1]) presented pilot scale blending experiments of miscible fluids to provide initial design requirements for a full scale blending pump. Scaling techniques for an 8 foot diameter pilot scale tank were also justified in that work. This second paper describes the overall reasons to perform tests, and documents pilot scale experiments performed to investigate disturbance of sludge, using non-radioactive sludge simulants. A third paper will document pilot scale CFD modeling for comparison to experimental pilot scale test results for both blending tests and sludge disturbance tests. That paper will also describe full scale CFD results. The final paper will document additional blending test results for stratified layers in salt solutions, scale up techniques, final full scale pump design recommendations, and operational recommendations. Specifically, this paper documents a series of pilot scale tests, where sludge simulant disturbance due to a blending pump or transfer pump are investigated. A principle design requirement for a blending pump is UoD, where Uo is the pump discharge nozzle velocity, and D is the nozzle diameter. Pilot scale test results showed that sludge was undisturbed below UoD = 0.47 ft{sup 2}/s, and that below UoD = 0.58 ft{sup 2}/s minimal sludge disturbance was observed. If sludge is minimally disturbed, hydrogen will not be released. Installation requirements were also determined for a transfer pump which will remove tank contents, and which is also required to not disturb sludge. Testing techniques and test results for both types of pumps are presented.

Leishear, R.; Poirier, M.; Lee, S.; Steeper, T.; Fowley, M.; Parkinson, K.

2011-01-12T23:59:59.000Z

100

Office of River Protection (ORP) and Washingotn River Protection Solutions, LLC (WRPS) Partnering Agreement for the DOE-EM Tank Operations Project  

Energy.gov (U.S. Department of Energy (DOE))

The Mission of the Office of River Protection is to safely retrieve and treat Hanford's tank waste and close the Tank Farms to protect the Columbia River.

Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

DOE/EIS-0279; Savannah River Site Spent Nuclear Fuel Management Final Environmental Impact Statement (March 2000)  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

March 2000 Summary S-iii COVER SHEET RESPONSIBLE AGENCY: U.S. Department of Energy (DOE) TITLE: Savannah River Site, Spent Nuclear Fuel Management Final Environmental Impact Statement (DOE/EIS-0279) CONTACT: For additional information on this environmental impact statement, write or call: Andrew R. Grainger, NEPA Compliance Officer U.S. Department of Energy, Savannah River Operations Office, Building 742A, Room 183 Aiken, South Carolina 29802 Attention: Spent Nuclear Fuel Management EIS Local and Nationwide Telephone: (800) 881-7292 Email: nepa@SRS.gov The EIS is also available on the internet at: http://tis.eh.doe.gov/nepa/docs/docs.htm. For general information on the process that DOE follows in complying with the National Environmental Policy Act, write or call:

102

DOE/EIS-0279; Savannah River Site Spent Nuclear Fuel Management Final Environmental Impact Statement (March 2000)  

NLE Websites -- All DOE Office Websites (Extended Search)

Summary Summary S-iii COVER SHEET RESPONSIBLE AGENCY: U.S. Department of Energy (DOE) TITLE: Savannah River Site, Spent Nuclear Fuel Management Final Environmental Impact Statement (DOE/EIS-0279) CONTACT: For additional information on this environmental impact statement, write or call: Andrew R. Grainger, NEPA Compliance Officer U.S. Department of Energy, Savannah River Operations Office, Building 742A, Room 183 Aiken, South Carolina 29802 Attention: Spent Nuclear Fuel Management EIS Local and Nationwide Telephone: (800) 881-7292 Email: nepa@SRS.gov The EIS is also available on the internet at: http://tis.eh.doe.gov/nepa/docs/docs.htm. For general information on the process that DOE follows in complying with the National Environmental Policy Act, write or call:

103

DOE/EIS-0279; Savannah River Site Spent Nuclear Fuel Management Final Environmental Impact Statement (March 2000)  

NLE Websites -- All DOE Office Websites (Extended Search)

Cover Sheet Cover Sheet iii COVER SHEET RESPONSIBLE AGENCY: U.S. Department of Energy (DOE) TITLE: Savannah River Site, Spent Nuclear Fuel Management Final Environmental Impact Statement (DOE/EIS-0279) CONTACT: For additional information on this environmental impact statement, write or call: Andrew R. Grainger, NEPA Compliance Officer U.S. Department of Energy, Savannah River Operations Office, Building 742A, Room 183 Aiken, South Carolina 29802 Attention: Spent Nuclear Fuel Management EIS Local and Nationwide Telephone: (800) 881-7292 Email: nepa@SRS.gov The EIS is also available on the internet at: http://tis.eh.doe.gov/nepa/docs/docs.htm. For general information on the process that DOE follows in complying with the National Environmental Policy Act, write or call:

104

Standard test methods for chemical, mass spectrometric, spectrochemical, nuclear, and radiochemical analysis of nuclear-grade plutonium nitrate solutions  

E-Print Network (OSTI)

1.1 These test methods cover procedures for the chemical, mass spectrometric, spectrochemical, nuclear, and radiochemical analysis of nuclear-grade plutonium nitrate solutions to determine compliance with specifications. 1.2 The analytical procedures appear in the following order: Sections Plutonium by Controlled-Potential Coulometry Plutonium by Amperometric Titration with Iron(II) Plutonium by Diode Array Spectrophotometry Free Acid by Titration in an Oxalate Solution 8 to 15 Free Acid by Iodate Precipitation-Potentiometric Titration Test Method 16 to 22 Uranium by Arsenazo I Spectrophotometric Test Method 23 to 33 Thorium by Thorin Spectrophotometric Test Method 34 to 42 Iron by 1,10-Phenanthroline Spectrophotometric Test Method 43 to 50 Impurities by ICP-AES Chloride by Thiocyanate Spectrophotometric Test Method 51 to 58 Fluoride by Distillation-Spectrophotometric Test Method 59 to 66 Sulfate by Barium Sulfate Turbidimetric Test Method 67 to 74 Isotopic Composition by Mass Spectrom...

American Society for Testing and Materials. Philadelphia

2010-01-01T23:59:59.000Z

105

Savannah River Operations Office P.O. Box A Aiken, South Carolina...  

NLE Websites -- All DOE Office Websites (Extended Search)

South Carolina 29802 BUSINESS SENSITIVE OEC 1 0 tuu9 Mr. Garry Flowen, President &. CEO Savannah River Nuclear Solutions, LLC Building 730- I a, Room 333 Aiken. SC 29808 Dear Mr....

106

Analysis of zero-frequency solutions of the pion dispersion equation in nuclear matter  

E-Print Network (OSTI)

In this paper we consider instability of nuclear matter which takes place when the frequencies of the collective excitations turn to zero. We investigate collective excitations with pion quantum numbers J^\\pi=0^-. We study the dependence of zero-frequency solutions of the pion dispersion equation on the value of the spin-isospin quasiparticle interaction G'. The solutions of the pion dispersion equation describe the different types of the excitations in the matter, \\omega_i(k). At the critical density \\rho=\\rho_c one of solutions of the definite type turns to zero: \\omega_{i0}(k_c)=0. When \\rho>\\rho_c, the excitations \\omega_{i0}(k) become amplified. It is shown that there is such a "transitional" value of G'=G'_{tr} that for G'G'_{tr} they pertain to the type \\omega_c. The solutions of the type \\omega_{sd} correspond to instability to small density fluctuations of the nuclear matter at G'\\le -1. On the other hand, \\omega_c is responsible for the "pion condensation" at G'\\approx 2. For the stable nuclear matter the branches of solutions \\omega_{sd}(k) and \\omega_c(k) are located on the unphysical sheets of the complex plane of frequency.

V. A. Sadovnikova

2005-10-25T23:59:59.000Z

107

Standard test methods for chemical, mass spectrometric, spectrochemical, nuclear, and radiochemical analysis of nuclear-grade uranyl nitrate solutions  

E-Print Network (OSTI)

1.1 These test methods cover procedures for the chemical, mass spectrometric, spectrochemical, nuclear, and radiochemical analysis of nuclear-grade uranyl nitrate solution to determine compliance with specifications. 1.2 The analytical procedures appear in the following order: Sections Determination of Uranium 7 Specific Gravity by Pycnometry 15-20 Free Acid by Oxalate Complexation 21-27 Determination of Thorium 28 Determination of Chromium 29 Determination of Molybdenum 30 Halogens Separation by Steam Distillation 31-35 Fluoride by Specific Ion Electrode 36-42 Halogen Distillate Analysis: Chloride, Bromide, and Iodide by Amperometric Microtitrimetry 43 Determination of Chloride and Bromide 44 Determination of Sulfur by X-Ray Fluorescence 45 Sulfate Sulfur by (Photometric) Turbidimetry 46 Phosphorus by the Molybdenum Blue (Photometric) Method 54-61 Silicon by the Molybdenum Blue (Photometric) Method 62-69 Carbon by Persulfate Oxidation-Acid Titrimetry 70 Conversion to U3O8 71-74 Boron by ...

American Society for Testing and Materials. Philadelphia

1999-01-01T23:59:59.000Z

108

Safety of interim storage solutions of used nuclear fuel during extended term  

SciTech Connect

In 2013, the total amount of stored used nuclear fuel (UNF) in the world will reach 225,000 T HM. The UNF inventory in wet storage will take up over 80% of the available total spent fuel pool (SFP) capacity. Interim storage solutions are needed. They give flexibility to the nuclear operators and ensure that nuclear reactors continue to operate. However, we need to keep in mind that they are also an easy way to differ final decision and implementation of a UNF management approach (recycling or final disposal). In term of public perception, they can have a negative impact overtime as it may appear that nuclear industry may have significant issues to resolve. In countries lacking an integrated UNF management approach, the UNF are being discharged from the SFPs to interim storage (mostly to dry storage) at the same rate as UNF is being discharged from reactors, as the SFPs at the reactor sites are becoming full. This is now the case in USA, Taiwan, Switzerland, Spain, South Africa and Germany. For interim storage, AREVA has developed different solutions in order to allow the continued operation of reactors while meeting the current requirements of Safety Authorities: -) Dry storage canisters on pads, -) Dual-purpose casks (dry storage and transportation), -) Vault dry storage, and -) Centralized pool storage.

Shelton, C.; Bader, S.; Issard, H.; Arslan, M. [AREVA, 7135 Minstrel Way, Suite 300 Columbia, MD 21045 (United States)

2013-07-01T23:59:59.000Z

109

Transfer of excess nuclear material from Los Alamos to Savannah River site for long-term disposition  

SciTech Connect

Los Alamos National Laboratory is preparing excess nuclear material for shipment to Savannah River Site (SRS) for final disposition. Prior to shipment the nuclear material will be stabilized and packaged to meet strict criteria. The criterion that must be met include: (1) the DOE stabilization, packaging and storage requirements for plutonium bearing materials, DOE-STD-3013, (2) shipping container packaging requirements, (3) SRS packaging and storage criteria, and (4) DOE Material Disposition criteria for either immobilization or MOX reactor fuel. Another issue in preparing for this transfer is the DOE certification of shipping containers and the availability of shipping containers. This transfer of the nuclear material is fully supported by the EM, DP and NN Sections of the DOE, as well as, by LANL and SRS, yet a strong collaboration is needed to meet all established requirements relating to stabilization, packaging, shipment, storage and final disposition. This paper will present the overall objectives, the issues and the planned strategy to accomplish this nuclear material transfer.

Hoth, C. W. (Carl W.); Yarbro, T. F. (Tresa F.); Foster, Lynn A.

2001-06-01T23:59:59.000Z

110

Independent Oversight Review, Savannah River Field Office Tritium  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Field Office Tritium Field Office Tritium Facilities - November 2013 Independent Oversight Review, Savannah River Field Office Tritium Facilities - November 2013 November 13, 2013 Review of Savannah River Field Office Tritium Facilities Radiological Controls Activity-Level Implementation This report documents the results of an independent oversight review of the radiological protection program at the Savannah River Site (SRS) tritium facilities implemented at the activity-level by Savannah River Nuclear Solutions, LLC and its subcontractors. The review was performed by the Office of Health, Safety and Security's Office of Safety and Emergency Management Evaluations within the broader context of an ongoing program of targeted assessments of radiological control programs, with an emphasis on

111

SRNS-RP-2013-00005 Savannah River Site Ten Year Site Plan FY  

NLE Websites -- All DOE Office Websites (Extended Search)

SRNS-RP-2013-00005 SRNS-RP-2013-00005 Savannah River Site Ten Year Site Plan FY 2014 - 2023 May 2013 United States Department of Energy Savannah River Site Ten Year Site Plan FY 2014 - 2023 May 2013 Prepared by: Savannah River Nuclear Solutions, LLC A Fluor Daniel Partnership Savannah River Site Aiken, SC 29808 SRNS-RP-2013-00005 Savannah River Site Ten Year Site Plan SRNS-RP-2013-00005 May 2013 DISCLAIMER This report was prepared by Savannah River Nuclear Solutions LLC (SRNS) for the United States Department of Energy under Contract No. DE-AC09-08SR22470 and is an account of work performed under that contract. Reference herein to any specific commercial product, process or services by trademark, name, manufacturer, or otherwise does not necessarily constitute or imply endorsement,

112

Fusion solution to dispose of spent nuclear fuel, transuranic elements, and highly enriched uranium  

Science Journals Connector (OSTI)

The disposal of the nuclear spent fuel, the transuranic elements, and the highly enriched uranium represents a major problem under investigation by the international scientific community to identify the most promising solutions. The investigation of this paper focused on achieving the top rated solution for the problem, the elimination goal, which requires complete elimination for the transuranic elements or the highly enriched uranium, and the long-lived fission products. To achieve this goal, fusion blankets with liquid carrier, molten salts or liquid metal eutectics, for the transuranic elements and the uranium isotopes are utilized. The generated energy from the fusion blankets is used to provide revenue for the system. The long-lived fission products are fabricated into fission product targets for transmutation utilizing the neutron leakage from the fusion blankets. This paper investigated the fusion blanket designs for small fusion devices and the system requirements for such application. The results show that 334 MW of fusion power from D–T plasma for 30 years with an availability factor of 0.75 can dispose of the 70,000 tons of the U.S. inventory of spent nuclear fuel generated up to the year 2015. In addition, this fusion solution eliminates the need for a geological repository site, which is a major advantage. Meanwhile, such utilization of the fusion power will provide an excellent opportunity to develop fusion energy for the future.

Yousry Gohar

2001-01-01T23:59:59.000Z

113

U.S. DEPARTMENT OF ENERGY * SAVANNAH RIVER SITE * AIKEN * SC  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

* SAVANNAH RIVER SITE * AIKEN * SC * SAVANNAH RIVER SITE * AIKEN * SC from Savannah River National Laboratory srnl.doe.gov SRNL is a DOE National Laboratory operated by Savannah River Nuclear Solutions. The SRNL Technical Assistance Program: When standard approaches don't work Teams provide phased technical solutions that combine applied strategies with technologies that are carefully matched to site- specific conditions and issues. The teams then delineate steps to optimize and focus final selection and implementation of strategies. At SRNL, we focus on matching remediation technologies with real- world conditions and desired goals to achieve transformational outcomes for the Environmental Management program. This innovation and flexibility is vital in meeting the needs

114

Industrial Hygiene Surveillance of the Washington River Protection Solutions, LLC Industrial Hygiene Program Strategy and Implementation of the Hanford Concerns Council Recommendations, October 2011  

NLE Websites -- All DOE Office Websites (Extended Search)

ORP-2011-10-26 ORP-2011-10-26 Site: Hanford (Office of River Protection) Subject: Office of Enforcement and Oversight's Office of Safety and Emergency Management Evaluations Activity Report for the Industrial Hygiene Surveillance of the Washington River Protection Solutions, LLC Industrial Hygiene Program Strategy and Implementation of the Hanford Concerns Council Recommendations Dates of Activity : 08/16-25/2011 (Field) Final Report 10/26/2011 Report Preparer: Jim Lockridge, Certified Industrial Hygienist Activity Description/Purpose: Staff from the U.S. Department of Energy's (DOE) Office of Enforcement and Oversight, within the Office of Health, Safety and Security (HSS), in coordination with the Office of River Protection (ORP), reviewed the status and programmatic health

115

A general numerical solution of dispersion relations for the nuclear optical model  

E-Print Network (OSTI)

A general numerical solution of the dispersion integral relation between the real and the imaginary parts of the nuclear optical potential is presented. Fast convergence is achieved by means of the Gauss-Legendre integration method, which offers accuracy, easiness of implementation and generality for dispersive optical model calculations. The use of this numerical integration method in the optical-model parameter search codes allows for a fast and accurate dispersive analysis. PACS number(s): 11.55.Fv, 24.10.Ht, 02.60.Jh

Roberto Capote; Alberto Molina; Jose Manuel Quesada

2001-05-09T23:59:59.000Z

116

Chernobyl nuclear accident hydrologic analysis and emergency evaluation of radionuclide distributions in the Dnieper River, Ukraine, during the 1993 summer flood  

SciTech Connect

This report describes joint activities of Program 7.1.F, ``Radionuclide Transport in Water and Soil Systems,`` of the USA/Commonwealth of Independent States (CIS) Joint Coordinating Committee of Civilian Nuclear Reactor Safety to study the hydrogeochemical behavior of radionuclides released to the Pripyat and Dnieper rivers from the Chernobyl Nuclear Power Plant in Ukraine. These joint activities included rapid evaluation of radionuclide distributions in the Pripyat and Dnieper river system and field data evaluation and modeling for the 1993 summer flood to assist the Ukrainian government in their emergency response during the flood. In July-August 1993, heavy rainfall over the Pripyat River Catchment in Belarus and Ukraine caused severe flooding, significantly raising {sup 90}Sr concentrations in the river. Near the Chernobyl area, the maximum {sup 90}Sr concentration in the Pripyat River reached 20--25 PCi/L in early August; near the Pripyat River mouth, the concentration rose to 35 pCi/L. The peak {sup 90}Sr concentration in the Kiev Reservoir (a major source of drinking water for Kiev) was 12 pCi/L. Based on these measured radionuclide levels, additional modeling results and the assumption of water purification in a water treatment station, {sup 90}Sr concentrations in Kiev`s drinking water were estimated to be less than 8 pCi/L. Unlike {sup 90}Sr, {sup 137}Cs concentrations in the Pripyat River during the flood did not rise significantly to the pre-flood levels. Estimated {sup 137}Cs concentrations for the Kiev drinking water were two orders of magnitude lower than the drinking water standard of 500 pCi/L for {sup 137}Cs.

Voitsekhovitch, O.V. [Ukrainian Hydrometeorological Inst., Kiev (Ukraine); Zheleznyak, M.J. [Ukrainian Academy of Sciences, Kiev (Ukraine). Cybernetics Center; Onishi, Y. [Pacific Northwest Lab., Richland, WA (United States)

1994-06-01T23:59:59.000Z

117

Alternative dispositioning methods for HEU spent nuclear fuel at the Savannah River Site  

SciTech Connect

The United States has a strong policy on prevention of the international spread of nuclear weapons. This policy was announced in Presidential Directive PDD-13 and summarized in a White House press release September 27, 1993. Two cornerstones of this policy are: seek to eliminate where possible the accumulation of stockpiles of highly- enriched uranium or plutonium; propose{hor_ellipsis}prohibiting the production of highly-enriched uranium (HEU) or plutonium for nuclear explosives purposes or outside international safeguards. The Department of Energy is currently struggling to devise techniques that safely and efficiently dispose of spent nuclear fuel (SNF) while satisfying national non-proliferation policies. SRS plans and proposals for disposing of their SNF are safe and cost effective, and fully satisfy non-proliferation objectives.

Krupa, J.F.; McKibben, J.M.; Parks, P.B.; DuPont, M.E.

1995-11-01T23:59:59.000Z

118

Americium/Lanthanide Separations in Alkaline Solutions for Advanced Nuclear Fuel Cycles  

SciTech Connect

Project goals: Can used nuclear fuel be partitioned by dissolution in alkaline aqueous solution to give a solution of uranium, neptunium, plutonium, americium and curium and a filterable solid containing nearly all of the lanthanide fission products and certain other fission products? What is the chemistry of Am/Cm/Ln in oxidative carbonate solutions? Can higher oxidation states of Am be stabilized and exploited? Conclusions: Am(VI) is kinetically stable in 0.5-2.0 M carbonate solutions for hours. Aliquat 336 in toluene has been successfully shown to extract U(VI) and Pu(VI) from carbonate solutions. (Stepanov et al 2011). Higher carbonate concentration gives lower D, SF{sub U/Eu} for = 4 in 1 M K{sub 2}CO{sub 3}. Experiments with Am(VI) were unsuccessful due to reduction by the organics. Multiple sources of reducing organics...more optimization. Reduction experiments of Am(VI) in dodecane/octanol/Aliquat 336 show that after 5 minutes of contact, only 30-40% of the Am(VI) has been reduced. Long enough to perform an extraction. Shorter contact times, lower T, and lower Aliquat 336 concentration still did not result in any significant extraction of Am. Anion exchange experiments using a strong base anion exchanger show uptake of U(VI) with minimal uptake of Nd(III). Experiments with Am(VI) indicate Am sorption with a Kd of 9 (10 minute contact) but sorption mechanism is not yet understood. SF{sub U/Nd} for = 7 and SF{sub U/Eu} for = 19 after 24 hours in 1 M K{sub 2}CO{sub 3}.

Goff, George S. [Los Alamos National Laboratory; Long, Kristy Marie [Los Alamos National Laboratory; Reilly, Sean D. [Los Alamos National Laboratory; Jarvinen, Gordon D. [Los Alamos National Laboratory; Runde, Wolfgang H. [Los Alamos National Laboratory

2012-06-11T23:59:59.000Z

119

Categorical Exclusion Determinations: Savannah River Operations Office |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

November 29, 2010 November 29, 2010 CX-004808: Categorical Exclusion Determination Flowsheet Evaluation for the Neutralization of High Aluminum ? Low Uranium Used Nuclear Fuel (UNF) Solution CX(s) Applied: B3.6 Date: 11/29/2010 Location(s): Aiken, South Carolina Office(s): Savannah River Operations Office November 29, 2010 CX-004809: Categorical Exclusion Determination Reactive Gas Reprocessing of Used Nuclear Fuel Simulants CX(s) Applied: B3.6 Date: 11/29/2010 Location(s): Aiken, South Carolina Office(s): Savannah River Operations Office November 29, 2010 CX-004806: Categorical Exclusion Determination Volume Measurement of Solids by Gas Pycnometry CX(s) Applied: B3.6 Date: 11/29/2010 Location(s): Aiken, South Carolina Office(s): Savannah River Operations Office November 12, 2010 CX-004805: Categorical Exclusion Determination

120

Independent Oversight Review, Savannah River Site- September 2011  

Energy.gov (U.S. Department of Energy (DOE))

Review of the Implementation Verification Review Processes at the Savannah River Site Environmental Management Nuclear Facilities

Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

Independent Oversight Review, Savannah River Site - August 2011 |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

August 2011 August 2011 Independent Oversight Review, Savannah River Site - August 2011 August 2011 Review of Commercial Grade Dedication Plans for the Safety Instrumented System at the Savannah River Site Waste Solidification Building Project The Office of Enforcement and Oversight (Independent Oversight) within the Office of Health, Safety and Security (HSS), conducted an independent review of selected aspects of Savannah River Nuclear Solutions' (SRNS) plans for commercial grade dedication (CGD) of the Waste Solidification Building (WSB) Safety Instrumented System (SIS) safety significant components at the Savannah River Site (SRS). The independent review was conducted during June 14-24 and July 12-13, 2011, by Independent Oversight in coordination with the U.S. Department of Energy and the National Nuclear

122

Use of Noncompetitive Procurements to Obtain Services at the Savannah River Site, IG-0862  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Use of Noncompetitive Use of Noncompetitive Procurements to Obtain Services at the Savannah River Site DOE/IG-0862 April 2012 U.S. Department of Energy Office of Inspector General Office of Audits and Inspections Department of Energy Washington, DC 20585 April 10, 2012 MEMORANDUM FOR THE SECRETARY FROM: Gregory H. Friedman Inspector General SUBJECT: INFORMATION: Audit Report on "Use of Noncompetitive Procurements to Obtain Services at the Savannah River Site" INTRODUCTION AND OBJECTIVE Savannah River Nuclear Solutions, LLC (SRNS), assumed management and operating responsibility for the Department of Energy's Savannah River Site located near Aiken, South Carolina, in August 2008. Under its contract, SRNS is responsible for environmental cleanup,

123

"1. Palo Verde","Nuclear","Arizona Public Service Co",3937 "2. Navajo","Coal","Salt River Project",2250  

U.S. Energy Information Administration (EIA) Indexed Site

Arizona" Arizona" "1. Palo Verde","Nuclear","Arizona Public Service Co",3937 "2. Navajo","Coal","Salt River Project",2250 "3. Gila River Power Station","Gas","Gila River Power Station LP",2060 "4. Springerville","Coal","Tucson Electric Power Co",1618 "5. Glen Canyon Dam","Hydroelectric","U S Bureau of Reclamation",1312 "6. Santan","Gas","Salt River Project",1227 "7. Mesquite Generating Station","Gas","Mesquite Power LLC",1073 "8. Harquahala Generating Project","Gas","New Harquahala Generating Co, LLC",1054 "9. Hoover Dam","Hydroelectric","U S Bureau of Reclamation",1040

124

Corrosion property of 9Cr-ODS steel in nitric acid solution for spent nuclear fuel reprocessing  

SciTech Connect

Corrosion tests of oxide dispersion strengthened with 9% Cr (9Cr-ODS) steel, which is one of the desirable materials for cladding tube of sodium-cooled fast reactors, in pure nitric acid solution, spent FBR fuel solution, and its simulated solution were performed to understand the corrosion behavior in a spent nuclear fuel reprocessing. In this study, the 9Cr-ODS steel with lower effective chromium content was evaluated to understand the corrosion behavior conservatively. As results, the tube-type specimens of the 9Cr-ODS steels suffered severe weight loss owing to active dissolution at the beginning of the immersion test in pure nitric acid solution in the range from 1 to 3.5 M. In contrast, the weight loss was decreased and they showed a stable corrosion in the higher nitric acid concentration, the dissolved FBR fuel solution, and its simulated solution by passivation. The corrosion rates of the 9Cr-ODS steel in the dissolved FBR fuel solution and its simulated solution were 1-2 mm/y and showed good agreement with each other. The passivation was caused by the shift of corrosion potential to noble side owing to increase in nitric acid concentration or oxidative ions in the dissolved FBR fuel solution and the simulated spent fuel solution. (authors)

Takeuchi, M.; Koizumi, T. [Japan Atomic Energy Agency, Tokai-mura, Naka-gun, Ibaraki 319-1195 (Japan); Inoue, M.; Koyama, S.I. [Japan Atomic Energy Agency, Oarai-machi, Higashi-ibaraki-gun, Ibaraki 311-1393 (Japan)

2013-07-01T23:59:59.000Z

125

Independent Oversight Activity Report, Savannah River Site Waste  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Savannah River Site Waste Savannah River Site Waste Solidification Building Independent Oversight Activity Report, Savannah River Site Waste Solidification Building May 2013 Savannah River Site Waste Solidification Building Corrective Actions from the January 2013 Report on Construction Quality of Mechanical Systems Installation and Fire Protection Design [HIAR SRS-2013-5-07] Activity Description/Purpose: Review the corrective actions being implemented by the construction contractor to address Findings 1-4, 6, and 9 from a construction quality review performed by the Office of Health, Safety and Security (HSS) (Reference 1). Meet with the SRS WSB project staff and Savannah River Nuclear Solutions (SRNS) engineers to discuss the proposed corrective actions discussed in Reference 2, and clarify additional reviews to be performed by

126

Independent Oversight Activity Report, Savannah River Site Waste  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Independent Oversight Activity Report, Savannah River Site Waste Independent Oversight Activity Report, Savannah River Site Waste Solidification Building Independent Oversight Activity Report, Savannah River Site Waste Solidification Building May 2013 Savannah River Site Waste Solidification Building Corrective Actions from the January 2013 Report on Construction Quality of Mechanical Systems Installation and Fire Protection Design [HIAR SRS-2013-5-07] Activity Description/Purpose: Review the corrective actions being implemented by the construction contractor to address Findings 1-4, 6, and 9 from a construction quality review performed by the Office of Health, Safety and Security (HSS) (Reference 1). Meet with the SRS WSB project staff and Savannah River Nuclear Solutions (SRNS) engineers to discuss the proposed corrective actions

127

NUCLEAR SCIENCE ANNUAL REPORT 1975  

E-Print Network (OSTI)

Gove and A. H. Wapstra, Nuclear Data Tables 11, 127 (1972).P. Jackson, Chalk River Nuclear Laboratories Report (1975)national Conference on Nuclear Structure and Spec­ troscopy,

Authors, Various

2010-01-01T23:59:59.000Z

128

Nuclear spin relaxation of sodium cations in bacteriophage Pf1 solutions D. N. Sobieski, N. R. Krueger, S. Vyas,a  

E-Print Network (OSTI)

Nuclear spin relaxation of sodium cations in bacteriophage Pf1 solutions D. N. Sobieski, N. R The nuclear magnetic resonance NMR spectra for the I=3/2 23 Na cation dissolved into filamentous bacteriophage the 23 Na nuclear quadrupole moment and the electric field gradient produced by the negatively charged Pf

Augustine, Mathew P.

129

Oversight Reports - Savannah River Site | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

December 9, 2009 Independent Oversight Inspection, Savannah River Site Office - December 2009 Inspection of Nuclear Safety at the Savannah River Site Office and the Tritium Program...

130

Numerical solution for stochastic point-kinetics equations with sinusoidal reactivity in dynamical system of nuclear reactor  

Science Journals Connector (OSTI)

In this present analysis, the numerical simulation methods are applied to calculate the solution for stochastic point-kinetic equations with sinusoidal reactivity in dynamical system of nuclear reactor. The resulting system of differential equations is solved for each time step-size. Using experimental data, the methods are investigated over initial conditions and with sinusoidal reactivity. The computational results designate that these numerical approximation methods are straightforward, effective and easy for solving stochastic point-kinetic equations.

S. Saha Ray; A. Patra

2013-01-01T23:59:59.000Z

131

Cutting-Edge Savannah River Site Project Avoids Millions in Costs, Removes  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Cutting-Edge Savannah River Site Project Avoids Millions in Costs, Cutting-Edge Savannah River Site Project Avoids Millions in Costs, Removes Chemical Solvents from Underground: Project avoided costs totaling more than $15 million, removed tons of chemical solvents from beneath the Savannah River Site Cutting-Edge Savannah River Site Project Avoids Millions in Costs, Removes Chemical Solvents from Underground: Project avoided costs totaling more than $15 million, removed tons of chemical solvents from beneath the Savannah River Site June 13, 2012 - 12:00pm Addthis Harrel McCray, left, and Joey Clark, employees with SRS management and operations contractor, Savannah River Nuclear Solutions, stand by an extensive SRS cleanup system that safely and successfully rid the site of more than 33,000 gallons of non-radioactive chemical

132

Cutting-Edge Savannah River Site Project Avoids Millions in Costs, Removes  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Cutting-Edge Savannah River Site Project Avoids Millions in Costs, Cutting-Edge Savannah River Site Project Avoids Millions in Costs, Removes Chemical Solvents from Underground: Project avoided costs totaling more than $15 million, removed tons of chemical solvents from beneath the Savannah River Site Cutting-Edge Savannah River Site Project Avoids Millions in Costs, Removes Chemical Solvents from Underground: Project avoided costs totaling more than $15 million, removed tons of chemical solvents from beneath the Savannah River Site June 13, 2012 - 12:00pm Addthis Harrel McCray, left, and Joey Clark, employees with SRS management and operations contractor, Savannah River Nuclear Solutions, stand by an extensive SRS cleanup system that safely and successfully rid the site of more than 33,000 gallons of non-radioactive chemical

133

Determination of dispersivities and reactionkinetics of selected basalts of columbia river plateau using an inverse analytical solution technique  

E-Print Network (OSTI)

on the determination of transport parameters by modeling sodium transport in the Priest Rapids and Roza flow tops of the Wanapum formation, and Rocky Coulee and Umtanum flow tops of the Grande Ronde formation, within the Cold Creek Syncline of the Hanford Nuclear Waste...

Fahlquist, Lisa Armstrong

2012-06-07T23:59:59.000Z

134

Savannah River Site | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Savannah River Site Savannah River Site Savannah River Site Savannah River Site | June 2011 Aerial View Savannah River Site | June 2011 Aerial View Savannah River Site (SRS) has mission responsibilities in nuclear weapons stockpile stewardship by ensuring the safe and reliable management of tritium resources; by contributing to the stockpile surveillance program; and by assisting in the development of alternatives for large-scale pit disassembly/conversion capability. SRS also manages excess nuclear materials and supports nuclear nonproliferation initiatives. Environmental stewardship activities include the management, treatment, and disposal of radioactive, hazardous, and mixed wastes. Enforcement April 13, 2010 Consent Order, Parsons Infrastructure & Technology Group, Inc. -

135

EM Develops Database for Efficient Solutions to Nuclear Cleanup Challenges Across Complex  

Energy.gov (U.S. Department of Energy (DOE))

WASHINGTON, D.C. – Many deactivation and decommissioning (D&D) projects across the EM complex require robotic and remote handling systems to protect workers during nuclear cleanup operations.

136

Savannah River Site - Reports  

NLE Websites -- All DOE Office Websites (Extended Search)

Reports Reports Savannah River Site Review Reports 2013 Independent Oversight Review of the Savannah River Field Office Tritium Facilities Radiological Controls Activity-Level Implementation, November 2013 Independent Oversight Review of the Savannah River Site Salt Waste Processing Facility Safety Basis and Design Development, August 2013 Independent Oversight Review of the Employee Concerns Program at the Savannah River Operations Office, July 2013 Assessment of Nuclear Safety Culture at the Salt Waste Processing Facility Project, January 2013 Review of the Savannah River Site, Waste Solidification Building, Construction Quality of Mechanical Systems Installation and Selected Aspects of Fire Protection System Design, January 2013 Activity Reports 2013 Savannah River Site Waste Solidification Building Corrective Actions from the January 2013 Report on Construction Quality of Mechanical Systems Installation and Fire Protection Design, May 2013

137

POTENTIAL FOR STRESS CORROSION CRACKING OF A537 CARBON STEEL NUCLEAR WASTE TANKS CONTAINING HIGHLY CAUSTIC SOLUTIONS  

SciTech Connect

The evaporator recycle streams of nuclear waste tanks may contain waste in a chemistry and temperature regime that exceeds the current corrosion control program, which imposes temperature limits to mitigate caustic stress corrosion cracking (CSCC). A review of the recent service history found that two of these A537 carbon steel tanks were operated in highly concentrated hydroxide solution at high temperature. Visual inspections, experimental testing, and a review of the tank service history have shown that CSCC has occurred in uncooled/un-stress relieved tanks of similar construction. Therefore, it appears that the efficacy of stress relief of welding residual stress is the primary corrosion-limiting mechanism. The objective of this experimental program is to test A537 carbon steel small scale welded U-bend specimens and large welded plates (30.48 x 30.38 x 2.54 cm) in a caustic solution with upper bound chemistry (12 M hydroxide and 1 M each of nitrate, nitrite, and aluminate) and temperature (125 C). These conditions simulate worst-case situations in these nuclear waste tanks. Both as-welded and stress-relieved specimens have been tested. No evidence of stress corrosion cracking was found in the U-bend specimens after 21 days of testing. The large plate test was completed after 12 weeks of immersion in a similar solution at 125 C except that the aluminate concentration was reduced to 0.3 M. Visual inspection of the plate revealed that stress corrosion cracking had not initiated from the machined crack tips in the weld or in the heat affected zone. NDE ultrasonic testing also confirmed subsurface cracking did not occur. Based on these results, it can be concluded that the environmental condition of these tests was unable to develop stress corrosion cracking within the test periods for the small welded U-bends and for the large plates, which were welded with an identical procedure as used in the construction of the actual nuclear waste tanks in the 1960s. The absence of evidence of stress corrosion cracking and general corrosion in the laboratory-scaled specimens indicate that this type of nuclear waste tank is not susceptible to highly caustic solutions up to 12 M hydroxide at 125 C when sufficient nitrite inhibitor is present.

Lam, P.; Stripling, C.; Fisher, D.; Elder, J.

2010-04-26T23:59:59.000Z

138

River Thames River Thames  

E-Print Network (OSTI)

West Kent House Penge East Lower Sydenham Forest Hill Honor Oak Park Crofton Park Nunhead New CrossC BD A River Thames River Thames Waterloo & City Southwark Northwood Northwood Hills North Harrow Harrow- on-the-Hill Northwick Park Harrow & Wealdstone Headstone Lane Pinner Kenton Stanmore Canons Park

Delmotte, Nausicaa

139

River Thames River Thames  

E-Print Network (OSTI)

River Thames River Thames Du Cane Road Wood Lane Wood Lane North Pole Road Barlby Road Highlever Street Acton Market Place Acton Horn Lane Wood Lane Du Cane Road Wood Lane South Africa Road White City for BBC Television Centre Wood Lane Ariel Way Wood Lane Shepherd's Bush Green Shepherd's Bush Green

140

Savannah River Site 2012 Outlook: Transuranic Waste Program Set to Safely  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Site 2012 Outlook: Transuranic Waste Program Set to Site 2012 Outlook: Transuranic Waste Program Set to Safely Reach Milestone Savannah River Site 2012 Outlook: Transuranic Waste Program Set to Safely Reach Milestone January 1, 2012 - 12:00pm Addthis By May, Savannah River Nuclear Solutions expects to be shipping transuranic waste to the Waste Isolation Pilot Plant almost continuously, using six TRUPACT-III shipping containers like the one shown here. By May, Savannah River Nuclear Solutions expects to be shipping transuranic waste to the Waste Isolation Pilot Plant almost continuously, using six TRUPACT-III shipping containers like the one shown here. Workers relocate a pipe overpack container used to transport small amounts of excess plutonium oxide destined for long-term storage at the Waste Isolation Pilot Plant in Carlsbad, New Mexico.

Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

8/25/07 11:53 PMNUCLEAR POWER:A Nuclear Solution to Climate Change? --Sailor et al. 288 (5469): 1177 --Science Page 1 of 6http://www.sciencemag.org/cgi/content/full/288/5469/1177  

E-Print Network (OSTI)

: Vol. 288. no. 5469, pp. 1177 - 1178 DOI: 10.1126/science.288.5469.1177 POLICY FORUM NUCLEAR POWER8/25/07 11:53 PMNUCLEAR POWER:A Nuclear Solution to Climate Change? -- Sailor et al. 288 (5469: A Nuclear Solution to Climate Change? William C. Sailor,* David Bodansky, Chaim Braun, Steve Fetter, Bob van

Kammen, Daniel M.

142

SAVANNAH RIVER SITE ENVIRONMENTAL REPORT FOR 2010  

SciTech Connect

This report was prepared in accordance with U.S. Department of Energy (DOE) Order 231.1A, 'Environment, Safety and Health Reporting,' to present summary environmental data for the purpose of: (a) characterizing site's environmental management performance; (b) summarizing environmental occurrences and responses reported during the calendar year; (c) describing compliance status with respect to environmental standards and requirements; and (d) highlighting significant site programs and efforts. This report is the principal document that demonstrates compliance with the requirements of DOE Order 5400.5, 'Radiation Protection of the Public and the Environment,' and is a key component of DOE's effort to keep the public informed of environmental conditions at Savannah River Site (SRS). SRS has four primary missions: (1) Environmental Management - Cleaning up the legacy of the Cold War efforts and preparing decommissioned facilities and areas for long-term stewardship; (2) Nuclear Weapons Stockpile Support - Meeting the needs of the U.S. nuclear weapons stockpile through the tritium programs of the National Nuclear Security Administration (NNSA); (3) Nuclear Nonproliferation Support - Meeting the needs of the NNSA's nuclear nonproliferation programs by safely storing and dispositioning excess special nuclear materials; and (4) Research and Development - Supporting the application of science by the Savannah River National Laboratory (SRNL) to meet the needs of SRS, the DOE complex, and other federal agencies During 2010, SRS worked to fulfill these missions and position the site for future operations. SRS continued to work with the South Carolina Department of Health and Environmental Control (SCDHEC), the Environmental Protection Agency (EPA), and the Nuclear Regulatory Commission to find and implement solutions and schedules for waste management and disposition. As part of its mission to clean up the Cold War legacy, SRS will continue to address the highest-risk waste management issues by safely storing and preparing liquid waste and nuclear materials for disposition, and by safely stabilizing any tank waste residues that remain on site.

Mamatey, A.; Dunaway-Ackerman, J.

2011-08-16T23:59:59.000Z

143

For the Federal Columbia River Power System  

NLE Websites -- All DOE Office Websites (Extended Search)

its products and services . BPA markets wholesale electrical power from 31 federal hydro projects in the Columbia River Basin, one nonfederal nuclear plant and several small...

144

Dose reconstruction for an occupational cohort at the Savannah River nuclear facility: evaluation of a hybrid method  

Science Journals Connector (OSTI)

......reprocessing of reactor fuels(19). However...type and number of reactors operating at SRS...dose. Statistical analysis The proportion of...her coworker. The reliability of this estimation...Statistical Nuclear Reactors statistics & numerical...methods Tritium analysis United States...

Ghassan Hamra; Leena A. Nylander-French; David Richardson

2008-08-01T23:59:59.000Z

145

A Parallel Multi-Domain Solution Methodology Applied to Nonlinear Thermal Transport Problems in Nuclear Fuel Pins  

E-Print Network (OSTI)

This paper describes an efficient and nonlinearly consistent parallel solution methodology for solving coupled nonlinear thermal transport problems that occur in nuclear reactor applications over hundreds of individual 3D physical subdomains. Efficiency is obtained by leveraging knowledge of the physical domains, the physics on individual domains, and the couplings between them for preconditioning within a Jacobian Free Newton Krylov method. Details of the computational infrastructure that enabled this work, namely the open source Advanced Multi-Physics (AMP) package developed by the authors is described. Details of verification and validation experiments, and parallel performance analysis in weak and strong scaling studies demonstrating the achieved efficiency of the algorithm are presented. Furthermore, numerical experiments demonstrate that the preconditioner developed is independent of the number of fuel subdomains in a fuel rod, which is particularly important when simulating different types of fuel rods...

Philip, Bobby; Allu, Srikanth; Hamilton, Steven P; Sampath, Rahul S; Clarno, Kevin T; Dilts, Gary A

2014-01-01T23:59:59.000Z

146

System and method for the analysis of one or more compounds and/or species produced by a solution-based nuclear reactor  

SciTech Connect

The present invention relates generally to both a system and method for determining the composition of an off-gas from a solution nuclear reactor (e.g., an Aqueous Homogeneous Reactor (AHR)) and the composition of the fissioning solution from those measurements. In one embodiment, the present invention utilizes at least one quadrupole mass spectrometer (QMS) in a system and/or method designed to determine at least one or more of: (i) the rate of production of at least one gas and/or gas species from a nuclear reactor; (ii) the effect on pH by one or more nitrogen species; (iii) the rate of production of one or more fission gases; and/or (iv) the effect on pH of at least one gas and/or gas species other than one or more nitrogen species from a nuclear reactor.

Policke, Timothy A; Nygaard, Eric T

2014-05-06T23:59:59.000Z

147

Savannah River National Laboratory Technologies Available for...  

NLE Websites -- All DOE Office Websites (Extended Search)

Available for Licensing The Savannah River National Laboratory (SRNL) "Puts Science to Work" to create and deploy practical, high-value, cost effective technology solutions. In...

148

Recovery of plutonium from electrorefining anode heels at Savannah River  

SciTech Connect

In a joint effort, the Savannah River Laboratory (SRL), Savannah River Plant (SRP), and the Rocky Flats Plant (RFP) have developed two processes to recover plutonium from electrorefining anode heel residues. Aqueous dissolution of anode heel metal was demonstrated at SRL on a laboratory scale and on a larger pilot scale using either sulfamic acid or nitric acid-hydrazine-fluoride solutions. This direct anode heel metal dissolution requires the use of a geometrically favorable dissolver. The second process developed involves first diluting the plutonium in the anode heel residues by alloying with aluminum. The alloyed anode heel plutonium can then be dissolved using a nitric acid-fluoride-mercury(II) solution in large non-geometrically favorable equipment where nuclear safety is ensured by concentration control.

Gray, J H; Gray, L W; Karraker, D G

1987-03-01T23:59:59.000Z

149

U. S. Department of Energy Savannah River Operations Office - DOE-SR News  

NLE Websites -- All DOE Office Websites (Extended Search)

Release Archive Release Archive DOE-SR News Release Archive 2012 News Releases Savannah River Site Reaches Significant Milestone with Waste Tank Closure SR-2012-06 Adobe Acrobat PDF DOE to Extend Savannah River Nuclear Solutions Contract at Savannah River Site to September 2016 SR-2012-05 Adobe Acrobat PDF Savannah River Site Federal Employees Volunteer for United Way Campaign SR-2012-04 Adobe Acrobat PDF Installation of Six Large Process Tanks Mark Big Step in Construction of Critical Waste Cleanup Facility at SRS SR-2012-03 Adobe Acrobat PDF Grouting Begins on First SRS Waste Tanks Since 1997 SR-2012-02 Adobe Acrobat PDF SRS Marks Successful Operational Startup of New Biomass Cogeneration Facility SR-2012-01 Adobe Acrobat PDF 2011 News Releases Recovery Act Funds Test Reactor Dome Removal in Historic D&D Project

150

Final Review of Safety Assessment Issues at Savannah River Site, August 2011  

SciTech Connect

At the request of Savannah River Nuclear Solutions (SRNS) management, a review team composed of experts in atmospheric transport modeling for environmental radiation dose assessment convened at the Savannah River Site (SRS) on August 29-30, 2011. Though the meeting was prompted initially by suspected issues related to the treatment of surface roughness inherent in the SRS meteorological dataset and its treatment in the MELCOR Accident Consequence Code System Version 2 (MACCS2), various topical areas were discussed that are relevant to performing safety assessments at SRS; this final report addresses these topical areas.

Napier, Bruce A.; Rishel, Jeremy P.; Bixler, Nathan E.

2011-12-15T23:59:59.000Z

151

Nuclear and Particle Futures  

NLE Websites -- All DOE Office Websites (Extended Search)

Nuclear and Particle Futures Nuclear and Particle Futures The Lab's four Science Pillars harness capabilities for solutions to threats- on national and global scales. Contacts...

152

Development of a novel solvent for the simultaneous separation of strontium and cesium from dissolved Spent Nuclear Fuel solutions  

SciTech Connect

The recovery of Cs and Sr from acidic solutions by solvent extraction has been investigated. The goal of this project was to develop an extraction process to remove Cs and Sr from high-level waste in an effort to reduce the heat loading in storage. Solvents for the extraction of Cs and Sr separately have been used on both caustic and acidic spent nuclear fuel waste in the past. The objective of this research was to find a suitable solvent for the extraction of both Cs and Sr simultaneously from acidic nitrate media. The solvents selected for this research possess good stability and extraction behavior when mixed together. The extraction experiments were performed with 4 ,4,(5 )-Di-(tbutyldicyclohexano)- 18-crown-6 {DtBuCH18C6}, Calix[4]arene-bis-(tert-octylbenzocrown-6) {BOBCalixC6} and 1-(2,2,3,3-tetrafluoropropoxy)-3-(4-sec-butylphenoxy)-2-propanol {Cs-7SB modifier} in a branched aliphatic kerosene {Isopar® L}. The BOBCalixC6 and Cs-7SB modifier were developed at Oak Ridge National Laboratory (ORNL) by Bonnesen et al. [1]. The values obtained from the SREX solvent for DSr in 1 M nitric acid ranged from 0.7 to 2.2 at 25oC and 10oC respectively. The values for DCs in 1 M nitric acid with the CSSX solvent ranged from 8.0 to 46.0 at 25oC and 10oC respectively. A new mixed solvent, developed at the Idaho National Engineering and Environmental Laboratory (INEEL) by Riddle et al. [2], showed distributions for Sr ranging from 8.8 to 17.4 in 1 M nitric acid at 25oC and 10oC respectively. The DCs for the mixed solvent ranged from 7.7 to 20.2 in 1 M nitric acid at 25oC to 10oC respectively. The unexpectedly high distributions for Sr at both 25oC and 10oC show a synergy in the mixed solvent. The DCs, although lower than with CSSX solvent, still showed good extraction behavior.

Catherine L. Riddle; John D. Baker; Jack D. Law; Christopher A. McGrath; David H. Meikrantz; Bruce J. Mincher; Dean R. Peterman; Terry A. Todd

2004-10-01T23:59:59.000Z

153

FY 2008 Washington Savannah River Company, LLC, PER Summary ...  

National Nuclear Security Administration (NNSA)

Washington Savannah River Company, LLC, PER Summary | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing...

154

Dennis Yates Of Savannah River Operations Named 2013 Facility...  

Office of Environmental Management (EM)

River Site. The HB-Line is part of the H-Canyon, which conducts hazardous nuclear chemistry, packaging, and processing operations on plutonium and transuranic materials. Mr....

155

Application of the NNWSI [Nevada Nuclear Waste Storage Investigations] unsaturated test method to actinide doped SRL [Savannah River Laboratory] 165 type glass  

SciTech Connect

The results of tests done using the Unsaturated Test Method are presented. These tests, done to determine the suitability of glass in a potential high-level waste repository as developed by the Nevada Nuclear Waste Storage Investigations Project, simulate conditions anticipated for the post-containment phase of the repository when only limited contact between the waste form and water is expected. The reaction of glass occurs via processes that are initiated due to glass/water vapor and glass/liquid water contact. Vapor interaction results in the initiation of an exchange process between water and the more mobile species (alkalis and boron) in the glass. The liquid reaction produces interactions similar to those seen in standard leaching tests, except due to the limited amount of water present and the presence of partially sensitized 304L stainless steel, the formation of reaction products greatly exceeds that found in MCC-1 type leach tests. The effect of sensitized stainless steel on the reaction is to enhance breakdown of the glass matrix thereby increasing the release of the transuranic elements from the glass. However, most of the Pu and Am released is entrained by either the metal components of the test or by the reaction phases, and is not released to solution. 16 refs., 20 figs., 17 tabs.

Bates, J.K.; Gerding, T.J.

1990-08-01T23:59:59.000Z

156

Savannah River Site Environmental Report for 1997  

SciTech Connect

The mission at the Savannah River Site has changed from the production of nuclear weapons materials for national defense to the management of waste, restoration of the environment, and the development of industry in and around the site.

Arnett, M.W.; Mamatey, A.R. [eds.

1998-08-01T23:59:59.000Z

157

Nuclear magnetic resonance solution structure of hirudin(1–51) and comparison with corresponding three-dimensional structures determined using the complete 65-residue hirudin polypeptide chain  

Science Journals Connector (OSTI)

The three-dimensional structure of the N-terminal 51-residue domain of recombinant hirudin in aqueous solution was determined by 1H nuclear magnetic resonance (NMR) spectroscopy, and the resulting high-quality solution structure was compared with corresponding structures obtained from studies with the intact, 65-residue polypeptide chain of hirudin. On the basis of 580 distance constraints derived from nuclear Overhauser effects and 109 dihedral angle constraints, a group of 20 conformers representing the solution structure of hirudin(1–51) was computed with the program DIANA and energyminimized with a modified version of the program AMBER. Residues 3 to 30 and 37 to 48 form a well-defined molecular core with two antiparallel ?-sheets composed of residues 14 to 16 and 20 to 22, and 27 to 31 and 36 to 40, and three reverse turns at residues 8 to 11 (type II), 17 to 20 (type II?) and 23 to 26 (type II). The average root-mean-square deviation of the individual NMR conformers relative to their mean co-ordinates is 0.38 Å for the backbone atoms and 0.77 Å for all heavy atoms of these residues. Increased structural disorder was found for the N-terminal dipeptide segment, the loop at residues 31 to 36, and the C-terminal tripeptide segment. The solution structure of hirudin(1–51) has the same molecular architecture as the corresponding polypeptide segment in natural hirudin and recombinant desulfatohirudin. It is also closely similar to the crystal structure of the N-terminal 51-residue segment of hirudin in a hirudin-thrombin complex, with root-mean-square deviations of the crystal structure relative to the mean solution structure of 0.61 Å for the backbone atoms and 0.91 Å for all heavy atoms of residues 3 to 30 and 37 to 48. Further coincidence is found for the loop formed by residues 31 to 36, which shows increased structural disorder in all available solution structures of hirudin, and of which residues 32 to 35 are not observable in the electron density map of the thrombin complex. Significant local structural differences between hirudin(1–51) in solution and hirudin in the crystalline thrombin complex were identified mainly for the N-terminal tripeptide segment and residues 17 to 21. These are further analyzed in an accompanying paper.

T. Szyperski; P. Güntert; S.R. Stone; K. Wüthrich

1992-01-01T23:59:59.000Z

158

Solution structure of a fragment of the dimerization domain of E2F-1 determined by circular dichroism, 1H nuclear magnetic resonance and distance geometry  

Science Journals Connector (OSTI)

The structure of a synthesized peptide with the sequence GVVDLNWAAEVLKVQKRRIYDITNVLEGIQ which corresponds to residues 149–178 of transcription factor E2F-1 was determined by 1H nuclear magnetic resonance in 40% d3-TFE/water. NOE cross peaks and ?H chemical shifts indicate that the peptide consists of a helix from Ala-8 to Leu-26 in this solution. Circular dichroism measurements confirm the presence of nearly 45% helix in TFE/water solution but show no evidence of helicity in water solution of this peptide. Fifty structures were constructed with 329 upper distance limits by DIANA. The 20 best conformers show a RMSD of 0.78 Å for backbone atoms and 1.78 Å for heavy atoms from residue Ala-8 to Leu-26. This result, together with our previous work on the solution structure of a fragment of DP-1, supports the proposal that E2F-1 and DP-1 may dimerize with a coiled-coil type interaction.

Shouhong Guang; Jihui Wu; Limei Tao; Youlin Xia; Yunyu Shi

1998-01-01T23:59:59.000Z

159

Independent Oversight Review, Savannah River Site - September 2011 |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Savannah River Site - September 2011 Savannah River Site - September 2011 Independent Oversight Review, Savannah River Site - September 2011 September 2011 Review of the Implementation Verification Review Processes at the Savannah River Site Environmental Management Nuclear Facilities The Office of Enforcement and Oversight (Independent Oversight) within the Office of Health, Safety and Security (HSS), conducted an independent review of the Implementation Verification Review (IVR) Processes at Savannah River Site Environmental Management Nuclear Facilities. The overall objective of the Independent Oversight IVR review process includes verification that contractors and site offices have developed and implemented appropriate methods for performing IVRs (including direction for scheduling and conducting IVR activities) and measurement of the

160

EIS-0082-S2: Savannah River Site Salt Processing, Savannah River Site,  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

082-S2: Savannah River Site Salt Processing, Savannah River 082-S2: Savannah River Site Salt Processing, Savannah River Site, Aiken, South Carolina EIS-0082-S2: Savannah River Site Salt Processing, Savannah River Site, Aiken, South Carolina SUMMARY This SEIS evaluates the potential environmental impacts of alternatives for separating the high-activity fraction from the low-activity fraction of the high-level radioactive waste salt solutions now stored in underground tanks at the Savannah River Site (SRS) near Aiken, South Carolina. The high-activity fraction of the high-level waste (HLW) salt solution would then be vitrified in the Defense Waste Processing Facility (DWPF) and stored until it could be disposed of as HLW in a geologic repository. The low activity fraction would be disposed of as low-level waste (saltstone)

Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

Our River  

NLE Websites -- All DOE Office Websites (Extended Search)

River River Nature Bulletin No. 22 July 7, 1945 Forest Preserve District of Cook County Clayton F. Smith, President Roberts Mann, Superintendent of Conservation OUR RIVER The people of Cook County are missing a bet. They are not using their DesPlaines River. The other day we took a boat trip down that river from Lake County to Lawndale Avenue in Summit. It being a week day, we saw few people other than an occasional fisherman or pairs of strolling boys. Except for a bridge now and then, there were no signs or sounds of civilization. Chicago might have been a thousand miles away. We rested. There was isolation. There was peace. Once in a while a heron flew ahead of us; or a squirrel scampered up a tree; once we saw a family of young muskrats playing around the entrance to their den in the bank; twice we saw and heard a wood duck; again and again big fish plowed ripples surging ahead of us. It was shady and cool and still beneath the arching trees. We thought of the centuries this river had traveled. We were babes nuzzling again at the breast of Mother Nature.

162

Solution of resource allocation problem for identification of cost-effective measures to reduce nuclear proliferation risks  

SciTech Connect

This report presents a methodology of selection of cost-effective measures to reduce nuclear proliferation risks. The methodology relies on a graded security model used in practice in different applications. The method is based on the controlled finite Markov chain approach set in combination with discrete dynamic programming and MCDM (Multi Criteria Decision Making) techniques that enables the expert to select the cost-effective measures to reduce nuclear proliferation risks depending on availability of resources. The analysis performed with different number of possible measures confirms the conclusions that the implementation of extra-large costs may not produce the required effect, and the increase in resources above a certain level does not appear sensitive. Diversification in improving the effectiveness of other measures seems more rational and efficient for the whole system than the unlimited improvement of the effectiveness of only one measure.

Andrianov, A.; Kuptsov, I. [Obninsk Institute for Nuclear Power Engineering, Studgorodok 1, Obninsk, Kaluga region 249030 (Russian Federation)

2013-07-01T23:59:59.000Z

163

A solute transport model calibration procedure as applied to a tritium plume in the Savannah River Plant F-Area, South Carolina  

E-Print Network (OSTI)

). . . . 71 . . . 72 vnt LIST OF FIGURES (Cont'd) Figures page 14 Well defined crossover of solution curves in ct& and Y for a given source centerpoint. 15 Location map for the centerpoint and centerline which provided the solution curves of Figure 14... manipulation, the original equation may be expressed as follows: aC/at = v, (u?(azc/ax?+n?(azCHyz)+a, (cPC/B, z)-(BC/Bx)]-XC (14a) For a steady-state portion of a plume, the equation may be written as XC = v, [ct?(t)2C/l)x 2)+ot?(AC/dy2)+a, (t)iC/d 2)-(BC...

Edwards, David Arthur

1988-01-01T23:59:59.000Z

164

River Steamboats  

NLE Websites -- All DOE Office Websites (Extended Search)

River Steamboats River Steamboats Nature Bulletin No. 628-A February 12, 1977 Forest Preserve District of Cook County George W. Dunne, President Roland F. Eisenbeis, Supt. of Conservation RIVER STEAMBOATS The westward migration of the pioneer settlers and the rapid growth of agriculture, commerce and industry in the Middle West is in large part the story of water transportation on our inland waterways. The two main water routes were the chain of Great Lakes on the north and the Ohio River on the south. Sailing vessels carrying hundreds of tons were able to navigate on the Great Lakes almost as freely as on the ocean. Also, on the Ohio and Mississippi rivers heavy loads could be floated downstream from Pittsburgh to New Orleans -- almost 2000 miles. But boats had to be hauled back upstream by manpower -- grueling labor, stretching over weeks or months to move a few tons a few hundred miles. The coming of the steamboat a century and a half ago changed all this.

165

Alkali metal Rankine cycle boiler technology challenges and some potential solutions for space nuclear power and propulsion applications  

SciTech Connect

Alkali metal boilers are of interest for application to future space Rankine cycle power conversion systems. Significant progress on such boilers was accomplished in the 1960's and early 1970's, but development was not continued to operational systems since NASA's plans for future space missions were drastically curtailed in the early 1970's. In particular, piloted Mars missions were indefinitely deferred. With the announcement of the Space Exploration Initiative (SEI) in July 1989 by President Bush, interest was rekindled in challenging space missions and, consequently in space nuclear power and propulsion. Nuclear electric propulsion (NEP) and nuclear thermal propulsion (NTP) were proposed for interplanetary space vehicles, particularly for Mars missions. The potassium Rankine power conversion cycle became of interest to provide electric power for NEP vehicles and for 'dual-mode' NTP vehicles, where the same reactor could be used directly for propulsion and (with an additional coolant loop) for power. Although the boiler is not a major contributor to system mass, it is of critical importance because of its interaction with the rest of the power conversion system; it can cause problems for other components such as excess liquid droplets entering the turbine, thereby reducing its life, or more critically, it can drive instabilities-some severe enough to cause system failure. Funding for the SEI and its associated technology program from 1990 to 1993 was not sufficient to support significant new work on Rankine cycle boilers for space applications. In Fiscal Year 1994, funding for these challenging missions and technologies has again been curtailed, and planning for the future is very uncertain. The purpose of this paper is to review the technologies developed in the 1960's and 1970's in the light of the recent SEI applications. In this way, future Rankine cycle boiler programs may be conducted most efficiently.

Stone, J.R.

1994-07-01T23:59:59.000Z

166

River DNA:.  

E-Print Network (OSTI)

??A new dynamic equilibrium between flood prevention, ecology, energy supply and recreation. This is amplified with the transformation of a nuclear plant into a centre… (more)

Van der Gaag, E.J.

2015-01-01T23:59:59.000Z

167

Waterbird and Food Resource Responses to Winter Drawdown in the east Tennessee River Valley  

E-Print Network (OSTI)

Tennessee Douglas Reservoir * ** * Study Sites Near Confluence of the... French Broad River Nolichucky River Electricity Generation Cool Nuclear Reactors Predictable Hydrology Historically, reservoir downdowns began Rankin Bottoms WMA East Tennessee Douglas Reservoir * ** * Study Sites Near Confluence of the... French

Gray, Matthew

168

Solution structure of a fragment of the dimerization domain of DP-1 determined by 1H-nuclear magnetic resonance and distance geometry  

Science Journals Connector (OSTI)

The structure of a synthesized peptide with the sequence of NHILPNESAYDQKNIRRRVYDALNVLMAMNIISK that corresponds to residues 151–184 of transcription factor DP-1 (Girling et al., Nature 362 (1993) 83–87) was determined by 1H-nuclear magnetic resonance in water and 40% d3-trifluoroethanol/water, respectively. Nuclear Overhauser effect cross peaks, ?H chemical shifts and J-coupling constants of ?H–NH show that the peptide consists a helix from Ser-8 to Ser-33 in solution. Fifty structures were constructed with 288 upper distance limits and 21 angle constraints by DIANA (Guntert et al., J. Mol. Biol. 217 (1991) 517–530). Although the N-terminal of the peptide exhibits a random conformation, the 20 best structures show a root mean square deviation of 0.89±0.36 Å for backbone atoms and 1.80±0.34 Å for heavy atoms from residue Ser-8 to Ser-33. This result supports the proposal that DP-1 and E2F-1 may dimerize with a coiled-coil type interaction.

Shouhong Guang; Jihui Wu; Tianning Yu; Youlin Xia; Yunyu Shi

1998-01-01T23:59:59.000Z

169

Facility Utilization and Risk Analysis for Remediation of Legacy Transuranic Waste at the Savannah River Site - 13572  

SciTech Connect

Savannah River Nuclear Solutions (SRNS) completed the Accelerated TRU Project for remediating legacy waste at the Savannah River Site with significant cost and schedule efficiencies due to early identification of resources and utilization of risk matrices. Initial project planning included identification of existing facilities that could be modified to meet the technical requirements needed for repackaging and remediating the waste. The project schedule was then optimized by utilization of risk matrices that identified alternate strategies and parallel processing paths which drove the overall success of the project. Early completion of the Accelerated TRU Project allowed SRNS to pursue stretch goals associated with remediating very difficult TRU waste such as concrete casks from the hot cells in the Savannah River National Laboratory. Project planning for stretch goals also utilized existing facilities and the risk matrices. The Accelerated TRU project and stretch goals were funded under the American Recovery and Reinvestment Act (ARRA). (authors)

Gilles, Michael L.; Gilmour, John C. [Savannah River Nuclear Solutions, LLC (United States)] [Savannah River Nuclear Solutions, LLC (United States)

2013-07-01T23:59:59.000Z

170

INSTALLATION OF BUBBLERS IN THE SAVANNAH RIVER SITED DEFENSE WASTE PROCESSING FACILITY MELTER  

SciTech Connect

Savannah River Remediation (SRR) LLC assumed the liquid waste contract at the Savannah River Site (SRS) in the summer of 2009. The main contractual agreement was to close 22 High Level Waste (HLW) tanks in eight years. To achieve this aggressive commitment, faster waste processing throughout the SRS liquid waste facilities will be required. Part of the approach to achieve faster waste processing is to increase the canister production rate of the Defense Waste Processing Facility (DWPF) from approximately 200 canisters filled with radioactive waste glass per year to 400 canisters per year. To reach this rate for melter throughput, four bubblers were installed in the DWPF Melter in the late summer of 2010. This effort required collaboration between SRR, SRR critical subcontractor EnergySolutions, and Savannah River Nuclear Solutions, including the Savannah River National Laboratory (SRNL). The tasks included design and fabrication of the bubblers and related equipment, testing of the bubblers for various technical issues, the actual installation of the bubblers and related equipment, and the initial successful operation of the bubblers in the DWPF Melter.

Smith, M.; Iverson, D.

2010-12-08T23:59:59.000Z

171

Independent Oversight Inspection, Savannah River Site Office - December  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Savannah River Site Office - Savannah River Site Office - December 2009 Independent Oversight Inspection, Savannah River Site Office - December 2009 December 2009 Inspection of Nuclear Safety at the Savannah River Site Office and the Tritium Program Facilities The U.S. Department of Energy (DOE) Office of Independent Oversight, within the Office of Health, Safety and Security (HSS), conducted an inspection of nuclear safety at several National Nuclear Security Administration (NNSA) facilities located at DOE's Savannah River Site (SRS) during August and September 2009. The inspection was performed by the Office of Independent Oversight's Office of Environment, Safety and Health Evaluations. With some isolated exceptions, the current SRNS nuclear safety programs and processes at the Tritium Program facilities are effective. Facility and

172

EnergySolutions Inc | Open Energy Information  

Open Energy Info (EERE)

Salt Lake City, Utah Zip: 84101 Sector: Services Product: Utah-based international nuclear services company that provides services and solutions to the nuclear industry....

173

Independent Activity Report, Savannah River Site - March 2013 | Department  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Savannah River Site - March 2013 Savannah River Site - March 2013 Independent Activity Report, Savannah River Site - March 2013 March 2013 Oversight Scheduling an Operational Awareness at the Savannah River Site [HIAR-SRS-2013-03-25] Activity Description/Purpose: The Independent Oversight Site Lead for the Savannah River Site traveled to the site to work with functional area managers to schedule nuclear safety oversight activities. The Site Lead reviewed the differing professional opinion (DPO) program at the Savannah River Operations Office (Department of Energy (DOE)-SR). Independent Activity Report, Savannah River Site - March 2013 More Documents & Publications Independent Oversight Review, Savannah River Operations Office - July 2013 Policy Flash 2013-74 Quarterly Notification of the DOE's Differing

174

Enforcement Documents - Savannah River Site | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Savannah River Site Savannah River Site Enforcement Documents - Savannah River Site April 13, 2010 Consent Order, Parsons Infrastructure & Technology Group, Inc. - NCO-2010-02 Consent Order issued to Parsons Infrastructure & Technology Group, Inc. related to Nuclear Facility Construction Deficiencies and Subcontractor Oversight at the Salt Waste Processing Facility at the Savannah River Site April 13, 2010 Enforcement Letter, Parsons Technology Development & Fabrication Complex - April 13, 2010 Enforcement Letter issued to Parsons Technology Development & Fabrication Complex related to Deficiencies in the Fabrication of Safety Significant Embed Plates at the Salt Waste Processing Facility at the Savannah River Site, April 13, 2010 Enforcement Letter, Amer Industrial Technologies - April 13, 2010

175

TESTING OF THE RADBALL TECHNOLOGY AT SAVANNAH RIVER NATIONAL LABORATORY  

SciTech Connect

The United Kingdom's National Nuclear Laboratory (NNL) has developed a remote, nonelectrical, radiation-mapping device known as RadBall (patent pending), which offers a means to locate and quantify radiation hazards and sources within contaminated areas of the nuclear industry. Positive results from initial deployment trials in nuclear waste reprocessing plants at Sellafield in the United Kingdom and the anticipated future potential use of RadBall throughout the U.S. Department of Energy Complex have led to the NNL partnering with the Savannah River National Laboratory (SRNL) to further test, underpin, and strengthen the technical performance of the technology. The study completed at SRNL addresses key aspects of the testing of the RadBall technology. The first set of tests was performed at Savannah River Nuclear Solutions Health Physics Instrument Calibration Laboratory (HPICL) using various gamma-ray sources and an x-ray machine with known radiological characteristics. The objective of these preliminary tests was to identify the optimal dose and collimator thickness. The second set of tests involved a highly contaminated hot cell. The objective of this testing was to characterize a hot cell with unknown radiation sources. The RadBall calibration experiments and hot cell deployment were successful in that for each trial radiation tracks were visible. The deployment of RadBall can be accomplished in different ways depending on the size and characteristics of the contaminated area (e.g., a hot cell that already has a crane/manipulator available or highly contaminated room that requires the use of a remote control device with sensor and video equipment to position RadBall). This report also presents SRNL-designed RadBall accessories for future RadBall deployment (a harness, PODS, and robot).

Farfan, E.; Foley, T.

2010-02-10T23:59:59.000Z

176

Red River Compact (Texas)  

Energy.gov (U.S. Department of Energy (DOE))

The Red River Compact Commission administers the Red River Compact to ensure that Texas receives its equitable share of quality water from the Red River and its tributaries as apportioned by the...

177

Slurry Nebulization-Inductively Coupled Plasma Mass Spectrometry with Solution Calibration for Determination of Ultratrace Boron in High Pure Nuclear Graphite Powder  

Science Journals Connector (OSTI)

Slurry nebulization-inductively coupled plasma mass spectrometry (ICP-MS) was developed for the direct determination of trace boron (B) in high-purity graphite powders. After the graphite powders were ground and sifted, the particle size of graphite was collected less than 5 ?m. Polyvinylpyrrolidone (PVP) was used as the dispersant in slurry preparation. The optimal mass ratio of PVP to the graphite was found to be 0.5. Well-proportioned and stable slurry solution was obtained by magnetic stirrer. 0.1 M NH4OH as the aqueous medium could provide the optimal pH of 10 for the stable slurry and eliminate the memory effect of B. ICP-MS was operated in a higher resolution mode (0.6 amu) to eliminate the interference with the matrix 12C by peak tailing. Oxygen was added into the plasma at a flow rate of 60 mL min?1 to resolve carbon deposition on the sampler and skimmer cones and accelerate particle dissociation in the plasma. External calibration with aqueous solution standards was established for quantification. Beryllium was chosen as the internal standard to evaluate the efficiency of matrix effect correction. A correlation coefficient of 0.9995 was obtained for B concentration ranging 2–200 ?g L?1. The detection limit (3S) of B was 0.095 ?g g?1. As a practical application, the proposed method was used for the determination of trace B in four nuclear graphite samples (claimed 99.999% purity), with the satisfactory recoveries for the spike tests in the range of 97.2%–103.1%.

Xin-Li LIU; Tai-Cheng DUAN; Yi HAN; Xiao-Yu JIA; Wei-Na ZHANG; Hang-Ting CHEN

2010-01-01T23:59:59.000Z

178

Scenic Rivers Act (Virginia)  

Energy.gov (U.S. Department of Energy (DOE))

Virginia Scenic Rivers Program’s intent is to identify, designate and help protect rivers and streams that possess outstanding scenic, recreational, historic and natural characteristics of...

179

Platte River Cooperative Agreement  

NLE Websites -- All DOE Office Websites (Extended Search)

Platte River Cooperative Agreement Skip Navigation Links Transmission Functions Infrastructure projects Interconnection OASIS OATT Platte River Cooperative Agreement PEIS, NE, WY,...

180

River Basin Commissions (Indiana)  

Energy.gov (U.S. Department of Energy (DOE))

This legislation establishes river basin commissions, for the Kankakee, Maumee, St. Joseph, and Upper Wabash Rivers. The commissions facilitate and foster cooperative planning and coordinated...

Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

Maine Rivers Policy (Maine)  

Energy.gov (U.S. Department of Energy (DOE))

The Maine Rivers Policy accompanies the Maine Waterway Development and Conservation Act and provides additional protection for some river and stream segments, which are designated as “outstanding...

182

Preliminary Review of Safety Assessment Issues at Savannah River Site, August 2011  

SciTech Connect

At the request of Savannah River Nuclear Solutions (SRNS) management, a review team composed of experts in atmospheric transport modeling for environmental radiation dose assessment convened at the Savannah River Site (SRS) on August 29-30, 2011. Several issues were presented at the meeting for discussion. This is a short summary that is organized in accordance with the primary issues discussed, which is not necessarily a chronological record. Issues include: SRS Meteorological Data and its Use in MACCS2; Deposition Velocities for Particles; Deposition Velocities for Tritium; MACCS2 Dispersion Coefficients; Use of Low Surface Roughness in Open Areas; Adequacy of Meteorological Tower and Instrumentation; Displacement Height; and Validity of MACCS2 Calculations at Close-in Distances. A longer report will be issued at a later date that expands upon these topics and recommendations.

Napier, Bruce A.; Rishel, Jeremy P.; Bixler, Nathan E.

2011-09-19T23:59:59.000Z

183

MEASUREMENT AND PREDICTION OF RADIOLYTIC HYDROGEN PRODUCTION IN DEFENSE WASTE PROCESSING SLURRIES AT SAVANNAH RIVER SITE  

SciTech Connect

This paper presents results of measurements and predictions of radiolytic hydrogen production rates from two actual process slurries in the Defense Waste Processing Facility (DWPF) at Savannah River Site (SRS). Hydrogen is a flammable gas and its production in nuclear facilities can be a safety hazard if not mitigated. Measurements were made in the Shielded Cells of Savannah River National Laboratory (SRNL) using a sample of Sludge Batch 3 (SB3) currently being processed by the DWPF. Predictions were made using published values for rates of radiolytic reactions producing H{sub 2} in aqueous solutions and the measured radionuclide and chemical compositions of the two slurries. The agreement between measured and predicted results for nine experiments ranged from complete agreement to 24% difference. This agreement indicates that if the composition of the slurry being processed is known, the rate of radiolytic hydrogen production can be reasonably estimated.

Bibler, N; John Pareizs, J; Terri Fellinger, T; Cj Bannochie, C

2007-01-10T23:59:59.000Z

184

Missouri River Energy Services (23 Member Cooperatives) - Business Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Missouri River Energy Services (23 Member Cooperatives) - Business Missouri River Energy Services (23 Member Cooperatives) - Business Energy Efficiency Rebate Missouri River Energy Services (23 Member Cooperatives) - Business Energy Efficiency Rebate < Back Eligibility Commercial Savings Category Heating & Cooling Commercial Heating & Cooling Heating Cooling Manufacturing Other Appliances & Electronics Heat Pumps Commercial Lighting Lighting Water Heating Program Info State Minnesota Program Type Utility Rebate Program Rebate Amount Varies by technology Provider Missouri River Energy Solutions Bright Energy Solutions offers energy efficiency cash incentive programs to [http://www.dsireusa.org/incentives/incentive.cfm?Incentive_Code=MN170F&r... residential] and business customers of municipal utilities that are members

185

U. S. Department of Energy Savannah River Operations Office ...  

NLE Websites -- All DOE Office Websites (Extended Search)

Manager for Nuclear Material Stabilization Project U. S. Department of Energy Savannah River Operations Office Pat McGuire Patrick W. (Pat) McGuire was named the Assistant Manager...

186

John C. Barnes of Savannah River Operations named 2012 Facility...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

the Savannah River Site, including the F and H-Canyons and the HB-Line. These facilities conduct hazardous nuclear chemistry, packaging, and processing operations on plutonium and...

187

Savannah River Site Waste Solidification Building Corrective Actions from the January 2013 Report on Construction Quality of Mechanical Systems Installation and Fire Protection Design, May 2013  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

HIAR SRS-2013-5-07 HIAR SRS-2013-5-07 Site: Savannah River Site Subject: Office of Enforcement and Oversight's Office of Safety and Emergency Management Evaluations Activity Report for the Savannah River Site (SRS) Waste Solidification Building (WSB) Corrective Actions from the January 2013 Report on Construction Quality of Mechanical Systems Installation and Fire Protection Design Dates of Activity : 05/07/2013 - 05/09/2013 Report Preparer: Joseph Lenahan Activity Description/Purpose: 1. Review the corrective actions being implemented by the construction contractor to address Findings 1-4, 6, and 9 from a construction quality review performed by the Office of Health, Safety and Security (HSS) (Reference 1). 2. Meet with the SRS WSB project staff and Savannah River Nuclear Solutions (SRNS) engineers to discuss the

188

Savannah River Site Waste Solidification Building Corrective Actions from the January 2013 Report on Construction Quality of Mechanical Systems Installation and Fire Protection Design, May 2013  

NLE Websites -- All DOE Office Websites (Extended Search)

HIAR SRS-2013-5-07 HIAR SRS-2013-5-07 Site: Savannah River Site Subject: Office of Enforcement and Oversight's Office of Safety and Emergency Management Evaluations Activity Report for the Savannah River Site (SRS) Waste Solidification Building (WSB) Corrective Actions from the January 2013 Report on Construction Quality of Mechanical Systems Installation and Fire Protection Design Dates of Activity : 05/07/2013 - 05/09/2013 Report Preparer: Joseph Lenahan Activity Description/Purpose: 1. Review the corrective actions being implemented by the construction contractor to address Findings 1-4, 6, and 9 from a construction quality review performed by the Office of Health, Safety and Security (HSS) (Reference 1). 2. Meet with the SRS WSB project staff and Savannah River Nuclear Solutions (SRNS) engineers to discuss the

189

Project #31: Connecticut River  

Science Journals Connector (OSTI)

GEOMORPHIC SETTING: At the project location, the Connecticut River has an annual average discharge of...

Wendi Goldsmith; Donald Gray; John McCullah

2014-01-01T23:59:59.000Z

190

Is Nuclear Energy the Solution?  

E-Print Network (OSTI)

fired power plant per unit of electrical energy. Wind powerpower plants will not be cost competitive with other electricity-generating alternatives. For example, wind

Saier, Milton H.; Trevors, Jack T.

2010-01-01T23:59:59.000Z

191

Categorical Exclusion Determinations: Savannah River Operations Office |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

February 24, 2011 February 24, 2011 CX-005504: Categorical Exclusion Determination Analytical Methods for Radiochemical Measurements CX(s) Applied: B3.6 Date: 02/24/2011 Location(s): Aiken, South Carolina Office(s): Environmental Management, Savannah River Operations Office February 24, 2011 CX-005503: Categorical Exclusion Determination Drain Line Replacement West of 735-A CX(s) Applied: B1.3 Date: 02/24/2011 Location(s): Aiken, South Carolina Office(s): Environmental Management, Savannah River Operations Office February 24, 2011 CX-005502: Categorical Exclusion Determination Implement Savannah River National Laboratory Defense Nuclear Facilities Safety Board 2004-2 Gap Closure Activity CX(s) Applied: B2.3 Date: 02/24/2011 Location(s): Aiken, South Carolina Office(s): Environmental Management, Savannah River Operations Office

192

Categorical Exclusion Determinations: Office of River Protection-Richland  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

January 13, 2012 January 13, 2012 CX-007980: Categorical Exclusion Determination Washington River Protection Solutions LLC - Proposed Actions For Calendar Year 2012 Scheduled To Take Place CX(s) Applied: B1.22 Date: 01/13/2012 Location(s): Washington Offices(s): River Protection-Richland Operations Office January 13, 2012 CX-007979: Categorical Exclusion Determination Washington River Protection Solutions LLC - Proposed Actions For Calendar Year 2012 Scheduled To Take Place CX(s) Applied: B1.17 Date: 01/13/2012 Location(s): Washington Offices(s): River Protection-Richland Operations Office January 13, 2012 CX-007978: Categorical Exclusion Determination Washington River Protection Solutions LLC - Proposed Actions For Calendar Year 2012 CX(s) Applied: B1.16 Date: 01/13/2012 Location(s): Washington

193

Independent Oversight Review, Savannah River Site - September 2011 |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

1 1 Independent Oversight Review, Savannah River Site - September 2011 September 2011 Review of the Implementation Verification Review Processes at the Savannah River Site Environmental Management Nuclear Facilities The Office of Enforcement and Oversight (Independent Oversight) within the Office of Health, Safety and Security (HSS), conducted an independent review of the Implementation Verification Review (IVR) Processes at Savannah River Site Environmental Management Nuclear Facilities. The overall objective of the Independent Oversight IVR review process includes verification that contractors and site offices have developed and implemented appropriate methods for performing IVRs (including direction for scheduling and conducting IVR activities) and measurement of the

194

Structural Basis of the 1H-Nuclear Magnetic Resonance Spectra of Ethanol–Water Solutions Based on Multivariate Curve Resolution Analysis of Mid-Infrared Spectra  

Science Journals Connector (OSTI)

The 1H-nuclear magnetic resonance (NMR) chemical shifts of ethanol and water hydroxyl groups show a pattern change at a critical ethanol concentration. Below the critical...

Hu, Naiping; Wu, Dan; Cross, Kelly J; Schaefer, Dale W

2010-01-01T23:59:59.000Z

195

FY 2007 Washington Savannah River Company, LLC, PER Summary | National  

National Nuclear Security Administration (NNSA)

7 Washington Savannah River Company, LLC, PER Summary | National 7 Washington Savannah River Company, LLC, PER Summary | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog FY 2007 Washington Savannah River Company, LLC, PER Summary Home > About Us > Our Operations > Acquisition and Project Management > Performance Evaluations > FY 2007 Washington Savannah River Company, LLC,

196

CRAD, Emergency Management - Office of River Protection K Basin Sludge  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Office of River Protection K Basin Office of River Protection K Basin Sludge Waste System CRAD, Emergency Management - Office of River Protection K Basin Sludge Waste System May 2004 A section of Appendix C to DOE G 226.1-2 "Federal Line Management Oversight of Department of Energy Nuclear Facilities." Consists of Criteria Review and Approach Documents (CRADs) used for a May 2004 assessment of the Emergency Management program at the Office of River Protection K Basin Sludge Waste System. CRADs provide a recommended approach and the types of information to gather to assess elements of a DOE contractor's programs. CRAD, Emergency Management - Office of River Protection K Basin Sludge Waste System More Documents & Publications CRAD, Engineering - Office of River Protection K Basin Sludge Waste System

197

U. S. Department of Energy Savannah River Operations Office ...  

NLE Websites -- All DOE Office Websites (Extended Search)

of G4S-Government Solutions, is contracted by the U.S. Department of Energy's Savannah River Operations Office to provide security support services for the 310-square-mile...

198

U.S. DEPARTMENT OF ENERGY * SAVANNAH RIVER ...  

NLE Websites -- All DOE Office Websites (Extended Search)

of Energy's (DOE) Savannah River Site (SRS), SRNL serves DOE and the nation by providing innovative solutions for DOE and other federal agencies across the country and around the...

199

High level nuclear waste  

SciTech Connect

The DOE Division of Waste Products through a lead office at Savannah River is developing a program to immobilize all US high-level nuclear waste for terminal disposal. DOE high-level wastes include those at the Hanford Plant, the Idaho Chemical Processing Plant, and the Savannah River Plant. Commercial high-level wastes, for which DOE is also developing immobilization technology, include those at the Nuclear Fuel Services Plant and any future commercial fuels reprocessing plants. The first immobilization plant is to be the Defense Waste Processing Facility at Savannah River, scheduled for 1983 project submission to Congress and 1989 operation. Waste forms are still being selected for this plant. Borosilicate glass is currently the reference form, but alternate candidates include concretes, calcines, other glasses, ceramics, and matrix forms.

Crandall, J L

1980-01-01T23:59:59.000Z

200

PII S0016-7037(00)00379-3 Geologic control of Sr and major element chemistry in Himalayan Rivers, Nepal  

E-Print Network (OSTI)

, Nepal N. B. ENGLISH,* J. QUADE, P. G. DECELLES, and C. N. GARZIONE Department of Geology, University) Abstract--Our study of the Seti River in far western Nepal shows that the solute chemistry of the river

Garzione, Carmala N.

Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

Pecos River Compact (Texas)  

Energy.gov (U.S. Department of Energy (DOE))

This legislation authorizes the state's entrance into the Pecos River Compact, a joint agreement between the states of New Mexico and Texas. The compact is administered by the Pecos River Compact...

202

EIS-0219: F-Canyon Plutonium Solutions  

Energy.gov (U.S. Department of Energy (DOE))

This EIS evaluates the potential environmental impacts of processing the plutonium solutions to metal form using the F-Canyon and FB-Line facilities at the Savannah River Site.

203

Office of River Protection (Hanford) - Enforcement Documents  

NLE Websites -- All DOE Office Websites (Extended Search)

Enforcement Documents Enforcement Documents Office of River Protection (Hanford) Enforcement Letter issued to Washington River Protection Solutions, LLC, related to a positive Unreviewed Safety Question involving the Tank Farm Waste Transfer System at the Hanford Site, (NEL-2012-01) February 28, 2012 Consent Order issued to Washington River Protection Solutions, LLC related to deficiencies in the corrective action management program, radiation control program, and sealed radioactive source accountability and control program (NCO-2011-01) May 27, 2011 Consent Order issued to Bechtel National, Inc. for Deficiencies in Vendor Commercial Grade Dedication Processes at the Hanford Waste Treatment and Immobilization Plant Project (NCO-2010-03) September 22, 2010 Preliminary Notice of Violation issued to Bechtel National, Inc., related to Deficiencies at the Waste Treatment and Immobilization Plant at the Hanford Site, December 3, 2008 (NEA-2008-04)

204

Nuclear Energy  

Science Journals Connector (OSTI)

Nuclear Energy ... A brief summary of the history and key concepts of nuclear energy. ... Nuclear / Radiochemistry ...

Charles D. Mickey

1980-01-01T23:59:59.000Z

205

Nuclear batteries  

Science Journals Connector (OSTI)

Nuclear batteries ... Describes the structure, operation, and application of nuclear batteries. ... Nuclear / Radiochemistry ...

Alfred B. Garrett

1956-01-01T23:59:59.000Z

206

Turbulent Rivers Bjorn Birnir  

E-Print Network (OSTI)

) function gives rise to Hack's law [16]; stating that the length of the main river, in mature river basins, scales with the area of the basin l Ah, h = 0.568 being Hack's exponent. 1 Introduction The flow]. One of the best known scaling laws of river basins is Hack's law [16] that states that the area

Birnir, Björn

207

Interim Management of Nuclear Materials  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

1995/01_eis0220_for.html[6/27/2011 12:53:53 PM] 1995/01_eis0220_for.html[6/27/2011 12:53:53 PM] FOREWORD The Savannah River Site (SRS) is a major Department of Energy (DOE) installation. The past mission of the SRS was to produce nuclear materials that supported the defense, research, and medical programs of the United States. In 1992 the Secretary of Energy directed the SRS to phase out defense-related chemical separations activities. As a result of shutdowns and reduced demand for nuclear materials, the SRS presently has a large inventory of in-process solutions, reactor fuel assemblies, and reactor targets. These materials, due to their form or to the condition in which they are maintained, could represent a concern for the public, worker health and safety, and the environment. DOE published a Notice of Intent (NOI) to prepare this environmental impact statement (EIS) on March 17, 1994 (59

208

Interim Management of Nuclear Materials  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

1995/01_eis0220_for.html[6/27/2011 12:53:53 PM] 1995/01_eis0220_for.html[6/27/2011 12:53:53 PM] FOREWORD The Savannah River Site (SRS) is a major Department of Energy (DOE) installation. The past mission of the SRS was to produce nuclear materials that supported the defense, research, and medical programs of the United States. In 1992 the Secretary of Energy directed the SRS to phase out defense-related chemical separations activities. As a result of shutdowns and reduced demand for nuclear materials, the SRS presently has a large inventory of in-process solutions, reactor fuel assemblies, and reactor targets. These materials, due to their form or to the condition in which they are maintained, could represent a concern for the public, worker health and safety, and the environment. DOE published a Notice of Intent (NOI) to prepare this environmental impact statement (EIS) on March 17, 1994 (59

209

Nuclear Forensics  

NLE Websites -- All DOE Office Websites (Extended Search)

nuclear forensics Nuclear Forensics AMS is a Powerful Tool for Nuclear Forensics Nuclear forensics, which can be applied to both interdicted materials and debris from a nuclear...

210

Raft River Geothermal Area | Open Energy Information  

Open Energy Info (EERE)

Raft River Geothermal Area Raft River Geothermal Area Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Geothermal Resource Area: Raft River Geothermal Area Contents 1 Area Overview 2 History and Infrastructure 3 DOE Involvement 4 Timeline 5 Regulatory and Environmental Issues 6 Future Plans 7 Raft River Unit II (26 MW) and Raft River Unit III (32 MW) 8 Enhanced Geothermal System Demonstration 9 Exploration History 10 Well Field Description 11 Technical Problems and Solutions 12 Geology of the Area 12.1 Regional Setting 12.2 Structure 12.3 Stratigraphy 12.3.1 Raft River Formation 12.3.2 Salt Lake Formation 12.3.3 Precambrian Rocks 13 Hydrothermal System 14 Heat Source 15 Geofluid Geochemistry 16 NEPA-Related Analyses (1) 17 Exploration Activities (77) 18 References Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"TERRAIN","zoom":6,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"500px","height":"300px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":42.10166667,"lon":-113.38,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

211

Categorical Exclusion Determinations: Savannah River Operations Office |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

November 7, 2011 November 7, 2011 CX-007671: Categorical Exclusion Determination Heat Exchanger Removal and Disposition CX(s) Applied: B6.1 Date: 11/07/2011 Location(s): South Carolina Offices(s): Savannah River Operations Office November 7, 2011 CX-007670: Categorical Exclusion Determination Maintenance Excavation of the B-07 Outfall Ditch CX(s) Applied: B1.3 Date: 11/07/2011 Location(s): South Carolina Offices(s): Savannah River Operations Office November 7, 2011 CX-007669: Categorical Exclusion Determination Vegetative Response to Metal Exposure in a Growing Media CX(s) Applied: B3.6 Date: 11/07/2011 Location(s): South Carolina Offices(s): Savannah River Operations Office October 27, 2011 CX-007672: Categorical Exclusion Determination Sampling of Nuclear Fuel Assembly CX(s) Applied: B3.6

212

Whats Next for Nuclear Waste  

NLE Websites -- All DOE Office Websites (Extended Search)

WHAT'S NEXT FOR NUCLEAR WASTE? A New Strategy for the CSRA September 2009 PREFACE This White Paper was prepared by the Savannah River Site Community Reuse Organization (SRSCRO) to...

213

Savannah River Site Celebrates Historic Closure of Radioactive Waste Tanks:  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Savannah River Site Celebrates Historic Closure of Radioactive Savannah River Site Celebrates Historic Closure of Radioactive Waste Tanks: Senior DOE Officials and South Carolina Congressional Leadership Gather to Commemorate Historic Cleanup Milestone Savannah River Site Celebrates Historic Closure of Radioactive Waste Tanks: Senior DOE Officials and South Carolina Congressional Leadership Gather to Commemorate Historic Cleanup Milestone October 1, 2012 - 12:00pm Addthis U.S. Energy Under Secretary for Nuclear Security Thomas D'Agostino, left, South Carolina Department of Health and Environmental Control Director Catherine Templeton and U.S. Sen. Lindsey Graham (R-SC) unveil a marker to commemorate the closing of waste tanks at the Savannah River Site in South Carolina. U.S. Energy Under Secretary for Nuclear Security Thomas D'Agostino, left,

214

Tank Farms at the Savannah River Site | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Tank Farms at the Savannah River Site Tank Farms at the Savannah River Site Tank Farms at the Savannah River Site Section 3116 of the Ronald W. Reagan National Defense Authorization Act for Fiscal Year 2005 authorizes the Secretary of Energy, in consultation with the Nuclear Regulatory Commission, to reclassify certain waste from reprocessing spent nuclear fuel from high-level waste to low-level waste if it meets the criteria set forth in Section 3116. A Waste Determination Basis (WD Basis) provides the analysis to document the Secretary's determination to manage the residuals as low-level radioactive waste. The Savannah River Site has several facilities managed under Section 3116. The F-Area Tank Farm (FTF) WD Basis covers 20 tanks remaining to be closed in the FTF and the H-Area Tank Farm (HTF) WD Basis will cover all 29 HTF

215

Savannah River Site Celebrates Historic Closure of Radioactive Waste Tanks:  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Savannah River Site Celebrates Historic Closure of Radioactive Savannah River Site Celebrates Historic Closure of Radioactive Waste Tanks: Senior DOE Officials and South Carolina Congressional Leadership Gather to Commemorate Historic Cleanup Milestone Savannah River Site Celebrates Historic Closure of Radioactive Waste Tanks: Senior DOE Officials and South Carolina Congressional Leadership Gather to Commemorate Historic Cleanup Milestone October 1, 2012 - 12:00pm Addthis U.S. Energy Under Secretary for Nuclear Security Thomas D'Agostino, left, South Carolina Department of Health and Environmental Control Director Catherine Templeton and U.S. Sen. Lindsey Graham (R-SC) unveil a marker to commemorate the closing of waste tanks at the Savannah River Site in South Carolina. U.S. Energy Under Secretary for Nuclear Security Thomas D'Agostino, left,

216

Species for the screening assessment. Columbia River Comprehensive Impact Assessment  

SciTech Connect

Because of past nuclear production operations along the Columbia River, there is intense public and tribal interest in assessing any residual Hanford Site related contamination along the river from the Hanford Reach to the Pacific Ocean. The Columbia River Comprehensive Impact Assessment was proposed to address these concerns. The assessment of the Columbia River is being conducted in phases. The initial phase is a screening assessment of the risk, which addresses current environmental conditions for a range of potential uses. One component of the screening assessment estimates the risk from contaminants in the Columbia River to the environment. The objective of the ecological risk assessment is to determine whether contaminants from the Columbia River pose a significant threat to selected receptor species that exist in the river and riparian communities of the study area. This report (1) identifies the receptor species selected for the screening assessment of ecological risk and (2) describes the selection process. The species selection process consisted of two tiers. In Tier 1, a master species list was developed that included many plant and animal species known to occur in the aquatic and riparian systems of the Columbia River between Priest Rapids Dam and the Columbia River estuary. This master list was reduced to 368 species that occur in the study area (Priest Rapids Dam to McNary Dam). In Tier 2, the 181 Tier 1 species were qualitatively ranked based on a scoring of their potential exposure and sensitivity to contaminants using a conceptual exposure model for the study area.

Becker, J.M.; Brandt, C.A.; Dauble, D.D.; Maughan, A.D.; O`Neil, T.K.

1996-03-01T23:59:59.000Z

217

Columbia River Treaty  

NLE Websites -- All DOE Office Websites (Extended Search)

an understanding of the implications for post-2024 Treaty planning and Columbia River operations. The joint effort by the Entities to conduct initial post-2024 modeling and...

218

Savannah River Ecology Laboratory  

NLE Websites -- All DOE Office Websites (Extended Search)

of lab building SREL Home Faculty and Scientists Research Technical Reports Assessment of Radionuclide Monitoring in the CSRA Savannah River NERP Research Opportunities Field Sites...

219

Savannah River Site (SRS) environmental overview  

SciTech Connect

The environmental surveillance activities at and in the vicinity of the Savannah River Site (SRS) (formerly the Savannah River Plant (SRP)) comprise one of the most comprehensive and extensive environmental monitoring programs in the United States. This overview contains monitoring data from routine and nonroutine radiological and nonradiological environmental surveillance activities, summaries of environmental protection programs in progress, a summary of National Environmental Policy Act (NEPA) activities, and a listing of environmental permits (Appendix A) issued by regulatory agencies. This overview provides information about the impact of SRS operations on the public and the environment. The SRS occupies a large area of approximately 300 square miles along the Savannah River, principally in Aiken and Barnwell counties of South Carolina. SRS's primary function is the production of tritium, plutonium, and other special nuclear materials for national defense, for other governmental uses, and for some civilian purposes. From August 1950 to March 31, 1989, SRS was operated for the Department of Energy (DOE) by E. I. du Pont de Nemours Co. On April 1, 1989 the Westinghouse Savannah River Company assumed responsibility as the prime contractor for the Savannah River Site.

O'Rear, M.G. (USDOE Savannah River Operations Office, Aiken, SC (USA)); Steele, J.L.; Kitchen, B.G. (Westinghouse Savannah River Co., Aiken, SC (USA)) (eds.)

1990-01-01T23:59:59.000Z

220

Large Scale Weather Control Using Nuclear Reactors  

E-Print Network (OSTI)

It is pointed out that controlled release of thermal energy from fission type nuclear reactors can be used to alter weather patterns over significantly large geographical regions. (1) Nuclear heat creates a low pressure region, which can be used to draw moist air from oceans, onto deserts. (2) Creation of low pressure zones over oceans using Nuclear heat can lead to Controlled Cyclone Creation (CCC).(3) Nuclear heat can also be used to melt glaciers and control water flow in rivers.

Moninder Singh Modgil

2002-10-02T23:59:59.000Z

Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

Independent Oversight Review, Savannah River Site Tritium Facilities -  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Tritium Tritium Facilities - December 2012 Independent Oversight Review, Savannah River Site Tritium Facilities - December 2012 December 2012 Review of Site Preparedness for Severe Natural Phenomena Events at the Savannah River Site Tritium Facilities The Office of Enforcement and Oversight (Independent Oversight), within the Office of Health, Safety and Security (HSS), conducted an independent review of preparedness for severe natural phenomena events (NPEs) at the National Nuclear Security Administration (NNSA) Savannah River Site's (SRS's) Tritium Facilities (TF). The HSS Office of Safety and Emergency Management Evaluations performed this review to evaluate the processes for identifying emergency response capabilities and maintaining them in a state of readiness in case of a severe NPE.

222

Schlumberger soundings in the Upper Raft River and Raft River...  

Open Energy Info (EERE)

Schlumberger soundings in the Upper Raft River and Raft River Valleys, Idaho and Utah Abstract In 1975, the U.S. Geological Survey made seventy Schlumberger resistivity...

223

Savannah River | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

River River Savannah River Following are compliance agreements for the Savannah River Site. Also included are short summaries of the agreements. Natural Resources Defense Council Consent Decree, May 26, 1988 Natural Resources Defense Council Consent Decree, May 26, 1988 Summary Savannah River Site Consent Order 99-155-W, October 11, 1999 Savannah River Site Consent Order 99-155-W, October 11, 1999 Summary Savannah River Site Consent Order 85-70-SW, November 7, 1985 Savannah River Site Consent Order 85-70-SW, November 7, 1985 Summary Savannah River Site Consent Order 95-22-HW, September 29, 1995 Savannah River Site Consent Order 95-22-HW, September 29, 1995 Summary Savannah River Site Consent Order 99-21-HW, July 13, 1999 Savannah River Site Consent Order 99-21-HW, July 13, 1999 Summary

224

Savannah River | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Savannah River Savannah River Savannah River Following are compliance agreements for the Savannah River Site. Also included are short summaries of the agreements. Natural Resources Defense Council Consent Decree, May 26, 1988 Natural Resources Defense Council Consent Decree, May 26, 1988 Summary Savannah River Site Consent Order 99-155-W, October 11, 1999 Savannah River Site Consent Order 99-155-W, October 11, 1999 Summary Savannah River Site Consent Order 85-70-SW, November 7, 1985 Savannah River Site Consent Order 85-70-SW, November 7, 1985 Summary Savannah River Site Consent Order 95-22-HW, September 29, 1995 Savannah River Site Consent Order 95-22-HW, September 29, 1995 Summary Savannah River Site Consent Order 99-21-HW, July 13, 1999 Savannah River Site Consent Order 99-21-HW, July 13, 1999 Summary

225

Categorical Exclusion Determinations: Savannah River Operations Office |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

June 23, 2009 June 23, 2009 CX-000497: Categorical Exclusion Determination F-Canyon Complex Deactivation CX(s) Applied: B1.28 Date: 06/23/2009 Location(s): Aiken, South Carolina Office(s): Environmental Management, Savannah River Operations Office June 15, 2009 CX-000495: Categorical Exclusion Determination M-Area Chemical Oxidation (MACO) - Installation of Southern Sector Coreholes and Monitoring Wells Date: 06/15/2009 Location(s): Aiken, South Carolina Office(s): Environmental Management, Savannah River Operations Office June 15, 2009 CX-000496: Categorical Exclusion Determination F Area Hazardous Waste Management Facility Silver Chloride Solution Injection Wells CX(s) Applied: B6.2 Date: 06/15/2009 Location(s): Aiken, South Carolina Office(s): Environmental Management, Savannah River Operations Office

226

Categorical Exclusion Determinations: Savannah River Operations Office |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

April 16, 2013 April 16, 2013 CX-010322: Categorical Exclusion Determination Research and Development Welding and Brazing Sample Preparation and Activities in Building 723-A CX(s) Applied: B3.6 Date: 04/16/2013 Location(s): South Carolina Offices(s): Savannah River Operations Office April 16, 2013 CX-010321: Categorical Exclusion Determination Destructive Evaluation of Plutonium Storage Can Bundles CX(s) Applied: B3.6 Date: 04/16/2013 Location(s): South Carolina Offices(s): Savannah River Operations Office April 16, 2013 CX-010320: Categorical Exclusion Determination Corrosion Testing in Aqueous Solutions CX(s) Applied: B3.6 Date: 04/16/2013 Location(s): South Carolina Offices(s): Savannah River Operations Office April 15, 2013 CX-010324: Categorical Exclusion Determination 772-F Chase 174 Sprinkler Modification

227

Savannah River Site Footprint Reduction Results under the American Recovery and Reinvestment Act - 13302  

SciTech Connect

The Savannah River Site (SRS) is an 802 square-kilometer United States Department of Energy (US DOE) nuclear facility located along the Savannah River near Aiken, South Carolina, managed and operated by Savannah River Nuclear Solutions. Construction of SRS began in the early 1950's to enhance the nation's nuclear weapons capability. Nuclear weapons material production began in the early 1950's, eventually utilizing five production reactors constructed to support the national defense mission. Past operations have resulted in releases of hazardous constituents and substances to soil and groundwater, resulting in 515 waste sites with contamination exceeding regulatory thresholds. More than 1,000 facilities were constructed onsite with approximately 300 of them considered radiological, nuclear or industrial in nature. In 2003, SRS entered into a Memorandum of Agreement with its regulators to accelerate the cleanup using an Area Completion strategy. The strategy was designed to focus cleanup efforts on the 14 large industrial areas of the site to realize efficiencies of scale in the characterization, assessment, and remediation activities. This strategy focuses on addressing the contaminated surface units and the vadose zone and addressing groundwater plumes subsequently. This approach streamlines characterization and remediation efforts as well as the required regulatory documentation, while enhancing the ability to make large-scale cleanup decisions. In February 2009, Congress approved the American Reinvestment and Recovery Act (ARRA) to create jobs and promote economic recovery. At SRS, ARRA funding was established in part to accelerate the completion of environmental remediation and facility deactivation and decommissioning (D and D). By late 2012, SRS achieved 85 percent footprint reduction utilizing ARRA funding by accelerating and coupling waste unit remediation with D and D of remnant facilities. Facility D and D activities were sequenced and permitted with waste unit remediation activities to streamline regulatory approval and execution. Achieving footprint reduction fulfills the Government's responsibility to address legacy contamination; allows earlier completion of legally enforceable compliance agreement milestones; and enables future potential reuse of DOE resources, including land and infrastructure for other missions. Over the last 3.5 years significant achievements were met that contributed to footprint reduction, including the closure of 41 waste units (including 20 miles of radiologically contaminated stream) and decommissioning of 30 facilities (including the precedent setting in situ closure of two former production reactors, the first in the DOE Complex). Other notable achievements included the removal of over 39,750 cubic meters of debris and 68,810 cubic meters of contaminated soils, including 9175 cubic meters of lead-contaminated soil from a former site small arms testing range and treatment of 1,262 cubic meters of tritium-laden soils and concrete using a thermal treatment system. (authors)

Flora, Mary [Savannah River Nuclear Solutions Bldg. 730-4B, Aiken, SC 29808 (United States)] [Savannah River Nuclear Solutions Bldg. 730-4B, Aiken, SC 29808 (United States); Adams, Angelia [United States Department of Energy Bldg. 730-B, Aiken, SC 29808 (United States)] [United States Department of Energy Bldg. 730-B, Aiken, SC 29808 (United States); Pope, Robert [United States Environmental Protection Agency Region IV Atlanta, GA 30303 (United States)] [United States Environmental Protection Agency Region IV Atlanta, GA 30303 (United States)

2013-07-01T23:59:59.000Z

228

River Edge Redevelopment Zone (Illinois)  

Energy.gov (U.S. Department of Energy (DOE))

The purpose of the River Edge Redevelopment Program is to revive and redevelop environmentally challenged properties adjacent to rivers in Illinois.

229

The Nation's Rivers  

Science Journals Connector (OSTI)

...task of water quality assessment." Such interpretation...environment demands continuing assessment and interpretation...pro-cesses active in river systems and hence such measures...character of many river systems. To date, observations...money, observational tools must be designed to...

M. Gordon Wolman

1971-11-26T23:59:59.000Z

230

Mesoscopic structuring and dynamics of alcohol/water solutions probed by Terahertz Time-Domain Spectroscopy and Pulsed Field Gradient Nuclear Magnetic Resonance  

E-Print Network (OSTI)

in the structure of alcohol/water mixtures. Taking aqueous ethanol as a representative example, excess enthalpy, heat capacity, diffusivity, and viscosity all exhibit maxima or minima at ?15?20 mol %;12,16,20?23 this is attributable to Received: March 20, 2014... dielectric spectroscopy and the results were compared to femtosecond infrared pump? probe studies. By investigating a range of concentrations of aqueous tetramethylurea solutions it was found that the dynamics of the water molecules in close vicinity...

Li, Ruoyu; D'Agostino, Carmine; McGregor, James; Mantle, Michael D.; Zeitler, J. Axel; Gladden, Lynn F.

2014-08-12T23:59:59.000Z

231

Solvent wash solution  

DOE Patents (OSTI)

A process is claimed for removing diluent degradation products from a solvent extraction solution, which has been used to recover uranium and plutonium from spent nuclear fuel. A wash solution and the solvent extraction solution are combined. The wash solution contains (a) water and (b) up to about, and including, 50 vol % of at least one-polar water-miscible organic solvent based on the total volume of the water and the highly-polar organic solvent. The wash solution also preferably contains at least one inorganic salt. The diluent degradation products dissolve in the highly-polar organic solvent and the organic solvent extraction solvent do not dissolve in the highly-polar organic solvent. The highly-polar organic solvent and the extraction solvent are separated.

Neace, J.C.

1984-03-13T23:59:59.000Z

232

Predicting the river’s blue line for fish conservation  

Science Journals Connector (OSTI)

...Basin (VRB), a tributary to the lower Colorado River that has been the poster child...rivers like the San Pedro River (also a Colorado River tributary in Arizona), citizen...reaches with zero flows (i.e., during floods) and hence colonize parts of the distant...

John L. Sabo

2014-01-01T23:59:59.000Z

233

CRAD, Management - Office of River Protection K Basin Sludge Waste System |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Office of River Protection K Basin Sludge Waste Office of River Protection K Basin Sludge Waste System CRAD, Management - Office of River Protection K Basin Sludge Waste System May 2004 A section of Appendix C to DOE G 226.1-2 "Federal Line Management Oversight of Department of Energy Nuclear Facilities." Consists of Criteria Review and Approach Documents (CRADs) used for a May 2004 assessment of the Management at the Office of River Protection K Basin Sludge Waste System. CRADs provide a recommended approach and the types of information to gather to assess elements of a DOE contractor's programs. CRAD, Management - Office of River Protection K Basin Sludge Waste System More Documents & Publications CRAD, Emergency Management - Office of River Protection K Basin Sludge Waste System CRAD, Conduct of Operations - Office of River Protection K Basin Sludge

234

EIS-0108: L-Reactor Operation, Savannah River Plant, Aiken, South Carolina  

Energy.gov (U.S. Department of Energy (DOE))

This Environmental Impact Statement (EIS) was prepared to provide environmental input into the proposed decision to restart L-Reactor operation at the Savannah River Plant (SRP). The Savannah River Plant is a major U.S. Department of Energy (DOE) installation for the production of defense nuclear materials. The proposed restart of L–Reactor would provide defense nuclear materials (i.e. , plutonium) to wet current and near-term needs for national defense purposes.

235

Columbia River Treaty History and 2014/2024 Review  

SciTech Connect

The Columbia River, the fourth largest river on the continent as measured by average annual ?ow, generates more power than any other river in North America. While its headwaters originate in British Columbia, only about 15 percent of the 259,500 square miles of the Columbia River Basin is actually located in Canada. Yet the Canadian waters account for about 38 percent of the average annual volume, and up to 50 percent of the peak ?ood waters, that ?ow by The Dalles Dam on the Columbia River between Oregon and Washington. In the 1940s, of?cials from the United States and Canada began a long process to seek a joint solution to the ?ooding caused by the unregulated Columbia River and to the postwar demand for greater energy resources. That effort culminated in the Columbia River Treaty, an international agreement between Canada and the United States for the cooperative development of water resources regulation in the upper Columbia River Basin. It was signed in 1961 and implemented in 1964.

None

2009-02-01T23:59:59.000Z

236

Development of glass vitrification at SRL as a waste treatment technique for nuclear weapon components  

SciTech Connect

This report discusses the development of vitrification for the waste treatment of nuclear weapons components at the Savannah River Site. Preliminary testing of surrogate nuclear weapon electronic waste shows that glass vitrification is a viable, robust treatment method.

Coleman, J.T.; Bickford, D.F.

1991-01-01T23:59:59.000Z

237

Shale Gas Development in the Susquehanna River Basin  

U.S. Energy Information Administration (EIA) Indexed Site

Water Resource Challenges Water Resource Challenges From Energy Production Major Types of Power Generation in SRB - Total 15,300 Megawatts - 37.5% 4.0% 12.0% 15.5% 31.0% Nuclear Coal Natural Gas Hydroelectric Other Marcellus Shale Gas Development in the Susquehanna River Basin The Basin: * 27,510-square-mile watershed * Comprises 43 percent of the Chesapeake Bay watershed * 4.2 million population * 60 percent forested * 32,000+ miles of waterways The Susquehanna River: * 444 miles, largest tributary to the Chesapeake Bay * Supplies 18 million gallons a minute to the Bay Susquehanna River Basin Geographic Location of Marcellus Shale within Susq. River Basin 72% of Basin (20,000 Sq. Miles) Underlain by Marcellus Shale Approximate Amount of Natural Gas in Marcellus Shale * U.S. currently produces approx. 30 trillion

238

Independent Activity Report, Office of River Protection - April 2011 |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Independent Activity Report, Office of River Protection - April Independent Activity Report, Office of River Protection - April 2011 Independent Activity Report, Office of River Protection - April 2011 April 2011 Hanford Tank Farms Unreviewed Safety Question Process Review [HIAR-HORP-2011-04-18] The purpose of the activity, which was performed by the Office of Health, Safety and Security (HSS) as part of the Department of Energy (DOE) Office of River Protection's (ORP's) nuclear safety assessment and oversight, was to review and evaluate selected aspects of the Tank Farms Operating Contractor's (TOC's) implementation of the recently revised unreviewed safety question (USQ) procedure. A major aspect of the revised implemented process (Ref. 1) was to eliminate unnecessary screening and to streamline the USQ process by defining facility and procedure changes that are outside

239

Preliminary Notice of Violation, Westinghouse Savannah River Company -  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

2 2 Preliminary Notice of Violation, Westinghouse Savannah River Company - EA-2000-02 March 6, 2000 Preliminary Notice of Violation issued to Westinghouse Savannah River Company, related to Procurement Quality Assurance and Quality Improvement Deficiencies at the Savannah River Site. This letter refers to the Department of Energy's (DOE) evaluation of quality assurance deficiencies with the procurement of items for use at nuclear facilities under your control. DOE conducted an investigation and issued an Investigation Summary Report on December 21, 1999, detailing its findings. An Enforcement Conference was held with management of the Westinghouse Savannah River Company (WSRC) to discuss these matters on January 11, 2000. The Enforcement Conference Summary Report is enclosed.

240

DOE Issues Salt Waste Determination for the Savannah River Site |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Issues Salt Waste Determination for the Savannah River Site Issues Salt Waste Determination for the Savannah River Site DOE Issues Salt Waste Determination for the Savannah River Site January 18, 2006 - 10:49am Addthis WASHINGTON, DC - The U.S. Department of Energy (DOE) today issued the waste determination for the treatment and stabilization of low activity salt-waste at the Savannah River Site allowing for significant reductions in environmental and health risks posed by the material. Stored in forty-nine underground tanks, approximately 36 million gallons of radioactive waste is left over from plutonium production during the Cold War. In addition, the department issued an amended Record of Decision and Implementation Plan to the Defense Nuclear Facilities Safety Board. "Today's announcement clears the way for the removal and treatment of this

Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

Independent Activity Report, Savannah River Site - July 2011 | Department  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Independent Activity Report, Savannah River Site - July 2011 Independent Activity Report, Savannah River Site - July 2011 Independent Activity Report, Savannah River Site - July 2011 July 2011 Savannah River Site Waste Solidification Building Project Peer Review [HIAR-SRS-2011-07-15] At the request of the National Nuclear Security Administration (NNSA) Office of Enterprise Project Management (NAAPM-20), the Office of Enforcement and Oversight (Independent Oversight), within the Office of Health, Safety and Security (HSS), provided an expert to review the Waste Solidification Building (WSB) startup programs and procedures associated with worker safety and health, environment, and security. Criteria for the review was detailed in the Criteria, Review and Approach Document (CRAD) contained within the NNSA review plan, and the expert served as a member of

242

Integration of Environmental Compliance at the Savannah River Site - 13024  

SciTech Connect

The Savannah River Site (SRS) is a large federal installation hosting diverse missions and multiple organizations with competing regulatory needs. Accordingly, there was a need to integrate environmental compliance strategies to ensure the consistent flow of information between Department of Energy-Savannah River (DOE-SR), the regulatory agencies and other interested parties. In order to meet this objective, DOE and major SRS contractors and tenants have committed to a strategy of collaboratively working together to ensure that a consistent, integrated, and fully coordinated approach to environmental compliance and regulator relationships is maintained. DOE-SR and Savannah River Nuclear Solutions, LLC, the SRS management and operations contractor, have established an environmental compliance integration process that provides for the consistent flow down of requirements to projects, facilities, SRS contractors, and subcontractors as well as the upward flow of information to assist in the early identification and resolution of environmental regulatory issues and enhancement of compliance opportunities. In addition, this process strongly fosters teamwork to collaboratively resolve complex regulatory challenges, promote pollution prevention and waste minimization opportunities to advance site missions in a manner that balances near-term actions with the long-term site vision, while being protective of human health and the environment. Communication tools are being utilized, some with enhancements, to ensure appropriate information is communicated to all levels with environmental responsibility at SRS. SRS internal regulatory integration is accomplished through a variety of informational exchange forums (e.g., Challenges, Opportunities and Resolution (COR) Team, DOE's Joint Site Regulatory Integration Team, and the Senior Environmental Managers Council (SEMC)). SRS communications and problem-solving with the regulatory agencies have been enhanced through formation of an interagency 'SRS Regulatory Integration Team (SRIT)'. The SRIT is a partnership comprised of representatives from DOE-SR (with contractor support), EPA Region 4 and the South Carolina Department of Health and Environmental Control (SCDHEC) and is chartered to develop a consensus understanding of SRS regulatory issues and activities. These forums and a formal environmental compliance integration process improve timely cross-functional decision making, problem solving, information sharing, and issue resolution. The SRS internal process has been formally documented in an Environmental Regulatory Integration Program Description, which is linked to the SRS Environmental Policy and agreed upon by all major contractors, subcontractors and tenants. (authors)

Hoel, David [United States Department of Energy - Savannah River Operations Office (United States)] [United States Department of Energy - Savannah River Operations Office (United States); Griffith, Michael [Savannah River Nuclear Solutions, LLC (United States)] [Savannah River Nuclear Solutions, LLC (United States)

2013-07-01T23:59:59.000Z

243

Sioux River Ethanol LLC | Open Energy Information  

Open Energy Info (EERE)

Sioux River Ethanol LLC Jump to: navigation, search Name: Sioux River Ethanol LLC Place: Hudson, South Dakota Zip: 57034 Product: Farmer owned ethanol producer, Sioux River Ethanol...

244

Enforcement Letter, Westinghouse Savannah River Company - April...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Savannah River Company - July 21, 1998 Enforcement Letter, Westinghouse Savannah River Company - March 29, 2000 Enforcement Letter, Savannah River Ecology Laboratory - June 7, 2000...

245

Scenic River Protection Policy, Minnesota Wild and Scenic Rivers Act  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Scenic River Protection Policy, Minnesota Wild and Scenic Rivers Scenic River Protection Policy, Minnesota Wild and Scenic Rivers Act (Minnesota) Scenic River Protection Policy, Minnesota Wild and Scenic Rivers Act (Minnesota) < Back Eligibility Utility Fed. Government Commercial Agricultural Investor-Owned Utility State/Provincial Govt Industrial Construction Municipal/Public Utility Local Government Residential Installer/Contractor Rural Electric Cooperative Tribal Government Low-Income Residential Schools Retail Supplier Institutional Multi-Family Residential Systems Integrator Fuel Distributor Nonprofit General Public/Consumer Transportation Savings Category Alternative Fuel Vehicles Hydrogen & Fuel Cells Buying & Making Electricity Water Home Weatherization Solar Wind Program Info State Minnesota Program Type Siting and Permitting

246

Nuclear Energy  

NLE Websites -- All DOE Office Websites (Extended Search)

Research Programs >> Nuclear Energy Error Error Nuclear Energy Home - RCC cannot be displayed due to a timeout error. We recommend: * Refresh Nuclear Energy Home - RCC * Increasing...

247

Alan Roback Policy Implications of Nuclear Winter  

E-Print Network (OSTI)

Alan Roback Policy Implications of Nuclear Winter and Ideas for Solutions The 5 May 1988 United of war or policy. Even a "first strike" or a "limited nuclear war" would be likely to result in nuclear Nations report clearly states that the nuclear winter theory is supported by current scientific evidence

Robock, Alan

248

Oversight Scheduling and Operational Awareness at the Savannah River Site, March 2013  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

HSS Independent Activity Report - HSS Independent Activity Report - Rev. 0 Report Number: HIAR-SRS-2013-03-25 Site: Savannah River Site Subject: Office of Enforcement and Oversight's Office of Safety and Emergency Management Evaluations Activity Report on Oversight Scheduling and Operational Awareness at the Savannah River Site Dates of Activity : 03/25/2013 - 03/28/2013 Report Preparer: Phillip D. Aiken Activity Description/Purpose: 1. The Independent Oversight Site Lead for the Savannah River Site traveled to the site to work with functional area managers to schedule nuclear safety oversight activities. 2. The Site Lead reviewed the differing professional opinion (DPO) program at the Savannah River Operations Office (Department of Energy (DOE)-SR). Result: 1. The Site Lead scheduled a radiological program review at the National Nuclear Security Administration Savannah River

249

Dynamic simulation of nuclear hydrogen production systems  

E-Print Network (OSTI)

Nuclear hydrogen production processes have been proposed as a solution to rising CO 2 emissions and low fuel yields in the production of liquid transportation fuels. In these processes, the heat of a nuclear reactor is ...

Ramírez Muñoz, Patricio D. (Patricio Dario)

2011-01-01T23:59:59.000Z

250

Microsoft Word - spent nuclear fuel report.doc  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Management of Spent Nuclear Fuel Management of Spent Nuclear Fuel at the Savannah River Site DOE/IG-0727 May 2006 REPORT ON MANAGEMENT OF SPENT NUCLEAR FUEL AT THE SAVANNAH RIVER SITE TABLE OF CONTENTS Spent Nuclear Fuel Management Details of Finding 1 Recommendations 2 Comments 3 Appendices 1. Objective, Scope, and Methodology 4 2. Prior Audit Reports 5 3. Management Comments 6 SPENT NUCLEAR FUEL MANGEMENT Page 1 Details of Finding H-Canyon The Department of Energy's (Department) spent nuclear fuel Operations program at the Savannah River Site (Site) will likely require Extended H-Canyon to be maintained at least two years beyond defined operational needs. The Department committed to maintain H-Canyon operational readiness to provide a disposal path for

251

EIS-0279: Spent Nuclear Fuel Management, Aiken, South Carolina | Department  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

79: Spent Nuclear Fuel Management, Aiken, South Carolina 79: Spent Nuclear Fuel Management, Aiken, South Carolina EIS-0279: Spent Nuclear Fuel Management, Aiken, South Carolina SUMMARY The proposed DOE action considered in this environmental impact statement (EIS) is to implement appropriate processes for the safe and efficient management of spent nuclear fuel and targets at the Savannah River Site (SRS) in Aiken County, South Carolina, including placing these materials in forms suitable for ultimate disposition. PUBLIC COMMENT OPPORTUNITIES None available at this time. DOCUMENTS AVAILABLE FOR DOWNLOAD April 5, 2013 EIS-0279: Amended Record of Decision Spent Nuclear Fuel Management at the Savannah River Site April 1, 2013 EIS-0279-SA-01: Supplement Analysis Savannah River Site Spent Nuclear Fuel Management (DOE/EIS-0279-SA-01 and

252

Nuclear Debate  

Science Journals Connector (OSTI)

Nuclear Debate ... This month, the Senate will consider the nominations of two women to serve on the Nuclear Regulatory Commission. ... Svinicki is a nuclear engineer with experience in the Department of Energy’s nuclear energy programs. ...

JEFF JOHNSON

2012-06-11T23:59:59.000Z

253

Savannah River Tritium Enterprise exceeds productivity savings goals for  

NLE Websites -- All DOE Office Websites (Extended Search)

Tritium Enterprise exceeds productivity savings goals for Tritium Enterprise exceeds productivity savings goals for FY13 | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Home > NNSA Blog > Savannah River Tritium Enterprise exceeds productivity savings ... Savannah River Tritium Enterprise exceeds productivity savings goals for FY13 Posted By Office of Public Affairs

254

Savannah River Tritium Enterprise exceeds productivity savings goals for  

National Nuclear Security Administration (NNSA)

Tritium Enterprise exceeds productivity savings goals for Tritium Enterprise exceeds productivity savings goals for FY13 | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Home > NNSA Blog > Savannah River Tritium Enterprise exceeds productivity savings ... Savannah River Tritium Enterprise exceeds productivity savings goals for FY13 Posted By Office of Public Affairs

255

CRAD, Occupational Safety & Health - Office of River Protection K Basin  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Office of River Protection K Office of River Protection K Basin Sludge Waste System CRAD, Occupational Safety & Health - Office of River Protection K Basin Sludge Waste System May 2004 A section of Appendix C to DOE G 226.1-2 "Federal Line Management Oversight of Department of Energy Nuclear Facilities." Consists of Criteria Review and Approach Documents (CRADs) used for a May 2004 assessment of the Environment, Safety and Health program at the Office of River Protection K Basin Sludge Waste System. CRADs provide a recommended approach and the types of information to gather to assess elements of a DOE contractor's programs. CRAD, Occupational Safety & Health - Office of River Protection K Basin Sludge Waste System More Documents & Publications CRAD, Management - Office of River Protection K Basin Sludge Waste System

256

CRAD, Training - Office of River Protection K Basin Sludge Waste System |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Office of River Protection K Basin Sludge Waste Office of River Protection K Basin Sludge Waste System CRAD, Training - Office of River Protection K Basin Sludge Waste System May 2004 A section of Appendix C to DOE G 226.1-2 "Federal Line Management Oversight of Department of Energy Nuclear Facilities." Consists of Criteria Review and Approach Documents (CRADs) used for a May 2004 assessment of the Environment, Safety and Health program at the Office of River Protection K Basin Sludge Waste System. CRADs provide a recommended approach and the types of information to gather to assess elements of a DOE contractor's programs. CRAD, Training - Office of River Protection K Basin Sludge Waste System More Documents & Publications CRAD, Emergency Management - Office of River Protection K Basin Sludge

257

CRAD, Conduct of Operations - Office of River Protection K Basin Sludge  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Office of River Protection K Basin Office of River Protection K Basin Sludge Waste System CRAD, Conduct of Operations - Office of River Protection K Basin Sludge Waste System May 2004 A section of Appendix C to DOE G 226.1-2 "Federal Line Management Oversight of Department of Energy Nuclear Facilities." Consists of Criteria Review and Approach Documents (CRADs) used for a May 2004 assessment of the Conduct of Operations program at the Office of River Protection, K Basin Sludge Waste System. CRADs provide a recommended approach and the types of information to gather to assess elements of a DOE contractor's programs. CRAD, Conduct of Operations - Office of River Protection K Basin Sludge Waste System More Documents & Publications CRAD, Occupational Safety & Health - Office of River Protection K Basin

258

CRAD, Engineering - Office of River Protection K Basin Sludge Waste System  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Engineering - Office of River Protection K Basin Sludge Waste Engineering - Office of River Protection K Basin Sludge Waste System CRAD, Engineering - Office of River Protection K Basin Sludge Waste System May 2004 A section of Appendix C to DOE G 226.1-2 "Federal Line Management Oversight of Department of Energy Nuclear Facilities." Consists of Criteria Review and Approach Documents (CRADs) used for a May 2004 assessment of the Engineering program at the Office of River Protection K Basin Sludge Waste System. CRADs provide a recommended approach and the types of information to gather to assess elements of a DOE contractor's programs. CRAD, Engineering - Office of River Protection K Basin Sludge Waste System More Documents & Publications CRAD, Emergency Management - Office of River Protection K Basin Sludge

259

Meteorological Support at the Savanna River Site  

SciTech Connect

The Department of Energy (DOE) operates many nuclear facilities on large complexes across the United States in support of national defense. The operation of these many and varied facilities and processes require meteorological support for many purposes, including: for routine operations, to respond to severe weather events, such as lightning, tornadoes and hurricanes, to support the emergency response functions in the event of a release of materials to the environment, for engineering baseline and safety documentation, as well as hazards assessments etc. This paper describes a program of meteorological support to the Savannah River Site, a DOE complex located in South Carolina.

Addis, Robert P.

2005-10-14T23:59:59.000Z

260

River Protection.PDF  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

cc: cc: DOE/IG-0506 I N S P E C T I O N R E P O R T U.S. DEPARTMENT OF ENERGY OFFICE OF INSPECTOR GENERAL OFFICE OF INSPECTIONS I N S P E C T I O N O F SELECTED ASPECTS OF THE OFFICE OF RIVER PROTECTION PERFORMANCE-BASED INCENTIVE PROGRAM JUNE 2001 U.S. DEPARTMENT OF ENERGY Washington, DC 20585 June 14, 2001 MEMORANDUM FOR THE SECRETARY FROM: Gregory H. Friedman /s/ Inspector General SUBJECT: INFORMATION: Report on "Inspection of Selected Aspects of the Office of River Protection Performance-Based Incentive Program" BACKGROUND The Office of River Protection (ORP), which reports to the Office of Environmental Management, is responsible for remediation of the radioactive waste stored in tanks at the Hanford Site in the State of Washington. For Fiscal Year (FY) 2000, ORP established 26 performance-based contract

Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

Rivanna River Basin Commission (Virginia)  

Energy.gov (U.S. Department of Energy (DOE))

The Rivanna River Basin Commission is an independent local entity tasked with providing guidance for the stewardship and enhancement of the water quality and natural resources of the Rivanna River...

262

Ecotoxicology | Savannah River Ecology Laboratory  

NLE Websites -- All DOE Office Websites (Extended Search)

Savannah River NERP Research Opportunities Field Sites Data Research Facilities Low Dose Irradiation Facility Tritium Irrigation Facility Microsatellite Development Education...

263

River restoration Ellen Wohl,1  

E-Print Network (OSTI)

, massive expenditures, and the burgeoning industry of aquatic and riparian restoration, river ecosystems. Introduction: Problem Statement [2] Continuing degradation of river ecosystems and loss of aquatic biodiversityRiver restoration Ellen Wohl,1 Paul L. Angermeier,2 Brian Bledsoe,3 G. Mathias Kondolf,4 Larry Mac

Poff, N. LeRoy

264

Independent Oversight Inspection, Savannah River Site - December 2009 |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

December December 2009 Independent Oversight Inspection, Savannah River Site - December 2009 December 2009 Inspection of Reinforced Concrete Construction at the Savannah River Site Mixed Oxide Fuel Fabrication Facility The U.S. Department of Energy (DOE) Office of Independent Oversight conducted a nuclear safety inspection at the Mixed Oxide (MOX) Fuel Fabrication Facility (MFFF) construction project, focusing on construction quality, specifically for reinforced concrete, at the MFFF construction project. This purpose of the inspection was to provide mission support to site management in determining whether the facility structure is constructed in accordance with the applicable requirements. The overall quality of concrete that has been placed in the MFFF to date is

265

Chao Phraya River  

Science Journals Connector (OSTI)

the river flow during low flow in January and 4% during high flow conditions in July 2004. The unit shoreline ...... since the water first became enriched in radium isotopes assuming no ... uranium-series isotopes (223Ra and 226Ra), estimating radium ages .... inventory into concentration by dividing by the water depth, which

2006-08-16T23:59:59.000Z

266

Condamine River Meteor Zamia  

E-Print Network (OSTI)

CONNORS Cape Townshend Townshend Island Island Long Broad Sound Condamine River Maran oa Comet Isaac Daws Roper Nogoa Ca llide Bungeworgorai North Balmy L ogan Denison L o t us Buck land Con ciliation Humb oldt Elphinstone Dam Eungella Dam R Ck Nebo RomaAmby Wowan Warra Miles Moura Dingo Comet Alpha Banana Rannes Marmor

Greenslade, Diana

267

Savannah River Site Robotics  

ScienceCinema (OSTI)

Meet Sandmantis and Frankie, two advanced robotic devices that are key to cleanup at Savannah River Site. Sandmantis cleans hard, residual waste off huge underground storage tanks. Frankie is equipped with unique satellite capabilities and sensing abilties that can determine what chemicals still reside in the tanks in a cost effective manner.

None

2012-06-14T23:59:59.000Z

268

The Nation's Rivers  

Science Journals Connector (OSTI)

...soil erosion and the need for soil conserva-tion were first clearly...residuals accumu-lated in soils, vegetation, and other organisms...from the Potomac River near Washing-ton, D.C., and doubtless...Ruhe and R. B. Daniels, J. Soil Water Conserv. 20, 52 (1965...

M. Gordon Wolman

1971-11-26T23:59:59.000Z

269

River meandering dynamics  

Science Journals Connector (OSTI)

The Ikeda, Parker, and Sawai river meandering model is reexamined using a physical approach employing an explicit equation of motion. For periodic river shapes as seen from above, a cross-stream surface elevation gradient creates a velocity shear that is responsible for the decay of small-wavelength meander bends, whereas secondary currents in the plane perpendicular to the downstream direction are responsible for the growth of large-wavelength bends. A decay length D=H/2Cf involving the river depth H and the friction coefficient Cf sets the scale for meandering, giving the downstream distance required for the fluid velocity profile to recover from changes in the channel curvature. Using this length scale and a time scale T, we explicitly trace the observed length scale invariance to the equations of motion, and predict similar time and velocity scale invariances. A general time-dependent nonlinear modal analysis for periodic rivers reveals that modes higher than the third mode are needed to describe upstream migration of bend apexes just before oxbow cutoff, and are important to accurate calculations of the time and sinuosity at cutoff.

Boyd F. Edwards and Duane H. Smith

2002-03-26T23:59:59.000Z

270

Avian Research at the Savannah River Site: A Model For Integrating Basic Research and Long-Term Management  

E-Print Network (OSTI)

... Savannah River Site: implications for habitat management and nuclear waste site remediation ... I. Lehr Brisbin, Jr., and Robert A. ... The resulting discus- sions improved our collective understanding of the research/management interaction, and even- tually ...

271

U.S. Navy Launches First Nuclear Sub | National Nuclear Security  

NLE Websites -- All DOE Office Websites (Extended Search)

Navy Launches First Nuclear Sub | National Nuclear Security Navy Launches First Nuclear Sub | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Home > About Us > Our History > NNSA Timeline > U.S. Navy Launches First Nuclear Sub U.S. Navy Launches First Nuclear Sub January 21, 1954 Thames River (Groton, Conn.) U.S. Navy Launches First Nuclear Sub

272

Nuclear Resonance Fluorescence for Nuclear Materials Assay  

E-Print Network (OSTI)

Potential of Nuclear Resonance Fluorescence . . . . . . . .2.9.1 Nuclear ThomsonSections . . . . . . . . . . . . . . . Nuclear Resonance

Quiter, Brian Joseph

2010-01-01T23:59:59.000Z

273

Savannah River Site: Plutonium Preparation Project (PuPP) at Savannah River Site  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Revieir of the Plutonium Revieir of the Plutonium Preparation Project at Savannah River Site October 2008 Dr. David S. Kosson, Vanderbilt University Dr. David R. Gallay, Logistics Management Institute Dr. R. Bruce Mathews, Consultant Mr. David Nulton, National Nuclear Security Administration (ret.) Dr. Kenneth Okafor, South Carolina State University Dr. Steven Krahn, U. S. Department of Energy I I External Technical Review of the Plutonium Preparation Project October 2008 - I Acknowledgements The Review Team thanks Ms. Michelle Ewart, Savantiah River Site, and Mr. Ricky Bell, for their exceptional support during this review. Ms. Ewart was the lead DOE representative responsible for organizing reviews held on-site by the Review Team. Mr. Theodore Venetz (Fluor Hanford Company) served as an observer to this review. The

274

Nuclear Returns  

Science Journals Connector (OSTI)

Nuclear Returns ... For the first time since 1978, the Nuclear Regulatory Commission has given the green light for a new U.S. nuclear power plant. ... NRC granted a license to Southern Co. to build and operate twin 1,100-MW reactors adjacent to two operating nuclear power plants at its Vogtle nuclear facility, near Waynesboro, Ga. ...

JEFF JOHNSON

2012-02-19T23:59:59.000Z

275

Cesium in the Savannah River Site environment  

SciTech Connect

Cesium in the Savannah River Site Environment is published as a part of the Radiological Assessment Program (RAP). It is the fourth in a series of eight documents on individual radioisotopes released to the environment as a result of Savannah River Site (SRS) operations. The earlier documents describe the environmental consequences of tritium, iodine, and uranium. Documents on plutonium, strontium, carbon, and technetium will be published in the future. These are dynamic documents and current plans call for revising and updating each one on a two-year schedule.Radiocesium exists in the environment as a result of above-ground nuclear weapons tests, the Chernobyl accident, the destruction of satellite Cosmos 954, small releases from reactors and reprocessing plants, and the operation of industrial, medical, and educational facilities. Radiocesium has been produced at SRS during the operation of five production reactors. Several hundred curies of [sup 137]Cs was released into streams in the late 50s and 60s from leaking fuel elements. Smaller quantities were released from the fuel reprocessing operations. About 1400 Ci of [sup 137]Cs was released to seepage basins where it was tightly bound by clay in the soil. A much smaller quantity, about four Ci. was released to the atmosphere. Radiocesium concentration and mechanisms for atmospheric, surface water, and groundwater have been extensively studied by Savannah River Technology Center (SRTC) and ecological mechanisms have been studied by Savannah River Ecology Laboratory (SREL). The overall radiological impact of SRS releases on the offsite maximum individual can be characterized by total doses of 033 mrem (atmospheric) and 60 mrem (liquid), compared with a dose of 12,960 mrem from non-SRS sources during the same period of time. Isotope [sup 137]Cs releases have resulted in a negligible risk to the environment and the population it supports.

Carlton, W.H.; Bauer, L.R.; Evans, A.G.; Geary, L.A.; Murphy, C.E. Jr.; Pinder, J.E.; Strom, R.N.

1992-03-01T23:59:59.000Z

276

Cesium in the Savannah River Site environment  

SciTech Connect

Cesium in the Savannah River Site Environment is published as a part of the Radiological Assessment Program (RAP). It is the fourth in a series of eight documents on individual radioisotopes released to the environment as a result of Savannah River Site (SRS) operations. The earlier documents describe the environmental consequences of tritium, iodine, and uranium. Documents on plutonium, strontium, carbon, and technetium will be published in the future. These are dynamic documents and current plans call for revising and updating each one on a two-year schedule.Radiocesium exists in the environment as a result of above-ground nuclear weapons tests, the Chernobyl accident, the destruction of satellite Cosmos 954, small releases from reactors and reprocessing plants, and the operation of industrial, medical, and educational facilities. Radiocesium has been produced at SRS during the operation of five production reactors. Several hundred curies of {sup 137}Cs was released into streams in the late 50s and 60s from leaking fuel elements. Smaller quantities were released from the fuel reprocessing operations. About 1400 Ci of {sup 137}Cs was released to seepage basins where it was tightly bound by clay in the soil. A much smaller quantity, about four Ci. was released to the atmosphere. Radiocesium concentration and mechanisms for atmospheric, surface water, and groundwater have been extensively studied by Savannah River Technology Center (SRTC) and ecological mechanisms have been studied by Savannah River Ecology Laboratory (SREL). The overall radiological impact of SRS releases on the offsite maximum individual can be characterized by total doses of 033 mrem (atmospheric) and 60 mrem (liquid), compared with a dose of 12,960 mrem from non-SRS sources during the same period of time. Isotope {sup 137}Cs releases have resulted in a negligible risk to the environment and the population it supports.

Carlton, W.H.; Bauer, L.R.; Evans, A.G.; Geary, L.A.; Murphy, C.E. Jr.; Pinder, J.E.; Strom, R.N.

1992-03-01T23:59:59.000Z

277

CHEMICAL SLUDGE HEEL REMOVAL AT THE SAVANNAH RIVER SITE F TANK FARM CLOSURE PROJECT 8183  

SciTech Connect

Chemical Sludge Removal (CSR) is the final waste removal activity planned for some of the oldest nuclear waste tanks located at the Savannah River Site (SRS) in Aiken, SC. In 2008, CSR will be used to empty two of these waste tanks in preparation for final closure. The two waste tanks chosen to undergo this process have previously leaked small amounts of nuclear waste from the primary tank into an underground secondary containment pan. CSR involves adding aqueous oxalic acid to the waste tank in order to dissolve the remaining sludge heel. The resultant acidic waste solution is then pumped to another waste tank where it will be neutralized and then stored awaiting further processing. The waste tanks to be cleaned have a storage capacity of 2.84E+06 liters (750,000 gallons) and a target sludge heel volume of 1.89E+04 liters (5,000 gallons) or less for the initiation of CSR. The purpose of this paper is to describe the CSR process and to discuss the most significant technical issues associated with the development of CSR.

Thaxton, D; Timothy Baughman, T

2008-01-16T23:59:59.000Z

278

Optimization Online - Guaranteed Minimum-Rank Solutions of ...  

E-Print Network (OSTI)

Jun 28, 2007 ... Guaranteed Minimum-Rank Solutions of Linear Matrix Equations via Nuclear Norm Minimization. Benjamin Recht(brecht ***at*** caltech.edu)

Benjamin Recht

2007-06-28T23:59:59.000Z

279

DOE woos scientists for nuclear waste work  

Science Journals Connector (OSTI)

DOE woos scientists for nuclear waste work ... The Department of Energy has established a $50 million-per-year program to involve for the first time the basic research community in cleaning up nuclear waste at DOE's widely scattered, heavily contaminated nuclear weapons facilities. ... Cleanup of waste at DOE's nuclear weapons facilities—at Savannah River, S.C.; Oak Ridge, Term.; Hanford, Wash.; and Paducah, Ky.; among others—is expected to take at least 50 years and cost at least $300 billion. ...

WIL LEPKOWSKI

1996-02-19T23:59:59.000Z

280

MagLab - Solution Nuclear Magnetic Resonance  

NLE Websites -- All DOE Office Websites (Extended Search)

organisms. This probe, which now operates at UFs AMRIS NMR facility, is based on high temperature superconductor (HTS) technology. It is the first HTS probe to use a 1-mm...

Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

Nuclear Fusion  

Science Journals Connector (OSTI)

Although not yet developed at the commercial stage, nuclear fusion technology is still being considered as a ... used in nuclear warfare. Since research in nuclear fusion for the production of energy started abou...

Ricardo Guerrero-Lemus; José Manuel Martínez-Duart

2013-01-01T23:59:59.000Z

282

Nuclear Nonproliferation  

NLE Websites -- All DOE Office Websites (Extended Search)

Nuclear Nonproliferation As more countries embrace nuclear power as a cost-effective and clean alternative to fossil fuels, the need exists to ensure that the nuclear fuel cycle is...

283

Nuclear Engineering Nuclear Criticality Safety  

E-Print Network (OSTI)

Nuclear Engineering Nuclear Criticality Safety The Nuclear Engineering Division (NE) of Argonne National Laboratory is experienced in performing criticality safety and shielding evaluations for nuclear, and neutron spectra. The NE nuclear criticality safety (NCS) capabilities are based on a staff with decades

Kemner, Ken

284

COLLOQUIUM - NOTE SPECIAL TIME OF 3:15PM: Savannah River National  

NLE Websites -- All DOE Office Websites (Extended Search)

May 15, 2013, 3:15pm to 5:30pm May 15, 2013, 3:15pm to 5:30pm Colloquia MBG Auditorium COLLOQUIUM - NOTE SPECIAL TIME OF 3:15PM: Savannah River National Laboratory: Underpinning Critical National Missions Dr. Jeff Griffin Savannah River National Laboratory The Cold War mission of the Savannah River Site in South Carolina was to produce nuclear materials for the national defense. Since the Cold War ended, SRS has continued to ensure United States national and energy security while cleaning up the environmental legacy from nuclear materials production. Throughout the history of SRS, the Savannah River National Laboratory has developed the processes to successfully accomplish the site's missions. SRNL is a multi-program laboratory dedicated to addressing the nation's present and future challenges in National Security, Clean Energy, and

285

Human scenarios for the screening assessment. Columbia River Comprehensive Impact Assessment  

SciTech Connect

Because of past nuclear production operations along the Columbia River, there is intense public and tribal interest in assessing any residual Hanford Site related contamination along the river from the Hanford Reach to the Pacific Ocean. The Columbia River Impact Assessment (CRCIA) was proposed to address these concerns. The assessment of the Columbia River is being conducted in phases. The initial phase is a screening assessment of risk, which addresses current environmental conditions for a range of potential uses. One component of the screening assessment estimates the risk from contaminants in the Columbia River to humans. Because humans affected by the Columbia river are involved in a wide range of activities, various scenarios have been developed on which to base the risk assessments. The scenarios illustrate the range of activities possible by members of the public coming in contact with the Columbia River so that the impact of contaminants in the river on human health can be assessed. Each scenario illustrates particular activity patterns by a specific group. Risk will be assessed at the screening level for each scenario. This report defines the scenarios and the exposure factors that will be the basis for estimating the potential range of risk to human health from Hanford-derived radioactive as well as non-radioactive contaminants associated with the Columbia River.

Napier, B.A.; Harper, B.L.; Lane, N.K.; Strenge, D.L.; Spivey, R.B.

1996-03-01T23:59:59.000Z

286

Compositions and methods for treating nuclear fuel  

DOE Patents (OSTI)

Compositions are provided that include nuclear fuel. Methods for treating nuclear fuel are provided which can include exposing the fuel to a carbonate-peroxide solution. Methods can also include exposing the fuel to an ammonium solution. Methods for acquiring molybdenum from a uranium comprising material are provided.

Soderquist, Chuck Z; Johnsen, Amanda M; McNamara, Bruce K; Hanson, Brady D; Smith, Steven C; Peper, Shane M

2013-08-13T23:59:59.000Z

287

Compositions and methods for treating nuclear fuel  

DOE Patents (OSTI)

Compositions are provided that include nuclear fuel. Methods for treating nuclear fuel are provided which can include exposing the fuel to a carbonate-peroxide solution. Methods can also include exposing the fuel to an ammonium solution. Methods for acquiring molybdenum from a uranium comprising material are provided.

Soderquist, Chuck Z; Johnsen, Amanda M; McNamara, Bruce K; Hanson, Brady D; Smith, Steven C; Peper, Shane M

2014-01-28T23:59:59.000Z

288

NUCLEAR REACTORS.  

E-Print Network (OSTI)

??Nuclear reactors are devices containing fissionable material in sufficient quantity and so arranged as to be capable of maintaining a controlled, self-sustaining NUCLEAR FISSION chain… (more)

Belachew, Dessalegn

2010-01-01T23:59:59.000Z

289

nuclear reactor  

Science Journals Connector (OSTI)

...a complex atomic apparatus used to obtain energy from nuclear fission chain reaction. Used to produce nuclear energy, radioactive isotopes, and artificial elements.... atomic pile ...

2009-01-01T23:59:59.000Z

290

Nuclear Energy  

NLE Websites -- All DOE Office Websites (Extended Search)

Nuclear Energy Idaho National Laboratory is the Department of Energy's lead nuclear energy research and development facility. Building upon its legacy responsibilities,...

291

Nuclear Hydrogen  

NLE Websites -- All DOE Office Websites (Extended Search)

Error Error Nuclear Hydrogen - RCC cannot be displayed due to a timeout error. We recommend: * Refresh Nuclear Hydrogen - RCC * Increasing your portlet timeout setting. *...

292

Nuclear Physics  

NLE Websites -- All DOE Office Websites (Extended Search)

Underground Research Facility in South Dakota, which will search for neutrinoless double-beta decay. Strong Los Alamos programs in nuclear data and nuclear theory supports...

293

State and Local Solution Center: Financing Solutions  

NLE Websites -- All DOE Office Websites (Extended Search)

Technical Assistance Technical Assistance Resources Printable Version Share this resource Send a link to State and Local Solution Center: Financing Solutions to someone by E-mail Share State and Local Solution Center: Financing Solutions on Facebook Tweet about State and Local Solution Center: Financing Solutions on Twitter Bookmark State and Local Solution Center: Financing Solutions on Google Bookmark State and Local Solution Center: Financing Solutions on Delicious Rank State and Local Solution Center: Financing Solutions on Digg Find More places to share State and Local Solution Center: Financing Solutions on AddThis.com... Strategic Energy Planning Energy Policies & Programs Financing Financing Overview Financing Program Market Segments Energy Data Management Energy Technologies

294

Westinghouse independent safety review of Savannah River production reactors  

SciTech Connect

Westinghouse Electric Corporation has performed a safety assessment of the Savannah River production reactors (K,L, and P) as requested by the US Department of Energy. This assessment was performed between November 1, 1988, and April 1, 1989, under the transition contract for the Westinghouse Savannah River Company's preparations to succeed E.I. du Pont de Nemours Company as the US Department of Energy contractor for the Savannah River Project. The reviewers were drawn from several Westinghouse nuclear energy organizations, embody a combination of commercial and government reactor experience, and have backgrounds covering the range of technologies relevant to assessing nuclear safety. The report presents the rationale from which the overall judgment was drawn and the basis for the committee's opinion on the phased restart strategy proposed by E.I. du Pont de Nemours Company, Westinghouse, and the US Department of Energy-Savannah River. The committee concluded that it could recommend restart of one reactor at partial power upon completion of a list of recommended upgrades both to systems and their supporting analyses and after demonstration that the organization had assimilated the massive changes it will have undergone.

Leggett, W.D.; McShane, W.J. (Westinghouse Hanford Co., Richland, WA (USA)); Liparulo, N.J.; McAdoo, J.D.; Strawbridge, L.E. (Westinghouse Electric Corp., Pittsburgh, PA (USA). Nuclear and Advanced Technology Div.); Toto, G. (Westinghouse Electric Corp., Pittsburgh, PA (USA). Nuclear Services Div.); Fauske, H.K. (Fauske and Associates, Inc., Burr Ridge, IL (USA)); Call, D.W. (Westinghouse Savannah R

1989-04-01T23:59:59.000Z

295

Faces of the Recovery Act: Jobs at Savannah River Site | Department of  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

the Recovery Act: Jobs at Savannah River Site the Recovery Act: Jobs at Savannah River Site Faces of the Recovery Act: Jobs at Savannah River Site October 30, 2009 - 3:35pm Addthis The Savannah River Site in Aiken, South Carolina has been able to create/save thousands of jobs through the Recovery Act. These are the stories of just a few of their new hires. Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs Hear from some of the Recovery Act hires at the Energy Department's Savannah River Site in Aiken, South Carolina. These are just a few of the jobs funded by the Recovery Act to accelerate the cleanup of the former nuclear weapons research site and make the site safe for future generations. Addthis Related Articles Deputy Secretary Poneman: Recovery Act Putting Americans to Work and

296

Estimating Fire Risks at Industrial Nuclear Facilities  

SciTech Connect

The Savannah River Site (SRS) has a wide variety of nuclear production facilities that include chemical processing facilities, machine shops, production reactors, and laboratories. Current safety documentation must be maintained for the nuclear facilities at SRS. Fire Risk Analyses (FRAs) are used to support the safety documentation basis. These FRAs present the frequency that specified radiological and chemical consequences will be exceeded. The consequence values are based on mechanistic models assuming specific fire protection features fail to function as designed.

Coutts, D.A.

1999-07-12T23:59:59.000Z

297

Nuclear Matter and Nuclear Dynamics  

E-Print Network (OSTI)

Highlights on the recent research activity, carried out by the Italian Community involved in the "Nuclear Matter and Nuclear Dynamics" field, will be presented.

M Colonna

2009-02-26T23:59:59.000Z

298

Susquehanna River Basin Compact (Maryland)  

Energy.gov (U.S. Department of Energy (DOE))

This legislation enables the state's entrance into the Susquehanna River Basin Compact, which provides for the conservation, development, and administration of the water resources of the...

299

Food production and consumption near the Savannah River Site  

SciTech Connect

Routine operations at the Savannah River Site (SRS) result in the release of radionuclides to the atmosphere and to the Savannah River. The resulting radiological doses to the off-site maximum individual and the 80-km population are estimated on a yearly basis. These estimates are generated using dose models prescribed in the NRC Reg. Guide 1.109 for the commercial nuclear power industry. A study of land and water usage characteristics in the region of the Savannah River Site has been conducted to determine site-specific values of the NRC dose model parameters. The study's scope included local characteristics of meat, milk, vegetable production; Savannah River recreational activities and fish harvests; meat, milk, vegetable, and seafood consumption rates; and Savannah River drinking-water populations. Average and maximum consumption rates of beef, milk, vegetables, and fish have been determined for individuals residing in the southern United States. The study suggest that many of the consumption rates provided by the NRC may not be appropriate for residents of the South. Average consumption rates are slightly higher than the defaults provided by the NRC. Maximum consumption rates, however, are typically lower than NRC values. Agricultural productivity in the SRS region was found to be quite different than NRC recommendations. Off-site doses have been predicted using both NRC and SRS parameter values to demonstrate the significance of site-specific data.

Hamby, D.M.

1991-01-01T23:59:59.000Z

300

Food production and consumption near the Savannah River Site  

SciTech Connect

Routine operations at the Savannah River Site (SRS) result in the release of radionuclides to the atmosphere and to the Savannah River. The resulting radiological doses to the off-site maximum individual and the 80-km population are estimated on a yearly basis. These estimates are generated using dose models prescribed in the NRC Reg. Guide 1.109 for the commercial nuclear power industry. A study of land and water usage characteristics in the region of the Savannah River Site has been conducted to determine site-specific values of the NRC dose model parameters. The study`s scope included local characteristics of meat, milk, vegetable production; Savannah River recreational activities and fish harvests; meat, milk, vegetable, and seafood consumption rates; and Savannah River drinking-water populations. Average and maximum consumption rates of beef, milk, vegetables, and fish have been determined for individuals residing in the southern United States. The study suggest that many of the consumption rates provided by the NRC may not be appropriate for residents of the South. Average consumption rates are slightly higher than the defaults provided by the NRC. Maximum consumption rates, however, are typically lower than NRC values. Agricultural productivity in the SRS region was found to be quite different than NRC recommendations. Off-site doses have been predicted using both NRC and SRS parameter values to demonstrate the significance of site-specific data.

Hamby, D.M.

1991-12-31T23:59:59.000Z

Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

Limits on Nuclear Materials for Arms Reduction: Complexities and Uncerainties  

Science Journals Connector (OSTI)

...there is little risk because the United...would ignore the nuclear materials production...capability ofthe Soviet power reactors and the...Savannah River Plant (SRP) reactors...U.S. would risk its national security...reactors at full power is not attractive...concomitant ban on nuclear tests would perpetuate...

W. G. SUTCLIFFE

1988-09-02T23:59:59.000Z

302

Limits on Nuclear Materials for Arms Reduction: Complexities and Uncerainties  

Science Journals Connector (OSTI)

...is little risk because the...ignore the nuclear materials...ofthe Soviet power reactors...Savannah River Plant (SRP) reactors...S. would risk its national security in this way...reactors at full power is not attractive...concomitant ban on nuclear tests would...

W. G. SUTCLIFFE

1988-09-02T23:59:59.000Z

303

DOE Selects Washington River Protection Solutions, LLC for Tank...  

Energy Savers (EERE)

Plateau. The scope of the tank operations contract includes base operations of the tanks, analytical laboratory support, single-shell tank retrieval and closure, Waste...

304

Consent Order, Washington River Protection Solutions, LLC - NCO...  

Office of Environmental Management (EM)

LLC - NCO-2011-01 More Documents & Publications Consent Order, Battelle Energy Alliance, LLC - NCO-2010-04 Consent Order, URS Energy & Construction, Inc. - NCO-2011-02...

305

Chapter 7 - Nuclear Energy  

Science Journals Connector (OSTI)

Abstract Nuclear energy grew rapidly during the 1960–1975 period in countries such as France, the United States, and Norway. But nuclear energy ran into problems in the 1970s because of public concern over the radioactive waste it generates, and this concern suppressed the further expansion of nuclear power. The public perception had begun to change in recent years, as concern about atmospheric carbon dioxide levels led to a renewed interest in energy sources not reliant on hydrocarbons. But, in 2010, a tsunami in Japan led to an accident at the Fukushima nuclear power plant, and the ensuing release of radioactive materials once again raised concerns about safety. At the same time, limited supplies of uranium have caused the price of that fuel material to go up. The solution to the shortage and resulting price increase is fast breeder reactors that use both uranium and thorium fuels. Unfortunately, this technology has not yet been perfected and commercialized.

Brian F. Towler

2014-01-01T23:59:59.000Z

306

RIVER RESEARCH AND APPLICATIONS River Res. Applic. 21: 849864 (2005)  

E-Print Network (OSTI)

to assimilate wastewater treatment plant effluent. Our study illustrates the types of changes that river of future climate scenarios on flow regimes and how predicted changes might affect river ecosystems. We under future climate scenarios to describe the extent and type of changes predicted to occur. Daily

Poff, N. LeRoy

307

Nuclear choices  

SciTech Connect

This book contains part of the series New Liberal Arts, which is intended to make science and technology more accessible to students of the liberal arts. Volume in hand provides a comprehensive, multifaceted examination of nuclear energy, in nontechnical terms. Wolfson explains the basics of nuclear energy and radiation, nuclear power..., and nuclear weapons..., and he invites readers to make their own judgments on controversial nuclear issues. Illustrated with photos and diagrams. Each chapter contains suggestions for additional reading and a glossary. For policy, science, and general collections in all libraries. (ES) Topics contained include Atoms and nuclei. Effects and uses of radiation. Energy and People. Reactor safety. Nuclear strategy. Defense in the nuclear age. Nuclear power, nuclear weapons, and nuclear futures.

Wolfson, R.

1991-01-01T23:59:59.000Z

308

Categorical Exclusion Determinations: Office of River Protection-Richland  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

14, 2012 14, 2012 CX-009693: Categorical Exclusion Determination CH2MHill Plateau Remediation Company - Site Characterization and Environmental Monitoring, December 2012 to December 2013 CX(s) Applied: B3.1 Date: 12/14/2012 Location(s): Washington Offices(s): River Protection-Richland Operations Office December 14, 2012 CX-009692: Categorical Exclusion Determination CH2MHill Plateau Remediation Company - Cleanup Actions, December 2012 to December 2013 CX(s) Applied: B6.1 Date: 12/14/2012 Location(s): Washington Offices(s): River Protection-Richland Operations Office December 14, 2012 CX-009673: Categorical Exclusion Determination Washington River Protection Solutions LLC - Facility Safety and Environmental Improvements CX(s) Applied: B2.5 Date: 12/14/2012 Location(s): Washington

309

Bubblers Speed Nuclear Waste Processing at SRS  

ScienceCinema (OSTI)

At the Department of Energy's Savannah River Site, American Recovery and Reinvestment Act funding has supported installation of bubbler technology and related enhancements in the Defense Waste Processing Facility (DWPF). The improvements will accelerate the processing of radioactive waste into a safe, stable form for storage and permit expedited closure of underground waste tanks holding 37 million gallons of liquid nuclear waste.

None

2014-08-06T23:59:59.000Z

310

Bubblers Speed Nuclear Waste Processing at SRS  

SciTech Connect

At the Department of Energy's Savannah River Site, American Recovery and Reinvestment Act funding has supported installation of bubbler technology and related enhancements in the Defense Waste Processing Facility (DWPF). The improvements will accelerate the processing of radioactive waste into a safe, stable form for storage and permit expedited closure of underground waste tanks holding 37 million gallons of liquid nuclear waste.

None

2010-11-14T23:59:59.000Z

311

Enforcement Letter, Westinghouse Savannah River Company- November 14, 2003  

Energy.gov (U.S. Department of Energy (DOE))

Issued to Westinghouse Savannah River Company related to Criticality Safety Violations at the Savannah River Site

312

Enforcement Letter, Westinghouse Savannah River Company- April 19, 2004  

Energy.gov (U.S. Department of Energy (DOE))

Issued to Westinghouse Savannah River Company related to Employee Reprisal at the Savannah River Site

313

Environmental Stewardship at the Savannah River Site: Generations of Success - 13212  

SciTech Connect

Approximately sixty years ago, the Savannah River Site (SRS) was built to produce nuclear materials. SRS production operations impacted air, soil, groundwater, ecology, and the local environment. Throughout its history, SRS has addressed these contamination issues directly and has maintained a commitment to environmental stewardship. The Site boasts many environmental firsts. Notably, SRS was the first major Department of Energy (DOE) facility to perform a baseline ecological assessment. This pioneering effort, by Ruth Patrick and the Philadelphia Academy of Sciences, was performed during SRS planning and construction in the early 1950's. This unique early generation of work set the stage for subsequent efforts. Since that time, the scientists and engineers at SRS pro-actively identified environmental problems and developed and implemented effective and efficient environmental management and remediation solutions. This second generation, spanning the 1980's through the 2000's, is exemplified by numerous large and small cleanup actions to address metals and radionuclides, solvents and hydrocarbons, facility and area decommissioning, and ecological restoration. Recently, a third generation of environmental management was initiated as part of Enterprise SRS. This initiative to 'Develop and Deploy Next Generation Cleanup Technologies' formalizes and organizes the major technology matching, development, and implementation processes associated with historical SRS cleanup success as a resource to support future environmental management missions throughout DOE. The four elements of the current, third generation, effort relate to: 1) transition from active to passive cleanup, 2) in situ decommissioning of large nuclear facilities, 3) new long term monitoring paradigms, and 4) a major case study related to support for recovery and restoration of the Japanese Fukushima-Daiichi nuclear power plant and surrounding environment. (authors)

Looney, Brian B.; Bergren, Christopher L.; Gaughan, Thomas F.; Aylward, Robert S.; Guevara, Karen C.; Whitaker, Wade C.; Hennessey, Brian T.; Mills, Gary L.; Blake, John I. [Savannah River Site, Aiken SC 29808, 773-42A (United States)] [Savannah River Site, Aiken SC 29808, 773-42A (United States)

2013-07-01T23:59:59.000Z

314

RIVER PROTECTION PROJECT SYSTEM PLAN  

SciTech Connect

The U.S. Department of Energy (DOE), Office of River Protection (ORP) manages the River Protection Project (RPP). The RPP mission is to retrieve and treat Hanford's tank waste and close the tank farms to protect the Columbia River. As a result, the ORP is responsible for the retrieval, treatment, and disposal of the approximately 57 million gallons of radioactive waste contained in the Hanford Site waste tanks and closure of all the tanks and associated facilities. The previous revision of the System Plan was issued in September 2003. ORP has approved a number of changes to the tank waste treatment strategy and plans since the last revision of this document, and additional changes are under consideration. The ORP has established contracts to implement this strategy to establish a basic capability to complete the overall mission. The current strategy for completion of the mission uses a number of interrelated activities. The ORP will reduce risk to the environment posed by tank wastes by: (1) Retrieving the waste from the single-shell tanks (SST) to double-shell tanks (DST) for treatment and disposal; (2) Constructing and operating the WTP, which will safely treat all of the high-level waste (HLW) and about half of the low-activity waste (LAW) contained in the tank farms, and maximizing its capability and capacity; (3) Developing and deploying supplemental treatment capability or a second WTP LAW Facility that can safely treat about half of the LAW contained in the tank farms; (4) Developing and deploying treatment and packaging capability for transuranic (TRU) tank waste for shipment to and disposal at the Waste Isolation Pilot Plant (WIPP); (5) Deploying interim storage capacity for the immobilized HLW and shipping that waste to Yucca Mountain for disposal; (6) Operating the Integrated Disposal Facility for the disposal of immobilized LAW, along with the associated secondary waste, (7) Closing the SST and DST tank farms, ancillary facilities, and al1 waste management and treatment facilities, (8) Developing and implementing technical solutions to mitigate the impact from substantial1y increased estimates of Na added during the pretreatment of the tank waste solids, This involves a combination of: (1) refining or modifying the flowsheet to reduce the required amount of additional sodium, (2) increasing the overall LAW vitrification capacity, (3) increasing the incorporation of sodium into the LAW glass, or (4) accepting an increase in mission duration, ORP has made and continues to make modifications to the WTP contract as needed to improve projected plant performance and address known or emerging risks, Key elements of the implementation of this strategy are included within the scope of the Tank Operations Contract, currently in procurement Since 2003, the ORP has conducted over 30 design oversight assessments of the Waste Treatment and Immobilization Plant (WTP). The estimated cost at completion has increased and the schedule for construction and commissioning of the WTP has extended, The DOE, Office of Environmental Management (EM), sanctioned a comprehensive review of the WTP flowsheet, focusing on throughput. In 2005, the TFC completed interim stabilization of the SSTs and as of March 2007, has completed the retrieval of seven selected SSTs. Demonstration of supplemental treatment technologies continues. The ongoing tank waste retrieval experience, progress with supplemental treatment technologies, and changes in WTP schedule led to the FY 2007 TFC baseline submittal in November 2006. The TFC baseline submittal was developed before the WTP schedule was fully understood and approved by ORP, and therefore reflects an earlier start date for the WTP facilities. This System Plan is aligned with the current WTP schedule with hot commissioning beginning in 2018 and full operations beginning in 2019. Major decisions regarding the use of supplemental treatment and the associated technology, the ultimate needed capacity, and its relationship to the WTP have not yet been finalized. This System Plan assumes that the outcome of

CERTA PJ

2008-07-10T23:59:59.000Z

315

Pennsylvania Scenic Rivers Program | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Pennsylvania Scenic Rivers Program Pennsylvania Scenic Rivers Program Pennsylvania Scenic Rivers Program < Back Eligibility Utility Commercial Agricultural Investor-Owned Utility State/Provincial Govt Industrial Construction Municipal/Public Utility Local Government Rural Electric Cooperative Transportation Savings Category Buying & Making Electricity Water Home Weatherization Solar Wind Program Info State Pennsylvania Program Type Environmental Regulations Siting and Permitting Provider Pennsylvania Department of Conservation and Natural Resources Rivers included in the Scenic Rivers System will be classified, designated and administered as Wild, Scenic, Pastoral, Recreational and Modified Recreational Rivers (Sections 4; (a) (1) of the Pennsylvania Scenic Rivers Act). Low dams are permitted on Modified Recreational Rivers, but are not

316

NERPs Definition | Savannah River National Environmental Park  

NLE Websites -- All DOE Office Websites (Extended Search)

NERPS: Idaho, Hanford, Los Alamos, Oak Ridge, Fermilab, Nevada, and Savannah River. The Savannah River Site became the first NERP in 1972. Unlike National Parks, NERPs provide a...

317

Overview | Savannah River National Environmental Park  

NLE Websites -- All DOE Office Websites (Extended Search)

Ecology Laboratory (SREL), USDA Forest Service - Savannah River (USFS-SR), and Savannah River National Laboratory (SRNL). As a research unit of UGA, SREL's primary function is...

318

Independent Oversight Review, Savannah River Operations Office...  

Energy Savers (EERE)

Savannah River Operations Office - July 2013 Independent Oversight Review, Savannah River Operations Office - July 2013 July 2013 Review of the Employee Concerns Program at the...

319

Independent Activity Report, Savannah River Operation - June...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Operation - June 2010 Independent Activity Report, Savannah River Operation - June 2010 June 2010 Savannah River Operations Office Self-Assessment of the Technical Qualification...

320

Independent Activity Report, Savannah River Site - September...  

Office of Environmental Management (EM)

September 2010 Independent Activity Report, Savannah River Site - September 2010 Savannah River Site Salt Waste Processing Facility Effectiveness Review The U.S. Department of...

Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

Independent Activity Report, Savannah River Remediation - July...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Remediation - July 2010 Independent Activity Report, Savannah River Remediation - July 2010 July 2010 Savannah River Operations Office Integrated Safety Management System Phase II...

322

Independent Oversight Inspection, Savannah River Site, Summary...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Savannah River Site, Summary Report - February 2004 February 2004 Inspection of Environment, Safety, and Health Management and Emergency Management at the Savannah River Site...

323

EIS-0147: Continued Operation of the K-,L-, and P- Reactors, Savannah River Site, Aiken, South Carolina  

Energy.gov (U.S. Department of Energy (DOE))

This environmental impact statement (EIS) analyzes the environmental impacts of the proposed action, which is to continue operation of K-, L-, and P-Reactors at the Savannah River Site (SRS) to ensure the capability to produce nuclear materials, and to produce nuclear materials as necessary for United States defense and nondefense programs.

324

An Adaptive, Consent-Based Path to Nuclear Waste Storage and...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

An Adaptive, Consent-Based Path to Nuclear Waste Storage and Disposal Solutions An Adaptive, Consent-Based Path to Nuclear Waste Storage and Disposal Solutions February 12, 2014 -...

325

Numerical Simulation of Flood Levels for Tropical Rivers  

Science Journals Connector (OSTI)

Flood forecasting is important for flood damage reduction. As a result of advances in the numerical methods and computer technologies, many mathematical models have been developed and used for hydraulic simulation of the flood. These simulations usually include the prediction of the flood width and depth along a watercourse. Results obtained from the application of hydraulic models will help engineers to take precautionary measures to minimize flood damage. Hydraulic models were used to simulate the flood can be classified into dynamic hydraulic models and static hydraulic models. The HEC-2 static hydraulic model was used to predict water surface profiles for Linggi river and Langat river in Malaysia. The model is based on the numerical solution of the one dimensional energy equation of the steady gradually varied flow using the iteration technique. Calibration and verification of the HEC-2 model were conducted using the recorded data for both rivers. After calibration, the model was applied to predict the water surface profiles for Q10, Q30, and Q100 along the watercourse of the Linggi river. The water surface profile for Q200 for Langat river was predicted. The predicted water surface profiles were found in agreement with the recorded water surface profiles. The value of the maximum computed absolute error in the predicted water surface profile was found to be 500 mm while the minimum absolute error was 20 mm only.

Thamer Ahmed Mohammed; Salim Said; Mohd Zohadie Bardaie; Shah Nor Basri

2011-01-01T23:59:59.000Z

326

defense nuclear security | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

nuclear security | National Nuclear Security Administration People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response...

327

Chernobyl Nuclear Accident | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

Chernobyl Nuclear Accident | National Nuclear Security Administration People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response...

328

Countering Nuclear Terrorism and Trafficking | National Nuclear...  

National Nuclear Security Administration (NNSA)

Countering Nuclear Terrorism and Trafficking | National Nuclear Security Administration People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...

329

Savannah River site environmental report for 1996  

SciTech Connect

The mission at the Savannah River Site (SRS) has changed from the production of nuclear weapons materials for national defense to the management of site-generated waste, restoration of the surrounding environment, and the development of industry in and around the site. However, SRS-through its prime operating contractor, Westinghouse Savannah River Company (WSRC)-continues to maintain a comprehensive environmental monitoring program. In 1996, effluent monitoring and environmental surveillance were conducted within a 31,000-square-mile area in and around SRS that includes neighboring cities, towns, and counties in Georgia and South Carolina and extends up to 100 miles from the site. Though the environmental monitoring program was streamlined in 1996-to improve its cost-effectiveness without compromising data quality or reducing its overall ability to produce critical information-thousands of samples of air, surface water, groundwater, food products, drinking water, wildlife, rainwater, soil, sediment, and vegetation were collected and analyzed for radioactive and nonradioactive contaminants.

Arnett, M.; Mamatey, A. [eds.

1998-12-31T23:59:59.000Z

330

Savannah River Site Environmental Report for 1994  

SciTech Connect

The mission at the Savannah River Site has changed from producing nuclear weapons materials for national defense to managing the waste it has generated, restoring the environment, and enhancing industrial development in and around the site. But no matter what the site`s mission is, it will continue to maintain its comprehensive environmental monitoring and surveillance program. In 1994, effluent monitoring and environmental surveillance were conducted within a 30,000-square-mile area in and around SRS that includes neighboring cities, towns, and counties in Georgia and South Carolina and extends up to 100 miles from the site. Thousands of samples of air, surface water, groundwater, foodstuffs, drinking water, wildlife, rainwater, soil, sediment, and vegetation were collected and analyzed for radioactive and nonradioactive contaminants.

Arnett, M.W.; Mamatey, A.; Spitzer, D.

1994-12-16T23:59:59.000Z

331

ELECTRONICS UPGRADE TO THE SAVANNAH RIVER NATIONAL LABORATORY COULOMETER FOR PLUTONIUM AND NEPTUNIUM ASSAY  

SciTech Connect

The Savannah River Site (SRS) has the analytical measurement capability to perform high-precision plutonium concentration measurements by controlled-potential coulometry. State-of-the-art controlled-potential coulometers were designed and fabricated by the Savannah River National Laboratory and installed in the Analytical Laboratories process control laboratory. The Analytical Laboratories uses coulometry for routine accountability measurements of and for verification of standard preparations used to calibrate other plutonium measurement systems routinely applied to process control, nuclear safety, and other accountability applications. The SRNL Coulometer has a demonstrated measurement reliability of {approx}0.05% for 10 mg samples. The system has also been applied to the characterization of neptunium standard solutions with a comparable reliability. The SRNL coulometer features: a patented current integration system; continuous electrical calibration versus Faraday's Constants and Ohm's Law; the control-potential adjustment technique for enhanced application of the Nernst Equation; a wide operating room temperature range; and a fully automated instrument control and data acquisition capability. Systems have been supplied to the International Atomic Energy Agency (IAEA), Russia, Japanese Atomic Energy Agency (JAEA) and the New Brunswick Laboratory (NBL). The most recent vintage of electronics was based on early 1990's integrated circuits. Many of the components are no longer available. At the request of the IAEA and the Department of State, SRNL has completed an electronics upgrade of their controlled-potential coulometer design. Three systems have built with the new design, one for the IAEA which was installed at SAL in May 2011, one system for Los Alamos National Laboratory, (LANL) and one for the SRS Analytical Laboratory. The LANL and SRS systems are undergoing startup testing with installation scheduled for this summer.

Cordaro, J.; Holland, M.; Reeves, G.; Nichols, S.; Kruzner, A.

2011-07-08T23:59:59.000Z

332

Savannah River Site Homepage  

NLE Websites -- All DOE Office Websites (Extended Search)

7/2014 7/2014 SEARCH GO News Releases Video Releases Upcoming Events 12.31.13 Dr. Sam Fink Earns Donald Orth Lifetime Achievement Award 12.31.13 Savannah River Remediation Issues Fiscal Year 2013 Annual Report 12.18.13 Prototype System Brings Advantages of Wireless Technology to Secure Environment CLICK HERE FOR ADDITIONAL NEWS RELEASES CLICK HERE for our email news service, govDELIVERY 2013 PMI Project of the Year Award - Click to play on YouTube 2013 PMI Project of the Year Award Finalist: SRS Recovery Act Project PLAY VIDEO CLICK HERE FOR ADDITIONAL VIDEO RELEASES Enterprise.SRS - Safety and Security begin with me! SRS Status & Emergency Information * Cold War Patriot's Resource Fair - Aiken, SC (04.25.13) * 3rd Annual Small Modular Reactor Conference - Columbia, SC (04.16-17.13)

333

Nuclear Science  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Science Science and Engineering Education Sourcebook 2013 American Nuclear Society US Department of Energy Nuclear Science & Engineering Education Sourcebook 2013 North American Edition American Nuclear Society Education, Training, and Workforce Division US Department of Energy Office of Nuclear Energy Editor and Founder John Gilligan Professor of Nuclear Engineering North Carolina State University Version 5.13 Welcome to the 2013 Edition of the Nuclear Science and Engineering Education (NS&EE) Sourcebook. We have evolved and improved! The core mission of the Sourcebook has not changed, however. Our purpose is to facilitate interaction among faculty, students, industry, and government agencies to accomplish nuclear research, teaching and service activities. Since 1986 we have compiled critical information on nuclear

334

Nuclear reactions  

Science Journals Connector (OSTI)

Much reference has been made in the last chapter to nuclear energy levels and their various properties (e.g ... ways of doing this — the use of nuclear reactions, and studies of how excited nuclei...

R. J. Blin-Stoyle FRS

1991-01-01T23:59:59.000Z

335

nuclear security  

National Nuclear Security Administration (NNSA)

3%2A en Shaping the future of nuclear detection http:nnsa.energy.govblogshaping-future-nuclear-detection

336

Wood River Levee Reconstruction, Madison County, IL  

E-Print Network (OSTI)

Wood River Levee Reconstruction, Madison County, IL 25 October 2006 Abstract: The recommended plan provides for flood damage reduction and restores the original degree of protection of the Wood River Levee-federal sponsor is the Wood River Drainage and Levee District. The Wood River Levee System was authorized

US Army Corps of Engineers

337

The Columbia River Estuary the Columbia River Basin  

E-Print Network (OSTI)

" fish and wildlife in the Columbia River as affected by development and operation of the hydroelectric modified in terms of physical and biological processes. The development and operation of the hydroelectric

338

Nuclear Ukraine  

Science Journals Connector (OSTI)

... SIR - Your article (Nature 365, 599; 1993) on the US-Ukraine stalemate over nuclear weapons prompts the following remarks. The United States made a mistake ... nuclear weapons prompts the following remarks. The United States made a mistake in not recognizing Ukraine as a legitimate successor state to the Soviet nuclear arsenal and is still insisting that ...

Arno Arrak

1994-01-13T23:59:59.000Z

339

SAVANNAH RIVER SITE A PUIIUCATION OF THE SAVANNAII RIVER ECOI"OGY LAIIORATORY  

E-Print Network (OSTI)

OF THE SAVANNAH RIVER SITE A PUIIUCATION OF THE SAVANNAII RIVER ECOI"OGY LAIIORATORY NATIONAL of the Savannah River Site National Environmental Research Park Program Publication number: SRO-NERP-2S Printed OF THE SAVANNAH RIVER SITE BY CHARLES E. DAVIS AND LAURA L. JANECEK A PUBLICATION OF THE SAVANNAH RIVER SITE

Georgia, University of

340

Nuclear Engineer (Nuclear Safety Specialist)  

Energy.gov (U.S. Department of Energy (DOE))

A successful candidate of this position will serve as a Nuclear Engineer (Nuclear Safety Specialist) responsible for day-to-day technical monitoring, and evaluation of aspects of authorization...

Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

SRS Completes Annual Examinations to Verify Safe Storage of Nuclear Materials  

Energy.gov (U.S. Department of Energy (DOE))

AIKEN, S.C. – The EM program at the Savannah River Site (SRS) recently completed an annual process in K Area that validates the site’s ongoing commitment to maintaining the safety and security of nuclear materials stored there.

342

Enhancing nuclear power safety  

Science Journals Connector (OSTI)

Through its ClydeUnion Pumps brand, SPX has a long history of providing pumps to the nuclear power industry and is working to help provide solutions that enhance vital safety systems on these plants. Compared with traditional alternatives, its TWL steam turbine driven pump is designed to increase the reliability of systems that provide heat removal from pressurised water reactors and boiling water reactors during extended emergency periods.

2014-01-01T23:59:59.000Z

343

Nuclear materials management storage study  

SciTech Connect

The Office of Weapons and Materials Planning (DP-27) requested the Planning Support Group (PSG) at the Savannah River Site to help coordinate a Departmental complex-wide nuclear materials storage study. This study will support the development of management strategies and plans until Defense Programs` Complex 21 is operational by DOE organizations that have direct interest/concerns about or responsibilities for nuclear material storage. They include the Materials Planning Division (DP-273) of DP-27, the Office of the Deputy Assistant Secretary for Facilities (DP-60), the Office of Weapons Complex Reconfiguration (DP-40), and other program areas, including Environmental Restoration and Waste Management (EM). To facilitate data collection, a questionnaire was developed and issued to nuclear materials custodian sites soliciting information on nuclear materials characteristics, storage plans, issues, etc. Sites were asked to functionally group materials identified in DOE Order 5660.1A (Management of Nuclear Materials) based on common physical and chemical characteristics and common material management strategies and to relate these groupings to Nuclear Materials Management Safeguards and Security (NMMSS) records. A database was constructed using 843 storage records from 70 responding sites. The database and an initial report summarizing storage issues were issued to participating Field Offices and DP-27 for comment. This report presents the background for the Storage Study and an initial, unclassified summary of storage issues and concerns identified by the sites.

Becker, G.W. Jr.

1994-02-01T23:59:59.000Z

344

Caney River | Open Energy Information  

Open Energy Info (EERE)

River River Jump to: navigation, search Name Caney River Facility Caney River Sector Wind energy Facility Type Commercial Scale Wind Facility Status In Service Owner Enel Green Power North America Inc. Developer Tradewind Energy LLC Energy Purchaser Tennessee Valley Authority Location Elk County KS Coordinates 37.448424°, -96.425027° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":37.448424,"lon":-96.425027,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

345

Marble River | Open Energy Information  

Open Energy Info (EERE)

River River Jump to: navigation, search Name Marble River Facility Marble River Sector Wind energy Facility Type Commercial Scale Wind Facility Status In Service Owner EDP Renewables North America LLC Developer EDP Renewables North America LLC Energy Purchaser Merchant Location Churubusco NY Coordinates 44.9406848°, -73.9303307° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":44.9406848,"lon":-73.9303307,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

346

Missouri River Institute Research Symposium  

E-Print Network (OSTI)

.S. Army Corps of Engineers) Corps of Engineers Outreach and Education Programs 11:00 Dan Catlin (Virginia and Pesticides on Amphibians Along the 59-Mile Reach of the Missouri River Posters from various individuals

Sweeney, Mark R.

347

Nuclear Deterrence  

NLE Websites -- All DOE Office Websites (Extended Search)

Nuclear Deterrence Nuclear Deterrence Nuclear Deterrence LANL's mission is to develop and apply science and technology to ensure the safety, security, and effectiveness of the U.S. nuclear deterrent; reduce global threats; and solve other emerging national security and energy challenges. April 12, 2012 A B-2 Spirit bomber refuels from a KC-135 Stratotanker A B-2 Spirit bomber refuels from a KC-135 Stratotanker. Contact Operator Los Alamos National Laboratory (505) 667-5061 Charlie McMillan, Director: "For the last 70 years there has not been a world war, and I have to think that our strong deterrent has something to do with that fact." Mission nuclear weapons Charlie McMillan, Director of Los Alamos National Laboratory 1:06 Director McMillan on nuclear deterrence While the role and prominence of nuclear weapons in U.S. security policy

348

Two-dimensional river modeling  

E-Print Network (OSTI)

flow conditions. This thesis investigates the application of a recently developed two- dimensional river model system. The microcomputer version of FESWMS-2DH was developed for the Federal Highway Administration by the U. S. Geological Survey. Four... simulations are used to examine the performance of the two- dimensional river modeling system: flow in a simple channel, flow in a strongly curved channel bend, flow in a meandering creek, and flow in Buckhorn Creek, a single opening bridge crossing of a...

Thompson, James Cameron

2012-06-07T23:59:59.000Z

349

Salt Waste Disposal at the Savannah River Site | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Salt Waste Disposal at the Savannah River Site Salt Waste Disposal at the Savannah River Site Salt Waste Disposal at the Savannah River Site Section 3116 of the Ronald W. Reagan National Defense Authorization Act for Fiscal Year 2005 authorizes the Secretary of Energy, in consultation with the Nuclear Regulatory Commission, to reclassify certain waste from reprocessing spent nuclear fuel from high-level waste to low-level waste if it meets the criteria set forth in Section 3116. Currently, DOE SRS has prepared one final (salt waste) and is working on two additional waste determinations: F Tank Farm and H Tank Farm. The Salt Waste Determination has been finalized and the Secretary of Energy issued that determination on January 17, 2006. In 2007, it was decided that due to a new Saltstone disposal vault design,

350

Response of winter birds to soil remediation along the Columbia River at the Hanford Site  

SciTech Connect

The Columbia River at the Hanford Site, located in south-central Washington State, USA, is a regionally important refugium for overwintering birds. Some of the river shoreline has been designated by the U.S. Department of Energy for environmental clean-up following past production of materials for nuclear weapons. We evaluated the effects of soil remediation on winter birds at six inactive nuclear reactor areas. Remediation activities consisted of daily excavation and removal of approximately 1,035 t of contaminated soil from previously herbicided and denuded areas located between 30 m and 400 m and mostly in line-of-sight of the river shoreline. Remediation activities had no apparent effect on numbers of riverine or terrestrial birds using adjacent undisturbed shoreline and riparian habitat.

Becker, James M.; McKinstry, Craig A.

2004-04-01T23:59:59.000Z

351

Faces of the Recovery Act: Jobs at Savannah River Site | Department of  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Jobs at Savannah River Site Jobs at Savannah River Site Faces of the Recovery Act: Jobs at Savannah River Site Addthis Description The Savannah River Site in Aiken, SC has been able to create/save thousands of jobs through the Recovery Act. These are the stories of just a few of the new hires. Speakers Skila Harris, Doug Clark, Bill Picciano, Kelli Culpepper, Nancy Cole, Duration 5:08 Topic Recovery Act Waste Management Nuclear Security & Safety Credit Energy Department Video SKILA HARRIS: We understand the health risks associated with radioactivity much better today than we did 50 years ago. And at the sites where this country was developing its weapons, we were not responsible in how we handled those materials. The recovery act has allowed us to accelerate the clean-up, hire a lot more people so we can

352

Major Cold War Cleanup Milestone Reached at the Savannah River Site |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Major Cold War Cleanup Milestone Reached at the Savannah River Site Major Cold War Cleanup Milestone Reached at the Savannah River Site Major Cold War Cleanup Milestone Reached at the Savannah River Site March 29, 2012 - 10:37am Addthis WASHINGTON, DC - Today, the Energy Department announced it has reached a major milestone in the Department's efforts to clean up the Cold War legacy at the Savannah River Site (SRS) in South Carolina, laying the groundwork for closing two underground storage tanks that previously held radioactive liquid waste from nuclear weapons production at SRS. The determination signed by Energy Secretary Steven Chu paves the way for SRS to begin closing the massive tanks that make up the F Tank Farm. The site will start this year by closing two tanks that pose the greatest risk to the environment - Tanks 18 and 19. These tank closures will be the first

353

Major Cold War Cleanup Milestone Reached at the Savannah River Site |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Major Cold War Cleanup Milestone Reached at the Savannah River Site Major Cold War Cleanup Milestone Reached at the Savannah River Site Major Cold War Cleanup Milestone Reached at the Savannah River Site March 29, 2012 - 10:37am Addthis WASHINGTON, DC - Today, the Energy Department announced it has reached a major milestone in the Department's efforts to clean up the Cold War legacy at the Savannah River Site (SRS) in South Carolina, laying the groundwork for closing two underground storage tanks that previously held radioactive liquid waste from nuclear weapons production at SRS. The determination signed by Energy Secretary Steven Chu paves the way for SRS to begin closing the massive tanks that make up the F Tank Farm. The site will start this year by closing two tanks that pose the greatest risk to the environment - Tanks 18 and 19. These tank closures will be the first

354

EM Celebrates Ribbon Cutting for New Biomass Plant at Savannah River Site |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Celebrates Ribbon Cutting for New Biomass Plant at Savannah Celebrates Ribbon Cutting for New Biomass Plant at Savannah River Site EM Celebrates Ribbon Cutting for New Biomass Plant at Savannah River Site March 1, 2012 - 12:00pm Addthis Pictured from left are Senior Advisor for Environmental Management David Huizenga; DOE Savannah River Operations Office Manager Dave Moody; SRNS Infrastructure Maintenance and Engineering Manager John Stafford; DOE Federal Projects Director Jim DeMass; Under Secretary for Nuclear Security Thomas D’Agostino; DOE-Savannah River Assistant Manager Karen Guevara; Ameresco Federal Programs Director Nicole Bulgarino; Ameresco Executive Vice President Keith Derrington; U.S. Rep. Joe Wilson (R-SC); Ameresco Program Manager Ken Chacey; and Ameresco President and CEO George Sakellaris.

355

Accelerating Solutions  

NLE Websites -- All DOE Office Websites (Extended Search)

Solutions From vehicles on the road to the energy that powers them, Oak Ridge National Laboratory innovations are advancing American transportation. Oak Ridge National Laboratory is making an impact on everyday America by enhancing transportation choices and quality of life. Through strong collaborative partnerships with industry, ORNL research and development efforts are helping accelerate the deployment of a new generation of energy efficient vehicles powered by domestic, renewable, clean energy. EPA ultra-low sulfur diesel fuel rule ORNL and the National Renewable Energy Laboratory co-led a comprehensive research and test program to determine the effects of diesel fuel sulfur on emissions and emission control (catalyst) technology. In the course of this program, involving

356

CRAD, Occupational Safety & Health- Office of River Protection K Basin Sludge Waste System  

Energy.gov (U.S. Department of Energy (DOE))

A section of Appendix C to DOE G 226.1-2 "Federal Line Management Oversight of Department of Energy Nuclear Facilities." Consists of Criteria Review and Approach Documents (CRADs) used for a May 2004 assessment of the Environment, Safety and Health program at the Office of River Protection K Basin Sludge Waste System.

357

CRAD, Engineering- Office of River Protection K Basin Sludge Waste System  

Energy.gov (U.S. Department of Energy (DOE))

A section of Appendix C to DOE G 226.1-2 "Federal Line Management Oversight of Department of Energy Nuclear Facilities." Consists of Criteria Review and Approach Documents (CRADs) used for a May 2004 assessment of the Engineering program at the Office of River Protection K Basin Sludge Waste System.

358

CRAD, Training- Office of River Protection K Basin Sludge Waste System  

Energy.gov (U.S. Department of Energy (DOE))

A section of Appendix C to DOE G 226.1-2 "Federal Line Management Oversight of Department of Energy Nuclear Facilities." Consists of Criteria Review and Approach Documents (CRADs) used for a May 2004 assessment of the Environment, Safety and Health program at the Office of River Protection K Basin Sludge Waste System.

359

CRAD, Emergency Management- Office of River Protection K Basin Sludge Waste System  

Energy.gov (U.S. Department of Energy (DOE))

A section of Appendix C to DOE G 226.1-2 "Federal Line Management Oversight of Department of Energy Nuclear Facilities." Consists of Criteria Review and Approach Documents (CRADs) used for a May 2004 assessment of the Emergency Management program at the Office of River Protection K Basin Sludge Waste System.

360

CRAD, Conduct of Operations- Office of River Protection K Basin Sludge Waste System  

Energy.gov (U.S. Department of Energy (DOE))

A section of Appendix C to DOE G 226.1-2 "Federal Line Management Oversight of Department of Energy Nuclear Facilities." Consists of Criteria Review and Approach Documents (CRADs) used for a May 2004 assessment of the Conduct of Operations program at the Office of River Protection, K Basin Sludge Waste System.

Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

Distributions of selenium, iodine, lead, thorium and uranium in Japanese river waters  

SciTech Connect

Long-lived radionuclides released from nuclear facilities, such as deep underground disposal facilities, could reach humans through several transfer paths in the environment. Uses of ground water and river water for agricultural field irrigation and for drinking water are important paths. In order to understand behavior of long-lived radionuclides in the terrestrial water environment, we carried out a natural analogue study, that is, measurement of selenium (Se), iodine (I), lead (Pb), thorium (Th) and uranium (U) concentrations in 45 Japanese rivers at 10 sampling points from the upper stream to the river mouth for each river. Geometric mean concentrations for Se, I, Pb, Th and U were 0.057, 1.4, 0.039, 0.0055, 0.0109 ng/mL, respectively. Distribution patterns from upper stream to river mouth were different by elements, for instance, the concentrations of I, Th and U increased when the sampling points were nearer the river mouth, while that of Se were almost constant. For Pb, the highest value was observed in the middle part of each river in many cases. (authors)

Tagami, K.; Uchida, S. [National Institute of Radiological Sciences, Chiba (Japan)

2007-07-01T23:59:59.000Z

362

Isotopic Tracking of Hanford 300 Area Derived Uranium in the Columbia River  

SciTech Connect

Our objectives in this study are to quantify the discharge rate of uranium (U) to the Columbia River from the Hanford Site's 300 Area, and to follow that U down river to constrain its fate. Uranium from the Hanford Site has variable isotopic composition due to nuclear industrial processes carried out at the site. This characteristic makes it possible to use high-precision isotopic measurements of U in environmental samples to identify even trace levels of contaminant U, determine its sources, and estimate discharge rates. Our data on river water samples indicate that as much as 3.2 kg/day can enter the Columbia River from the 300 Area, which is only a small fraction of the total load of dissolved natural background U carried by the Columbia River. This very low-level of Hanford derived U can be discerned, despite dilution to < 1 percent of natural background U, 350 km downstream from the Hanford Site. These results indicate that isotopic methods can allow the amounts of U from the 300 Area of the Hanford Site entering the Columbia River to be measured accurately to ascertain whether they are an environmental concern, or are insignificant relative to natural uranium background in the Columbia River.

Christensen, John N.; Dresel, P. Evan; Conrad, Mark E.; Patton, Gregory W.; DePaolo, Donald J.

2010-10-31T23:59:59.000Z

363

Comments of the Lower Colorado River Authority | Department of...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

the Lower Colorado River Authority Comments of the Lower Colorado River Authority Comments of the Lower Colorado River Authority on Implementing the National Broadband Plan by...

364

Flambeau River Papers Makes a Comeback with a Revised Energy...  

Office of Environmental Management (EM)

ITP LEADER Case Study: Flambeau River Papers Makes a Comeback With a Revised Energy Strategy Flambeau River Biofuels Demonstration-Scale Biorefinery FlambeauRiverBiofuels.pdf...

365

ITP LEADER Case Study: Flambeau River Papers Makes a Comeback...  

Office of Environmental Management (EM)

Documents & Publications Flambeau River Papers Makes a Comeback with a Revised Energy Strategy Flambeau River Biofuels Demonstration-Scale Biorefinery FlambeauRiverBiofuels.pdf...

366

EA-1692: Red River Environmental Products, LLC Activated Carbon...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

2: Red River Environmental Products, LLC Activated Carbon Manufacturing Facility, Red River Parish, LA EA-1692: Red River Environmental Products, LLC Activated Carbon Manufacturing...

367

Enforcement Documents - Savannah River Site | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

the Savannah River Site (EA-2000-08) June 7, 2000 Enforcement Letter, Savannah River Ecology Laboratory - June 7, 2000 Issued to Savannah River Ecology Laboratory related to...

368

A Perspective on Coupled Multiscale Simulation and Validation in Nuclear Materials  

SciTech Connect

The field of nuclear materials encompasses numerous opportunities to address and ultimately solve longstanding industrial problems by improving the fundamental understanding of materials through the integration of experiments with multiscale modeling and high-performance simulation. A particularly noteworthy example is an ongoing study of axial power distortions in a nuclear reactor induced by corrosion deposits, known as CRUD (Chalk River unidentified deposits). We describe how progress is being made toward achieving scientific advances and technological solutions on two fronts. Specifically, the study of thermal conductivity of CRUD phases has augmented missing data as well as revealed new mechanisms. Additionally, the development of a multiscale simulation framework shows potential for the validation of a new capability to predict the power distribution of a reactor, in effect direct evidence of technological impact. The material- and system-level challenges identified in the study of CRUD are similar to other well-known vexing problems in nuclear materials, such as irradiation accelerated corrosion, stress corrosion cracking, and void swelling; they all involve connecting materials science fundamentals at the atomistic- and mesoscales to technology challenges at the macroscale.

M. P. Short; D. Gaston; C. R. Stanek; S. Yip

2014-01-01T23:59:59.000Z

369

A Safer Nuclear Enterprise  

Science Journals Connector (OSTI)

...2012 at the Nuclear Security...leadership in nuclear enterprise...multinational assessment of emerging risks and consequences...to assess nuclear risks in...or nuclear terrorism. States...and nuclear power. Since 1945...nuclear power plant can mean...

Sidney D. Drell; George P. Shultz; Steven P. Andreasen

2012-06-08T23:59:59.000Z

370

Nuclear astrophysics  

SciTech Connect

The problem of core-collapse supernovae is used to illustrate the many connections between nuclear astrophysics and the problems nuclear physicists study in terrestrial laboratories. Efforts to better understand the collapse and mantle ejection are also motivated by a variety of interdisciplinary issues in nuclear, particle, and astrophysics, including galactic chemical evolution, neutrino masses and mixing, and stellar cooling by the emission of new particles. The current status of theory and observations is summarized.

Haxton, W.C.

1992-12-31T23:59:59.000Z

371

Nuclear astrophysics  

SciTech Connect

The problem of core-collapse supernovae is used to illustrate the many connections between nuclear astrophysics and the problems nuclear physicists study in terrestrial laboratories. Efforts to better understand the collapse and mantle ejection are also motivated by a variety of interdisciplinary issues in nuclear, particle, and astrophysics, including galactic chemical evolution, neutrino masses and mixing, and stellar cooling by the emission of new particles. The current status of theory and observations is summarized.

Haxton, W.C.

1992-01-01T23:59:59.000Z

372

Nuclear Counterterrorism  

Directives, Delegations, and Requirements

The Order defines requirements for the protection of sensitive improvised nuclear device information and provides a framework to support DOE activities related to nuclear counterterrorism. (A supplemental DOE Manual, Control of and Access to Improvised Nuclear Device Information, provides requirements and procedures for protecting Sigma 20 information.) Appendices A and B are Official Use Only. Point of contact is Adam Boyd (NA-82), 202-586-0010. Cancels DOE O 457.1 and DOE M 457.1-1.

2013-08-26T23:59:59.000Z

373

Enterprise SRS: Leveraging Ongoing Operations To Advance Nuclear Fuel Cycles Research And Development Programs  

SciTech Connect

The Savannah River Site (SRS) is repurposing its vast array of assets to solve future national issues regarding environmental stewardship, national security, and clean energy. The vehicle for this transformation is Enterprise SRS which presents a new, radical view of SRS as a united endeavor for ''all things nuclear'' as opposed to a group of distinct and separate entities with individual missions and organizations. Key among the Enterprise SRS strategic initiatives is the integration of research into facilities in conjunction with on-going missions to provide researchers from other national laboratories, academic institutions, and commercial entities the opportunity to demonstrate their technologies in a relevant environment and scale prior to deployment. To manage that integration of research demonstrations into site facilities, The Department of Energy, Savannah River Operations Office, Savannah River Nuclear Solutions, the Savannah River National Laboratory (SRNL) have established a center for applied nuclear materials processing and engineering research (hereafter referred to as the Center). The key proposition of this initiative is to bridge the gap between promising transformational nuclear fuel cycle processing discoveries and large commercial-scale-technology deployment by leveraging SRS assets as facilities for those critical engineering-scale demonstrations necessary to assure the successful deployment of new technologies. The Center will coordinate the demonstration of R&D technologies and serve as the interface between the engineering-scale demonstration and the R&D programs, essentially providing cradle-to-grave support to the research team during the demonstration. While the initial focus of the Center will be on the effective use of SRS assets for these demonstrations, the Center also will work with research teams to identify opportunities to perform research demonstrations at other facilities. Unique to this approach is the fact that these SRS assets will continue to accomplish DOE's critical nuclear material missions (e.g., processing in H-Canyon and plutonium storage in K-Area). Thus, the demonstration can be accomplished by leveraging the incremental cost of performing demonstrations without needing to cover the full operational cost of the facility. Current Center activities have been focused on integrating advanced safeguards monitoring technologies demonstrations into the SRS H-Canyon and advanced location technologies demonstrations into K-Area Materials Storage. These demonstrations are providing valuable information to researchers and customers as well as providing the Center with an improved protocol for demonstration management that can be exercised across the entire SRS (as well as to offsite venues) so that future demonstrations can be done more efficiently and provide an opportunity to utilize these unique assets for multiple purposes involving national laboratories, academia, and commercial entities. Key among the envisioned future demonstrations is the use of H-Canyon to demonstrate new nuclear materials separations technologies critical for advancing the mission needs DOE-Nuclear Energy (DOE-NE) to advance the research for next generation fuel cycle technologies. The concept is to install processing equipment on frames. The frames are then positioned into an H-Canyon cell and testing in a relevant radiological environment involving prototypic radioactive materials can be performed.

Murray, Alice M.; Marra, John E.; Wilmarth, William R.; Mcguire, Patrick W.; Wheeler, Vickie B.

2013-07-03T23:59:59.000Z

374

Nuclear Power  

Science Journals Connector (OSTI)

Nuclear Power ... THIS WEEK’S issue contains six letters on nuclear power, a representative sample of the letters C&EN received in response to the editorial, “Resist Hysteria,” I wrote shortly after the earthquake and tsunami in Japan devastated the Fukushima Daiichi Nuclear Power Station (C&EN, March 21, page 5). ... Four of the six letters take sharp issue with the primary point I made in the editorial, which was that, despite the severity of the situation in Japan, nuclear power remains an essential component of our overall energy mix for the near to mid-term because it will help us avert the worst impacts of global climate disruption. ...

RUDY M. BAUM

2011-05-09T23:59:59.000Z

375

NUCLEAR STUDIES  

Science Journals Connector (OSTI)

Japanese nuclear power plant crisis sparks examination of U.S. REACTORS ... Calls are particularly zeroing in on reactors similar in location and design to those in Japan. ...

JEFF JOHNSON

2011-04-04T23:59:59.000Z

376

Canadian River Compact (Texas) | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Canadian River Compact (Texas) Canadian River Compact (Texas) Canadian River Compact (Texas) < Back Eligibility Utility Fed. Government Commercial Agricultural Investor-Owned Utility State/Provincial Govt Industrial Construction Municipal/Public Utility Local Government Residential Installer/Contractor Rural Electric Cooperative Tribal Government Low-Income Residential Schools Retail Supplier Institutional Multi-Family Residential Systems Integrator Fuel Distributor Nonprofit General Public/Consumer Transportation Savings Category Water Buying & Making Electricity Home Weatherization Program Info State Texas Program Type Siting and Permitting Provider Canadian River Compact Commission The Canadian River Commission administers the Canadian River Compact which includes the states of New Mexico, Oklahoma, and Texas. Signed in 1950 by

377

Deep drilling data, Raft River geothermal area, Idaho-Raft River geothermal  

Open Energy Info (EERE)

Deep drilling data, Raft River geothermal area, Idaho-Raft River geothermal Deep drilling data, Raft River geothermal area, Idaho-Raft River geothermal exploration well sidetrack-C Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Report: Deep drilling data, Raft River geothermal area, Idaho-Raft River geothermal exploration well sidetrack-C Details Activities (1) Areas (1) Regions (0) Abstract: Cassia County Idaho; data; geophysical surveys; Idaho; Raft River geothermal area; surveys; United States; USGS; Well No. 3; well-logging Author(s): Covington, H.R. Published: Open-File Report - U. S. Geological Survey, 1/1/1978 Document Number: Unavailable DOI: Unavailable Exploratory Well At Raft River Geothermal Area (1977) Raft River Geothermal Area Retrieved from "http://en.openei.org/w/index.php?title=Deep_drilling_data,_Raft_River_geothermal_area,_Idaho-Raft_River_geothermal_exploration_well_sidetrack-C&oldid=473365"

378

Reduce, reuse and recycle: A green solution to Canada's medical isotope shortage  

Science Journals Connector (OSTI)

Abstract Due to the unforeseen maintenance issues at the National Research Universal (NRU) reactor at Chalk River and coincidental shutdowns of other international reactors, a global shortage of medical isotopes (in particular technetium-99m, Tc-99m) occurred in 2009. The operation of these research reactors is expensive, their age creates concerns about their continued maintenance and the process results in a large amount of long-lived nuclear waste, whose storage cost has been subsidized by governments. While the NRU has since revived its operations, it is scheduled to cease isotope production in 2016. The Canadian government created the Non-reactor based medical Isotope Supply Program (NISP) to promote research into alternative methods for producing medical isotopes. The NRC was a member of a collaboration looking into the use of electron linear accelerators (LINAC) to produce molybdenum-99 (Mo-99), the parent isotope of Tc-99m. This paper outlines NRC’s involvement in every step of this process, from the production, chemical processing, recycling and preliminary animal studies to demonstrate the equivalence of LINAC Tc-99m with the existing supply. This process stems from reusing an old idea, reduces the nuclear waste to virtually zero and recycles material to create a green solution to Canada's medical isotope shortage.

R. Galea; C. Ross; R.G. Wells

2014-01-01T23:59:59.000Z

379

Savannah River Operations Office Interim Managemnet of Nuclear  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

099 099 Federal Register / Vol. 62, No. 220 / Friday, November 14, 1997 / Notices Barbara A. Carmichael, Alternate Air Force Federal Register Liaison Officer. [FR Doc. 97-29919 Filed 11-13-97; 8:45 am] BILLING CODE 3910-01-P DEPARTMENT OF EDUCATION Notice of Proposed Information Collection Requests AGENCY: Department of Education. ACTION: Proposed collection; comment request. SUMMARY: The Deputy Chief Information Officer, Office of the Chief Information Officer, invites comments on the proposed information collection requests as required by the Paperwork Reduction Act of 1995. DATES: Interested persons are invited to submit comments on or before January 13, 1998. ADDRESSES: Written comments and requests for copies of the proposed information collection requests should be addressed to Patrick J. Sherrill,

380

EM Issues Amended Decision to Expand Use of Nuclear Facility | Department  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Issues Amended Decision to Expand Use of Nuclear Facility Issues Amended Decision to Expand Use of Nuclear Facility EM Issues Amended Decision to Expand Use of Nuclear Facility April 1, 2013 - 12:00pm Addthis H-Canyon at Savannah River Site. The building is called a canyon because of its long rectangular shape and two continuous trenches that contains process vessels. H-Canyon at Savannah River Site. The building is called a canyon because of its long rectangular shape and two continuous trenches that contains process vessels. AIKEN, S.C. - EM issued an amended Record of Decision (ROD) to the Savannah River Site (SRS) Spent Nuclear Fuel Environmental Impact Statement to expand the operations of the H-Canyon Facility at SRS to support a major nuclear non-proliferation goal and save taxpayer dollars. DOE recently signed a contract allowing Atomic Energy of Canada Limited

Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

EM Issues Amended Decision to Expand Use of Nuclear Facility | Department  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

EM Issues Amended Decision to Expand Use of Nuclear Facility EM Issues Amended Decision to Expand Use of Nuclear Facility EM Issues Amended Decision to Expand Use of Nuclear Facility April 1, 2013 - 12:00pm Addthis H-Canyon at Savannah River Site. The building is called a canyon because of its long rectangular shape and two continuous trenches that contains process vessels. H-Canyon at Savannah River Site. The building is called a canyon because of its long rectangular shape and two continuous trenches that contains process vessels. AIKEN, S.C. - EM issued an amended Record of Decision (ROD) to the Savannah River Site (SRS) Spent Nuclear Fuel Environmental Impact Statement to expand the operations of the H-Canyon Facility at SRS to support a major nuclear non-proliferation goal and save taxpayer dollars. DOE recently signed a contract allowing Atomic Energy of Canada Limited

382

Nuclear radiation electronic gear  

Science Journals Connector (OSTI)

Nuclear radiation electronic gear ... Examines the line of nuclear radiation instrumentation offered by Nuclear-Chicago Corporation and Victoreen Instrument Company. ... Nuclear / Radiochemistry ...

S. Z. Lewin

1961-01-01T23:59:59.000Z

383

Nuclear Weapons Journal  

NLE Websites -- All DOE Office Websites (Extended Search)

Nuclear Weapons Journal Nuclear Weapons Journal x The Nuclear Weapons Journal ceased publication after Issue 2, 2009. Below are Nuclear Weapons Journal archived issues. Issue 2,...

384

Nuclear Forces and Nuclear Systems  

NLE Websites -- All DOE Office Websites (Extended Search)

Forces and Nuclear Systems Forces and Nuclear Systems Our goal is to achieve a description of nuclear systems ranging in size from the deuteron to nuclear matter and neutron stars using a single parameterization of the nuclear forces. Our work includes both the construction of two- and three-nucleon potentials and the development of many-body techniques for computing nuclear properties with these interactions. Detailed quantitative, computationally intense studies are essential parts of this work. In the last decade we have constructed several realistic two- and three-nucleon potential models. The NN potential, Argonne v18, has a dominant charge-independent piece plus additional charge-dependent and charge-symmetry-breaking terms, including a complete electromagnetic interaction. It fits 4301 pp and np elastic scattering data with a chi**2

385

Decommissioning an Active Historical Reactor Facility at the Savannah River Site - 13453  

SciTech Connect

The Savannah River Site (SRS) is an 802 square-kilometer United States Department of Energy (US DOE) nuclear facility located along the Savannah River near Aiken, South Carolina, where Management and Operations are performed by Savannah River Nuclear Solutions (SRNS). In 2004, DOE recognized SRS as structure within the Cold War Historic District of national, state and local significance composed of the first generation of facilities constructed and operated from 1950 through 1989 to produce plutonium and tritium for our nation's defense. DOE agreed to manage the SRS 105-C Reactor Facility as a potentially historic property due to its significance in supporting the U.S. Cold War Mission and for potential for future interpretation. This reactor has five primary areas within it, including a Disassembly Basin (DB) that received irradiated materials from the reactor, cooled them and prepared the components for loading and transport to a Separation Canyon for processing. The 6,317 square meter area was divided into numerous work/storage areas. The walls between the individual basin compartments have narrow vertical openings called 'slots' that permit the transfer of material from one section to another. Data indicated there was over 830 curies of radioactivity associated with the basin sediments and approximately 9.1 M liters of contaminated water, not including a large quantity of activated reactor equipment, scrap metal, and debris on the basin floor. The need for an action was identified in 2010 to reduce risks to personnel in the facility and to eliminate the possible release of contaminants into the environment. The release of DB water could potentially migrate to the aquifer and contaminate groundwater. DOE, its regulators [U. S. Environmental Protection Agency (USEPA)-Region 4 and the South Carolina Department of Health and Environmental Control (SCDHEC)] and the SC Historical Preservation Office (SHPO) agreed/concurred to perform a non-time critical removal action for the In Situ Decommissioning (ISD) of the 105-C Disassembly Basin. ISD consisted of stabilization/isolation of remaining contaminated water, sediment, activated reactor equipment, and scrap metal by filling the DB with underwater non-structural grout to the appropriate (-4.877 meter) grade-level, thence with dry area non-structural grout to the final -10 centimeter level. The roof over the DB was preserved due to its potential historical significance and to prevent the infiltration of precipitation. Forced evaporation was the form of treatment implemented to remove the approximately 9.1 M liters of contaminated basin water. Using specially formulated grouts, irradiated materials and sediment were treated by solidification/isolation thus reducing their mobility, reducing radiation exposure and creating an engineered barrier thereby preventing access to the contaminants. Grouting provided a low permeability barrier to minimize any potential transport of contaminants to the aquifer. Efforts were made to preserve the historical significance of the Reactor in accordance with the National Historic Preservation Act. ISD provides a cost effective means to isolate and contain residual radioactivity from past nuclear operations allowing natural radioactive decay to reduce hazards to manageable levels. This method limits release of radiological contamination to the environment, minimizes radiation exposure to workers, prevents human/animal access to the hazardous substances, and allows for ongoing monitoring of the decommissioned facility. Field construction was initiated in August 2011; evaporator operations commenced January 2012 and ended July 2012 with over 9 M liters of water treated/removed. Over 8,525 cubic meters of grout were placed, completing in August 2012. The project completed with an excellent safety record, on schedule and under budget. (authors)

Bergren, Christopher L.; Long, J. Tony; Blankenship, John K. [Savannah River Nuclear Solutions, LLC, Bldg. 730-4B, Aiken, SC 29808 (United States)] [Savannah River Nuclear Solutions, LLC, Bldg. 730-4B, Aiken, SC 29808 (United States); Adams, Karen M. [United States Department of Energy, Bldg. 730-B, Aiken, SC 29808 (United States)] [United States Department of Energy, Bldg. 730-B, Aiken, SC 29808 (United States)

2013-07-01T23:59:59.000Z

386

Nuclear Systems Modeling, Simulation & Validation | Nuclear Science...  

NLE Websites -- All DOE Office Websites (Extended Search)

Research Areas Fuel Cycle Science & Technology Fusion Nuclear Science Isotope Development and Production Nuclear Security Science & Technology Nuclear Systems Modeling, Simulation...

387

Nuclear Materials Management & Safeguards System | National Nuclear...  

National Nuclear Security Administration (NNSA)

System Nuclear Materials Management & Safeguards System NMMSS U.S. Department of Energy U.S. Nuclear Regulatory Commission Nuclear Materials Management & Safeguards...

388

Modeling-Computer Simulations At Raft River Geothermal Area (1983) | Open  

Open Energy Info (EERE)

Modeling-Computer Simulations At Raft River Geothermal Area (1983) Modeling-Computer Simulations At Raft River Geothermal Area (1983) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Modeling-Computer Simulations At Raft River Geothermal Area (1983) Exploration Activity Details Location Raft River Geothermal Area Exploration Technique Modeling-Computer Simulations Activity Date 1983 Usefulness useful DOE-funding Unknown Exploration Basis Predict flow rate and porosity Notes The objectives of the physical modeling effort are to: (1) evaluate injection-backflow testing for fractured reservoirs under conditions of known reservoir parameters (porosity, fracture width, etc.); (2) study the mechanisms controlling solute transport in fracture systems; and (3) provide data for validation of numerical models that explicitly simulate

389

Gamma Log At Raft River Geothermal Area (1979) | Open Energy Information  

Open Energy Info (EERE)

Gamma Log At Raft River Geothermal Area (1979) Gamma Log At Raft River Geothermal Area (1979) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Gamma Log At Raft River Geothermal Area (1979) Exploration Activity Details Location Raft River Geothermal Area Exploration Technique Gamma Log Activity Date 1979 Usefulness useful DOE-funding Unknown Exploration Basis To allow for the lateral and vertical extrapolation of core and test data and bridged the gap between surface geophysical data and core analyses. Notes Borehole gamma spectrometry can be used to identify anomalous concentration of uranium, thorium, and potassium which are probably due to transportation by hydrothermal solutions. Computer crossplotting was used as an aid to the identification of such rock types as quartzite, quartz monzonite, and

390

Nuclear options  

Science Journals Connector (OSTI)

... sad if transient commercial expediency led the country to take risks now by adopting nuclear reactor designs from abroad which are in some respects technically less sound than those produced at ... much lower priority. It can be anticipated, however; that although the types of nuclear reactor selected as the best that Britain could build next may be suitable for unit designs ...

G. R. Bainbridge

1974-06-21T23:59:59.000Z

391

Savannah River Operations Office; Interim Management of Nuclear Materials at the Savannah River Site  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

474 474 Federal Register / Vol. 61, No. 179 / Friday, September 13, 1996 / Notices James R. Holbein, United States Secretary, NAFTA Secretariat, Suite 2061, 14th and Constitution Avenue, Washington, DC 20230, (202) 482-5438. SUPPLEMENTARY INFORMATION: On April 30, 1996 the Binational Panel issued its decision affirming in part and remanding in part the Final Determination in this matter. The Determination Remand was filed by the International Trade Administration on June 14, 1996. No challenge to that Redetermination on Remand was filed under Rule 73 of the Article 1904 Panel Rules. Therefore, pursuant to Rule 73(5) the Panel issued an Order on July 19, 1996 affirming the Redetermination on Remand and instructing the Secretariat to issue a Notice of Final Panel Action. The Notice of Final Panel Action was

392

Savannah River National Laboratory - Home  

NLE Websites -- All DOE Office Websites

SRNL Logo SRNL and DOE logo art SRNL Logo SRNL and DOE logo art Top Menu Bar SRNL Update: Embassy Fellows Report A report co-authored by Savannah River National Laboratory Senior Advisory Engineer, Dr. Robert Sindelar, has been released. The report to the Government of Japan - Ministry of the Environment provides observations and recommendations on decontamination work and progress... >>MORE Portable Power Research at SRNL Hadron Technologies, Inc., a microwave technology and systems development and manufacturing company with offices in Tennessee and Colorado, has signed a license for a Hybrid Microwave and Off-Gas Treatment System developed by the Savannah River National Laboratory, the Department of Energy's applied science laboratory located at the Savannah River Site. >>MORE

393

Savannah River Tank Waste Residuals  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Savannah Savannah River Savannah River Tank Waste Residuals HLW Corporate Board November 6, 2008 1 November 6, 2008 Presentation By Sherri R. Ross Department of Energy Savannah River Operations Office The Issue * How clean is clean? * Ultimate Challenge - Justify highly radioactive radionuclides have been removed to the maximum extent practical? 2 removed to the maximum extent practical? - Building compelling regulatory documentation that will withstand intense scrutiny §3116 Requirements 1. Does not require disposal in deep geological repository 2. Highly radioactive radionuclides removed to the maximum extent practical 3. Meet the performance objectives in 10 CFR Part 3 3. Meet the performance objectives in 10 CFR Part 61, Subpart C 4. Waste disposed pursuant to a State-approved closure plan or permit Note: If it is anticipated that Class C disposal limits will be exceeded, additional

394

Snake River Geothermal Project - Innovative Approaches to Geothermal...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Snake River Geothermal Project - Innovative Approaches to Geothermal Exploration Snake River Geothermal Project - Innovative Approaches to Geothermal Exploration DOE Geothermal...

395

Enforcement Letter, Savannah River Ecology Laboratory- June 7, 2000  

Energy.gov (U.S. Department of Energy (DOE))

Issued to Savannah River Ecology Laboratory related to Radioactive Material Control Deficiencies at the Savannah River Site

396

Flambeau River Biofuels | Open Energy Information  

Open Energy Info (EERE)

Flambeau River Biofuels Flambeau River Biofuels Jump to: navigation, search Name Flambeau River Biofuels Place Park Falls, Wisconsin Sector Biomass Product A subsidiary of Flambeau River Papers LLC that plans to develop a Fischer Tropsch diesel project in Park Falls, Wisconsin that will process residual wood biomass from forest and agricultural sources. References Flambeau River Biofuels[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. Flambeau River Biofuels is a company located in Park Falls, Wisconsin . References ↑ "Flambeau River Biofuels" Retrieved from "http://en.openei.org/w/index.php?title=Flambeau_River_Biofuels&oldid=345407" Categories: Clean Energy Organizations

397

Youghiogheny Wild and Scenic River (Maryland)  

Energy.gov (U.S. Department of Energy (DOE))

Portions of the Youghiogheny River are protected under the Scenic and Wild Rivers Act, and development on or near these areas is restricted. COMAR section 08.15.02 addresses permitted uses and...

398

Salinity Gradient Energy at River Mouths  

Science Journals Connector (OSTI)

Salinity Gradient Energy at River Mouths ... River mouths are potentially abundant locations for the exploitation of the clean and renewable salinity gradient energy (SGE) as here perpetually fresh water mixes with saline seawater. ...

Oscar Alvarez-Silva; Christian Winter; Andres F. Osorio

2014-09-03T23:59:59.000Z

399

Spent Nuclear Fuel Alternative Technology Decision Analysis  

SciTech Connect

The Westinghouse Savannah River Company (WSRC) made a FY98 commitment to the Department of Energy (DOE) to recommend a technology for the disposal of aluminum-based spent nuclear fuel (SNF) at the Savannah River Site (SRS). The two technologies being considered, direct co-disposal and melt and dilute, had been previously selected from a group of eleven potential SNF management technologies by the Research Reactor Spent Nuclear Fuel Task Team chartered by the DOE''s Office of Spent Fuel Management. To meet this commitment, WSRC organized the SNF Alternative Technology Program to further develop the direct co-disposal and melt and dilute technologies and ultimately provide a WSRC recommendation to DOE on a preferred SNF alternative management technology.

Shedrow, C.B.

1999-11-29T23:59:59.000Z

400

Critical wavelength for river meandering  

Science Journals Connector (OSTI)

A fully nonlinear modal analysis identifies a critical centerline wave number qc for river meandering that separates long-wavelength bends, which grow to cutoff, from short-wavelength bends, which decay. Exact, numerical, and approximate analytical results for qc rely on the Ikeda, Parker, and Sawai [J. Fluid Mech. 112, 363 (1981)] model, supplemented by dynamical equations that govern the river migration and length. Predictions also include upvalley bend migration at long times and a peak in lateral migration rates at intermediate times. Experimental tests are suggested.

Boyd F. Edwards and Duane H. Smith

2001-03-28T23:59:59.000Z

Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

Interim Management of Nuclear Materials  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Summary-1995.html[6/27/2011 12:50:20 PM] Summary-1995.html[6/27/2011 12:50:20 PM] SUMMARY The Atomic Energy Commission (AEC), a predecessor agency of the Department of Energy (DOE), established the Savannah River Site (SRS) in the early 1950s for the production of special radioactive isotopes. The primary SRS mission was to produce strategic isotopes (plutonium-239 and tritium) used in the development and production of nuclear weapons for national defense. The Site produced other special isotopes (californium-252, plutonium-238, americium-241, etc.) to support research in nuclear medicine, space exploration, and commercial applications. The historic production cycle at the SRS involved the fabrication of metal fuel and target assemblies for irradiation in the Site reactors, followed by chemical dissolution, separation, and conversion of the radioisotopes into solid forms for use

402

Nuclear Reactor Materials and Fuels  

Science Journals Connector (OSTI)

Nuclear reactor materials and fuels can be classified into six categories: Nuclear fuel materials Nuclear clad materials Nuclear coolant materials Nuclear poison materials Nuclear moderator materials

Dr. James S. Tulenko

2012-01-01T23:59:59.000Z

403

Wild and Scenic Rivers | Open Energy Information  

Open Energy Info (EERE)

Retrieved from "http:en.openei.orgwindex.php?titleWildandScenicRivers&oldid612228" Category: NEPA Resources...

404

Columbia River Component Data Evaluation Summary Report  

SciTech Connect

The purpose of the Columbia River Component Data Compilation and Evaluation task was to compile, review, and evaluate existing information for constituents that may have been released to the Columbia River due to Hanford Site operations. Through this effort an extensive compilation of information pertaining to Hanford Site-related contaminants released to the Columbia River has been completed for almost 965 km of the river.

C.S. Cearlock

2006-08-02T23:59:59.000Z

405

Bayer Material Science (TRL 1 2 3 System)- River Devices to Recover Energy with Advanced Materials(River DREAM)  

Energy.gov (U.S. Department of Energy (DOE))

Bayer Material Science (TRL 1 2 3 System) - River Devices to Recover Energy with Advanced Materials(River DREAM)

406

Special Nuclear Materials: EM Manages Plutonium, Highly Enriched Uranium  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Nuclear Materials & Waste » Nuclear Materials & Waste » Special Nuclear Materials: EM Manages Plutonium, Highly Enriched Uranium and Uranium-233 Special Nuclear Materials: EM Manages Plutonium, Highly Enriched Uranium and Uranium-233 105-K building houses the K-Area Material Storage (KAMS) facility, designated for the consolidated storage of surplus plutonium at Savannah River Site pending disposition. The plutonium shipped to KAMS is sealed inside a welded 3013 containers that are nested in 9975 shipping containers. 105-K building houses the K-Area Material Storage (KAMS) facility, designated for the consolidated storage of surplus plutonium at Savannah River Site pending disposition. The plutonium shipped to KAMS is sealed inside a welded 3013 containers that are nested in 9975 shipping

407

2012 Congressional Nuclear Cleanup Caucus Briefings | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

2 Congressional Nuclear Cleanup Caucus Briefings 2 Congressional Nuclear Cleanup Caucus Briefings 2012 Congressional Nuclear Cleanup Caucus Briefings The Congressional Nuclear Cleanup Caucus serves as a way to brief members of Congress and their staff on EM headquarters and site activities, including budget, safety and project progress. 02/16/2012 - FY 2013 Budget Overview 03/07/2012 - Richland Operations Office, WA 03/21/2012 - Oak Ridge, TN 03/22/2012 - Portsmouth/Paducah Project Office, OH-KY 03/27/2012 - Safety Overview with Deputy Assistant Secretary for Safety & Security Program, Matthew Moury 03/28/2012 - Idaho Operations Office, ID 04/18/2012 - Savannah River Site, SC 04/19/2012 - Office of River Protection, WA More Documents & Publications Assistant Secretary Triay's FY 2012 EM Budget Rollout Presentation

408

(Nuclear theory). [Research in nuclear physics  

SciTech Connect

This report discusses research in nuclear physics. Topics covered in this paper are: symmetry principles; nuclear astrophysics; nuclear structure; quark-gluon plasma; quantum chromodynamics; symmetry breaking; nuclear deformation; and cold fusion. (LSP)

Haxton, W.

1990-01-01T23:59:59.000Z

409

SRO -NERP-1 THE SAVANNAH RIVER PLANT  

E-Print Network (OSTI)

AND TREATMENT by Whit Gibbons Savannah River Ecology Laboratory Aiken , South Carolina A PUBLICATION OF EROA 'S SAVANNAH RIVER NATIONAL ENVIRONMENTAL RESEARCH PARK -SEPTEMBER 1977 COPIES MAY BE OBTAINEO FROM SAVANNAHSRO -NERP-1 SNAKES OF THE SAVANNAH RIVER PLANT WITH INFORMATION ABOUT SNAKEBITE PREVENTION

Georgia, University of

410

Atlas of the Columbia River Basin  

E-Print Network (OSTI)

#12;Atlas of the Columbia River Basin Oregon State University Computer-Assisted Cartography Course & GEOVISUALIZATION GROUP UNIVERSITY #12;2013 Oregon State University Atlas of the Columbia River Basin FOREWORDAtlas, Montana, Nevada, Wyoming, and Utah. 2013 Oregon State University Atlas of the Columbia River Basin

Jenny, Bernhard

411

G. A. Antaki Westinghouse Savannah River Company Savannah River...  

Office of Scientific and Technical Information (OSTI)

Recognizing the excessive costs and the limited value added of wholesale analysis, the nuclear industry, through EPRI, has developed rules for the seismic evaluation of small...

412

Nuclear Astrophysics  

E-Print Network (OSTI)

Nuclear physics has a long and productive history of application to astrophysics which continues today. Advances in the accuracy and breadth of astrophysical data and theory drive the need for better experimental and theoretical understanding of the underlying nuclear physics. This paper will review some of the scenarios where nuclear physics plays an important role, including Big Bang Nucleosynthesis, neutrino production by our sun, nucleosynthesis in novae, the creation of elements heavier than iron, and neutron stars. Big-bang nucleosynthesis is concerned with the formation of elements with A nuclear physics inputs required are few-nucleon reaction cross sections. The nucleosynthesis of heavier elements involves a variety of proton-, alpha-, neutron-, and photon-induced reactions, coupled with radioactive decay. The advent of radioactive ion beam facilities has opened an important new avenue for studying these processes, as many involve radioactive species. Nuclear physics also plays an important role in neutron stars: both the nuclear equation of state and cooling processes involving neutrino emission play a very important role. Recent developments and also the interplay between nuclear physics and astrophysics will be highlighted.

Carl R. Brune

2005-02-28T23:59:59.000Z

413

nuclear security | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

security | National Nuclear Security Administration People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our...

414

Nuclear Incident Team | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

Incident Team | National Nuclear Security Administration People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing...

415

nuclear navy | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

navy | National Nuclear Security Administration People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our...

416

nuclear threat science | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

threat science | National Nuclear Security Administration People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing...

417

Nuclear Operations | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

Nuclear Security Administration People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure...

418

Nuclear Radius and Nuclear Forces  

Science Journals Connector (OSTI)

The difference between the radius of the nuclear matter distribution and the nuclear force radius, RN?1.4A13×10-13 cm, for heavy nuclei (A>100) is interpreted as a consequence of the finite range of nuclear forces. Assuming that the nuclear matter distribution coincides with the charge distribution as determined at Stanford (RC=1.12A13×10-13 cm is the distance at which the charge density falls to one half value) we sum up the nuclear interactions of an incident nucleon for various proposed internucleon potentials, V(r). We also evaluate contributions from the spin, charge, and matter polarizations induced in the nuclear distributions by the incident nucleon as a test of the convergence of these calculations. The aim here is to infer some features of nuclear forces which satisfy saturation requirements and at the same time give rise to an appreciable nuclear attraction for an incident nucleon at RN. Analyses of the scattering of neutrons and protons by heavy nuclei suggest a nuclear attraction ?14 Mev at a distance RN.These considerations are primarily sensitive to the long range behavior of the direct, central part of V(r). The key point which emerges from them is that the nuclear forces must contain long range (~ meson Compton wavelength) direct, central attractions which will be felt by an incident nucleon at RN before the shorter range repulsions (hard cores, many-body forces, or exchange interactions), which are responsible for saturation, become effective. Such interactions can be constructed phenomenologically, but are not found in recent meson-theoretically deduced potentials.

S. D. Drell

1955-10-01T23:59:59.000Z

419

Nuclear condensation  

Science Journals Connector (OSTI)

This work draws an analogy between a heated nucleus breaking up into clusters and a liquid undergoing a phase transition to a gas in which droplets appear. The critical temperature and density in the nucleus are investigated using a Skyrme effective interaction and finite temperature Hartree-Fock theory. The energy and pressure as a function of density are calculated. The effects of compressibility, effective mass, and binding energy per particle on the critical temperature and critical density of nuclear systems is developed. In some cases, analytic expressions for these quantities can be obtained.NUCLEAR REACTIONS Phase transitions in hot nuclear matter.

H. Jaqaman; A. Z. Mekjian; L. Zamick

1983-06-01T23:59:59.000Z

420

Nuclear War  

SciTech Connect

Several chapters in Last Aid warrant the attention of the medical profession. What is known and not known about acute biologic effects following a nuclear explosion is described. The social, physical, and environmental impact of nuclear war on urban population centers is described. How nuclear weapons could affect the composition of the ozone layer and the effects this could have on human survival, including possible interruption of the aquatic ecosystem to produce single-cell organisms for the food cycle, especially seafood is noted.

MacLeod, G.K.

1983-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

EVG USAIX, Svergreen chalk River Liaison Office Ontario, Canada  

Office of Legacy Management (LM)

and Special Nuc.lear and Special Nuc.lear ?kk?rials kcc+ntabilitg EVG USAIX, Svergreen chalk River Liaison Office Ontario, Canada iulff USAEC, Washington Office See Div. of Rak Materials c~!:KRGO O?ER.i~TIONS ---.-- :ri:i!k USAZC, Ctricago Opnrations Office AGT General Electric Company AN? Project A.J,I Argonne Nat'1 Lab. AYL Al-tonne Nat'1 Lab. B XI Battelle Xfemorial Inst. CKX Vi.l;ro Carp, of America Em USAEC, East Hartford Area a TSC Ioxa State College ITS General Electric Company ANP Jk!pt, -%IAO IJSAK;, Lo&land Area Office . George L. ldercer P. 0. Box 59 Lemont, .Illinois P. 0. Box 132 Cincinnati 15, Ohio P. 0. Box 1096 Idaho Falls, Idaho P. 0. Box 299 -Lemont, Illinois 505 King Ave, Columbus, Ohio J. J. Uawning Lemont 800 bxt. 20~3 . . . . B. J. Sevold

422

Nuclear energy: current situation and prospects to 2020  

Science Journals Connector (OSTI)

...as a matter of policy that a country will have nuclear in its forward...and accept. For nuclear energy in the UK, clarity in waste policy is essential as...immediately to encourage nuclear build. There...deliver such a policy and the solution...

2007-01-01T23:59:59.000Z

423

Nuclear magnetic resonance analysis of protein–DNA interactions  

Science Journals Connector (OSTI)

...review-article Review articles 1004 30 15 Nuclear magnetic resonance analysis of protein-DNA...instrumental advances in solution-state nuclear magnetic resonance have opened up the...structural biology|protein-DNA complex|nuclear magnetic resonance| 1. Introduction...

2011-01-01T23:59:59.000Z

424

GEOLOGY, December 2007 1063 Semi-arid and arid rivers typically exhibit increasing salinity levels  

E-Print Network (OSTI)

of subsurface saline waters of connate, diagenetic, or geothermal origin, and anthropogenic sources), and (2-basin scale and must consider geologic as well as anthropogenic solute sources and the processes that may Grande­ Rio Bravo (United States and Mexico), a highly stressed arid-region river in which chronic water

Asmerom, Yemane

425

Energy Secretary Ernest Moniz Talks with SRS Workforce, Meets...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

National Laboratory and executive vice president of Savannah River Nuclear Solutions, Energy Secretary Ernest Moniz, Savannah River Waste Disposition Operations Director Phillip...

426

Beasley Lab | Savannah River Ecology Laboratory  

NLE Websites -- All DOE Office Websites (Extended Search)

are chronic and low dose, such as exposure resulting from medical uses, fallout from nuclear bomb testing, emission from nuclear power plants, andor nuclear accidents. Yet,...

427

Climate Change, Nuclear Power and Nuclear  

E-Print Network (OSTI)

Climate Change, Nuclear Power and Nuclear Proliferation: Magnitude Matters Rob Goldston MIT IAP biomass wind hydro coal CCS coal nat gas CCS nat gas nuclear Gen IV nuclear Gen III nuclear Gen II 5-1 Electricity Generation: CCS and Nuclear Power Technology Options Available Global Electricity Generation WRE

428

Resilience of river flow regimes  

Science Journals Connector (OSTI)

...Junk WJ Bayley PB Sparks RE ( 1989 ) The flood pulse concept in river-floodplain systems...F Ward JV ( 2000 ) An extension of the flood pulse concept...ZZQQhy2011 Bisbee (AZ) Bisbee (AZ) Summer Boulder Creek Arizona (United States) 98 1984...

Gianluca Botter; Stefano Basso; Ignacio Rodriguez-Iturbe; Andrea Rinaldo

2013-01-01T23:59:59.000Z

429

Resilience of river flow regimes  

Science Journals Connector (OSTI)

...Junk WJ Bayley PB Sparks RE ( 1989 ) The flood pulse concept in river-floodplain systems...F Ward JV ( 2000 ) An extension of the flood pulse concept...summer, autumn, winter Vallecito Creek Colorado (United States) 188 1963 ZZQQhy1997...

Gianluca Botter; Stefano Basso; Ignacio Rodriguez-Iturbe; Andrea Rinaldo

2013-01-01T23:59:59.000Z

430

Nuclear Medicine  

Science Journals Connector (OSTI)

Nuclear medicine is the branch of medicine that is concerned with the use of in the diagnosis, management, and treatment of disease. It usually uses small amounts of radioactive materials or , substances th...

2008-01-01T23:59:59.000Z

431

Nuclear viscosity  

Science Journals Connector (OSTI)

The decay rate of momentum in a nuclear reaction is given by an exact formula expressed in terms of the T matrix. A special case, where a viscosity coefficient can be estimated, is considered.

B. Giraud; J. Le Tourneux; E. Osnes

1975-01-01T23:59:59.000Z

432

Nuclear Waste  

Science Journals Connector (OSTI)

Nuclear waste is radioactive material no longer considered valuable...238U, 235U, and 226Ra (where the latter decays to 222Rn gas by emitting an alpha particle) or formed through fission of fissile radioisotopes ...

Rob P. Rechard

2014-01-01T23:59:59.000Z

433

Nuclear Golf  

E-Print Network (OSTI)

Broadcast Transcript: Pay no attention to that nuclear warhead behind the 18th hole; just shout "Fore!" and drive your Titleist down the fairway. In a development that is bizarre even by North Korean standards, the country ...

Hacker, Randi; Tsutsui, William

2006-12-06T23:59:59.000Z

434

Nuclear Fuels  

Science Journals Connector (OSTI)

The core of a nuclear reactor is composed of a controlled critical configuration of a fissile material, which in strict a sense is the fuel. This fissile material is contained in a matrix, normally a ceramic c...

Rudy J. M. Konings; Thierry Wiss…

2011-01-01T23:59:59.000Z

435

Nuclear Energy!  

NLE Websites -- All DOE Office Websites (Extended Search)

driver, see the Nuclear Clean Air Energy race car and receive a special clean energy patch on October 21 from 6:30 - 7:30 p.m. Space is limited RSVP by October 4 Hands-on...

436

Nuclear forces  

SciTech Connect

These lectures present an introduction into the theory of nuclear forces. We focus mainly on the modern approach, in which the forces between nucleons emerge from low-energy QCD via chiral effective field theory.

Machleidt, R. [Department of Physics, University of Idaho, Moscow, Idaho 83844 (United States)

2013-06-10T23:59:59.000Z

437

Nuclear Physics for Nuclear Fusion  

SciTech Connect

The nuclear fusion data for deuteron-triton resonance near 100 keV are found to be consistent with the selective resonant tunneling model. The feature of this selective resonant tunneling is the selectivity. It selects not only the energy level, but also the damping rate (nuclear reaction rate). When the Coulomb barrier is thin and low, the resonance selects the fast reaction channel; however, when the Coulomb barrier is thick and high, the resonance selects the slow reaction channel. This mechanism might open an approach toward fusion energy with no strong nuclear radiation.

Li Xingzhong [Tsinghua University (China)

2002-01-15T23:59:59.000Z

438

Countering Nuclear Terrorism | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

Countering Nuclear Terrorism | National Nuclear Security Administration Countering Nuclear Terrorism | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog The National Nuclear Security Administration Countering Nuclear Terrorism Home > Our Mission > Countering Nuclear Terrorism Countering Nuclear Terrorism NNSA provides expertise, practical tools, and technically informed policy

439

Schlumberger soundings in the Upper Raft River and Raft River Valleys,  

Open Energy Info (EERE)

soundings in the Upper Raft River and Raft River Valleys, soundings in the Upper Raft River and Raft River Valleys, Idaho and Utah Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Report: Schlumberger soundings in the Upper Raft River and Raft River Valleys, Idaho and Utah Details Activities (1) Areas (1) Regions (0) Abstract: In 1975, the U.S. Geological Survey made seventy Schlumberger resistivity soundings in the Upper Raft River Valley and in parts of the Raft River Valley. These soundings complement the seventy-nine soundings made previously in the Raft River Valley (Zohdy and others, 1975) and bring the total number of soundings to 149. This work was done as part of a hydrogeologic study of the area. The location, number, and azimuth of all 149 Schlumberger sounding stations are presented. The location of the new

440

Fissile solution dynamics: Student research  

SciTech Connect

There are two research projects in criticality safety at the University of Arizona: one in dynamic simulation of hypothetical criticality accidents in fissile solutions, and one in criticality benchmarks using transport theory. We have used the data from nuclear excursions in KEWB, CRAC, and SILENE to help in building models for solution excursions. An equation of state for liquids containing gas bubbles has been developed and coupled to point-reactor dynamics in an attempt to predict fission rate, yield, pressure, and kinetic energy. It appears that radiolytic gas is unimportant until after the first peak, but that it does strongly affect the shape of the subsequent power decrease and also the dynamic pressure.

Hetrick, D.L.

1994-09-01T23:59:59.000Z

Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

G. A. Antaki Westinghouse Savannah River Company Savannah River Site  

Office of Scientific and Technical Information (OSTI)

W S R C: M S- 9 5 -0 0 0 8 W S R C: M S- 9 5 -0 0 0 8 Analytical Considerations in the Code Qualification of Piping Systems (U) by G. A. Antaki Westinghouse Savannah River Company Savannah River Site Aiken, South Carolina 29808 DISCLAIMER This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government nor any agency thereof, nor any of their employees, makes any warranty, express or implied, or assumes any legal liability or respnsi- bility for the accuracy, completeness, or usefulness of any information, apparatus, product, or process disclosed, or represents that its use would not infringe privately owned rights. Refer- ence herein to any specific commercial product, process, or service by trade name, trademark,

442

Nuclear shadowing in the light-cone dipole approach  

E-Print Network (OSTI)

We study nuclear shadowing at small Bjorken x nuclear shadowing for the barq-q Fock component of the photon is calculated using exact numerical solution of the evolution equation for the Green function. At x nuclear shadowing becomes effective. Numerical results for nuclear shadowing are compared with available data from the E665 and NMC collaborations. Model calculations are finally tested with the results obtained from other models.

Jan Nemchik

2008-03-12T23:59:59.000Z

443

Evaporation of Enriched Uranium Solutions Containing Organophosphates  

SciTech Connect

The Savannah River Site has enriched uranium (EU) solution which has been stored for almost 10 years since being purified in the second uranium cycle of the H area solvent extraction process. The preliminary SRTC data, in conjunction with information in the literature, is promising. However, very few experiments have been run, and none of the results have been confirmed with repeat tests. As a result, it is believed that insufficient data exists at this time to warrant Separations making any process or program changes based on the information contained in this report. When this data is confirmed in future testing, recommendations will be presented.

Pierce, R.A.

1999-03-18T23:59:59.000Z

444

Viscosity of polymer solutions  

Science Journals Connector (OSTI)

Viscosity of polymer solutions ... Abstracts for Volume 5A, Number 2. This program contains three components: "Density of Liquids", "Viscosity of Liquids", and "Viscosity of Polymer Solutions". ...

Gary L. Bertrand

1992-01-01T23:59:59.000Z

445

THE DAYLIGHTING SOLUTION  

E-Print Network (OSTI)

1980, pp.l4-20 THE DAYLIGHTING SOLUTION Stephen SelkowitzEEB-W·-80-19 W-74 THE DAYLIGHTING SOLUTION Stephen Selkowitz

Selkowitz, Stephen

2013-01-01T23:59:59.000Z

446

Nuclear Induction  

Science Journals Connector (OSTI)

The magnetic moments of nuclei in normal matter will result in a nuclear paramagnetic polarization upon establishment of equilibrium in a constant magnetic field. It is shown that a radiofrequency field at right angles to the constant field causes a forced precession of the total polarization around the constant field with decreasing latitude as the Larmor frequency approaches adiabatically the frequency of the r-f field. Thus there results a component of the nuclear polarization at right angles to both the constant and the r-f field and it is shown that under normal laboratory conditions this component can induce observable voltages. In Section 3 we discuss this nuclear induction, considering the effect of external fields only, while in Section 4 those modifications are described which originate from internal fields and finite relaxation times.

F. Bloch

1946-10-01T23:59:59.000Z

447

Collaborating Organizations - Nuclear Data Program, Nuclear Engineering  

NLE Websites -- All DOE Office Websites (Extended Search)

Collaborating Organizations Collaborating Organizations Nuclear Data Program Overview Current Projects & Recent Activities Collaborating Organizations Publications Nuclear Data Measurements (NDM) Reports Experimental Nuclear Data Resources Contact ND Program Related Resources Other Major Programs Work with Argonne Contact us For Employees Site Map Help Join us on Facebook Follow us on Twitter NE Division on Flickr Nuclear Data Program Collaborating Organizations Bookmark and Share National Nuclear Data Center, Brookhaven National Laboratory, Upton, New York. International Nuclear Structure and Decay Data Network, coordinated by IAEA, Vienna, Austria Heavy-Ion Nuclear Physics Group, Physics Division, Argonne National Laboratory, Argonne, Illinois. Nuclear Spectroscopy Group, Department of Nuclear Physics,

448

Nuclear Data Program - Nuclear Engineering Division (Argonne)  

NLE Websites -- All DOE Office Websites (Extended Search)

Data Program Data Program Nuclear Data Program Overview Current Projects & Recent Activities Collaborating Organizations Publications Nuclear Data Measurements (NDM) Reports Experimental Nuclear Data Resources Contact ND Program Related Resources Other Major Programs Work with Argonne Contact us For Employees Site Map Help Join us on Facebook Follow us on Twitter NE Division on Flickr Nuclear Data Program We contribute to the development of comprehensive nuclear reactions and nuclear structure databases, including nuclear data measurement, analysis, modeling and evaluation methodologies, that are implemented in basic science research and advanced nuclear technologies. Bookmark and Share Recent Events Nuclear Structure 2012 Conference Argonne National Laboratory hosted the

449

Nuclear Science & Technology  

NLE Websites -- All DOE Office Websites (Extended Search)

Nuclear Science & Technology Nuclear Science & Technology Nuclear Science & Technology1354608000000Nuclear Science & TechnologySome of these resources are LANL-only and will require Remote Access. /No/ Nuclear Science & Technology Some of these resources are LANL-only and will require Remote Access. Key Resources Databases Organizations Journals Key Resources International Atomic Energy Agency IAEA scientific and technical publications cover areas of nuclear power, radiation therapy, nuclear security, nuclear law, and emergency repose. Search under Publications/Books and Reports for scientific books, standards, technical guides and reports National Nuclear Data Center Nuclear physics data for basic nuclear research and for applied nuclear technologies, operated by Brookhaven.

450

NUCLEAR PROXIMITY FORCES  

E-Print Network (OSTI)

One might summarize of nuclear potential energy has beendegree of freedom) for the nuclear interaction between anyUniversity of California. Nuclear Proximity Forces 'I< at

Randrup, J.

2011-01-01T23:59:59.000Z

451

Nuclear Nonproliferation Programs | ORNL  

NLE Websites -- All DOE Office Websites (Extended Search)

Nuclear Nonproliferation Programs SHARE Nuclear Nonproliferation Programs image Oak Ridge National Laboratory covers the entire spectrum of nuclear nonproliferation work, from...

452

Independent Activity Report, Savannah River Operation - June 2010 |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Savannah River Operation - June 2010 Savannah River Operation - June 2010 Independent Activity Report, Savannah River Operation - June 2010 June 2010 Savannah River Operations Office Self-Assessment of the Technical Qualification Program The U.S. Department of Energy (DOE), Office of Independent Oversight, within the Office of Health, Safety and Security (HSS), participated in the DOE Savannah River Operations Office (DOE-SR) self-assessment of the Technical Qualification Program (TQP). Independent Activity Report, Savannah River Operation - June 2010 More Documents & Publications Independent Oversight Review, Savannah River Operations Office - July 2013 Independent Activity Report, Savannah River Remediation - July 2010 2011 Annual Workforce Analysis and Staffing Plan Report - Savannah River

453

Nuclear Data | More Science | ORNL  

NLE Websites -- All DOE Office Websites (Extended Search)

Nuclear Data SHARE Nuclear Data Nuclear Data ORNL is a recognized, international leader in nuclear data research and development (R&D) to support nuclear applications analyses. For...

454

Nuclear Facilities | Department of Energy  

Energy Savers (EERE)

Nuclear Facilities Nuclear Facilities Nuclear Facilities Locator Map Numerical map data points indicate two or more nuclear facilities in the same geographic location. Nuclear...

455

ORISE: White paper analyzes Deepwater Horizon event for improving nuclear  

NLE Websites -- All DOE Office Websites (Extended Search)

Deepwater Horizon and Nuclear and Radiological Incidents: Common Challenges Deepwater Horizon and Nuclear and Radiological Incidents: Common Challenges and Solutions White paper analyzes Deepwater Horizon response, identifies approaches for radiological or nuclear emergency planning The 2010 Deepwater Horizon oil spill shares many of the same challenges associated with a radiological incident like the one considered in the Empire 09 exercise or even a much larger nuclear incident. By analyzing experiences during Deepwater Horizon, these challenges can be identified by the interagency in advance of a radiological or nuclear emergency and solutions made available. In the white paper Deepwater Horizon and Nuclear and Radiological Incidents: Common Challenges and Solutions (PDF, 462KB), ORISE examines the following three aspects of the Deepwater Horizon response:

456

Categorical Exclusion Determinations: Savannah River Operations Office |  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Savannah River Operations Savannah River Operations Office Categorical Exclusion Determinations: Savannah River Operations Office Categorical Exclusion Determinations issued by Savannah River Operations Office. DOCUMENTS AVAILABLE FOR DOWNLOAD September 10, 2013 CX-010669: Categorical Exclusion Determination 484-17D Coal Yard Remediation CX(s) Applied: B6.1 Date: 06/07/2013 Location(s): South Carolina Offices(s): Savannah River Operations Office August 1, 2013 CX-010837: Categorical Exclusion Determination Disassembly, Relocation, and Reassembly of a Metal-framed Quonset Hut CX(s) Applied: B1.22 Date: 08/01/2013 Location(s): South Carolina Offices(s): Savannah River Operations Office August 1, 2013 CX-010836: Categorical Exclusion Determination Subcontractor Roof Repair at 717-12S CX(s) Applied: B1.3

457

The Columbia River System : the Inside Story.  

SciTech Connect

The Columbia Ricer is one of the greatest natural resources in the western United States. The river and its tributaries touch the lives of nearly every resident of the Northwest-from providing the world-famous Pacific salmon to supplying the clean natural fuel for over 75 percent of the region's electrical generation. Since early in the century, public and private agencies have labored to capture the benefits of this dynamic river. Today, dozens of major water resource projects throughout the region are fed by the waters of the Columbia Basin river system. And through cooperative efforts, the floods that periodically threaten developments near the river can be controlled. This publication presents a detailed explanation of the planning and operation of the multiple-use dams and reservoirs of the Columbia River system. It describes the river system, those who operate and use it, the agreements and policies that guide system operation, and annual planning for multiple-use operation.

United States. Bonneville Power Administration.

1991-09-01T23:59:59.000Z

458

Wing River Wind Farm | Open Energy Information  

Open Energy Info (EERE)

River Wind Farm River Wind Farm Jump to: navigation, search Name Wing River Wind Farm Facility Wing River Wind Sector Wind energy Facility Type Commercial Scale Wind Facility Status In Service Owner Wing River Wind Farm Developer Wing River Wind Farm Location Hewitt MN Coordinates 46.3254°, -95.0864° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":46.3254,"lon":-95.0864,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

459

Savannah River Site's H Canyon Begins 2012 with New and Continuing  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Site's H Canyon Begins 2012 with New and Site's H Canyon Begins 2012 with New and Continuing Missions - Transuranic waste remediation, new mission work are the focus of the nation's only active nuclear chemical separations facility in 2012 Savannah River Site's H Canyon Begins 2012 with New and Continuing Missions - Transuranic waste remediation, new mission work are the focus of the nation's only active nuclear chemical separations facility in 2012 January 1, 2012 - 12:00pm Addthis H Canyon, above, and HB-Line are scheduled to soon begin dissolving and purifying plutonium currently stored at the Savannah River Site to demonstrate the capability to produce oxide material that meets the Mixed Oxide Facility (MOX) feedstock specifications. The production process at MOX, which is now under construction, will eventually create fuel pellets for U.S. commercial reactor fuel assemblies.

460

Nuclear “waffles”  

Science Journals Connector (OSTI)

Background: The dense neutron-rich matter found in supernovae and inside neutron stars is expected to form complex nonuniform phases, often referred to as nuclear pasta. The pasta shapes depend on density, temperature and proton fraction and determine many transport properties in supernovae and neutron star crusts.

A. S. Schneider; D. K. Berry; C. M. Briggs; M. E. Caplan; C. J. Horowitz

2014-11-24T23:59:59.000Z

Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

Nuclear cheap?  

Science Journals Connector (OSTI)

... account of the fact that if there had been no nuclear contribution the additional fossil fuel supplies would have had to come from expanded output at the marginal and most expensive ... a perfectly proper accountancy basis, including allowance for costs yet to be incurred, the price we would be paying for electricity would be higher now had fossil stations been preferred ...

P.M.S. JONES

1980-12-18T23:59:59.000Z

462

Nuclear electricity  

Science Journals Connector (OSTI)

... p.344-6) and referred to in my letter of 23 October. The retail price index (RPI) has been used to correct for inflation and a uniform interest rate ... as given by historic costs, and if a previously unconsidered effect of inflation on nuclear fuel costs is included, the margin becomes 34 per cent above that for coal.

J.W. JEFFERY

1981-08-27T23:59:59.000Z

463

Neutrino nuclear response and photo nuclear reaction  

E-Print Network (OSTI)

Photo nuclear reactions are shown to be used for studying neutrino/weak nuclear responses involved in astro-neutrino nuclear interactions and double beta decays. Charged current weak responses for ground and excited states are studied by using photo nuclear reactions through isobaric analog states of those states, while neutral current weak responses for excited states are studied by using photo nuclear reactions through the excited states. The weak interaction strengths are studied by measuring the cross sections of the photo nuclear reactions, and the spin and parity of the state are studied by measuring angular correlations of particles emitted from the photo nuclear reactions. Medium-energy polarized photons obtained from laser photons scattered off GeV electrons are very useful. Nuclear responses studied by photo nuclear reactions are used to evaluate neutrino/weak nuclear responses, i.e. nuclear beta and double beta matrix elements and neutrino nuclear interactions, and to verify theoretical calculations for them.

H. Ejiri; A. I. Titov; M. Boswell; A. Young

2013-11-10T23:59:59.000Z

464

Green River Locks and Dams 3, 4, 5, 6 and Barren River Lock and Dam 1 Disposition, Kentucky  

E-Print Network (OSTI)

Green River Locks and Dams 3, 4, 5, 6 and Barren River Lock and Dam 1 Disposition, Kentucky 16 September 2014 ABSTRACT: Green River Locks and Dams 3 through 6 and Barren River Lock and Dam 1 were. The Green River Locks and Dams 5 and 6 ceased operations in 1951 due to a marked decline in navigation

US Army Corps of Engineers

465

River Corridor Closure Project Partnering Performance Agreement...  

Office of Environmental Management (EM)

- March 2009 Voluntary Protection Program Onsite Review, River Corridor Closure Project - June 2012 Indoctrinating Subcontractors into the DOE Safety Culture and Expectations...

466

Savannah River Laboratory monthly report, September 1991  

SciTech Connect

This document details monthly activities at the Savannah River Laboratory. Topics addressed are reactor operation, tritium facilities and production; separation operations; environmental concerns; and waste management. (FI)

Ferrell, J.M. [comp.

1991-12-31T23:59:59.000Z

467

Home | Savannah River Ecology Laboratory Environmental Outreach...  

NLE Websites -- All DOE Office Websites (Extended Search)

the public about the diverse ecological research conducted by scientists at the Savannah River Ecology Laboratory. Today, the Outreach Program continues to provide a great variety...

468

Savannah River Remediation (SRR) Expanded Staff Meeting  

NLE Websites -- All DOE Office Websites (Extended Search)

Savannah River Remediation Delivering the Mission Dave Olson President and Project Manager January 27, 2012 SRS Executive Management Community Discussion 2 * Liquid Waste Funding...

469

Kimberly Andrews | Savannah River Ecology Laboratory  

NLE Websites -- All DOE Office Websites (Extended Search)

Andrews with kingsnake Curriculum Vitae Faculty & Scientists SREL Home SREL Herpetology Kimberly Andrews Savannah River Ecology Laboratory P O Drawer E, Aiken, SC 29802 (803)...

470

Kurt Buhlmann | Savannah River Ecology Laboratory  

NLE Websites -- All DOE Office Websites (Extended Search)

Buhlmann Curriculum Vitae Faculty & Scientists SREL Home SREL Herpetology Kurt A. Buhlmann Savannah River Ecology Laboratory P O Drawer E, Aiken, SC 29802 (803) 725-5293 office...

471

J. Whitfield Gibbons | Savannah River Ecology Laboratory  

NLE Websites -- All DOE Office Websites (Extended Search)

Gibbons Curriculum Vitae Faculty & Scientists SREL Home SREL Herpetology J. Whitfield Gibbons Savannah River Ecology Laboratory P O Drawer E, Aiken, SC 29802 (803) 725-5852 ...

472

Justin D. Congdon | Savannah River Ecology Laboratory  

NLE Websites -- All DOE Office Websites (Extended Search)

Congdon Curriculum Vitae Faculty & Scientists SREL Home SREL Herpetology Justin D. Congdon Savannah River Ecology Laboratory P O Drawer E, Aiken, SC 29802 (803) 725-5341 office...

473

The Columbia River System Inside Story  

SciTech Connect

The Columbia River is one of the greatest natural resources in the western United States. The river and its tributaries touch the lives of nearly every resident of the Pacific Northwest—from fostering world-famous Pacific salmon to supplying clean natural fuel for 50 to 65 percent of the region’s electrical generation. Since early in the 20th century, public and private agencies have labored to capture the benefits of this dynamic river. Today, dozens of major water resource projects throughout the region are fed by the waters of the Columbia Basin river system.

none,

2001-04-01T23:59:59.000Z

474

Workplace Charging Challenge Partner: Salt River Project  

Energy.gov (U.S. Department of Energy (DOE))

The mission of Salt River Project's (SRP) Electric Vehicle Initiative is to encourage greater use of clean energy transportation. Under this program, SRP's headquarters received two Level 2...

475

Conference Center | Savannah River Ecology Laboratory  

NLE Websites -- All DOE Office Websites (Extended Search)

Conference Center front view UGA-SREL Conference Center large conference room Large conference room small conference room Small conference room The Savannah River Ecology...

476

Savannah River Needs Assessment | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

and concerns for the site. Savannah River Needs Assessment More Documents & Publications Oak Ridge Reservation Needs Assessment Oak Ridge Y-12 and ORNL Needs Assessment Former...

477

Savannah River Laboratory monthly report, November 1991  

SciTech Connect

This document details monthly activities at the Savannah River Laboratory. Topics addressed are reactor operation; tritium facilities and production; separation operations; environmental concerns; and waste management. (FI)

Ferrell, J.M. (comp.)

1991-01-01T23:59:59.000Z

478

Savannah River Laboratory monthly report, November 1991  

SciTech Connect

This document details monthly activities at the Savannah River Laboratory. Topics addressed are reactor operation; tritium facilities and production; separation operations; environmental concerns; and waste management. (FI)

Ferrell, J.M. [comp.

1991-12-31T23:59:59.000Z

479

Wild and Scenic Rivers Act (Maryland)  

Energy.gov (U.S. Department of Energy (DOE))

It is state policy to protect the outstanding scenic, geologic, ecologic, historic, recreational, agricultural, fish, wildlife, cultural, and other similar values of certain rivers and adjacent...

480

Savannah River Laboratory monthly report, August 1991  

SciTech Connect

This document details monthly activities at the Savannah River Laboratory. Topics addressed are reactor operation, tritium facilities and production; separation operations; environmental concerns; and waste management. (FI)

Ferrell, J.M. (comp.)

1991-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "river nuclear solution" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

Savannah River Laboratory monthly report, August 1991  

SciTech Connect

This document details monthly activities at the Savannah River Laboratory. Topics addressed are reactor operation, tritium facilities and production; separation operations; environmental concerns; and waste management. (FI)

Ferrell, J.M. [comp.

1991-12-31T23:59:59.000Z

482

The Columbia River System: Inside Story  

NLE Websites -- All DOE Office Websites (Extended Search)

Falls Little Wood Reservoir Idaho Falls (City Plant) Idaho Falls (Lower Plant) Idaho Falls (Upper Plant) Ponds Lodge Ashton St. Anthony Felt Gem State Portneuf River Billingsley...

483

Root River Energy LLC | Open Energy Information  

Open Energy Info (EERE)

search Name: Root River Energy LLC Place: Minnesota Zip: 55961 Sector: Renewable Energy, Wind energy Product: Minesota-based wind development company tasked with developing...

484

Sandia National Laboratories: river current energy converters  

NLE Websites -- All DOE Office Websites (Extended Search)

is a partnered effort to develop marine hydrokinetic (MHK) reference models (RMs) for wave energy converters and tidal, ocean, and river current energy converters. The RMP team...

485

Financing Solutions | Department of Energy  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

Solution Center Financing Solutions Financing Solutions Transitioning to a clean energy economy requires innovative financing solutions that enable state, local, and tribal...

486

Restart of K-Reactor, Savannah River Site: Safety evaluation report  

SciTech Connect

This Safety Evaluation Report (SER) focuses on those issues required to support the restart of the K-Reactor at the Savannah River Plant. This SER provides the safety criteria for restart and documents the results of the staff reviews of the DOE and operating contractor activities to meet these criteria. To develop the restart criteria for the issues discussed in this SER, the Savannah River Restart Office and Savannah River Special Projects Office staffs relied, when possible, on commercial industry codes and standards and on NRC requirements and guidelines for the commercial nuclear industry. However, because of the age and uniqueness of the Savannah River reactors, criteria for the commercial plants were not always applicable. In these cases, alternate criteria were developed. The restart criteria applicable to each of the issues are identified in the safety evaluations for each issue. The restart criteria identified in this report are intended to apply only to restart of the Savannah River reactors. Following the development of the acceptance criteria, the DOE staff and their support contractors evaluated the results of the DOE and operating contractor (WSRC) activities to meet these criteria. The results of those evaluations are documented in this report. Deviations or failures to meet the requirements are either justified in the report or carried as open or confirmatory items to be completed and evaluated in supplements to this report before restart. 62 refs., 1 fig.

Not Available

1991-04-01T23:59:59.000Z

487

Divisional isolation using electro-pneumatic controls at Entergy`s River Bend Power Station  

SciTech Connect

In 1991, The Service Water System at River Bend Nuclear Plant was modified from an open flume system to a closed system. Closing the system presented some unique challenges to the Design Engineering staff with respect to compliance to The Nuclear Regulatory Commission`s Regulatory Guide 1.75 (RG 1.75). This paper will explain the mechanical and electrical changes made to the plant in order to maintain compliance with the applicable regulations and the reasoning for the design decisions involved.

Finkenaur, R.G. III [Entergy Operations, Inc., St. Francisville, LA (United States). River Bend Station

1995-10-01T23:59:59.000Z

488

Upper White River Watershed Alliance Upper White River Watershed Alliance (UWRWA)  

E-Print Network (OSTI)

Upper White River Watershed Alliance Upper White River Watershed Alliance (UWRWA) P.O. Box 2065 integrity of the White River ecosystem. To successfully accomplish the vision of UWRWA, a 16-county was formed. It exists to improve and protect water quality on a watershed basis in the larger Upper White

489

Nuclear Medicine CT Angiography  

E-Print Network (OSTI)

Nuclear Medicine CT Angiography Stress Testing Rotation The Nuclear Medicine/CT angiography. Understand the indications for exercise treadmill testing and specific nuclear cardiology tests, safe use Level 2 proficiency in performing and interpreting cardiac nuclear imaging tests. Progression

Ford, James

490

Nuclear Forensics | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

Forensics | National Nuclear Security Administration Forensics | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Nuclear Forensics Home > About Us > Our Programs > Emergency Response > Responding to Emergencies > Nuclear Forensics Nuclear Forensics Forensics Operations The National Technical Nuclear Forensics (NTNF) program is a Homeland Security Council and National Security

491

Nuclear structure and nuclear reactions | Argonne Leadership...  

NLE Websites -- All DOE Office Websites (Extended Search)

the production Automatic Dynamic Load Balancing (ADLB) library on the BGP. Steve Pieper, Argonne National Laboratory Nuclear structure and nuclear reactions PI Name: James Vary PI...

492

Audit Report National Nuclear Security Administration Nuclear...  

Energy.gov (U.S. Department of Energy (DOE)) Indexed Site

National Nuclear Security Administration Nuclear Weapons Systems Configuration Management DOEIG-0902 March 2014 U.S. Department of Energy Office of Inspector General Office of...

493

Nuclear Resonance Fluorescence for Nuclear Materials Assay  

E-Print Network (OSTI)

to learn MCNPX and nuclear safeguards, Bill B. , Steve K. ,Introduction 1.1 Nuclear Safeguards . . . . . . . . . . . .Programme to IAEA Safeguards. STUK-YTO-TR 170. Helsinki

Quiter, Brian Joseph

2010-01-01T23:59:59.000Z

494

Civilian Nuclear Programs  

NLE Websites -- All DOE Office Websites (Extended Search)

Civilian Nuclear Programs Civilian Nuclear Programs Civilian Nuclear Programs Los Alamos is committed to using its advanced nuclear expertise and unique facilities to meet the civilian nuclear national security demands of the future. CONTACT US Program Director Bruce Robinson (505) 667-1910 Email Los Alamos partners extensively with other laboratories, universities, industry, and the international nuclear community to address real-world technical challenges The Civilian Nuclear Programs Office is the focal point for nuclear energy research and development and next-generation repository science at Los Alamos National Laboratory. The Civilian Nuclear Programs Office manages projects funded by the Department of Energy's offices of Nuclear Energy Environmental Management Nuclear Regulatory Commission

495

Development and Implementation of a Comprehensive Program to Deal with Canada's Nuclear Legacy Liabilities  

SciTech Connect

The Government of Canada nuclear legacy liabilities have resulted from 60 years of nuclear research and development (R and D) carried out on behalf of Canada by the National Research Council (1944 to 1952) and Atomic Energy of Canada Limited (AECL, 1952 to present). These liabilities are largely located at AECL research sites, and consist of shutdown research buildings (including several prototype and research reactors), a wide variety of buried and stored wastes, and contaminated lands. The shutdown buildings and contaminated lands need to be safely decommissioned to meet federal regulatory requirements, and long-term solutions need to be developed and implemented for management of the wastes. More than half of the liabilities are the result of Cold War activities during the 1940's, 50's and early 60's. The remaining liabilities stem from R and D for medical isotopes and nuclear reactor technology, as well as national science programs. About 70 percent of the liabilities are located at AECL's Chalk River Laboratories (CRL) in Ontario, and a further 20 percent are located at AECL's shutdown Whiteshell Laboratories in Manitoba. The remaining 10 percent relate largely to three shutdown prototype reactors in Ontario and Quebec, which were key to the developmental stage of Canada's CANDU reactor technology. The inventory of legacy waste includes spent fuel, high-level, intermediate-level and low-level solid and liquid radioactive waste, and wastes (largely contaminated soils) from site clean-up work across Canada. Most of the wastes are in raw, unconditioned form, and limited characterization information is available for the wastes generated in past decades. In many cases unique and potentially costly solutions will be required to recover, handle and process the wastes. In conclusion: the Government of Canada has initiated a program to deal with nuclear legacy liabilities dating back to the Cold War and the birth of nuclear technologies and medicine in Canada. The 5-year start-up phase will address immediate health, safety and environmental priorities, as well as provide the facilities, studies and plans required for subsequent phases. Over the next few years, the long-term strategy will be further developed and refined, and public consultations are planned to inform this work and decisions on the next phase of the strategy.

Brown, Peter; Metcalfe, Douglas; Blanchette, Marcia [Natural Resources Canada, 580 Booth Street, Ottawa, Ontario, K1A 0E4 (Canada); Dolinar, George; Halpenny, Steven; Purdy, Chris; Smith, David; Kupferschmidt, William [Atomic Energy of Canada Limited, Chalk River, Ontario, K0J 1J0 (Canada)

2008-01-15T23:59:59.000Z

496

Theory of nuclear reactions  

SciTech Connect

The book presents a theory of nuclear reaction. An account is given of the nonrelativistic nuclear reaction theory. The R - matrix description of nuclear reactions is considered and the dispersion method is formulated. Mechanisms of nuclear reactions and their relationship are studied in detail. Attention is paid to nuclear reactions involving the compound nuclear formation and to direct nuclear processes. The optical model the diffraction approach and high - energy diffraction nuclear processes involving composite particles are discussed.

Sitenko, A.G.

1990-01-01T23:59:59.000Z

497

Technical solutions to nonproliferation challenges  

SciTech Connect

The threat of nuclear terrorism is real and poses a significant challenge to both U.S. and global security. For terrorists, the challenge is not so much the actual design of an improvised nuclear device (IND) but more the acquisition of the special nuclear material (SNM), either highly enriched uranium (HEU) or plutonium, to make the fission weapon. This paper provides two examples of technical solutions that were developed in support of the nonproliferation objective of reducing the opportunity for acquisition of HEU. The first example reviews technologies used to monitor centrifuge enrichment plants to determine if there is any diversion of uranium materials or misuse of facilities to produce undeclared product. The discussion begins with a brief overview of the basics of uranium processing and enrichment. The role of the International Atomic Energy Agency (IAEA), its safeguard objectives and how the technology evolved to meet those objectives will be described. The second example focuses on technologies developed and deployed to monitor the blend down of 500 metric tons of HEU from Russia's dismantled nuclear weapons to reactor fuel or low enriched uranium (LEU) under the U.S.-Russia HEU Purchase Agreement. This reactor fuel was then purchased by U.S. fuel fabricators and provided about half the fuel for the domestic power reactors. The Department of Energy established the HEU Transparency Program to provide confidence that weapons usable HEU was being blended down and thus removed from any potential theft scenario. Two measurement technologies, an enrichment meter and a flow monitor, were combined into an automated blend down monitoring system (BDMS) and were deployed to four sites in Russia to provide 24/7 monitoring of the blend down. Data was downloaded and analyzed periodically by inspectors to provide the assurances required.

Satkowiak, Lawrence [Director, Nonproliferation, Safeguards and Security Programs, Oak Ridge National Laboratory, Oak Ridge, Tennessee (United States)

2014-05-09T23:59:59.000Z

498

Comparative Evaluation of Generalized River/Reservoir System Models  

E-Print Network (OSTI)

This report reviews user-oriented generalized reservoir/river system models. The terms reservoir/river system, reservoir system, reservoir operation, or river basin management "model" or "modeling system" are used synonymously to refer to computer...

Wurbs, Ralph A.

499

Wild and Scenic Rivers Act | Open Energy Information  

Open Energy Info (EERE)

Rivers Act Jump to: navigation, search OpenEI Reference LibraryAdd to library Legal Document- StatuteStatute: Wild and Scenic Rivers ActLegal Abstract This Act classifies rivers as...

500

Application of a 2-D particle tracking model to simulate entrainment of winter flounder larvae at the Millstone Nuclear Power Station  

E-Print Network (OSTI)

A 2-D random walk model, developed by Dimou (1989) as part of this research project, was used to simulate entrainment at the Millstone Nuclear Power Station of winter flounder larvae hatched within Niantic River.

Dimou, Nadia K.

1989-01-01T23:59:59.000Z