Powered by Deep Web Technologies
Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

Fundamentals of RMA  

Science Journals Connector (OSTI)

The purpose of this chapter is to review briefly the fundamental principles and methods of RMA. We assume that you have prior knowledge of RMA and require only a refresher. If you require more than a refresher...

Mark H. Klein; Thomas Ralya; Bill PollakÖ

1993-01-01T23:59:59.000Z

2

Investigating High Performance RMA Interfaces for the MPI-3 Standard  

SciTech Connect (OSTI)

The MPI-2 Standard, released in 1997, defined an interface for one-sided communication, also known as remote memory access (RMA). It was designed with the goal that it should permit efficient implementations on multiple platforms and networking technologies, and also in heterogeneous environments and non-cache-coherent systems. Nonetheless, even 12 years after its existence, the MPI-2 RMA interface remains scarcely used for a number of reasons. This paper discusses the limitations of the MPI-2 RMA specification, outlines the goals and requirements for a new RMA API that would better meet the needs of both users and implementers, and presents a strawman proposal for such an API. We also study the tradeoffs facing the design of this new API and discuss how it may be implemented efficiently on both cache-coherent and non-cache-coherent systems.

Tipparaju, Vinod [ORNL; Gropp, William D [University of Illinois, Urbana-Champaign; Thakur, Dr. Rajeev [Argonne National Laboratory (ANL); Traff, Jesper [NEC Europe Ltd; Ritzdorf, Hubert [NEC Europe Ltd

2009-01-01T23:59:59.000Z

3

MHK Technologies/CoRMaT | Open Energy Information  

Open Energy Info (EERE)

CoRMaT CoRMaT < MHK Technologies Jump to: navigation, search << Return to the MHK database homepage CoRMaT.jpg Technology Profile Technology Type Click here Axial Flow Turbine Technology Readiness Level Click here TRL 5 6 System Integration and Technology Laboratory Demonstration Technology Description The CoRMat employs two closely spaced contra rotating rotors driving a contra rotating electrical generator The first rotor has three blades rotating in a clockwise direction while the second rotor located directly behind the first has four blades rotating in an anti clockwise direction The turbine directly drives a flooded permanent magnet contra rotating generator without a gearbox The flooded generator is cooled passively by the water eliminating parasitic energy losses associated with gearbox driven water tight active oil based gearbox generator cooling systems and power absorbing shaft seals

4

Course info Machine Learning  

E-Print Network [OSTI]

Course info Machine Learning Real life problems Lecture 1: Machine Learning Problem Qinfeng (Javen) Shi 28 July 2014 Intro. to Stats. Machine Learning COMP SCI 4401/7401 Qinfeng (Javen) Shi Lecture 1: Machine Learning Problem #12;Course info Machine Learning Real life problems Table of Contents I 1 Course

Shi, Qinfeng "Javen"

5

Advertisements Info for Advertisers  

E-Print Network [OSTI]

Advertisements Info for Advertisers Browse By Issue Select Decade Select Volume Select Issue Stay Current Get your research ASAP. e-Alerts | RSS Feeds Advertisements Thematic Collection on Chemistry://pubs.acs.org/page/crtoec/thematic/dna-damage.html 1 of 4 11/10/09 11:51 AM #12;Info for Advertisers Proteomic Analysis of DNA-Protein Cross

Gates, Kent. S.

6

U.S. DEP_~TIVffNT OFl1N1!RGY EERE PROJECT MANAGEMENT CENTER  

Broader source: Energy.gov (indexed) [DOE]

DEP_~TIVffNT OFl1N1!RGY DEP_~TIVffNT OFl1N1!RGY EERE PROJECT MANAGEMENT CENTER NliPA DI!Tl!RMINATION RECIPIENT: UALR Nanotechnology Center PROJECT TITLE: Nanostructred Solar Cells Page 1 of2 STATE: AR Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number em Number FY 2010 COP DE-FG36-06G086072 GF0-06-067b G066702 Based on my review onbe information conce.-niog the propoud action, as NEPA Compliance OWletr (authori7.ed under DOE Order45I.1A), I hJl\'c made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: 83.6 Siting, oonstrudion (or modification), operation, and decommissioning of facilities for indoor bench-scale research projects and oonventionallaboratory operations (for example, preparation of chemical standards and sample analysis):

7

pine (mail utility info)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

pine (mail utility info) pine (mail utility info) Basics, FAQ, etc, On our UNIX machines, module load pine The line module load pine should ALSO be in the file ~/.rc/user_modules (The pine module also includes pico) pine usage with IMAP4 (UNIX) Moving pine email files into IMAP4 LBNL UNIX info on pine links to Pine Information Center Pine 4.2.1/Solaris: Forwarding as attachment; the following procedure has proved successful for at least some users: Check the option "enable-full-header-cmd". To get to this option, 1. M (Main Menu) 2. S (Setup) "Choose a setup task from the menu below :" 3. C (Configure) 4. Scroll down to "Advanced Command Preferences", and press "X" to set "enable-full-header-cmd". It looks like this: ================================================================

8

CONTACT INFO BUILDING SHELTER  

E-Print Network [OSTI]

CONTACT INFO SIGNALS BUILDING SHELTER THE DISABLED B.E.R.T. TEAM B.E.R.T.* EMERGENCY RESPONSE GUIDE, SIUC*Building Emergency Response Team Siren* Long Blast: Tornado High/Low: Any Other Emergency Radio needed. 2. Find two or three B.E.R.T. "buddies" who are willing to help you in the event of an emergency

King, David G.

9

Past Restoration Fund Info  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Rates > Past Restoration Rates > Past Restoration Fund Info Past Restoration Fund Info FY 2013 Restoration Fund SNR Letter to Customers Regarding Revision to FY13 Restoration Fund Obligation Mid-Year Adjustment (June 19, 2013) (PDF - 1146 KB) SNR Letter to Customers Regarding FY13 Restoration Fund Obligation Mid-Year Adjustment (April 15, 2013) (PDF - 829 KB) SNR Letter to Customers Regarding Restoration Fund Obligations for FY 2013 (August 8, 2012) (PDF - 325 KB) FY 2012 Restoration Fund SNR Letter to Customers Regarding Restoration Fund Obligations for FY 2012 (August 9, 2011) (PDF - 340 KB) Mid Year Adjustment to the FY 2012 Restoration Fund Payment (April 18, 2012) (PDF - 174 KB) FY 2011 Restoration Fund SNR Letter to Customers Regarding Restoration Fund Obligations for FY 2011 (August 20, 2010) (PDF - 705 KB)

10

BUDGET DETAILS BOOK FOUR DPRMN OF N RGY U.S. Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

BUDGET DETAILS BUDGET DETAILS BOOK FOUR DPRMN OF N RGY U.S. Department of Energy Transition Team Budget Book Office of the Chief Financial Officer Office of Budget 1. Budget Overview 2. Funding Tables and Charts 3. Appropriations Subcommittees 4. Program Overviews 5. Major Construction Projects, Activities, and Initiatives 6. Laboratory and State Data Acronyms commonly used in budget documents. ACI American Competitiveness Initiative AEI Advanced Energy Initiative AFP Approved Funding Program (monthly financial plan that dictates how funding is to be executed) AlP Accelerator Improvement Project Ames Ames National Laboratory ANL Argonne National Laboratory B&R Budget and Reference Code BA Budget Authority BAPL Bettis Atomic Power Laboratory BNL Brookhaven National Laboratory BO Budget Outlay

11

U.S DEPARTMENT OFl!NllRGY EERE PROJ ECT MANAG EMENT CENTER NEPA D:E=llNATION  

Broader source: Energy.gov (indexed) [DOE]

S DEPARTMENT OFl!NllRGY S DEPARTMENT OFl!NllRGY EERE PROJ ECT MANAG EMENT CENTER NEPA D:E=llNATION R[CIPIENT: Scientific Solutions, Inc. STATE: NH PROJECf TITLE: Underwater Active Acoustic Monitoring Network for Marine and Hydrokinetic Energy Projects FUnding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number elD Number DE· FQA'{)()()293 DE-EEOOO3639 GF()'{)()()3639-002 G03639 Based on my review ofthe Information concerning the proposed aelion,.1.5 NEPA Compliance Officer (authorized under DOE Order 451.1A), I have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: B3.3 Research related to Field and laboratory research, inventory, and information collection activities that are directly conservation of fi sh, wildlife, related to the conservation of fish and wildlife resources or to the protection of cultural

12

DFPARThIFNT OFENJ!RGY EERE PROJECT MANAGEMENT CENTER NEPA DETER1>llNATION  

Broader source: Energy.gov (indexed) [DOE]

DFPARThIFNT OFENJ!RGY DFPARThIFNT OFENJ!RGY EERE PROJECT MANAGEMENT CENTER NEPA DETER1>llNATION Page I of3 RECIPIENT :Oklahoma State University - New Product Development Center ST ATE: OK PROJEL. TITLE; Manufacturing Improvement Program for the Oil and Gas Industry Supply Chain Funding Opportunity Announcement Number JIAC2012AM Procurement Instrument Number DE-EE0006029 NKPA Control Number GFO-OOO6029-001 CID Number G06029 Based on my review ofthe information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE O rder 451.IA), I have made the following determination : CX, EA, EIS APPENDIX AND NUMBER : Description: A9 Information gathering, analysis, and dissemination A11 Technical advice and assistance to organizations Information gathering (including, but not limited to, literature surveys, inventories, site visits, and

13

U.S. DEPARTMENT OF ENl'RGY EERE PROJECT MANAGEMENT CENTER NFPA DFIFIU.llNATION  

Broader source: Energy.gov (indexed) [DOE]

ENl'RGY ENl'RGY EERE PROJECT MANAGEMENT CENTER NFPA DFIFIU.llNATION RECIPIENT: Unlverslty of Maine at Presque Isle PROJECT TITLE: Solar Energy for the North Page I of2 STATE: ME Funding Opportunity Announcement Number FY 2010 COP Procurt'mcnt Instrument Number EEOOO3185 NEPA Control Number cm Number GFO-OO03185-OO1 EE3185 Based on my rt'yiew oftbe information concerning tbe proposed action, as NEPA Compliance Officer (authorized under DOE Order 4SI.lA), I baye made the following determination: C X, EA, EIS APPENDIX AND NUMBER: Description: A9 Information gathering (including, but not limited to, literature surveys, inventories, audits), data analysis (including computer modeling), document preparation (such as conceptual design or feasibility studies, analytical energy supply

14

US. DEPARThIENI OFI!Nl!RGY EERE PROJECT MANAGEMDH CENTER NEPA DI!TI!RMINATION  

Broader source: Energy.gov (indexed) [DOE]

DEPARThIENI OFI!Nl!RGY DEPARThIENI OFI!Nl!RGY EERE PROJECT MANAGEMDH CENTER NEPA DI!TI!RMINATION Page I of2 RECIPIENT: Board of Trustees of the Leland Stanford Junior University STATE: CA PROJECr TlTl.E : PVMI Bay Area Photovoltaic Consortium Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number elD Numbn OE-FOA-000259, PV DE-EEOOO4946 GFO-OO4946-004 G04946 Based on my review ofthe information concerning the proposed action, as NEPA Compliance Officer (authorb,cd under DO": Order451.1A), I bave made the following determination: ex, EA, [IS APPENDIX AND NUMBER: Description: A9 Information gathering, analysis, and dissemination 83.15 Small-scale Indoor research and development projects using nanoscale materials Information gathering (including, but not limited to, literature surveys, inventories, site visits, and

15

U.S. DEPARTMENT OF I!NI!RGY EERE PROJECT MANAGEMENT CENTER NFPA DETTIUlIINATION  

Broader source: Energy.gov (indexed) [DOE]

I!NI!RGY I!NI!RGY EERE PROJECT MANAGEMENT CENTER NFPA DETTIUlIINATION RECIPIENT:Magelian Midstream Partners. LP (SEP Sub-recipient of the Iowa Office of Energy STATE: IA Independence) PROJECf TITLE: Magellan Des Moines Biodiesel Terminal Project Page 10f3 Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number DE FDA 000052 OE-EE-OOOO162 GFQ-OOOO162-016 EE162 Based on my review orlbe information concerning tbe proposed action, as NEPA Compliance Officer (authorl7.ed under DOE Order 451.JA), I have made the following determination: ex, EA, ~:IS APPI<:NDIX AND NUMBER: Description: 85.1 Actions to oonserve energy, demonstrate potential energy conservation, and promote energy-efficiency that do not increase the indoor concentrations of potentially harmful substances. These actions may involve financial and techmcal

16

US DEPARTMENT OF ENJ!RGY EERE PROJECT MANAGEMENT CENTER NFPA DF1'EIU.llNATION  

Broader source: Energy.gov (indexed) [DOE]

ENJ!RGY ENJ!RGY EERE PROJECT MANAGEMENT CENTER NFPA DF1'EIU.llNATION Page 1 of2 RECIPIENT:Ben Franklin Technology Partners STATE: PA PROJECf TITLE: Altemative and Clean Energy Technology Development and Commercialization Initiative Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number DE-EEOOO1967 GF0-0001967 -001 NT1967 Based on my review orlhe informalion concerning the proposed action,.s NEPA Compliance Officer (authorized under DOE Order 451.IA), I have made the following determination: ex, EA, EIS APP .. : NDIX AND NUMBER : Description: 83.6 Small-scale research and development, labo rat ory operations, and pilot projects Rational for detennination: Siting, construction. modification, operation, and decommissioning of facilities for smallscale research

17

u.s. DEPARTMENT OF ENl!RGY EERE PROJECT MANAGEMENT CENTER NEPA DFTEIu.llNATION  

Broader source: Energy.gov (indexed) [DOE]

ENl!RGY ENl!RGY EERE PROJECT MANAGEMENT CENTER NEPA DFTEIu.llNATION RECIPIENT:Oklahoma Department of Commerce PROJECT TITL.E: DE EE 0000922 Warr Aetes Ground Source Heat Project w/HVAC retrofit Page 1 of2 STATE : OK Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number em Number DE FDA 0000013 DE EE 0000922 0 Based on my review orlh" information concerning (he proposed action, as NEPA Compliance Officer (authorized under DOE Order 4Sl.lA), I have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: 85.1 Actions to conserve energy, demonstrate potential energy conservation, and promote energy-efficiency thaI do not increase the indoor concentrations of potentially harmful substances. These actions may involve financial and technical

18

DEPARTMENT OFENl!RGY EERE PROJECT MANAGEMENT CENTER Nl!PA DETl!lU.nNATION  

Broader source: Energy.gov (indexed) [DOE]

OFENl!RGY OFENl!RGY EERE PROJECT MANAGEMENT CENTER Nl!PA DETl!lU.nNATION RECIPIENT:Atargis Energy Inc. PROJECT TITLE : Cycloidal Wave Energy Converter Page lof2 STATE: CO Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number elD Number DE·FOA-OOOO293 DE-EEOOO3635 GFQ-000363S-001 0 Based on my review of tbe information concerning tbe proposed action, as NEPA Compliance Officer (authorized under DOE Order 451.IA). I have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: A9 Information gathering (including, bul not limited to, literature surveys, inventories, audits), data analysis (including computer modeling), document preparation (such as conceptual design or feasibility studies. analytical energy supply

19

MHK Projects/Contra Rotating Marine Turbine CoRMaT | Open Energy  

Open Energy Info (EERE)

Contra Rotating Marine Turbine CoRMaT Contra Rotating Marine Turbine CoRMaT < MHK Projects Jump to: navigation, search << Return to the MHK database homepage Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":5,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"500px","height":"350px","centre":false,"title":"","label":"","icon":"File:Aquamarine-marker.png","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":55.6655,"lon":-4.93682,"alt":0,"address":"","icon":"http:\/\/prod-http-80-800498448.us-east-1.elb.amazonaws.com\/w\/images\/7\/74\/Aquamarine-marker.png","group":"","inlineLabel":"","visitedicon":""}]}

20

Field studies of wildlife at Rocky Mountain Arsenal (RMA): Relevance to risk assessment  

SciTech Connect (OSTI)

Field studies of wildlife at contaminated sites can provide information about past and present effects, but are limited in spatial and temporal resolution. They cannot be used to predict future risks without utilizing risk assessment methodologies, including exposure-response relationships. RMA is unusual among Superfund sites in that its large size permits the existence of diverse wildlife populations in peripheral areas, despite high levels of contamination in central areas. Risk assessments conducted at RMA predict steep gradients in severity of effects from high in the central areas to low in peripheral areas. The population effects of such gradients will vary among species, depending on their exposure ranges and dispersal behavior. Effects on survival or reproduction in core areas may be partly or wholly offset by immigration from peripheral or offsite areas. Most field studies of wildlife populations at RMA have been conducted at scales inappropriate for ecological risk characterization, and have not been integrated with information on patterns of contamination or exposure. Hence, they do not provide much useful information to complement or modify the results of risk assessments. More focused field studies are needed to provide useful information on wildlife effects before and after remediation.

Nisbet, I.C.T. [I.C.T. Nisbet and Co., Inc., N. Falmouth, MA (United States); Swain, W.R. [ECO Logic, Inc., Ann Arbor, MI (United States); Star, I. [GeoTrans, Inc., Boulder, CO (United States)

1994-12-31T23:59:59.000Z

Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

InfoSpi Inc | Open Energy Information  

Open Energy Info (EERE)

InfoSpi Inc InfoSpi Inc Jump to: navigation, search Name InfoSpi Inc. Place Ft. Lauderdale, Florida Zip 33309 Sector Biofuels, Carbon Product Florida-based, OTC-quoted firm that plans to get involved in biofuels project development and has said it plans to start a hedge fund focused on carbon markets. References InfoSpi Inc.[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. InfoSpi Inc. is a company located in Ft. Lauderdale, Florida . References ‚ÜĎ "InfoSpi Inc." Retrieved from "http://en.openei.org/w/index.php?title=InfoSpi_Inc&oldid=346906" Categories: Clean Energy Organizations Companies Organizations Stubs What links here Related changes Special pages

22

H + CD4 Abstraction Reaction Dynamics: Product Energy Partitioning Wenfang Hu, Gyo1rgy Lendvay, Diego Troya,# George C. Schatz,*, Jon P. Camden,|  

E-Print Network [OSTI]

H + CD4 Abstraction Reaction Dynamics: Product Energy Partitioning Wenfang Hu, Gyo1rgy LendvayVember 12, 2005 This paper presents experimental and theoretical studies of the product energy partitioning of the energy appears in product translation at energies just above the reactive threshold; however, HD

Zare, Richard N.

23

info  

Broader source: Energy.gov (indexed) [DOE]

3 3 AUDIT REPORT REVIEW OF THE U.S. DEPARTMENT OF ENERGY'S INFORMATION MANAGEMENT SYSTEMS U.S. DEPARTMENT OF ENERGY OFFICE OF INSPECTOR GENERAL OFFICE OF AUDIT SERVICES AUGUST 1998 August 10, 1998 MEMORANDUM FOR THE SECRETARY FROM: Gregory H. Friedman Acting Inspector General SUBJECT: INFORMATION : Audit Report on "Review of the U.S. Department of Energy's Information Management Systems" BACKGROUND The Federal emphasis on reinventing Government and the end of the Cold War have driven change at the Department of Energy. In the midst of this change, the Department' s Information Architecture Program was initiated. Over the past several years, the Department realized that information management and strategic planning efforts must focus on the utility and management of information,

24

Template:ContactInfo | Open Energy Information  

Open Energy Info (EERE)

ContactInfo ContactInfo Jump to: navigation, search This is the ContactInfo template. It is designed for use by Companies, Organizations and Government Agencies. To specify the contact info for an arganization, go to that organization's page and click Edit with Form. Parameters For - The branch of the organizations or specialty with which this contact is associated. (i.e. "Biomass", "New Applications", etc. Default is "GeneralInfo".) This will be used to differentiate this contact from others associated with the same organization. Name - The name Topics this page discusses. (optional) When a person's name is unknown, a position name will often suffice. Phone - The contact's phone number. Website - A web page URL with additional contact info.

25

Contact Info | Occupational Medicine Clinic  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Occupational Medicine Clinic Occupational Medicine Clinic Promoting optimal physical and emotional health through quality care that is convenient, confidential & individualized. Home Health Promotion Program Employee Assistance Program Contact Contact Info Occupational Medicine Joseph Falco, M.D. 344-3666 OMC Manager/Supervising Physician Staff Physicians Carol Davis, D.O. 344-3667 Board Certified - Occupational Medicine Eva Erens, M.D. 344-3668 Board Certified - Internal Medicine Jaishree Subramani, M.D. MPH 344-3669 Board Certified - Internal Medicine Health Promotion Program Michael Thorn, RN, MBA 344-8612 Health Promotion/Disease Prevention Program Employee Assistance Program (EAP) Nancy Losinno, LCSW, CEAP 344-4567 EAP Manager Linda DiPierro 344-2733 Senior Occupational Medicine Assistant

26

U.S. DEPARTMENT OF ENl!RGY EERE PROJECT MANAGEMENT CENTER Nl!PA DETl!R1.llNATION  

Broader source: Energy.gov (indexed) [DOE]

ENl!RGY ENl!RGY EERE PROJECT MANAGEMENT CENTER Nl!PA DETl!R1.llNATION RECIPIENT: Magma Energy (U.S .) Corp. Page 1 of3 STATE: NV PROJECf TITLE: Recovery Act: A 3D·3C Reflection Seismic Survey and Data Integration to Identify the Seismic Response of Fractures and Permeable Zones over a Known Geothermal Resource: Soda lake , Churchill Co" NV Funding Opportunity Announcement Number PrO(u.-ement Instrument Number NEPA Control Number em Number 0000109 DE-EEOOO2832 GFO-OOO2832·003 0 Based on my review oftbe informatioD concerning the proposed action, as NEPA Compliance Officer (authori7.ed under DOE Order 451.IA), I have made the following determination: ex, EA, [IS APPENDIX AND NUMBER: Description: A9 Information gathenng (including , but nollimiled 10, literature surveys, inventories, audits), data analYSIS (including

27

Property:GBIG/NeighborhoodInfo | Open Energy Information  

Open Energy Info (EERE)

NeighborhoodInfo Jump to: navigation, search This is a property of type String. Retrieved from "http:en.openei.orgwindex.php?titleProperty:GBIGNeighborhoodInfo&oldid509342"...

28

Sustainability Double Degree Double Degree Info  

E-Print Network [OSTI]

Sustainability Double Degree Double Degree Info: · 36 credits in B for graduation. Sustainability Core: Take each course below for a total of 17 -20 credits. Term/Grade Course _____ ____ *NR 350 (4) Sustainable

Gr√ľnwald, Niklaus J.

29

ICREC and InfoEd Approval Procedure Flowchart Researcher ticks "Does this research include any aspects that may have ethical  

E-Print Network [OSTI]

implications can relate to health or non- health issues, and to proposals that will be sent to ICREC or COREC aspects that may have ethical implications?" on the InfoEd cover page, fills in and attaches the ICREC this research include any aspects that may have ethical implications?" on the InfoEd cover page, fills

30

InfoPower | Open Energy Information  

Open Energy Info (EERE)

InfoPower InfoPower Jump to: navigation, search Name InfoPower Place Madrid, Spain Zip 28039 Product Information provider for the power sector in Spain Coordinates 40.4203¬į, -3.705774¬į Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":40.4203,"lon":-3.705774,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

31

Property:LithologyInfo | Open Energy Information  

Open Energy Info (EERE)

LithologyInfo LithologyInfo Jump to: navigation, search Property Name LithologyInfo Property Type Text Subproperties This property has the following 93 subproperties: 2 2-M Probe Survey A Active Seismic Methods Active Sensors Aerial Photography Aeromagnetic Survey Analytical Modeling C Caliper Log Cation Geothermometers Cement Bond Log Chemical Logging Compound and Elemental Analysis Conceptual Model Controlled Source Frequency-Domain Magnetics Cross-Dipole Acoustic Log D Data Acquisition-Manipulation Data Collection and Mapping Data Techniques Data and Modeling Techniques Drilling Methods E Electric Micro Imager Log Electromagnetic Sounding Methods Elemental Analysis with Fluid Inclusion F FLIR Fault Mapping Field Techniques Flow Test Fluid Inclusion Analysis Fluid Lab Analysis Formation Testing Techniques

32

Property:StratInfo | Open Energy Information  

Open Energy Info (EERE)

StratInfo StratInfo Jump to: navigation, search Property Name StratInfo Property Type Text Subproperties This property has the following 82 subproperties: 2 2-M Probe Survey A Active Seismic Methods Airborne Electromagnetic Survey Analytical Modeling C Caliper Log Cation Geothermometers Cement Bond Log Chemical Logging Compound and Elemental Analysis Conceptual Model Controlled Source Frequency-Domain Magnetics Cuttings Analysis D Data Acquisition-Manipulation Data Techniques Data and Modeling Techniques Drilling Methods E Earth Tidal Analysis Electric Micro Imager Log Electromagnetic Sounding Methods Elemental Analysis with Fluid Inclusion F FLIR Flow Test Fluid Inclusion Analysis Fluid Lab Analysis Formation Testing Techniques Frequency-Domain Electromagnetic Survey G Gas Geothermometry

33

Property:HydroInfo | Open Energy Information  

Open Energy Info (EERE)

HydroInfo HydroInfo Jump to: navigation, search Property Name HydroInfo Property Type Text Subproperties This property has the following 77 subproperties: 2 2-M Probe Survey A Acoustic Logs Active Seismic Methods Aeromagnetic Survey Analytical Modeling C Caliper Log Cation Geothermometers Cement Bond Log Conceptual Model Core Analysis Core Holes Cuttings Analysis D Data Acquisition-Manipulation Data Techniques Data and Modeling Techniques Drilling Methods E Electric Micro Imager Log Electromagnetic Sounding Methods Elemental Analysis with Fluid Inclusion F FLIR Formation Testing Techniques Frequency-Domain Electromagnetic Survey G Gamma Log Gas Flux Sampling Gas Geothermometry Geochemical Data Analysis G cont. Geochemical Techniques Geodetic Survey Geophysical Methods Geothermal Literature Review

34

Property:ThermalInfo | Open Energy Information  

Open Energy Info (EERE)

Property Property Edit with form History Facebook icon Twitter icon ¬Ľ Property:ThermalInfo Jump to: navigation, search Property Name ThermalInfo Property Type Text Subproperties This property has the following 93 subproperties: A Acoustic Logs Active Seismic Methods Active Sensors Aeromagnetic Survey Airborne Electromagnetic Survey Analytical Modeling C Caliper Log Cation Geothermometers Cement Bond Log Conceptual Model Controlled Source Frequency-Domain Magnetics Cross-Dipole Acoustic Log Cuttings Analysis D Data Acquisition-Manipulation Data Collection and Mapping Data Techniques Data and Modeling Techniques Density Log Direct-Current Resistivity Survey Drilling Methods E Earth Tidal Analysis Electric Micro Imager Log Electromagnetic Sounding Methods Elemental Analysis with Fluid Inclusion

35

Dale Meade Some promised international collaboration info  

E-Print Network [OSTI]

Dale Meade Some promised international collaboration info 1 message Glen Wurden to the German tokamak (fast imaging equipment to study pellets). The collaboration was possible, because I met was my collaborator then later in Germany. There I met, and became integrated with the entire ASDEX team

36

V-050: IBM InfoSphere Information Server Multiple Vulnerabilities |  

Broader source: Energy.gov (indexed) [DOE]

0: IBM InfoSphere Information Server Multiple Vulnerabilities 0: IBM InfoSphere Information Server Multiple Vulnerabilities V-050: IBM InfoSphere Information Server Multiple Vulnerabilities December 19, 2012 - 1:00am Addthis PROBLEM: IBM InfoSphere Information Server Multiple Vulnerabilities PLATFORM: The vulnerabilities are reported in versions prior to 9.1. ABSTRACT: Multiple vulnerabilities have been reported in IBM InfoSphere Information Server REFERENCE LINKS: Secunia Advisory SA51605 IBM Support home IBM InfoSphere Information Server, Version 9.1 fix list IMPACT ASSESSMENT: Medium DISCUSSION: Multiple vulnerabilities have been reported in IBM InfoSphere Information Server, where some have an unknown impact and others can be exploited by malicious users to bypass certain security restrictions. 1) An unspecified error exists in the InfoCenter component.

37

V-050: IBM InfoSphere Information Server Multiple Vulnerabilities |  

Broader source: Energy.gov (indexed) [DOE]

0: IBM InfoSphere Information Server Multiple Vulnerabilities 0: IBM InfoSphere Information Server Multiple Vulnerabilities V-050: IBM InfoSphere Information Server Multiple Vulnerabilities December 19, 2012 - 1:00am Addthis PROBLEM: IBM InfoSphere Information Server Multiple Vulnerabilities PLATFORM: The vulnerabilities are reported in versions prior to 9.1. ABSTRACT: Multiple vulnerabilities have been reported in IBM InfoSphere Information Server REFERENCE LINKS: Secunia Advisory SA51605 IBM Support home IBM InfoSphere Information Server, Version 9.1 fix list IMPACT ASSESSMENT: Medium DISCUSSION: Multiple vulnerabilities have been reported in IBM InfoSphere Information Server, where some have an unknown impact and others can be exploited by malicious users to bypass certain security restrictions. 1) An unspecified error exists in the InfoCenter component.

38

Template:InfoForPlace | Open Energy Information  

Open Energy Info (EERE)

InfoForPlace InfoForPlace Jump to: navigation, search This is the 'InfoForPlace' template. It should be called in the following format: {{InfoForPlace |place= |target= |var= |heading= |label= }} For example: {{InfoForPlace |place={{SUBJECTPAGENAME}} |target=Category:Research Institutions |var=num_institutions |heading=Registered Energy Research Institutions in {{SUBJECTPAGENAME}} |label=Institutions }} Edit the page to see the template text. Retrieved from "http://en.openei.org/w/index.php?title=Template:InfoForPlace&oldid=325497" Category: Experimental Templates What links here Related changes Special pages Printable version Permanent link Browse properties 429 Throttled (bot load) Error 429 Throttled (bot load) Throttled (bot load) Guru Meditation: XID: 1863773880 Varnish cache server

39

Info-Exch 2012 - Shirley Olinger Presentation | Department of...  

Office of Environmental Management (EM)

and Lessons Learned Workshop: Field Manager's Top Issues More Documents & Publications EM Recovery Act Lessons Learned (Olinger) Info-Exch 2012 - Thomas Johnson Presentation...

40

Energy for the future with Ris from nuclear power to sustainable energy Ris NatioNal laboRatoRy foR sustaiNable eNeRgy  

E-Print Network [OSTI]

Energy for the future ¬≠ with Ris√ł from nuclear power to sustainable energy Ris√ł NatioNal laboRatoRy foR sustaiNable eNeRgy edited by MoRteN JastRup #12;Energy for the future #12;Energy for the future ¬≠ with Ris√ł from nuclear power to sustainable energy Translated from 'Energi til fremtiden ¬≠ med Ris√ł fra

Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

NETL: Contact Info and Privacy Act Advisory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Contact Info and Privacy Act Advisory To contact us: National Energy Technology Laboratory 626 Cochrans Mill Road P.O. Box 10940 Pittsburgh, PA 15236-0940 Phone: 412-386-6167 PRIVACY ACT ADVISORY: Authority: 5 U.S.C. 301, 5 U.S.C. 552, Freedom of Information Act (FOIA); and Title 10, Code of Federal Regulations, Part 1004. Purpose: To allow individuals to file electronic FOIA requests; to track all FOIA requests from receipt to response to compile statistics for the Annual FOIA Report; to research and respond to FOIA requests; to maintain case files to comply with records disposal requirements; and to maintain an administrative record to support any litigation. Routine Use: Records related to the FOIA request will be maintained in DOE-55 "Freedom of Information and Privacy Act (FOIA/PA) Requests for Records." A record

42

Connecting ARC/INFO and SNACTor Project Report  

E-Print Network [OSTI]

Connecting ARC/INFO and SNACTor Project Report June 1991 Stuart C. Shapiro, Hans Chalupsky;Connecting ARC/INFO* and SNACTor --- Project Report1 Stuart C. Shapiro2 , Hans Chalupsky2 and Hsueh and reasoning system developed by Stuart C. Shapiro et al. at the State University of New York at Buffalo

California at Santa Barbara, University of

43

The Comparative Logistics Project www.ed-w.info  

E-Print Network [OSTI]

The Comparative Logistics Project www.ed-w.info The Impact of e-Commerce on the Japanese Raw Fish Supply Chain Edmund W. Schuster and Kazunari Watanabe #12;The Comparative Logistics Project www in the Japanese market #12;The Comparative Logistics Project www.ed-w.info 1. Introduction (continued) · E

Brock, David

44

Information for Development Program (infoDev) | Open Energy Information  

Open Energy Info (EERE)

Development Program (infoDev) Development Program (infoDev) Jump to: navigation, search Logo: Information for Development Program (infoDev) Name Information for Development Program (infoDev) Place Washington DC Coordinates 38.8951118¬į, -77.0363658¬į Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":38.8951118,"lon":-77.0363658,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

45

Alternative Fueling Station Locator App Provides Info at Your Fingertips |  

Broader source: Energy.gov (indexed) [DOE]

Alternative Fueling Station Locator App Provides Info at Your Alternative Fueling Station Locator App Provides Info at Your Fingertips Alternative Fueling Station Locator App Provides Info at Your Fingertips November 15, 2013 - 10:12am Addthis The Alternative Fueling Station Locator iPhone app helps you find fueling stations that offer electricity, natural gas, biodiesel, E85, propane, or hydrogen. | Energy Department The Alternative Fueling Station Locator iPhone app helps you find fueling stations that offer electricity, natural gas, biodiesel, E85, propane, or hydrogen. | Energy Department Shannon Brescher Shea Communications Manager, Clean Cities Program Smartphone users are familiar with the prompt, "Would you like this site to use your current location?" If you're looking for somewhere to fuel your

46

Alternative Fueling Station Locator App Provides Info at Your Fingertips |  

Broader source: Energy.gov (indexed) [DOE]

Alternative Fueling Station Locator App Provides Info at Your Alternative Fueling Station Locator App Provides Info at Your Fingertips Alternative Fueling Station Locator App Provides Info at Your Fingertips November 15, 2013 - 10:12am Addthis The Alternative Fueling Station Locator iPhone app helps you find fueling stations that offer electricity, natural gas, biodiesel, E85, propane, or hydrogen. | Energy Department The Alternative Fueling Station Locator iPhone app helps you find fueling stations that offer electricity, natural gas, biodiesel, E85, propane, or hydrogen. | Energy Department Shannon Brescher Shea Communications Manager, Clean Cities Program Smartphone users are familiar with the prompt, "Would you like this site to use your current location?" If you're looking for somewhere to fuel your

47

Secondary Energy InfoBook | Open Energy Information  

Open Energy Info (EERE)

Secondary Energy InfoBook Secondary Energy InfoBook Jump to: navigation, search Tool Summary Name: Secondary Energy Infobook and Secondary Infobook Activities Agency/Company /Organization: United States Department of Energy Sector: Energy Focus Area: Renewable Energy Resource Type: Training materials User Interface: Website Cost: Free Language: English Fact sheets about the major energy sources, electricity, efficiency, conservation,transportation, and emerging technologies. The teacher's infobook contains dozens of fact sheets about the major energy sources, electricity, energy efficiency, energy conservation, transportation, and emerging technologies. Detailed information covers an introduction to energy, the forms of energy, global climate change, the history of electricity, and information about the major energy sources. The

48

Donnerstag, 24. Juli 2003 Biomasse Info-Zentrum  

E-Print Network [OSTI]

Centre Biogas - fuel cell Dust engine/-turbine ORC--process Hot Gasturbine Gasification - engine-engine Steamprocess Bioethanol - engine Methanol - engine* Methanol - fuel cell* Co- Combustion Biogas Methan - fuel 8 Biomasse Info-Zentrum Biomass Information Centre Internal Combustion Engine, Biogas #12;Donnerstag

49

Chemistry in Higher What's available and where is the info?  

E-Print Network [OSTI]

Chemistry in Higher Education What's available and where is the info? What does studying chemistry? Where does it lead and what might a chemistry career look like? Dr. David Read, Director of Outreach 2013 #12;310 (294) HE courses with chemistry offered as a single subject hosted at 53 universities 699

Anderson, Jim

50

Developing the ability to model acid-rock interactions and mineral dissolution during the RMA stimulation test performed at the Soultz-sous-ForÍts EGS site, France  

Science Journals Connector (OSTI)

The Soultz Enhanced Geothermal System (EGS) reservoir's response to chemical stimulation is assessed by numerical simulation of coupled thermo-hydraulic-chemical processes. To assess chemical interactions between host rocks and a mixture of \\{HCl\\} and HF as well as its potential effects on the Soultz EGS reservoir, new modelling efforts using the FRACHEM code have been initiated. This article presents the model calibration and results. Simulations consider realistic conditions with available data sets from the EGS system at Soultz. Results indicate that the predicted amount of fracture sealing minerals dissolved by injection of a mixture of acids Regular Mud Acid (RMA) was consistent with the estimated amount from the test performed on GPK4 well at Soultz EGS site. Consequently reservoir porosity and permeability can be enhanced especially near the injection well by acidizing treatment.

Sandrine Portier; FranÁois D. Vuataz

2010-01-01T23:59:59.000Z

51

Information for Development Program (infoDev) Feed | Open Energy  

Open Energy Info (EERE)

for Development Program (infoDev) Feed for Development Program (infoDev) Feed Jump to: navigation, search Home | About | Inventory | Partnerships | Capacity Building | Webinars | Reports | Events | News | List Serve CLEAN Member Feeds Center for Environment and National Security at Scripps Centro de Energías Renovables (CER) The Children's Investment Fund Foundation (CIFF) Climate and Development Knowledge Network (CDKN) Climate Technology Initiative (CTI) ClimateWorks Foundation Coalition for Rainforest Nations (CfRN) Ecofys Energy Research Centre of the Netherlands (ECN) Energy Sector Management Assistance Program of the World Bank (ESMAP) Environment and Development Action in the Third World (ENDA-TM) German Aerospace Center (DLR) German Agency for International Cooperation (GIZ) Global Village Energy Partnership (GVEP)

52

Info-F-205 : Solutions TP1 Introduction  

E-Print Network [OSTI]

Info-F-205 : Solutions TP1 Introduction Matlab : Matrix Laboratory Interpr√©teur avec une structure Possibilit√©s graphiques commande plot(x,y) 2 s√©ries de valeurs de m√™me taille 1 graphe. Exemple : x = -pi:0 apr√®s dans un m√™me graphe. On peut voir le r√©sultat dans la Figure 1. 2 #12;Structures de contr√īle pour

Bontempi, Gianluca

53

JSON shows incomplete info | OpenEI Community  

Open Energy Info (EERE)

JSON shows incomplete info JSON shows incomplete info Home > Groups > Utility Rate I pointed this out this bug a while ago, but I'm re-posting since it still hasn't been resolved. I have found several rates where the JSON file doesn't show all of the information shown in the web interface. This is not an approval issue since I see it on both rates that say "This is the approved revision of this page, as well as being the most recent." and "No revision has been approved for this page. It is currently under review by our subject matter experts." Here is an example: http://en.openei.org/wiki/Data:0a897297-e17e-42c0-8f40-8db41b44b004 http://en.openei.org/services/rest/utility_rates?version=latest&format=json_plain&detail=full&getpage=Data:0a897297-e17e-42c0-8f40-8db41b44b004

54

MAGENCO: A map generalization controller for Arc/Info  

SciTech Connect (OSTI)

The Arc/Info GENERALIZE command implements the Douglas-Peucker algorithm, a well-regarded approach that preserves line ``character`` while reducing the number of points according to a tolerance parameter supplied by the user. The authors have developed an Arc Macro Language (AML) interface called MAGENCO that allows the user to browse workspaces, select a coverage, extract a sample from this coverage, then apply various tolerances to the sample. The results are shown in multiple display windows that are arranged around the original sample for quick visual comparison. The user may then return to the whole coverage and apply the chosen tolerance. They analyze the ergonomics of line simplification, explain the design (which includes an animated demonstration of the Douglas-Peucker algorithm), and discuss key points of the MAGENCO implementation.

Ganter, J.H.; Cashwell, J.W.

1994-06-01T23:59:59.000Z

55

M.Sc.Info-Veranstaltung, 21. Juni 2011 M.Sc. Chemie und Molecular Science  

E-Print Network [OSTI]

M.Sc.Info-Veranstaltung, 21. Juni 2011 M.Sc. Chemie und Molecular Science an der FAU Erlangen-N√ľrnberg Rainer Fink - Studiendekan Chemie / Mol.Sci. - #12;M.Sc.Info-Veranstaltung, 21. Juni 2011 Grundz√ľge der Masterstudieng√§nge Chemie und Molecular Science Qualifikation zu den Masterstudieng√§ngen Modulwahl (Chemie

Stummer, Wolfgang

56

InfoDev and DFID Climate Technology Program | Open Energy Information  

Open Energy Info (EERE)

DFID Climate Technology Program DFID Climate Technology Program Jump to: navigation, search Logo: InfoDev Climate Technology Program Name InfoDev Climate Technology Program Agency/Company /Organization World Bank, Information for Development Program (infoDev) Partner UK's Department for International Development (DFID) Sector Energy, Land Focus Area Energy Efficiency, Renewable Energy, Biomass, Solar, Wind, Buildings, Transportation, Forestry, Agriculture Topics Implementation, Market analysis, Policies/deployment programs Resource Type Workshop Website http://www.infodev.org/climate Program Start 2009 Country Kenya, India Eastern Africa, Southern Asia References Climate Technology Program [1] infoDev's Climate Technology Program (www.infoDev.org/climate) is conducting country-specific projects aimed at accelerating the development,

57

LinShim6 -Implementation of the Shim6 protocol http://inl.info.ucl.ac.be/LinShim6  

E-Print Network [OSTI]

LinShim6 - Implementation of the Shim6 protocol http://inl.info.ucl.ac.be/LinShim6 Documentation at http://inl.info.ucl. ac.be/publications/shim6-masterthesis. Like the whole project, this documentation

Bonaventure, Olivier

58

V-058: Microsoft Internet Explorer CDwnBindInfo Object Reuse Flaw Lets  

Broader source: Energy.gov (indexed) [DOE]

8: Microsoft Internet Explorer CDwnBindInfo Object Reuse Flaw 8: Microsoft Internet Explorer CDwnBindInfo Object Reuse Flaw Lets Remote Users Execute Arbitrary Code V-058: Microsoft Internet Explorer CDwnBindInfo Object Reuse Flaw Lets Remote Users Execute Arbitrary Code December 31, 2012 - 6:58am Addthis PROBLEM: Microsoft Internet Explorer CDwnBindInfo Object Reuse Flaw Lets Remote Users Execute Arbitrary Code PLATFORM: Version(s): 6, 7, 8 ABSTRACT: A vulnerability was reported in Microsoft Internet Explorer. A remote user can cause arbitrary code to be executed on the target user's system. REFERENCE LINKS: SecurityTracker Alert ID: 1027930 Secunia Advisory SA51695 CVE-2012-4792 IMPACT ASSESSMENT: High DISCUSSION: A remote user can create specially crafted HTML that, when loaded by the target user, will trigger a memory corruption error and execute arbitrary

59

Countdown to Solar Decathlon: The Info You Need Before You Go | Department  

Broader source: Energy.gov (indexed) [DOE]

Countdown to Solar Decathlon: The Info You Need Before You Go Countdown to Solar Decathlon: The Info You Need Before You Go Countdown to Solar Decathlon: The Info You Need Before You Go September 29, 2009 - 10:44am Addthis Elizabeth Spencer Communicator, National Renewable Energy Laboratory Maybe I'm just not paying enough attention to the date, but this took me a little by surprise: The Solar Decathlon is already less than two weeks away! The Solar Decathlon, if you haven't heard about it, is an event put on once every two years by the U.S. Department of Energy. Essentially, 20 university teams are challenged to construct a house that is 100% powered by solar energy. In early October, the teams will set up their homes in Washington, D.C., on the National Mall, where they'll be judged in ten contests. And those homes

60

Biodiversity, Entropy and Thermodynamics http://math.ucr.edu/home/baez/bio info/  

E-Print Network [OSTI]

Biodiversity, Entropy and Thermodynamics John Baez http://math.ucr.edu/home/baez/bio info/ October(pi ) is fundamental to thermodynamics and information theory. But it's also used to measure biodiversity, where pi. In biodiversity studies, the entropy of an ecosystem is the expected amount of information we gain about

Baez, John

Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

Introducing Propositional Logic and Queueing Theory with the InfoTraffic Interactive Learning Environments  

E-Print Network [OSTI]

Environments Ruedi Arnold Institute for Pervasive Computing ETH Zurich 8092 Zurich, Switzerland rarnold of propositional logic when you see traffic lights at intersections? Or do you reason about what the throughput of a street might be while being caught up in a traffic jam? Most people do not, we presume. But as Info

62

www.ConferenceOnSustainableRealEstate.com info@ ConferenceOnSustainableRealEstate.com  

E-Print Network [OSTI]

www.ConferenceOnSustainableRealEstate.com info@ ConferenceOnSustainableRealEstate.com The Conference On Sustainable Real Estate will be held at the University of Memphis campus on March 24, 25, 26 those opportunities. How does Sustainable Real Estate practice benefit investors, developers

Dasgupta, Dipankar

63

Professor Mehran Mehregany, Director Info & application: http://engineering.case.edu/wireless_health  

E-Print Network [OSTI]

) ­ Electrical or Biomedical Engineering Setting the standard for wireless health education ­ First ever, reach and cost of care through wireless health solutions. #12;Master of Science ­ Electrical EngineeringProfessor Mehran Mehregany, Director Info & application: http://engineering.case.edu/wireless

Rollins, Andrew M.

64

Professor Mehran Mehregany, Director Info & application: http://engineering.case.edu/wireless_health  

E-Print Network [OSTI]

) ­ Electrical or Biomedical Engineering Setting the standard for wireless health education ­ First everProfessor Mehran Mehregany, Director Info & application: http://engineering.case.edu/wireless_health Questions: wirelesshealth@case.edu Professional & Graduate Education in Wireless Health #12;Case Western

Rollins, Andrew M.

65

Get your Tsunami info here | OSTI, US Dept of Energy, Office of Scientific  

Office of Scientific and Technical Information (OSTI)

Get your Tsunami info here Get your Tsunami info here From the Science.gov search "tsunami sendai japan" Find out how the U.S. Military Gears Up to Help ... DefenseLINK Web Site Visit NOAA Center for Tsunami Research - Forecast Propagation Database See how NASA Shows Topography of Tsunami-Damaged Japan City, NASA Website S.RES.101 : A resolution expressing the sense of the Senate relating to the March 11, 2011, earthquake and tsunami in Japan.THOMAS, 112th Congress Guidance on Psychological First Aid Field Operations Guide (available in Japanese). MedlinePLUS Earthquake events Figure 1. Locations of the unit sources for pre-computed simulated earthquake events in the Propagation Database. These can be combined to provide a very fast forecast during an actual tsunami event. A WorldWideScience.org search yields:

66

OSTI News Transcripts, OSTI sends solar energy info to the public (March  

Office of Scientific and Technical Information (OSTI)

OSTI sends solar energy info to the public (March OSTI sends solar energy info to the public (March 2007), Office of Scientific and Technical Information, U.S. Department of Energy, www.osti.gov June 2007 WorldWideScience.org Listen Now WorldWideScience.org Global Science Gateway Now Open You can now easily access science from around the world via a single Web entry point, WorldWideScience.org. This new global science gateway opened for free public access on June 22, at the public meeting of the International Council for Scientific and Technical Information Annual General Assembly in Nancy, France. WorldWideScience.org currently retrieves research results from more than 200 million pages of information from 15 national portals of 10 countries - Australia, Brazil, Canada, Denmark, France, Germany, Japan, the

67

DOE Science Showcase - DOE Nuclear Physics R&D Info | OSTI, US Dept of  

Office of Scientific and Technical Information (OSTI)

DOE Nuclear Physics R&D Info DOE Nuclear Physics R&D Info While quarks and gluons are fairly well understood, how they fit together to create different types of matter is still a mystery. The DOE Nuclear Physics program's mission is to solve this mystery through theoretical and experimental research; the benefits to society range from fighting cancer to ensuring food safety to border protection. Find DOE research information on this topic from the OSTI databases and read about the Department's Nuclear Physics program. From the Databases Select a database to initiate a search. DOE Information Bridge DOE R&D Accomplishments Energy Citations Database ScienceCinema Science.gov WorldWideScience.org More information Accelerating Innovation: How nuclear physics benefits us all About DOE's Nuclear Physics Program

68

OpenEI.org: A wealth of renewable energy info at your fingertips | OpenEI  

Open Energy Info (EERE)

OpenEI.org: A wealth of renewable energy info at your fingertips OpenEI.org: A wealth of renewable energy info at your fingertips Home > Groups > OpenEI Community Central Graham7781's picture Submitted by Graham7781(1992) Super contributor 15 November, 2010 - 08:46 imported OpenEI Are you looking for information on how to make your home more energy efficient? Want to know what types of government incentives are available in your state if you utilize wind energy to power your business? Or maybe you're an analyst looking for up-to-date data on ARRA-funded geothermal projects in your technology sector. Whether you're a consumer, business owner, analyst or researcher, OpenEI.org puts a wealth of information on renewable energy at your fingertips. And it's all free. OpenEI was created in response to the White House's Open Government

69

OSTI News Transcripts, OSTI sends solar energy info to the public (March  

Office of Scientific and Technical Information (OSTI)

OSTI News Transcripts, OSTI sends solar energy info to the public (March OSTI News Transcripts, OSTI sends solar energy info to the public (March 2007), Office of Scientific and Technical Information, U.S. Department of Energy, www.osti.gov May 2007 Listen Now OSTI Celebrates 60 Years of Knowledge Sharing 1947-2007 Whether by print or by pixel, OSTI has long been committed to ensuring appropriate and ready access to government research. Born in 1947 of General Leslie R. Grove's mandate to tell the American people about the formerly secret Manhattan Project and the development of the atomic bomb, the Office of Scientific and Technical Information, or OSTI, rapidly became home to one of the world's most comprehensive collections of energy-related information. Long before the Internet came along, OSTI advanced science by making research information widely available. Located in Oak Ridge, Tennessee,

70

OSTI News Transcripts, OSTI sends solar energy info to the public (March  

Office of Scientific and Technical Information (OSTI)

OSTI sends solar energy info to the public (March OSTI sends solar energy info to the public (March 2007), Office of Scientific and Technical Information, U.S. Department of Energy, www.osti.gov March 2007 Solar Energy R&D Listen Now The sun's heat and light provide an abundant source of energy that can be harnessed in many ways. You can read more and find a wide range of solar energy information through OSTI's Solar Energy Web page. From educational materials to radiation resource information, OSTI has pulled together one-stop access to U.S. Department of Energy solar energy resources. In addition, you can search for solar energy research at OSTI's Information Bridge. The U.S. Department of Energy has played a major role in solar energy research and development. As a result of solar R&D, the cost of solar energy has been reduced 100-fold over the past two decades.

71

Institut Galile L2 info S1 Anne 2008-2009 Administration de Parc Informatique  

E-Print Network [OSTI]

Institut Galilée L2 info S1 ­ Année 2008-2009 Administration de Parc Informatique TP 05 Internet. Dans notre cas de machines virtuelles, nous n'avons besoin que de l'image iso du cédérom : debian-40r4a-i386-netinst.iso Vous la trouverez dans le répertoire /LOCAL/qemulator/images/ Pour débuter l

Messiant, Cédric

72

Institut Galilee L2 info S1 Annee 20082009 Administration de Parc Informatique  

E-Print Network [OSTI]

Institut Galil¬īee L2 info S1 ¬≠ Ann¬īee 2008¬≠2009 Administration de Parc Informatique TP 03'ordinateur `a l'aide du Live DVD. Rappel, `a l'invite boot:, il faut taper : knoppix bootfro,=!dev!sdq`e!LOCQL!QDSY:iso et il doit s'afficher : knoppix bootfrom=/dev/sda7/LOCAL/ADSY.iso Une fois l'ordinateur d

Messiant, Cédric

73

INFO-F-309 Administration des Systmes TP1: Installation de Linux et gestion des packages  

E-Print Network [OSTI]

virtuelle avant de la lancer pour mon- ter l'image .iso disponible dans le répertoire /serveur/logicielles/tpINFO-F-309 ­ Administration des Systèmes TP1: Installation de Linux et gestion des packages trouverez l(es) image(s) du TP dans le répertoire : /serveur/logicielles/tp-adminsys/partie1 Ce répertoire

Collette. Sébastien

74

Institut Galilee L2 info S1 Annee 20082009 Administration de Parc Informatique  

E-Print Network [OSTI]

Institut Galil¬īee L2 info S1 ¬≠ Ann¬īee 2008¬≠2009 Administration de Parc Informatique TP 02 ligne de commande suivante : knoppix bootfrom=/dev/sda7/LOCAL/ADSY.iso ATTENTION ! au d¬īemarrage, le^eme si c'est la ligne ci-dessus qui s'affiche, il faut en fait taper la ligne suivante : knoppix bootfro,=!dev!sdq`e!LOCQL!QDSY:iso

Messiant, Cédric

75

Institut Galilee L2 info S1 Annee 20082009 Administration de Parc Informatique  

E-Print Network [OSTI]

Institut Galil¬īee L2 info S1 ¬≠ Ann¬īee 2008¬≠2009 Administration de Parc Informatique TP 04 R¬īesolution de noms. Le but de ce TP est d'apprendre aux machines `a se conna^itre par le nom plut^ot que DVD. Rappel, `a l'invite boot:, il faut taper : knoppix bootfro,=!dev!sdq`e!LOCQL!QDSY:iso et il doit

Messiant, Cédric

76

Informacin durante o despus de una emergencia : Llame al nmero 459-INFO (4636)  

E-Print Network [OSTI]

Informaci√≥n durante o despu√©s de una emergencia : ¬∑ Llame al n√ļmero 459-INFO (4636) ¬∑ Prenda su emergencia. ¬∑ No regresar al edificio hasta que el personal de emergencia se lo ind√≠que. Evacuaci√≥n LSi usted descubre un fuego: ¬∑ Evacue el √°rea inmediatomente. ¬∑ Active la alarma de fuego mas cercana. ¬∑ Llame al

California at Santa Cruz, University of

77

SJSU Information Support Services Run a Query info-support@sjsu.edu, 408-924-1530 Page 1  

E-Print Network [OSTI]

....................................................................................................................................................................3 Advanced Search Run a Query info-support@sjsu.edu, 408-924-1530 Page 4 Advanced Search 4. To do an advanced search, click the Advanced Search link. The Advanced Search parameters display. Notes: The other most commonly

Su, Xiao

78

DOE  

Gasoline and Diesel Fuel Update (EIA)

DOE DOE /E/A- 0202( 83//Q J Sh or t-T er m En er gy O ut lo ok a to m Quar terly Proje ction s Febru ary 1983 Ene rgy Info rma tion Adm inist ratio n Was hing ton, D.C. t rt jrt .or t lor t lor t .lor t- ior t- ior t <.o rt ort . m .er m -Te rm -Te rm -Te rm -Te rm -Te rm -Te rm -Te rm -Te rm -Te rm -Te rm -Te rm -Te rm -T erm -T erm -T erm Nrm ue rgy En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y En erg y ^n erg y Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Ou tlo ok Sh ort -T erm 1 Sh ort -T erm Sh ort -T erm Sh ort -T erm Sh ort -T erm Sh ort -T erm Sh ort -T erm Sh ort -T erm Sh ort -T erm Sh ort -T erm Sh ort -T erm Sh ort -T erm

79

RMA Annual Conference 15 17 July 2010  

E-Print Network [OSTI]

/26) Chair: John Deathridge Beyond Jazz (Room G35) Chair: Peter Elsdon Gregory Camp (University of Oxford in the Twenty-First Century: Hybridity, the Internet and the Boundaries of Genre 17.30 Short Break 17.45 Keynote in Liszt's `Einzug der Gäste auf Wartburg' from Tannhäuser Shay Loya, Nineteenth-Century Folklorism

Miranda, Eduardo Reck

80

SJSU Information Support Services Send Messages by Instructor info-support@sjsu.edu, 408-924-1530 Page 1  

E-Print Network [OSTI]

, and Expiration Date for the message. 10. Enter the Term number for the class. To select from a list of terms, use-924-1530 Page 2 The Sign In page displays. 3. Enter your SJSU ID and Password. 4. Click the Sign In button. 5 by Instructor info-support@sjsu.edu, 408-924-1530 Page 3 The SJSU Messaging Search page displays. 6. Click

Su, Xiao

Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

2009 -Asia rld Reneuvable ffxx*rgy Smxlgr&$$ XSSS * Asia  

E-Print Network [OSTI]

ethanol blended with gasoline as a vehicle fuel. These include: 1) the effects on the emissions of air on the use of l0% by volume blends of ethanol with gasoline (E10), the most commonly used blend globally and sustainability of ethanol in gasoline. Niven reviews data available on five environmental aspects of using

82

GENOVIS AB, Box 790, SE-220 07 LUND, SWEDEN Phone +46 46 10 12 30 Fax +46 46 12 80 20 info@genovis.com www.genovis.com  

E-Print Network [OSTI]

GENOVIS AB, Box 790, SE-220 07 LUND, SWEDEN Phone +46 46 10 12 30 Fax +46 46 12 80 20 info LUND, SWEDEN Phone +46 46 10 12 30 Fax +46 46 12 80 20 info@genovis.com www.genovis.com APPLICATION

Lebendiker, Mario

83

Info Session for: All PHAS 2nd, 3rd, and 4th Year UG Students Provided by: UBC Department of Physics & Astronomy  

E-Print Network [OSTI]

Info Session for: All PHAS 2nd, 3rd, and 4th Year UG Students Provided by: UBC Department of Physics & Astronomy Held at: Hennings 201 Date: Tuesday, September 3th, 2013 Time: 11:00 a.m. to 14:30 p Dunning, Yingyu Yao 12:00 p.m. 2nd Year Student Session -- Hennings 201 Honours, Majors, Minors Programs

Plotkin, Steven S.

84

Registration General Info. Day 1 Sched. Day 2 Sched. Keynote Speaker Bios. Symposia Matrix Symposia Abstracts 13th Annual ARC Conference  

E-Print Network [OSTI]

Director, Diesel Engine Engineering for GM Powertrain Dan Kapp Director, Powertrain R & A Ford Motor.S. Army TARDEC Rolf Dreisbach Head of Diesel and Powertrain Mechanics Engineering and TechnologyRegistration General Info. Day 1 Sched. Day 2 Sched. Keynote Speaker Bios. Symposia Matrix Symposia

Papalambros, Panos

85

Registration General Info. Day 1 Sched. Day 2 Sched. Keynote Speaker Bios. Symposia Matrix Symposia Abstracts 15th Annual ARC Conference  

E-Print Network [OSTI]

matrix. Symposium I 10:45 - 12:00pm Diesel Engine Combustion 12:00 - 1:30 Lunch 1:30 - 2:45 EngineRegistration General Info. Day 1 Sched. Day 2 Sched. Keynote Speaker Bios. Symposia Matrix Symposia and Engineering Center (TARDEC) National Automotive Center (NAC) Automotive Research Center 2043 W.E. Lay

Papalambros, Panos

86

Mac mini: How to Reset the PMU http://docs.info.apple.com/article.html?artnum=300574 1 of 2 7/23/2007 2:06 PM  

E-Print Network [OSTI]

Mac mini: How to Reset the PMU http://docs.info.apple.com/article.html?artnum=300574 1 of 2 7 the PMU on a Mac mini and it still isn't displaying video or turning on, contact Apple technical support (1-800-APL-CARE in the U.S.) or take your computer to your local Apple Retail Store or Apple

California at Santa Barbara, University of

87

Voici donc le dernier numro de Gosciences-Infos avant l't. Un t sans rapport AERES rdiger... Mais avec quelques devoirs de vacances tout de mme, de faon tre tout--fait  

E-Print Network [OSTI]

édito Voici donc le dernier numéro de Géosciences-Infos avant l'été. Un été sans rapport AERES à

Demouchy, Sylvie

88

FMAPropInfoStat  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Proposal Gammasphere Checklist Proposal Gammasphere Checklist Experiment Title: Spokesperson: Spokesperson Contact: Alternate: Alternate Contact: Date/Time Submitted: PAC Cycle: 1. Gammasphere Operating Mode (check one): Coupled to FMA Standalone on APEX beamline No Preference 4. FMA Operation: Recoil Energy/charge > 4 MeV - D. Seweryniak Beam power > 6 watts - D. Seweryniak 2. Target Chamber: Gammasphere chamber - M. Carpenter Gammasphere target wheel - K. Lister Microball chamber - D. Sarantites FMA stand-alone chamber - D. Seweryniak 5. Focal Plane Detectors (check one): PPAC - D. Seweryniak Microchannel Plates - D. Seweryniak

89

Info Weapon Contest  

Science Journals Connector (OSTI)

One of the current paradigms on Ďwarí is the solubility of the frontlines and territory in general. Since the Second World War we have been living in the age of Ďtotal warí or Ďpure warí, as Paul Virilio has call...

Geert Lovink

1998-01-01T23:59:59.000Z

90

Exam #3 Info Sheet  

E-Print Network [OSTI]

The volume/surface area formulas for a cone, cylinder, and/or sphere will also be ... Lesson 24: (page 206) 51, 84. Lesson 25: (page 206) 39, 40, 50, 57, 59, 60,†...

Devlin, Patrick M

2014-11-14T23:59:59.000Z

91

Emploi du temps Licence de Mathmatiques semestre 6 MA= parcours maths approfondies M= parcours maths MI= parcours math-info ( groupe C en LI2)  

E-Print Network [OSTI]

M= parcours maths MI= parcours math-info ( groupe C en LI2) 08h00-09h30 09h45-11h15 11h30-13h00 13h15-14h45 15h00-16h30 16h45-18h15 lundi MA MA M M MI MI mardi MA Anglais MA M TD Histoire des Maths M 3.2 M MI Anglais MI mercredi MA TD Variable Complexe M 3.2 MA M M MI MI jeudi MA MA M M MI MI

Berger, Clemens

92

Emploi du temps Licence de Mathmatiques semestre 6 MA= parcours maths approfondies M= parcours maths MI= parcours math-info ( groupe A en LI2)  

E-Print Network [OSTI]

M= parcours maths MI= parcours math-info ( groupe A en LI2) 08h00-09h30 09h45-11h15 11h30-13h00 13h15-14h45 15h00-16h30 16h45-18h15 lundi MA MA M Anglais* M MI TP Programmation C PV202 MI mardi MA Anglais MA M TD Histoire des Maths M 3.2 M MI TP Projet Scientifique PV214 MI mercredi MA TD Variable

Parusinski, Adam

93

07/14/2005 03:15 PMEBSCOhost Page 1 of 9https://sslvpn.pitt.edu/DeliveryPrintSave.asp,DanaInfo=weblinks2.ep...a&ev=CA&fd=&fi=aph_4562569_AN&del_submit=Print&est=&ft=on&ff=s&df=2  

E-Print Network [OSTI]

.pitt.edu/DeliveryPrintSave.asp,DanaInfo=weblinks2.ep...a&ev=CA&fd=&fi=aph_4562569_AN&del_submit=Print&est=&ft=on&ff=s&df=2 11 page://sslvpn.pitt.edu/DeliveryPrintSave.asp,DanaInfo=weblinks2.ep...a&ev=CA&fd=&fi=aph_4562569_AN

Spirtes, Peter

94

Scientific Systems Company, Inc. 500 West Cummings Park, Suite 3000, Woburn, MA 01801, USA Tel: (781) 933-5355 Fax: (781) 938-4752 Email: info@ssci.com  

E-Print Network [OSTI]

Scientific Systems Company, Inc. 500 West Cummings Park, Suite 3000, Woburn, MA 01801, USA Tel. Founded in 1976 and headquartered in the metro-Boston area, SSCI has built a reputation for delivering Park, Suite 3000, Woburn, MA 01801, USA Tel: (781) 933-5355 Fax: (781) 938-4752 Email: info

Plotkin, Joshua B.

95

Gschwind Benot, Lionel Mnard, Thierry Ranchin, Lucien Wald, Paul Stackhouse, 2007. A proposal for a thesaurus for web services in solar radiation. In Proceedings EnviroInfo 2007, O. Hryniewicz, J. Studzinski and M. Romaniuk (Eds), Shaker Verlag,  

E-Print Network [OSTI]

for a thesaurus for web services in solar radiation. In Proceedings EnviroInfo 2007, O. Hryniewicz, J. Studzinski in Solar Radiation Beno√ģt Gschwind1 , Lionel M√©nard1 , Thierry Ranchin1 , Lucien Wald1 and Paul Stackhouse2 energies. This communication focuses on solar energy and more specifically on aspects in solar radiation

Boyer, Edmond

96

9/18/09 2:44 PMThunderbolts Forum View topic -Dark Energy may not actually exist Page 1 of 12http://www.thunderbolts.info/forum/phpBB3/viewtopic.php?p=25303&sid=87fbf6c3a5361ee50b143431ee0e553d  

E-Print Network [OSTI]

http://www.thunderbolts.info/forum/phpBB3/viewtopic.php?p=25303&sid=87fbf6c3a5361ee50b143431ee0e553d of 12http://www.thunderbolts.info/forum/phpBB3/viewtopic.php?p=25303&sid=87fbf6c3a5361ee50b143431ee0e553 Forum · View topic - Dark Energy may not actually exist Page 3 of 12http://www.thunderbolts.info/forum/php

Temple, Blake

97

Intel-based iMac, Intel-based Mac mini: How to reset the System Mana... http://docs.info.apple.com/article.html?artnum=303446 1 of 1 7/23/2007 2:16 PM  

E-Print Network [OSTI]

Intel-based iMac, Intel-based Mac mini: How to reset the System Mana... http://docs.info.apple.com/article.html?artnum=303446 1 of 1 7/23/2007 2:16 PM Visit the Apple Store online (1-800-MY-APPLE), visit a retail location on an iMac (Early 2006), iMac (Mid 2006), iMac (Late 2006), or Mac mini (Early 2006): From the Apple menu

California at Santa Barbara, University of

98

U.S. DEPARTMENT OF l!Nl!RGY EERE PROJECT MANAGEMENT CENTER NEPA DETERMINATION  

Broader source: Energy.gov (indexed) [DOE]

NEPA DETERMINATION NEPA DETERMINATION RECIPIENT:Recovery Act: City of North Uttle Rock Page I of3 STATE: AR PROJECT TITLE: Hydroelectric Facility Improvement Project· Automated Intake Cleaning Equipment and Materials Management Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CIO Number DE-FOA-OOOO120 DE-EEOOO2674 GF~2674..oo2 EE2674 Based on my review of the Information concerning tbe proposed action, as NEPA Compliance Officer (authorized under DOE Order 451.1 A), J have made tbe following determination: CX, EA, EIS APPENDIX AND NUMBER : Description: B5.1 Actions to conserve energy, demonstrate potential energy conservation, and promote energy--efficlency that do not increase the indoor concentrations of potentially harmful substances. These acllons may involve financial and tecl"lOica!

99

Renewable and alteRnative eneRgy Fact Sheet Using Biodiesel Fuel in Your Engine  

E-Print Network [OSTI]

speaking, this usually means combining vegetable oil with methanol in the presence of a cata- lyst (usually for a number of reasons, the most notable one being its lower viscosity. Many large and small producers have begun producing biodiesel, and the fuel can now be found in many parts of Pennsylvania and beyond either

Boyer, Elizabeth W.

100

RPP_info2013.dvi  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

1. 1. Introduction The collection of online information resources in particle physics and related areas presented in this chapter is of necessity incomplete. An expanded and regularly updated online version can be found at: http://library.web.cern.ch/particle physics information Suggestions for additions and updates are very welcome. † 2. Particle Data Group (PDG) resources * Review of Particle Physics (RPP) A comprehensive report on the fields of particle physics and related areas of cosmology and astrophysics, including both review articles and a compilation/evaluation of data on particle properties. The review section includes articles, tables and plots on a wide variety of theoretical and experimental topics of interest to particle physicists and astrophysicists. The particle properties section provides tables of published measurements as well as the Particle

Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

PittsburghMap&Info  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Pittsburgh, PA Area Hotel & Restaurants Pittsburgh, PA Area Hotel & Restaurants 9 10 31 4 7 8 South Hills Village 88 19 51 1 3 1 4 5 6 2 3 20 21 30 22 26 28 29 27 25 23 24 Curry Hollow Rd. Lebanon Church Rd. Allegheny Co. Airport 885 88 2 3 11 15 16 17 18 19 NETL Pittsburgh Site Pittsburgh, PA Century III Mall 12 13 14 15 16 51 Entrance Restaurants Hotels June 2009 Entrance to NETL See page 2 for listings CCAC South Campus 885 Hotels NETL Pittsburgh, PA 1. SpringHill Suites by Marriott 1000 Regis Ave 1. McDonald's 2251 Century Dr. 11. Boston Market 98 Clairton Blvd. (Rt. 51) 21. Taco Bell 2050 Lebanon Church Rd. Restaurants NETL Pittsburgh, PA 1000 Regis Ave. West Mifflin, PA 15122 412-653-9800 2. Hampton Inn 1550 Lebanon Church Rd. Pittsburgh, PA 15236 2251 Century Dr. West Mifflin, PA 15122 412-655-8825 2. Arby's 5205 Library Rd. Bethel Park, PA 15102 412-833-3733 3. Wendy's 98 Clairton Blvd. (Rt. 51)

102

Aps_notify Info Page  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

phones. In the US, email can be sent directly to most cell phones. Please contact your cell phone provider to retreive your address. Once you are subscribed, you can log in...

103

info disclosure-rocky mts  

Broader source: Energy.gov (indexed) [DOE]

site is tritium. Impacted media. Affected media include surface and subsurface soils, air, and ground- water. Forest resources on the slopes adjacent to the site have also been...

104

Eddie Price Grad Student Info  

E-Print Network [OSTI]

Computers and Technology. If you have any questions, comments, or concerns about the computer system in the Math Department, you can contact Paul Kepley

105

ch1_General_Info  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

technology for the reuse of Carbon dioxide (CO 2 ) emissions from industrial sources for green energy products. This project would use CO 2 to grow algae for the production of...

106

Page 1Where will Microsoft's green path lead? | InfoWorld | Weblog | March 13, 2008 | By Ted Samson 17/04/2008 08:44:53 PMhttp://weblog.infoworld.com/archives/emailPrint.jsp?R=printThis&A=http://weblog.in...  

E-Print Network [OSTI]

Page 1Where will Microsoft's green path lead? | InfoWorld | Weblog | March 13, 2008 | By Ted SamsonPrint.jsp?R=printThis&A=http://weblog.in... Back to article Print this Where will Microsoft's green path lead? For months now, many of the hardware lengths to highlight their green products, plans, and corporate visions. Now the software behemoth

Loke, Seng W. - Loke, Seng W.

107

file://C:\Documents%20and%20Settings\rma\My%20Documents\CSEQ\we  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Full data base of agricultural experiments used in this study. Full data base of agricultural experiments used in this study. Site ID 1 Tillage 2 Crop 3 Fertilizer (kg/ha/yr) Sample year Sampling Depth (cm) Depth increment (cm) 4 SOC (%) 4 SOC (g/m^2) KY01 n/a sod n/a 1975 0-5 5 2.70 KY01 n/a sod n/a 1975 5-15 10 1.39 KY01 n/a sod n/a 1975 15-30 15 0.79 KY01 n/a sod n/a 1980 0-5 5 3.81 KY01 n/a sod n/a 1980 5-15 10 1.73 KY01 n/a sod n/a 1980 15-30 15 0.90 KY01 n/a sod n/a 1989 0-5 5 3.11 KY01 n/a sod n/a 1989 5-15 10 1.41 KY01 n/a sod n/a 1989 15-30 15 1.11 KY01 CT corn 0 1975 0-5 5 1.33 KY01 CT corn 0 1975 5-15 10 1.24 KY01 CT corn 0 1975 15-30 15 0.68 KY01 CT corn 0 1980 0-5 5 1.25 KY01 CT corn 0 1980 5-15 10 1.38 KY01 CT corn 0 1980 15-30 15 0.78 KY01 CT corn 0 1989 0-5 5 1.31 KY01 CT corn 0 1989 5-15 10 1.55

108

file://C:\Documents%20and%20Settings\rma\My%20Documents\CSEQ\we  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Analysis (http://cdiac.ornl.gov/programs/CSEQ/terrestrial/westpost2002/westpost2002.html). Carbon Dioxide Information Analysis Center, U.S. Department of Energy, Oak Ridge National Laboratory, Oak Ridge, Tennessee, U.S.A. Summary of agricultural experiments used in this study. Location *Crop or Tillage Prior history Duration (yr) **Treatment Depth (cm) ***‚ąÜSOC (g m -2 ) √Ös, Norway N/A (low N) N/A 31 3 yr cereal-3 yr row crop vs. cereal 20 -199 √Ös, Norway N/A (low N) N/A 31 2 yr ley-4 yr row crop vs. 3 yr cereal- 3 yr row crop 20 199 √Ös, Norway N/A (low N) N/A 31 4 yr ley-2 yr row crop vs. 3 yr cereal- 3 yr row crop 20 881 √Ös, Norway N/A (medium N) N/A 31 3 yr cereal-3 yr row crop vs. cereal 20 -171 √Ös, Norway N/A (medium N) N/A 31 2 yr ley-4 yr row

109

HealtHyCows-RMaMeeting tHuRsday,FebRuaRy14,2013  

E-Print Network [OSTI]

Service Agency, USDA Risk Management Agency, NOFA New Hampshire and private crop insurance agencies. Thank Services, New England Area Office. Some of the programs and services provided include: health certificate and parts of MA. The University of New Hampshire Cooperative Extension is an equal opportunity educator

New Hampshire, University of

110

U.S. DEPARTMENT OFENl!RGY EERE PROJECT MANAGEMENT CENTER Nl!PA DETlffiMINATION  

Broader source: Energy.gov (indexed) [DOE]

Nl!PA DETlffiMINATION Nl!PA DETlffiMINATION R[CIPIENT:New York State Energy Research and Development Authority PROJECf TITLE: Program Year 2012 Formula Grants - State Energy Program Page 1 of3 STATE: NY Funding Opportunity Announcement Numbel" Procurement Instrument Number NEPA Control Number CID Number DE-FOA-Q000643 R130772 GF0-0130772-OO1 Based on my review orlbe information concerning the proposed action, as NEPA Compliance Omen (authorized under DOE Order 451.1A), I hne made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: All Technical advice and assistance to organization, A9 Information gathering, analysis, and dissemination Rational for determination: Technical advice and planning aSSistance to international, national, slate, and local organizations.

111

U.S. DEPARTMENT OFENl!RGY EERE PROJECT MANAGEMENT CENTER NEPA DE1'FIU.llNATION  

Broader source: Energy.gov (indexed) [DOE]

NEPA DE1'FIU.llNATION NEPA DE1'FIU.llNATION RECIPIENT:Colorado School of Mines Page 1 of2 STATE: CO PROJECf TITLE: Hot Carrier Collection in Thin Film Silicon with Tailored Nanocrystalline/Amorphous Structure Funding Opportunity Announcement Numbu Procurement Instrument Number NEPA Control Number elD Number OE-FOA-OOOO387 DE-EE0005326 GF0-0005326-001 0 Based on my review oftbe Information conccming the proposed action, as NEPA Compliance Officer (authorized under DOE Order 451.1A), I have made the follo",," ing determination: ex, EA, EIS APPENDIX AND NUMBER: Description: 8 3.15 Small-scale i ndoor research and development projects usIng nanascate materials Siting, construction, modrficabon, operation, and decommissioning of facilities for indoor small-scale research and

112

Renewable and alteRnative eneRgy Fact Sheet College of Agricultural Sciences Agricultural Research and Cooperative Extension  

E-Print Network [OSTI]

"(FAEE). introduction Biodiesel is a liquid fuel that is created by chemically process- ing vegetable oil and altering and blends. The companion fact sheet in this series Using Biodiesel Fuel in Your Engine explains Research and Cooperative Extension What's So Different about Biodiesel Fuel? 1. If the biodiesel is made

Boyer, Elizabeth W.

113

IMPACT Vol. 5 No. 1 | Spring 2010 CLeAn eneRGy DeMAnDS  

E-Print Network [OSTI]

and development are vital if America is to decrease greenhouse gas emissions at lower cost, reduce dependence and reduce environ- mental risks. The University of Maryland Energy Research Center, or UMERC, coordinates of Science and Technology Policy. Many of the major federal grants related to energy research, including

Hill, Wendell T.

114

Microsoft Office InfoPath - Form2  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

ACL Analytical Request ACL Analytical Request Analytical Chemistry Laboratory at Argonne National Laboratory Submitted by: Division: Date: Cost Code: Authorization: E-mail: Building: Phone: Report Results To: E-mail: Division: Description of Analytical Service Needed: (i.e. analysis methods, analytes of interest, project support) Quality Requirements: (i.e. detection limits, accuracy, regulatory holding times or data packages) Sample Description and Sample Origin: (i.e. general sample composition, approximate concentration of analytes) Potential Heath Hazard or Special Handling Required? Yes -- Provide Details ÔĀß ÔĀ¶ ÔĀ• ÔĀ§ ÔĀ£ Submitter's Sample ID ACL Sample ID Suspect Radionuclides: Radioactivity: Yes No Suspect ÔĀß ÔĀ¶ ÔĀ• ÔĀ§ ÔĀ£ ÔĀß ÔĀ¶ ÔĀ• ÔĀ§ ÔĀ£ ÔĀß ÔĀ¶ ÔĀ• ÔĀ§ ÔĀ£

115

Microsoft Word - tchr_work_info.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Number of teachers: Number of teachers: 3. Number of years teacher can participate: 4. Nature of academic year follow-up: 5. Remuneration received by teachers: 6. Major content focus of teacher work projects: Facility Characteristics 1. Special facilities: 2. Unique capabilities or attributes: 3. Core science mathematics, and technological competencies (e.g., applied and basic technologies, integration activities, product realization): Teacher Characteristics* 1. Education in scientific/technical discipline (major degrees): 2. Gender 3. Race, ethnicity 4. Years of teaching experience 5. Research Experience 6. Computer knowledge/experience 7. Courses currently teaching 8. Student ability level 9. Community type (urban/suburban/rural) 10. Community wealth (High/middle/low SES)

116

Microsoft InfoPath - nepa_19496.xml  

Broader source: Energy.gov (indexed) [DOE]

67 67 Title: Replace Brine Disposal System Header to WH Brine Tanks Description: Subcontractor shall shall provide all labor, materials, tools, equipment, and supervision required to replace the existing brine disposal piping to the WH brine tanks with new cement lined piping and fittings, to be supplied by others as Government Furnished Equipment under WH-MM-767A. Regulatory Requirements: NEPA Implementing Procedures (10 CFR 1021) 10 CFR 1021.410 (Application of Categorical Exclusions) (a) The actions listed in Appendices A and B of Subpart D are classes of actions that DOE has determined do not individually or cumulatively have a significant effect on the human environment (categorical exclusions). (b) To find that a proposal is categorically excluded, DOE shall determine the following:

117

Magellan Info Session Professor Shahrokh Valaee  

E-Print Network [OSTI]

­ Provides student counselling support 3September 24, 2014 #12;Who Are We? Linda Espeut (Manager Mechanics Area 2 Electromagnetics and Energy Systems ECE314 ­ Fund. Of Electrical Energy Systems ECE320 Electronics: Switch-Mode Power Supplies BME595 ­ Medical Imaging ECE413 ­ Energy Systems & Distributed

Prodiæ, Aleksandar

118

TwitInfo: Aggregating and Visualizing Microblogs  

E-Print Network [OSTI]

traveled to the ASEAN conference and to NATO to work on issues in those parts of the world. He then spent

Pratt, Vaughan

119

Microsoft Word - Badging and Facility Info  

Office of Environmental Management (EM)

Subgroup Spring 2015 Meeting Page 1 Sponsor: EA-10 and EFCOG Host: Brian Barbero, NSTec Regulatory Enforcement Program Manager National Security Technologies, LLC Where:...

120

OSU Contact Info Stores Service Center  

E-Print Network [OSTI]

, and guestroom renovations in 2008 24 hour in-room dining Complimentary Business Center Complimentary WIFI in all public areas of the hotel Westin Workout Center and Westin Workout guestrooms Heavenly Beds in all guestrooms Laptop safes and refreshment centers in all guestrooms Starwood Preferred Guest

Jones, Michelle

Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

Jurisdiction Members Contact Info Key Staffers  

E-Print Network [OSTI]

Legislative authorizing / oversight for: · Air pollution, including the Clean Air Act · Environmental research and development · Environmental regulation · Transportation policy · Water resources Majority: · Barbara Boxer (D (R-NE) · John Boozman (R-AR) Majority (Democrats): · Dirksen Senate Office Building, SD-410

122

Info-Greedy Sequential Adaptive Compressed Sensing  

E-Print Network [OSTI]

] (Ct)/H(F) and P[M = O(H(F))] = 1 - o(1). #12;k-sparse signal: windfarm example n wind turbines more general signal and noise model new algorithms: sparse measurement #12;Information theoretical in Algorithm 5. The following theorem shes the error bound. em V.1 (White Gaussian noise added prior

Xie, Yao

123

Info-Exch 2012- Thomas Johnson Presentation  

Broader source: Energy.gov [DOE]

EM Recovery Act Program Director Thomas Johnson gave a presentation on Recovery Act lessons learned at the 2012 Recovery Act Information Exchange.

124

MEPC 2014 Info Session Peter A. Beerel  

E-Print Network [OSTI]

development on diesel engines. · General Atomic expressed interest in development work with TPS-strings-attached" Grand Prize · Free legal services awards Housed in the Viterbi School of Engineering #12;Target VSoE Students MEPC motivation and goal · Engineering innovation central to address of big challenges MEPC Rules

Zhou, Chongwu

125

Fisher info and thermodynamics' first law  

E-Print Network [OSTI]

theory, that thermodynamicsí ?rst law (TFL) can bewhich is a ďFisherís thermodynamicsĒ ?rst-law: note that theone can derive thermodynamics ?rst law for the Fisher

Plastino, A; Plastino, A R; Soffer, Bernard H

2006-01-01T23:59:59.000Z

126

ARRA Project Info Combined 0112110.xls  

Broader source: Energy.gov (indexed) [DOE]

(Lead (Lead Organization) DOE Grant Amount Non- Federal Cost Share Project Lead Organization Location (City) Project Lead Organization Location (State) Description Partners National Alliance for Advanced Biofuels and Bioproducts (NAABB) Led by the Donald Danforth Plant Science Center $44,036,473 $11,009,118 St. Louis MO Develop and demonstrate the science and technology necessary to significantly increase production of algal biomass and lipids, efficiently harvest and extract algae and algal products, and establish valuable conversion routes to fuels and co-products. These activities will accelerate the ability to overcome several key barriers identified in the Algal Biofuels Roadmap, including:

127

Enforcement InfoCenter | Department of Energy  

Office of Environmental Management (EM)

More Nuclear Safety Documents December 2, 2014 Consent Order, Battelle Energy Alliance - NCO-2014-02 Nuclear Safety Enforcement Consent Order issued to Battelle Energy...

128

Microsoft Word - Shipping Info_2014.docx  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

your shipment by the Career Fair: LANL Attn: Jeanette GallegosMary Anne With Bikini Atoll Road, SM-30 MS M714 TA-00, Bldg. 199 Los Alamos, NM 87545-0001 Questions:...

129

MATH 89 -SPRING 2012 Course Info  

E-Print Network [OSTI]

the speed of light. · Thought experiments and abstract description of implications of special relativity, the Doppler effect, and absolute vs. relative Motion. · Historical views leading up to Einstein. · Measuring. · Lorentz coordinates, light cones and a mathematical derivation of special relativity. · The equivalence

Marzuola, Jeremy

130

U.S. DEPARTMENT OF l!Nl!RGY EERE PROJECT MANAGEMENT CENTER Nl!PA DETl!la.llNATION  

Broader source: Energy.gov (indexed) [DOE]

Nl!PA DETl!la.llNATION Nl!PA DETl!la.llNATION RECIPIENT:lmpact Technologies llC PROJECf TITLE : Deep Geothermal Drilling using Millimeter Wave Technology Page 1 of2 STATE: OK Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number em Number DE-FOA-OOOOS22 DE-EEOOO5504 GFO-OOO5504-OO1 G05504 Based on my review or lhe infonnation concerning the proposed action, as NEPA Compliance OtrlCCf (authorized unde r DOE OTdu451.IA), I have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: A9 Information gathering, analysis, and dissemination Information gathering (induding. but not limited to. literature surveys, inventories, site visits, and audits), data analysis (induding. but not limited 10, computer modeling), document preparation (induding. bul nollimited to, conceptual design,

131

E3NE3R'GY ORNL/Sub/80-13817/1&20 RD&D Opportunities for Large Air  

E-Print Network [OSTI]

by TRW Energy Engineering Division 800 Oak Ridge Turnpike Oak Ridge, Tennessee 37830 under Subcontract 62X-13817C, Letter Release 62X-20 JN -sf2;~~~~~~~~~for Oak Ridge National Laboratory Oak Ridge by TRW Energy Engineering Division 800 Oak Ridge Turnpike Oak Ridge, Tennessee 37830 Under Subcontract 62

Oak Ridge National Laboratory

132

UW Box 354809 Seattle, WA 98195-4809 ph: 206.666.3406 fx: 206.666.3406 email: info@ccph.info web: www.ccph.info  

E-Print Network [OSTI]

decline, and threats of peak soil and peak oil, many communities are making paths to a brighter future

Chen, Tsuhan

133

Microsoft Word - SCI Sensitive Compartmented Info Final 032108.doc  

Broader source: Energy.gov (indexed) [DOE]

ACCESS PROGRAM ACCESS PROGRAM Inspection Report Office of Intelligence and Counterintelligence Internal Controls Over the Department of Energy's Sensitive Compartmented Information Access Program DOE/IG-0790 March 2008 U.S. Department of Energy Office of Inspector General Office of Inspections and Special Inquiries OFFICE OF INTELLIGENCE AND COUNTERINTELLIENCE INTERNAL CONTROLS OVER THE DEPARTMENT OF ENERGY'S SENSITIVE COMPARTMENTED INFORMATION ACCESS PROGRAM TABLE OF CONTENTS OVERVIEW Introduction and Objective 1 Observations and Conclusions 2 DETAILS OF FINDINGS Background 3 Removal from SCI Roster 3 Administrative Debriefing 4 Employment Status Change 5 Incomplete Nondisclosure Agreements 6

134

Microsoft Word - ORNL ACREM INFO MEMO 050409.doc  

Broader source: Energy.gov (indexed) [DOE]

U.S. Department of Energy Office of Inspector General Office of Inspections and Special Inquiries Inspection Report Internal Controls over Accountable Classified Removable Electronic Media at Oak Ridge National Laboratory INS-O-09-02 May 2009 Department of Energy Washington, DC 20585 May 4, 2009 MEMORANDUM FOR THE MANAGER, OAK RIDGE OFFICE FROM: Elise M. Ennis Assistant Inspector General for Inspections SUBJECT: INFORMATION: Inspection Report on "Internal Controls over Accountable Classified Removable Electronic Media at Oak Ridge National Laboratory" BACKGROUND The Department of Energy's Oak Ridge National Laboratory (ORNL) conducts cutting edge scientific research. ORNL utilizes removable electronic media, such as computer hard drives,

135

Microsoft Word - REMA Comments EIA_Agency_Info_Collection.doc  

Gasoline and Diesel Fuel Update (EIA)

1 Connecticut Ave NW, Suite 600 * Washington, DC 20036-2701 1 Connecticut Ave NW, Suite 600 * Washington, DC 20036-2701 202-640-6597 tel * 202-223-5537 fax * www.renewablemarketers.org Submitted via: ERS2014@eia.gov May 6, 2013 Ms. Rebecca Peterson U.S. Energy Information Administration Mail Shop EI-23 Forrestal Building 1000 Independence Ave SW Washington, DC 20585 RE: Comments of the Renewable Energy Markets Association on the Energy Information Administration's Agency Information Collection Extension Dear Ms. Peterson: The Renewable Energy Markets Association (REMA) is pleased to submit the following recommendations and comments in response to the Energy Information Administration's (EIA) call for improved industry data collection. REMA is a North American trade association dedicated to maintaining and growing strong

136

Microsoft InfoPath - NEPA_21124_306.xml  

Broader source: Energy.gov (indexed) [DOE]

24A 24A Title: Replace BH Circuit Breakers OCB-4009, 4010 and 4011 (GFE) Description: Subcontractor shall provide all labor, supervision, tools, equipment, and transportation required to furnish three new 138 kV SF 6 circuit breakers to replace the existing BH oil circuit breakers OCB-4009, 4010 and 4011. This procurement will be Government Furnished Equipment (GFE) for installation by others. Regulatory Requirements: NEPA Implementing Procedures (10 CFR 1021) 10 CFR 1021.410 (Application of Categorical Exclusions) (a) The actions listed in Appendices A and B of Subpart D are classes of actions that DOE has determined do not individually or cumulatively have a significant effect on the human environment (categorical exclusions). (b) To find that a proposal is categorically excluded, DOE shall determine the following:

137

shiprock info sheet 08.20.13.cdr  

Office of Legacy Management (LM)

Shiprock, New Mexico, Disposal Site pond. Shiprock, New Mexico, Disposal Site pond. Tailings Cover Site After Cleanup Groundwater Shiprock Site Background 1951 Uranium found on Navajo Nation lands near Shiprock. 1952 Uranium-ore buying station is established in Shiprock. 1954 Mill is built in Shiprock. 1954-1968 Various companies operate the mill, processing uranium and vanadium ore. During milling operations, chemicals from mill tailings piles and ponds drain into the soil and groundwater. 1968-1973 Mill buildings and equipment are torn down. 1975-1980 Initial cleanup of materials from former milling operations. 1986 Mill tailings are put in a disposal cell and a cover is constructed over the materials. The disposal cell cover is a barrier that prevents radon gas from escaping and reduces the amount of water drainage through the cell.

138

Sapienza Universit di Roma Centro InfoSapienza  

E-Print Network [OSTI]

'APPALTO Il valore contrattuale dell'appalto è pari a 2.093.000,00 (euro duemilioninovantatremila/00), IVA pari ad 3.000,00 (iva esclusa) di cui al "Documento Unico di valutazione dei rischi standard da sono ammesse offerte in aumento. Al Fornitore potrà essere richiesto un incremento o una diminuzione

Guidoni, Leonardo

139

IP Networking Lab http://inl.info.ucl.ac.be  

E-Print Network [OSTI]

Eduroam - Abuse scenario 12 Stockholms universitet UCL Internet user: Beck@SU.se Swedish Authority Belgian Belgium, Jan 2009 Eduroam - Abuse scenario 13 Stockholms universitet UCL Internet Swedish Authority Context : Open WiFi Roaming 3 H F Internet #12;ALAWN - Technical aspects D. Leroy, M. Manulis, F. Koeune

Bonaventure, Olivier

140

Home Fruit Spray Schedule Education Center & Info LIne  

E-Print Network [OSTI]

is followed, trees and small fruit plants should be reasonably free from insect and disease injury. This spray certain aphids, mites, scales, and pear psyllas on fruit trees. Copper soap (copper octanoate and situations where supplementary sprays or sanitation may be helpful. Diseases Black Knot of Plum and Cherry

New Hampshire, University of

Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

SDS/forms/student info STUDENT CONTACT INFORMATION  

E-Print Network [OSTI]

: __________________________________________________________________ Residence Address: _______________________________________________________________ Cell Phone: _________________________________________________________________ _________________________________________________________________ _________________________________________________________________ Home Phone Number: _____________________________________________________ Cell Phone Number: _____________________________ Home Phone: ________________________ Email

Massachusetts at Lowell, University of

142

MINERvA Engineering Info for Director's 3b review  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

we also need to start construction of the Support Stand and Bookend for use in the cavern. These drawings are shown in: 8. Support Structure Ass'y (PDF 1748k) (controlled by J....

143

Purdue Extension 1-888-EXT-INFO  

E-Print Network [OSTI]

as a burndown before planting; used in-crop on Roundup Ready¬ģ soybeans, corn, alfalfa, cotton, and canola

144

ME 305, Course Info, p. 1 Mechanics of Materials  

E-Print Network [OSTI]

calculator Access to a computer with either MatLab or Octave installed Syllabus: See attached; some topics will be given unless these are completed. Any projects assigned will be regarded as part of the homework

145

INFO-FINANCES dition : Juin 2011 BULLETIN 25  

E-Print Network [OSTI]

://www.sf.ulaval.ca/ AApppprroovviissiioonnnneemmeenntt Contrat d'approvisionnement des gaz comprimés (gaz en cylindre) Le contrat actuel avec Praxair'exécutera une prise d'inventaire des cylindres sur le campus. La prise d'inventaire sera coordonnée par Praxair

Laval, Université

146

Constructing a Cleaner Economy Info Graphic | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

More Documents & Publications Strategies for the Commercialization & Deployment of GHG Intensity-Reducing Technologies & Practices Open Government Plan 1.0 Fiscal Year 2010...

147

ARRA Project Info Combined 0112110.xls | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

More Documents & Publications ARRA Projects Chart Missouri Recovery Act State Memo Texas Hydrogen Highway - Fuel Cell Hybrid Bus and Fueling Infrastructure Technology Showcase...

148

Supp. Info. Gentner/2002-09188B 1 Supplementary Information  

E-Print Network [OSTI]

in northern Indiana, transported in cages by car to the University of Chicago, and housed in large flight to food and water ad libitum while in the flight aviary. Subjects were naive to all the trainingHz to 10 Hz to 10 kHz over 2 s (2 s ISI, 10 s total duration). The peak power of all stimuli (song samples

Gentner, Timothy

149

Novembre -Dcembre 2013 -N 251 SUBAQUA InfosRecherche  

E-Print Network [OSTI]

's University de Belfast (Irlande du Nord), nous révèlent. On s'en doutait. Fallait-il encore le prouver. En- loureuse les conduisant à changer de stra- tégie, de parcours. L'expérience ayant été menée sur 90

Jacquet, Stéphan

150

Alternative Fueling Station Locator App Provides Info at Your...  

Broader source: Energy.gov (indexed) [DOE]

Fueling Station Locator website. It provides information on more than 15,000 public and private alternative fueling stations throughout the United States. The app lists where...

151

Info Vis Comp5048 lecture August 13 Tutorial: when?  

E-Print Network [OSTI]

in upper case are fixed and spaced regularly around a circle), and b. the Hooke's law spring method. A B,C,d,B,c f C,d,e,g g d,e,f 2. Find some code that computes force-directed layout. Test in on graphs with 10

Hong,Seokhee

152

TwitInfo: Aggregating and Visualizing Microblogs for Event Exploration  

E-Print Network [OSTI]

Microblogs are a tremendous repository of user-generated content about world events. However, for people trying to understand events by querying services like Twitter, a chronological log of posts makes it very difficult ...

Marcus, Adam

153

Info-Exch 2012- Sites Lessons Learned Presentation  

Broader source: Energy.gov [DOE]

Sites around the DOE complex funded by the EM Recovery Act Program provided lessons learned during the 2012 Information Exchange.

154

Start uw eigen web dialoog op www.lucide.info  

Science Journals Connector (OSTI)

Website Bent u bestuurder of toezichthouder bij een zorginstelling? Bent u alleen ge Ônteresseerd, of wilt u gewoon meepraten met de mensen die het in de zorg voor het zeggen hebben? Op de websit...

2014-03-01T23:59:59.000Z

155

Education Toolbox Search | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

rgy-101-energy-efficient-data-centers Video Energy 101: Electric Vehicles This edition of Energy 101 highlights the benefits of electric vehicles, including improved fuel...

156

Microsoft Word - info quality guidelines updated 3-7-11.docx  

Broader source: Energy.gov (indexed) [DOE]

p p DEPARTMENT OF ENERGY Final Report Implementing Office of Management and Budget Information Dissemination Quality Guidelines AGENCY: Office of the Chief Information Officer, Department of Energy (DOE). ACTION: Notice. SUMMARY: DOE gives notice of the final report to the Office of Management and Budget (OMB) that contains final DOE guidelines setting forth policy and procedures to ensure and maximize the quality, utility, objectivity, and integrity of the information that DOE disseminates to members of the public. DOE has prepared this final report pursuant to OMB government wide guidelines under section 515 of the Treasury and General Government Appropriations Act for Fiscal Year 2001 (Act) (Pub.L. 106-554, 114 Stat. 2763). DATES: The guidelines in the final report to OMB are effective October 1, 2002.

157

MIT Plasma Science & Fusion Center: research>alcator>facility info  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Density Physics Waves & Beams Technology & Engineering Useful Links Alcator C-Mod Criteria for Design of Vacuum Components This document is meant to be a guideline for design and construction of components that interface with the CMOD vacuum system. It does not intend to cover all situations but instead is designed to start one thinking about the problems encountered in constructing a successful device that will operate in the Alcator vacuum environment without causing any unwanted effect on the quality of that vacuum. Material Selection The Alcator vacuum vessel is made from 304L SS, as are most of the support devices and diagnostic assemblies in the vacuum. Other than Molybdenum on the limiters and in the divertor, this is the predominate material used in

158

Microsoft Word - Material_ChemEmissions_Info_LBNL_090810_final-2  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Environmental Energy Technologies Division September 2010 Funding was provided by the U.S. Dept. of Energy Building Technologies Program, Office of Energy Efficiency and Renewable Energy under DOE Contract No. DE-AC02- 05CH11231; by the U.S. Dept. of Housing and Urban Development Office of Healthy Homes and Lead Hazard Control through Interagency Agreement I-PHI-01070, and by the California Energy Commission through Contract 500-08-06. Chemical Emissions of Residential Materials and Products: Review of Available Information Henry Willem and Brett C. Singer LBNL-3938E Chemical Emissions of Residential Materials and Products: Review of Available Information

159

GeneInfoMiner?a web server for exploring biomedical literature using batch sequence ID  

Science Journals Connector (OSTI)

......freely available over the Internet at http://brainarray...National Institute on Drug Abuse R21 DA13754-01 to F...al. 1999MedMiner: an internet text-mining tool for...National Institute on Drug Abuse R21 DA13754-01 to F...1999) MedMiner: an internet text-mining tool for......

Weijian Xuan; Stanley J. Watson; Fan Meng

2005-08-01T23:59:59.000Z

160

1http://info.anu.edu.au/hr/ Career Development GuiDe  

E-Print Network [OSTI]

and facilitator · career consultant · staff development consultant Hr Generalists Workforce planning · college/division Hr officer · college/division Hr consultant · workforce planning consultant · workforce planning · identifying appropriate professional development · creating a career development plan · improving your

Botea, Adi

Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

Online.Academy.edu/BuildingInfo Ads by Google August 1, 2010  

E-Print Network [OSTI]

According to a poll released July 27 America has nine of the most important green buildings in the world publication Architect Magazine listing the 'most important green buildings since 1980' were released on July 28. The poll was conducted amongst 150 leading green building experts including architects, engineers

162

EMERGENCY CONTACTS for DOWNER LAB Contact Phone After Hours Purpose/Additional Info  

E-Print Network [OSTI]

(Building-Related) 471-0043 471-2020 Plumbing/floods, fire sprinklers, heating/cooling, lighting, electrical whether to see a healthcare provider. For severe or potentially life-threatening medical or mental health

Shvets, Gennady

163

InfoTraffic Teaching Important Concepts of Computer Science and Math through Real-World Examples  

E-Print Network [OSTI]

Ruedi Arnold Inst. for Pervasive Computing ETH Zurich 8092 Zurich, Switzerland rarnold@inf.ethz.ch Marc Langheinrich Inst. for Pervasive Computing ETH Zurich 8092 Zurich, Switzerland langhein@inf.ethz.ch Werner Hartmann Center for Comp. Education PH Bern 3012 Bern, Switzerland werner.hartmann@phbern.ch ABSTRACT

164

Continuing Education examination available at http://www.cdc.gov/mmwr/cme/conted_info.html#weekly.  

E-Print Network [OSTI]

-pod laundry detergent exposures. Parents and caregivers should keep laundry detergent pods, as well as other was discharged 24 hours after the exposure. Poison center staff members fol- lowed up with the child's parents 4 of Potential Life Lost from Unintentional Injuries Among Persons Aged 0­19 Years -- United States, 2000

165

Organization Industry Majors Positions Info Sessions Job Fair Application Process/Interviews Baker Hughes  

E-Print Network [OSTI]

& Gas Service Company All Engineering majors, Engineering Technology, Geology, Mathematics, Physics Services Civil Engineering, Computer Science, Mechanical Engineering, Petroleum Engineering Full Time, Part Hughes Oilfield Service Company Internships, Full Time Sept 23, 8:30 PM Wood Center C/D Yes See job

Ickert-Bond, Steffi

166

Veterans and STEM Mentoring Programs- Info Session and Brown Bag Networking  

Broader source: Energy.gov [DOE]

January is National Mentoring Month. Join the Veterans Mentoring Program and the STEM Mentoring Program at DOE for information distribution and networking to meet current and potential mentors and...

167

Land Universitet Sprk OBS! Mer info Argentina Instituto Tecnologico de Buenos Aires Spanska Ej fr F  

E-Print Network [OSTI]

/Engelska Endast A Finland Tampereen Teknillinen Korkeakoulu Engelska / Finska Finland University of Lapland Engelska/Finska Endast ID Finland Oulun Yliopisto Finska/Engelska Finland √?bo Akademi Svenska Finland Aalto yliopisto Finland Lahti University of Applied Sciences (Lahti Yrkesh√∂gskola) Endast ID Finland Vaasan

168

Convergence of Bio Info Nano Eco: Global Public Goods and Economic Growth  

E-Print Network [OSTI]

This article is about convergence and why not. How about a ride to space in an elevator? Why not? A single nanotube could stretch from earth to the stratosphere and be able to support its own weight. This fact spurred NASA ...

Datta, Shoumen

2008-07-31T23:59:59.000Z

169

TravInfo Evaluation (Technology Element) Traveler Information Center (TIC) Study: Operator Response Time Analysis  

E-Print Network [OSTI]

Traveler Information Center (TIC) Study Operator Inte$aceTraveler Information Center (TIC) Study Operator ZnterjizceInformation Center (TIC) Study (Technology Evaluation

Miller, Mark A.; Loukakos, Dimitri

2000-01-01T23:59:59.000Z

170

Trav Info Evaluation (Technology Element ) Traveler Information Center (TIC) Study: System Reliability and Communications Interface  

E-Print Network [OSTI]

Traveler Information Center (TIC) Study (September 1996 -Information Center (TIC) Study (Technology EvaluationTraveler Information Center (TIC) Study: System Reliability

Miller, Mark; Loukakos, Dimitri

1998-01-01T23:59:59.000Z

171

Trav Info Evaluation ( Technology Element ) Traveler Information Center ( TIC ) Study: Operator Interface Analysis - Phase III  

E-Print Network [OSTI]

and evaluator visits to the TIC. The objective of this workthe different aspects of the TIC working environment. Thecontribute to or hinder the TIC operator’s job performance.

Miller, Mark; Loukakos, Dimitri

1998-01-01T23:59:59.000Z

172

[info:lanl-repo/lareport/LA-UR-14-27140] Proceedings of the Workshop...  

Office of Scientific and Technical Information (OSTI)

Library A permalink (or permanent link) is a URL that points to a specific record or resource. Permalinks remain unchanged indefinitely Permalinks are considered the best way to...

173

The Integrated Use of EMME/2 and Arc/Info -Practice in Lyon County, Minnesota  

E-Print Network [OSTI]

maps for these software are very difficult to find. The Geographic Information System (GIS), like Arc in a systematic way. Much effort has been invested in building GIS map databases at city, county and state level in recent years so we can get a digitized map in GIS format easily from the Internet. But the GIS software

Levinson, David M.

174

PHYS 113 General Physics I Fall 2012 KSU -4 credits Section: Room Instructor: Contact Info.  

E-Print Network [OSTI]

introductory physics course dealing with the topics of mo- tion, mechanics, matter and energy. Emphasis #12;Laboratory The laboratory is a required and integrated part of the course, and counts 20% towards your grade. A passing grade (60%) in the laboratory is required to pass the course. See the lab manual

Wysin, Gary

175

Providing a networked future for interpersonal information retrieval: InfoVine and user modelling  

Science Journals Connector (OSTI)

......proposes a novel approach for future Intranet commu- nication. A software system...therefore the presence of particular characteristics would imply that of others [30...the next version is to be run over the Intranet and accessed via the World Wide Web......

Clare F. Harvey; Peter Smith; Peter Lund

1998-05-01T23:59:59.000Z

176

Providing a networked future for interpersonal information retrieval: InfoVine and user modelling  

Science Journals Connector (OSTI)

......novel approach for future Intranet communication. A software...Abstract The Internet and Intranet provide the potential for...novel approach for future Intranet commu- nication. A software...related phenomenon of the technology gatekeeper. 2.1. Case......

Clare F. Harvey; Peter Smith; Peter Lund

1998-05-01T23:59:59.000Z

177

Lab-Corps Program info. session - Jan. 20, 2015 | Argonne National...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

energy ---Nuclear energy modeling & simulation ---Nuclear fuel cycle ---Reactors -Energy usage --Energy storage ---Batteries ----Lithium-ion batteries ----Lithium-air...

178

info710 : Complements de bases de donnees TD 6 : decompositions et forme normale  

E-Print Network [OSTI]

) ; - R(A, B, C, D, E), avec F = {AC E, B D, AE BCD, DC} et = (ABC, CDE) ; Question 2. Est-ce que les 1 1 1 1 1 0 1 2 1 0 1 3 2 2 2 2 avec = (AB, BCD) ; - R A B C D E n n + 1 n + 2 n + 1 n + 3" : code unique de d¬īesignation d'un livre publi¬īe) - le Prix du livre. Les d¬īependances impos¬īees sont G

Hyvernat, Pierre

179

Microsoft Word - info quality guidelines updated 3-7-11.docx...  

Office of Environmental Management (EM)

Final Report Implementing Office of Management and Budget Information Dissemination Quality Guidelines (67 Fed Reg 62446) Final Information Quality Bulletin for Peer Review...

180

FINANCIAL INFoRmATIoN ANU ANNUAl RepoRt 2009 67  

E-Print Network [OSTI]

the Australian Radiation protection and Nuclear Safety Agency CDU Charles Darwin University CPAS Centre and Safety RAP Reconciliation Action plan SII Systemic Infrastructure Initiative UAI Universities Admissions

Botea, Adi

Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

http://www.sord.nv.doe.gov/MEDAStationInfo-tng.htm  

National Nuclear Security Administration (NNSA)

Phone: Contact - (702) 295-1232 Fax - (702) 295-3068 http:www.sord.nv.doe.gov Report web page problems to: SORD Webmaster Date Modified: 031208 ||Home | Privacy Policy |...

182

OpenEI: Datasets in the OpenEnergyInfo Data Repository  

DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

The Open Energy Information initiative (OpenEI) is a platform to connect the world's energy data. It is a linked open data platform bringing together energy information to provide improved analyses, unique visualizations, and real-time access to data. OpenEI follows guidelines set by the White House Open Government Initiative , which is focused on transparency, collaboration, and participation. OpenEI strives to provide open access to this energy information, with the ultimate goal of spurring creativity and driving innovation in the energy sector.[Copied from the OpenEI Wiki main page]. It features a wiki, a blog, a list of information gateways, and a browsing list of deposited data sets.

183

1 Health Gov Info.doc HEALTH-RELATED GOVERNMENT INFORMATION & STATISTICS  

E-Print Network [OSTI]

.gc.ca/publicat/sars-sras/naylor/index-eng.php · Building on Values: The Future of Health Care in Canada (Romanow report) http://dsp-psd.pwgsc.gc.ca/Collection/CP32-85-2002E.pdf · A Framework for Reform: Report of the Alberta Premier's Advisory Council on Health listing, check out the `publications' list at URL: http://www.health.alberta.ca/newsroom/pub-health-care

Abolmaesumi, Purang

184

www.reteortibotanicilombardia.it info@reteortibotanicilombardia.it con il contributo di  

E-Print Network [OSTI]

'invisibile... - a cura di Barbara Meani. ore 17.00 "SugheriAMO" - laboratorio creativo per bambini e famiglie - I tappi

De Cindio, Fiorella

185

Discrete Math, 10th day, Friday 7/9/04 REU 2004. Info  

E-Print Network [OSTI]

to Cauchy's functional equation (CFE)? Clearly, f(x) = cx is a solution. We will make several observations: if f satis#12;es CFE then 1. f(0) = 0. (Why?) 2. Let c := f(1). Then (Vx P Z)(f(x) = cx). 3. f (p)(f(x) = cx). Exercise 10.4. If f is a solution of CFE and it is bounded in an interval then (Vx)(f(x) = cx

Babai, László

186

PNWD  

Office of Legacy Management (LM)

- - - - - -- - - - -- -- -- - - - - - - - - - - -- - - - - - - -- - - -- - --, PNWD -3802 Battelle 71u! Business a/Innovation Monticello Mill Ta:i.lings Site Macroinvertebrate Sampling for 2006 A.L. Bunn R.P. Mueller CA. Duberstein J.M. Brandenberger February 2007 Prepared for the U.S. Department of Ene rgy under Con tract DE-AC13-02GJ79491 DI SCLAIM ER This report was prepared as an account of wo rk spo nso red by an agency of th e United States Go vernment. N either th e United States G overnment n or any agency thereof, nor Battelle Mem orial In stitute, no r an y o f th eir em ployees, m akes any w arranty, ex press o r implied, o r as s u mes any leg al liabili ty o r resp o nsib ility for the acc u ra cy, comple te ness, o r u sefuln ess of an y info rmation, ap paratus, p roduct , or proce ss d is close d, or re p re sents th at its u se would no t infri nge p rivately owned rights. Reference he rein to any specific commercial product, process,

187

The role of mechanical forces in the planar-to-bulk transition in growing Escherichia coli microcolonies  

Science Journals Connector (OSTI)

...microcolonies Matthew A. A. Grant 1 Bartlomiej Waclaw 2 Rosalind...combined with individual-based computer simulations, to show how mechanical...Science Programme Organization, grant no. RGY0069/2009-C. R...funding from the same source, grant no. RGY0081/2012 and from...

2014-01-01T23:59:59.000Z

188

EE 744 Coding Theory and Spread Spectrum Class Info: Meeting time: 2:20-3:40 Tuesday and Thursday  

E-Print Network [OSTI]

. Fundamentals of Codes, Graphs, and Iterative Decoding, Kluwer, 2003. Objectives: By the end of the semester you student handbook. The penalties for cheating and plagiarism are defined in the handbook. Web Site: A web

Joiner, Laurie L.

189

http://www.illegal-logging.info/item_single.php?item=document&item_id=21&approach_id=26  

E-Print Network [OSTI]

change, 1990-2000 Annual change (%) Global total 3,963,429 3,869,455 -9,391 -0.22 Source: FAO 2001 #12 of deforestation, compiled by the FAO, suggests global forests are disappearing at a rate of 0.2% per annum accounted for 25-50% of global imports for several important timber products in 2000. A large, though

190

L:\\RHtoUGRD\\transfer general info\\RHAG-UGRD Procedures December 2012 RATCLIFFE HICKS SCHOOL OF AGRICULTURE  

E-Print Network [OSTI]

OF AGRICULTURE TRANSFER PROCEDURES Ratcliffe Hicks students may apply to transfer into the College of Agriculture degree requirements to graduate from the Ratcliffe Hicks School of Agriculture (RHAG) to transfer School of Agriculture Office of Academic Programs #12;

Alpay, S. Pamir

191

Organizing Off-Campus Networking/Recruiting Info: 3 Popular Approaches (Tips compiled from Erb and other SNRE students)  

E-Print Network [OSTI]

: Create a folder on your hard drive for each company to track notes from each conversation, your exact and networking priorities for each company · Each company on a diff tab in greater depth · Field headings: firmMind, , MindMapping, MindJet, plenty of other free and online tools via a google search on "Mind Mapping" o

Edwards, Paul N.

192

PFP: Protein Function Prediction server For any questions regarding PFP contact the administration at info@kiharalab.org  

E-Print Network [OSTI]

also click on "Load Sample" link to load this sequence in the text box and follow the next steps "Enter Query Sequence(s)". Consider the following sequence that you can enter. >sp|P56851|EP3B. Clicking on "Clear" link will clear the text box for sequence and load default ESG parameters in the boxes

Kihara, Daisuke

193

Pouze informativn! Zvazn podmnky pijmacho zen viz https://is.cuni.cz/studium/podprij/index.php?do=info&fakulta=11320  

E-Print Network [OSTI]

Pouze informativní! Závazné podmínky pijímacího ízení viz https://is.cuni.cz/studium/podprij/index.php/2012 Praha 2010 #12;2 Pouze informativní! Závazné podmínky pijímacího ízení viz https://is.cuni.cz/studium/podprij/index.php ISBN 978-80-7378-125-5 #12;3 Pouze informativní! Závazné podmínky pijímacího ízení viz https://is.cuni.cz/studium/podprij/index.php

Cerveny, Vlastislav

194

Presented in Randolph Center, VT and West Lebanon, NH by UNHCE Geospatial Outreach Program Course info and registration online  

E-Print Network [OSTI]

: ArcGIS 10 Topics covered: Creating GIS maps GIS techniques GIS data maintenance $495 standard $349 to ArcGIS 10. Participants learn how to use ArcGIS 10 to produce attractive, effective maps. Data processing and data editing techniques are covered, as well as, new techniques for mapping and sharing GIS

New Hampshire, University of

195

ROOM RESERVATION INFO: The Department of Genome Sciences controls reservations for conference rooms on each floor of the Foege Building.  

E-Print Network [OSTI]

address. Requests sent from non-u.washington.edu email accounts can not be processed. #12;April 2011 S040:00-10:00 Genome 361 10:00-11:00 GS-ITS 11:00-12:00 Genome 351 TA Office Hours 12:00-1:30 Genome 361 TA Mtg 3:00-12:00 Genome 351 TA Office Hours 12:00-1:30 Genome 361 TA Mtg 3:00-4:00 D. Skelly 10:30-12:00 Genome 541 1

Kaminsky, Werner

196

ROOM RESERVATION INFO: The Department of Genome Sciences controls reservations for conference rooms on each floor of the Foege Building.  

E-Print Network [OSTI]

address. Requests sent from non-u.washington.edu email accounts can not be processed. #12;April 2011 S330 Lab 4 5 6 7 8 9:30-11:30 Brewer Lab 11:30-12:30 T. Lemus 9:00-10:00 Managers Mtg 10:30-12:30 Waterston:00-3:00 Blimes 9:30-11:30 Brewer Lab 3:00-5:00 O. Serang Dissertation 9:00-10:00 Managers Mtg 10

Kaminsky, Werner

197

ROOM RESERVATION INFO: The Department of Genome Sciences controls reservations for conference rooms on each floor of the Foege Building.  

E-Print Network [OSTI]

address. Requests sent from non-u.washington.edu email accounts can not be processed. #12;April 2011 S110 Monday Tuesday Wednesday Thursday Friday 1 9:00-10:00 E. Torskey 10:00-11:30 NWGC Mtg 11:30-12:30 E:00-11:30 NWGC Mtg 12:00-1:30 PopGenLunch 11 12 13 14 15 1:00-2:20 Genome 599A 3:30-4:50 Genome 475 9

Kaminsky, Werner

198

ROOM RESERVATION INFO: The Department of Genome Sciences controls reservations for conference rooms on each floor of the Foege Building.  

E-Print Network [OSTI]

address. Requests sent from non-u.washington.edu email accounts can not be processed. #12;April 2011 S230 Informatics 2:00-3:00 Admin Staff Mtg 4:00-5:00 N. Cameron 10:00-11:00 NWGC Comp 1:00-2:00 Nickerson Lab 2 11 12 13 14 15 12:00-1:00 PostDoc Mtg 1:00-2:00 W. Swanson 2:00-3:00 Nickerson Lab 10:00-11:30 Manoil

Kaminsky, Werner

199

NCBI Handout Series | CDD | Last Update August 19, 2013 Contact: info@ncbi.nlm.nih.gov CDD: Conserved Domain Database  

E-Print Network [OSTI]

.ncbi.nlm.nih.gov/pub/mmdb/cdd/ Searching CDD with text query Entering a set of query terms in the search box and pressing the "Search and is extensively linked with other NCBI data. CDs can be found by direct text searching from the CDD homepage is represented in scoremat format and these scoremats have been made available for search with a pro- tein query

Levin, Judith G.

200

NCBI Handout Series | SRA | Last Update August 19, 2013 Contact: info@ncbi.nlm.nih.gov SRA: Sequence Read Archive  

E-Print Network [OSTI]

the Entrez SRA page by entering desired terms and clicking the "Search" button (A). Complex que- ries can the "Edit" link (F) so that custom terms, such as history #, can be entered. Clicking the "Add to history can be browsed, searched and downloaded from its homepage at www.ncbi.nlm.nih.gov/sra/ and www

Levin, Judith G.

Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

IEEE TRANSACTIONS ON COMPUTERS, VOL. 47, NO. 10, OCTOBER 1998 1073 The InfoPad Multimedia Terminal: A Portable  

E-Print Network [OSTI]

designed for portable stand-alone operation. The requirements to reduce the weight and energy consumption- sary to reduce the energy consumption, weight and cost of the end-user device as much a the terminal to have the port- ability of a paper notebook (1 lb, 8.5" x 11") while still being able to support

Han, Richard Y.

202

HOME NEWS SPORTS BUSINESS OPINIONS ENTERTAINMENT HEALTH TRAVEL INFO CLASSIFIED ADSLong Beach, CA, 12/21/2006 Advertisement  

E-Print Network [OSTI]

, 12/21/2006 Advertisement del.icio.us Digg Reddit YahooMyWeb Google What's this? L.B. Port pollution to be studied Researchers hope to find source of pollutants detected in nearby areas. By Kristopher Hanson agency are teaming up to capture and test the origin of tiny pollution particles floating around harbor

Valero-Cuevas, Francisco

203

postdoc:Postdoc Program:Career Fair:2013:Shipping Info_2013.docx Shipping Information and Display Setup  

E-Print Network [OSTI]

address: Los Alamos National Laboratory (LANL) Attn: Jeanette Gallegos/Mary Anne With Bikini Atoll Road

204

When Pfizer Met McDreamy: A Classic American Love Story Between Medicine and the Media  

E-Print Network [OSTI]

Jordan, 2003 Pharmaceutical Industry. In Companion toPhRMA the pharmaceutical industryís lobbying organization.loosened for the pharmaceutical industry but the information

Bodoh-Creed, Jessica Anne

2013-01-01T23:59:59.000Z

205

Education Toolbox Search | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

rgy-electricity-consumption-and-efficiency Download An Exploration of Wind Energy & Wind Turbines This unit, which includes both a pre and post test on wind power engages students...

206

Gainache. Lori M From: Conrad, Jill A  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

PM TO: Alex Nazara-i Lale)(nazarali@ctuirorg), Alyssa Buck (Abuc k1gcrpLjd.Org), HNRTC Smith, Anthory; 'Rambi Rodriquez (ba mbirod riquez@ctu i .rg.)Y; 'Barbara Harper...

207

WELLBEING RESOURCE GUIDE http://info.anu.edu.au/hr/anu-staff-wellbeing. Enquiries: Nicki.read-Jones@anu.edu.au Wellbeing Consultant x58943  

E-Print Network [OSTI]

/187/ For information and assistance in the ACT contact (02) 6207 9977 http://www.drugs.health.gov.au/internet of the illness call 02 6232 9044 Centrelink http://www.centrelink.gov.au/internet/internet affected by domestic violence call 02 6280 0900 Elder Abuse http://www.eapa.asn.au/ Information

Botea, Adi

208

Pacific Institute 654 13th Street, Oakland, CA 94612 510.251.1600 info@pacinst.org www.pacinst.org  

E-Print Network [OSTI]

). Including air pollution as a screening criterion acknowledges the health impacts borne by Californians pollution and reducing public health impacts. Including air pollution as a screening criterion provides will be the greatest beneficiary of air pollution improvements in terms of occupational safety and health. The Pacific

209

SJSU Information Support Services Create Contracts for 12-Month Appointment info-support@sjsu.edu, 408-924-1530 Page 1  

E-Print Network [OSTI]

. Note Data about the position will populate. Term Enter the fall term of the current year in a four demonstrates how to create a contract for a 12-month appointment by entering effective dates that encompass hyperlink. 3. Click the CSU Contract Data hyperlink. The CSU Contract Data search page displays. 4. Click

Su, Xiao

210

SJSU Information Support Services Run Batch Contracts for Temporary Faculty info-support@sjsu.edu, 408-924-1530 Page 1  

E-Print Network [OSTI]

page displays. 5. Term: Use the lookup button to search the appropriate term. 6. Due Date: (optional data that exists in the system for the temporary faculty will appear on the Contract Appointment letter/Terms. 2. Click Batch Contracts for T. Faculty. The Batch Process for TF Contract search page displays. 3

Su, Xiao

211

SJSU Information Support Services Hire a Teaching Associate or Graduate Assistant info-support@sjsu.edu, 408-924-1530 Page 1  

E-Print Network [OSTI]

displays. 1. From the Main Menu, click the CSU ID Search hyperlink. 2. Enter any known search criteria. 3 Name Description Enter the Position Click the lookup icon to perform search, if unknown. When you click the tab or outside of the field, position data will populate. Term Enter term in a four-digit format

Su, Xiao

212

SJSU Information Support Services SR102: Basic Records Processing II info-support@sjsu.edu, 408-924-1530 Page 1  

E-Print Network [OSTI]

this option, skip step 11. The Enter Search Criteria page displays. 9. Enter the Course Subject-924-1530 Page 5 The Enter Search Criteria page displays. 11. Enter at least two criteria and then click. Once students are term activated and assigned a registration appointment time, they can enroll

Su, Xiao

213

SJSU Information Support Services Rehire a Part-Time Temporary Faculty, TA or GA info-support@sjsu.edu, 408-924-1530 Page 1  

E-Print Network [OSTI]

of the contract. Contract Desc Enter a name for the contract. Include the Last Name, Dept Name and Term. Example of the field, position data will populate. Term Enter term in a four-digit format. Example: 2054 = Fall 2005 if the person is a Late Start or Early Termination. (Enter L for Late Start. Enter E for Early Term). Number

Su, Xiao

214

SLU, Box 58, SE-230 53Alnarp, Sverige tel: +46 (0)40-4150 00 Org.nr 202100-2817 info@slu.se  

E-Print Network [OSTI]

to such questions of sustainable urban development, for instance, when it comes to the importance of green areas continually threatened by building development. Conflicts over land use are expected to increase further sustainable development. The exchange of experiences with other key future research areas has thus far been

215

ESG: Extended Similarity Group method for protein function prediction For any questions regarding ESG contact the administration at info@kiharalab.org  

E-Print Network [OSTI]

box titled "Enter Query Sequence(s)". Consider the following sequence that you can enter. >sp|P56851 KDKSSHMFIYISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSF NYIEFHCSMDGYVDSIEDLKMVEPIGN You can also click on "Load Sample" link to load this sequence in the text box and follow the next steps. Clicking on "Clear" link will clear the text box for sequence

Kihara, Daisuke

216

NASA Space Craft Contest -Artist Info -2D Original, Pg. 1 Information includes title of artwork, artist name and Etsy shop  

E-Print Network [OSTI]

ROBOTS Dylan Strzynski dylanS.etsy.com Orrery Alisha Gould alishagould.etsy.com Moon Tile Kelly Cook Cookstah.etsy.com Wayfinder - Light Reactive Painting Shayla Maddox shaylamaddox.etsy.com The Wonders Painting W. Brent Wear brentwear.etsy.com High Texture Embroidered Moon Rachel B. Hobson Rachel

217

G:\\Insurance\\WPS14-15\\Info\\Web\\Healthmain.Docx Rev 5-12-14 Medical College of Wisconsin Affiliated Hospitals  

E-Print Network [OSTI]

Subscriber" 2. Enter your Member # 3. Click "continue" and Start your Provider Search Or, Call WPS Customer a standardized template utilizing a uniform glossary of terms and can be used to compare this benefit plan to other benefit plans available to you. Note: Exact details and coverage are subject to the terms

218

www.westlothianonline.infoWEST LOTHIAN COUNCIL DELIVERS www.westlothian.gov.ukWEST LOTHIAN COUNCIL DELIVERS EXCELLENCE IN PUBLIC SERVICES  

E-Print Network [OSTI]

.17 102.38 100.62 101.87 99.74 99.74 99.97 99.76 99.74 99.75 99.67 99.57 99.58 99.50 99.68 99.5199.54 99

Heal, Kate

219

Destination Palo Alto -Lodging http://www.destinationpaloalto.com/pages/lodging.php?visitor_info_id=8[7/27/2011 10:00:32 AM  

E-Print Network [OSTI]

, restaurant, bar Complimentary: parking, Internet in guest rooms $99-$399 AAA Each furnished guestroom has

Quake, Stephen R.

220

MyEmployeeInfo Help Sheet (rev 01/05) 1) Please select a web browser from your desktop. We recommend the following browsers based on the  

E-Print Network [OSTI]

may find the icon browser on the desktop or from the Start menu (generally in the bottom left corner) under Programs. Internet Explorer Icon Firefox icon Safari icon Konqueror 2) In the address field) Channel Controls (i.e. Section Headings) Focus / Un-focus The focus icon will hide the rest

Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

LASLO EVERS | Change Password | Change User Info | CiteTrack Alerts | Subscription Help | Sign Out Editors' Choice: Highlights of the recent literature  

E-Print Network [OSTI]

-barometer to reduce noise from atmospheric wind. Evers and Haak report detection on 8 November 1999 of a discrete 0 that such propellers or turbines can be integrated into more complex devices. As an example, they prepare a light

Evers, Läslo G.

222

Suggested Search Terms Try searching a few of the phrases provided in PsycINFO and ABI/INFORM, and use appropriate  

E-Print Network [OSTI]

fit and Empirical organizational change and resistance learning organization organizational learning organizational learning job satisfaction motivation and employees personality traits and job

Abolmaesumi, Purang

223

NCBI Handout Series | Structure | Last Update August 19, 2013 Contact: info@ncbi.nlm.nih.gov The Structure Database from NCBI  

E-Print Network [OSTI]

) and relevant resources (C). A search can be performed by entering a set of terms in the search box and clicking through the Entrez search and retrieval system using a web browser (www structure records using the Vector Alignment Search Tool (VAST). A web service for this tool is available

Levin, Judith G.

224

NCBI Handout Series | dbGaP | Last Update August 19, 2013 Contact: info@ncbi.nlm.nih.gov dbGaP: Database of Genotype and Phenotype  

E-Print Network [OSTI]

a central entry point to access the data from this database. Entering terms in the search box and clicking the Search button (A) performs a search against this database. In the body of the homepage, Getting Started Results Browser (H). Integrated searches for phenotype and genotype data can be done using the Phenotype

Levin, Judith G.

225

HowTo-update-MyAccess-personal-info.docx:06/19/2012 1 of 2 How to update your personal information in MyAccess ...  

E-Print Network [OSTI]

. Below are a few steps that will help you. 1. go to web site: http://myaccess.wvu.edu/ - click on "Login

Mohaghegh, Shahab

226

Resilience by design for cloud services  

E-Print Network [OSTI]

adapted from the industry-standard technique known as Failure Mode and Effects Analysis (FMEA)1 the industry-standard process known as FMEA have been adapted to create a Resilience Modeling and Analysis (RMA

Chaudhuri, Surajit

227

E-Print Network 3.0 - astrobiology education poster Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

David Catling, UW... Astrobiology, and & Mark Claire, UW Astronomy 2:30 P.M., Rm.A-118, PAA "Biogeochemistry and photochemistry... in its services, programs, activities, education...

229

Affiliated with Universit de Montral Pavillons lassonde,  

E-Print Network [OSTI]

-use in the sanitation system, we use 92% less drinking water than conventional buildings. #12;. Red : magma orange : earth Green : flora Blue : Sky eneRGY PeRFoRManCe 60 % better than the standard set by model national energy code of canada for buildings. mechanical systems that use hfc-134a

230

National Aeronautics and Space Administration November 2010  

E-Print Network [OSTI]

Rgy SToRAge RoADmAp Technology Area 03 Valerie J. Lyons, Chair Guillermo A. Gonzalez Michael G. Houts technology roadmap, including both technology pull and technology push strategies, considers a wide range in NASA's DRAFT Space Technology Roadmap, an integrated set of fourteen technology area roadmaps

231

2008 BUILDING ENERGY EFFICIENCY STANDARDS  

E-Print Network [OSTI]

2008 BUILDING ENERGY EFFICIENCY STANDARDS C A L I F O R N I A E N E RGY CO M M I S S I O N Buildings and Appliances Office #12;Acknowledgments The Building Energy Efficiency Standards (Standards the adoption of the 2008 Building Energy Efficiency Standards to Jon Leber, PE, (November 13, 1947 - February

232

Datasheet Fujitsu EsPRiMO C5731 E-staR 5.0 DEsktOP PC Page 1 / 7 http://ts.fujitsu.com/esPRIMO  

E-Print Network [OSTI]

. Up to 500 GB hard drive and PCI Low Profile Slot eneRgy savIng Reduced power costs and consumption the environmental protection requirements of tomorrow, for example EnERGY staR¬ģ 5.0. COMPaCt DesIgn Fully fledged PC and vertical position. Ultra small form factor PC, power supply, legacy interfaces and powered serial ports

Fiebig, Peter

233

Environmental Management American Recovery & Reinvestment Act...  

Office of Environmental Management (EM)

project reviews to track and monitor project performance and foresee any challenges. Info-Exch 2012 - Thomas Johnson Presentation Info-Exch 2012 - Shirley Olinger Presentation...

234

Slide14 | OSTI, US Dept of Energy, Office of Scientific and Technical...  

Office of Scientific and Technical Information (OSTI)

In Summary: Three Points on Nano Info Diffusion In Summary: Three Points on Nano Info Diffusion. Link to larger image. Modeling - It's possible. Metadata - numeric data, unlike...

235

Slide02 | OSTI, US Dept of Energy, Office of Scientific and Technical...  

Office of Scientific and Technical Information (OSTI)

Collaboration Is Imperative Info Age OSTI TIO STIM OR Info Age STIM TIO OSTI Program Manager Researcher Together we can achieve more (with less) than we can individually....

236

MA 16100  

E-Print Network [OSTI]

Course Info. Syllabus ∑ Emergency Preparedness Syllabus Attachment ∑ Course Calendar ∑ Assignment Sheet. Resources. Online Graphing Calculator ∑ Past†...

237

Calculus For Technology II  

E-Print Network [OSTI]

MA 22200, Spring 2012. Calculus For Technology II ... Other Information. Emergency procedures ∑ Exam info (A Hoffman)†...

238

e-mail: inikol@aueb.gr : 210 8203121  

E-Print Network [OSTI]

International Airport, Schneider Electric, Siemens, TOYTA, Citibank, Info ­ Quest, HSBC, Direct Services

Chatziantoniou, Damianos

239

01.07.2013, 2013_EnviroInfo_wald_hc1_short.doc HelioClim-1: 21-years of daily values in solar radiation in one-click  

E-Print Network [OSTI]

manuscript, published in "27th International Conference on Informatics for Environmental Protection, Hambourg as the main use of these data relates to investment decision in solar plants and selection of appropriate

Paris-Sud XI, Université de

240

Laboratoire d'InfoRmatique en Image et Systmes d'information LIRIS UMR 5205 CNRS/INSA de Lyon/Universit Claude Bernard Lyon 1/Universit Lumire Lyon 2/Ecole Centrale de Lyon  

E-Print Network [OSTI]

! Ververidis et al (2004, 2005): Anger, happiness, neutral, sadness, surprise Pitch, spectrum and energy six" Anger, Happiness, Fear, Neutral, Sadness, Surprise... !Dimensional theory [Wie05a] 2 or 3 Dimensional emotions: helps in building classifiers 5 #12;State of the art: Acoustic correlates ! Emotion may

Dellandréa, Emmanuel

Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

AgriculturalPO Box 339, Bloemfontein, 9300 I Tel: 051 401 9111 I E-mail: info@ufs.ac.za I www.ufs.ac.za Natural and  

E-Print Network [OSTI]

www.ufs.ac.za Faculty of Natural and Agricultural Sciences 2013 #12;1 SCIENCES If age brings wisdom Sciences. For a century this faculty has been one of the leaders in science training and research and Agricultural Sciences where our motto "no substitute for excellence" drives our academic endeavors. The Faculty

Buehrer, R. Michael

242

Cet article est disponible en ligne l'adresse : http://www.cairn.info/article.php?ID_REVUE=ANNA&ID_NUMPUBLIE=ANNA_595&ID_ARTICLE=ANNA_595_0971  

E-Print Network [OSTI]

. c.) et ya¬Įsa¬Į lorsqu'il s'agit de sources en persan et en arabe, car c'est sous cette forme que le terme appara√ģt le plus souvent. Pour la translitt√©ration des mots arabes et persans, nous suivons le

Boyer, Edmond

243

This paper was published in Optics InfoBase and is made available as an electronic reprint with the permission of OSA. The paper can be found at the  

E-Print Network [OSTI]

to classify the elements of a scene is a convenient and efficient solution to many image-processing tasks daylight. Estimates of the mean number of distinguishable colored surfaces were

Foster, David H.

244

BOX 50005, SE-104 05 STOCKHOLM, SWEDEN, RECEPTION +46 8 673 95 00, FAX +46 8 15 56 70 BESK/VISIT: LILLA FRESCATIVGEN 4A, STOCKHOLM, INFO@KVA.SE HTTP://KVA.SE  

E-Print Network [OSTI]

BOX 50005, SE-104 05 STOCKHOLM, SWEDEN, RECEPTION +46 8 673 95 00, FAX +46 8 15 56 70 BES√?K by Patricia K. Kuhl, University of Washington, Seattle, WA, USA and Hon. Dr., Stockholm University, Sweden will be followed by a panel discussion including Hugo Lagercrantz, Karolinska Institutet, Solna, Sweden, Andrew

245

M A R C D A V I S P U B L I C A T I O N S www.marcdavis.me info@marcdavis.me  

E-Print Network [OSTI]

to Enrich Co-Presence Information." In: Adjunct Proceedings of the Seventh International Conference to Enrich Co-Presence Information Bibliographic Reference: Rahul Nair and Marc Davis. "Bluetooth Pooling on Ubiquitous Computing (UbiComp 2005) in Tokyo, Japan, 2005. #12;Bluetooth Pooling to Enrich Co

246

NCBI Handout Series | Clone DB | Last Update: August 19, 2013 Contact: info@ncbi.nlm.nih.gov Repository for DNA clones with integrated information on sequences, maps and distributors  

E-Print Network [OSTI]

terms are automatically entered in the query box (F). Clicking the "Add to history" link (G) pre- views box so custom terms such as a search history (#9) can be added. Displaying the search results A search for accessing data from CloneDB: Text searching through the Clone DB homepage www.ncbi.nlm.nih.gov/clone/ Bulk

Levin, Judith G.

247

Enterprise GIS System Architecture Prepared for: State of Rhode Island  

E-Print Network [OSTI]

Enterprise GIS System Architecture Prepared for: State of Rhode Island Date: 9/26/2011 Prepared byEdit, ArcEditor, ArcEurope, ArcExplorer, ArcExpress, ArcGIS, ArcGlobe, ArcGrid, ArcIMS, ARC/INFO, ArcInfo, ArcInfo Librarian, ArcInfo--Professional GIS, ArcInfo--The World's GIS, ArcLessons, ArcLocation, Arc

Wang, Y.Q. "Yeqiao"

248

Site plan safety submission for sampling, monitoring, decontamination of GB agent - north plant Rocky Mountain Arsenal. Volume 2  

SciTech Connect (OSTI)

During TVA's visit and survey of RMA's GB facility, sample points were identified (Table A-1). The sample points initially identified were from Buildings 1501, 1503, 1603, 1506, 1601, 1601A, and 1602. Piping isometrics were produced for each sample point identified and are shown in Appendix B. After a careful review of each sample point and discussions with RMA personnel, 67 of the original sample points were eliminated. The sample points eliminated consisted of all ventilation points and process equipment/piping that is open to the atmosphere.

Not Available

1988-10-01T23:59:59.000Z

249

Matematik Dnyas>, 2003 K>fl Tbitak Bilim dl (1979) sahibi, k>rk do-  

E-Print Network [OSTI]

> ayn> √ľniversiteden 1953'te ald>. 1960'da Ege √?niversitesi T>p Fak√ľltesi'nde "yabanc> ma- tematik ve- l>flt>. Ege √?niversitesi'nde do√ßent (1965) ve profe- s√∂r (1967) oldu. 1969-76 y>llar> aras>nda OD>rma Merke- zi'nde, 1995-97'de Gebze'de, Elektronik ve Krip- toloji Araflt>rma Merkezi'nde g√∂rev ald>. 1997

Sertöz, Ali Sinan

250

Categorical Exclusion Determination Form Proposed Action Title: (0474-1528) Ideal Power Converters Inc. -  

Broader source: Energy.gov (indexed) [DOE]

rgy rgy ·Submitby£-mail Categorical Exclusion Determination Form Proposed Action Title: (0474-1528) Ideal Power Converters Inc. - Dual Bi-Directional Silicon IGBTs Modules Enables Breakthrough PV Inverter Using Current-Modulation Topology Program or Field Office: Advanced Research Projects Agency - Energy LocationCs) CCitY/County/State): California, New York, Virginia, Texas Proposed Action Description: Funding will support development of a low-cost, high-efficiency 100 kW power inverter to connect photovoltaic (PV) solar panels to the grid, using revolutionary bi-directiona linsulated gate bipolar transistor (BD-IGBT) switches and dual chip modules. Proposed work consists of indoor laboratory-based research and development (R&D) and semiconductor fabrication, including (1) device

251

RECIPIENT:3M Company  

Broader source: Energy.gov (indexed) [DOE]

u.s. DEPARTMENT OFENl!RGY u.s. DEPARTMENT OFENl!RGY EERE PROJECT MANAGEMENT CENTER Nl!PA DETERMINATION PROJEl.i TITLE : 3M Columbia Solar Film Page 1 of2 STATE: MO Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number cm Number EEOOOO131 GFO-OOOO131-QOa EE131 Based on my review orthe information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 451.1A), I have made the following determination: CX, EA, EIS APPENDIX AND NUMBER : Description: 85.1 Actions to conserve energy, demonstrate potential energy conservation, and promote energy-eff"lCiency that do not increase the indoor concentrations of potentially harmful substances. These actions may involve financial and technical assistance to individuals (sud! as builders, owners, consultants, designers), organizations (such as utilities), and state

252

Categorical Exclusion Determination Form Proposed Action Title: (0473-1579) GE Global Research -  

Broader source: Energy.gov (indexed) [DOE]

partment of n rgy partment of n rgy Categorical Exclusion Determination Form Proposed Action Title: (0473-1579) GE Global Research - Nanoclay-reinforced Ethylene-Propylene-Rubber for Low Cost HVDC Cabling Program or Field Office: Advanced Research Projects Agency - Energy LocationCs) (City/County/State): Niskayuna, NY Proposed Action Description: Funding will support development of a low cost, extrudable, nanoclay-reinforced ethylene-propylene-rubber (EPR) for making high voltage direct current (HVDC) cable. Proposed work will consist of (1) indoor, laboratory-based synthesis, characterization, and testing of nanoclay-reinforced EPR and (2) computer- based modeling of the performance characteristics and production cost of the nanoclay-reinforced EPR HVDC cable at full scale.

253

Categorical Exclusion Determination Form  

Broader source: Energy.gov (indexed) [DOE]

n rgy n rgy Categorical Exclusion Determination Form Proposed Action Title: (0474-1555) University of Colorado - Boulder - Wafer-Level Sub-Module Integrated DCfDC Converter Program or Field Office: Advanced Research Projects Agency - Energy LocationCs) CCity/County/State): Colorado, Maine, Virginia Proposed Action Description: Funding will support development of a planar, wafer-level sub-module integrated converter (SubMIC) device that can be integrated into various types of photovoltaic (PV) modules to enable low-cost maximum power point tracking at high power processing efficiencies. Proposed work consists of indoor laboratory-based research and development (R&D), microfabrication activities, and analytical research, including: (1) simulated modeling and design of SubMIC components and integrated units, (2) development, fabrication, testing, and optimization

254

EERE PROJECT MANAGEMENT CENTER NFPA DFT1!lUIINATION  

Broader source: Energy.gov (indexed) [DOE]

OFEN:rRGY OFEN:rRGY EERE PROJECT MANAGEMENT CENTER NFPA DFT1!lUIINATION Page 1 of2 RECIPIENT:Middlesex Community College STATE: MA PROJECf TITLE: Middlesex Community College - Geothermal Project Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number N/A DE-EEOOOO323 GF0-0000323-002 EE323 Based on my review ofthe information concerning the proposed action, as NEPA Compliance Officer (authorized under DOE Order 4SI.IA), I have made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: A9 Inf ormation gathering, analYSiS, and dissemination 82.1 Workplace enhancements B2.2 Building and equipment instrumentation Information gathering (including, but not limited to, literature surveys, inventories, site visits, and audils),

255

Categorical Exclusion Determination Form Proposed Action Title: (0473-1621) Autogrid, Inc. -  

Broader source: Energy.gov (indexed) [DOE]

partment n rgy partment n rgy Categorical Exclusion Determination Form Proposed Action Title: (0473-1621) Autogrid, Inc. - Highly Dispatchable and Distributed Demand Response for the Integration of Distributed Generation Program or Field Office: Advanced Research Projects Agency - Energy Location{s) (City/County/State): California and New York Proposed Action Description: Funding will support development a highly distributed Demand Response Optimization and Management System for Real-time (DROMS-RT) power flow control software to support large scale integration of distributed renewable generation sources into the electricity grid. Proposed work consists of (1) developing a web-based software platform to enable full DROMS-RT functionality; (2) developing standards for

256

Categorical Exclusion Determination Form Proposed Action Title: (0473-1510) Texas Engineering Experiment Station -  

Broader source: Energy.gov (indexed) [DOE]

rtm nt n rgy rtm nt n rgy Categorical Exclusion Determination Form Proposed Action Title: (0473-1510) Texas Engineering Experiment Station - Robust Adaptive Topology Control (RATC) Program or Pield Office: Advanced Research Projects Agency - Energy Location(s) (City/County/State): Texas, Arizona, California, New Jersey, and Tennessee. Proposed Action Description: Funding will support development an algorithmic Topology Control software to enable real-time, automated control over the transmissions lines within the electricity grid during unexpected power supply interruptions caused by intermittent availability of renewable generation sources, and cascading network failures due to extreme operating conditions or malicious attacks. Proposed work consists of (1) developing a fast, adaptive topology control algorithm to identify actions that will mitigate effects of unexpected

257

INTERNATIONAL PROSPECTUS 2012  

E-Print Network [OSTI]

and career. At CDU I am confident that we can help you achieve your ambitions. I look forward to welcomingDUCAtIon 25 tHe CentRe FoR ReneWABLe eneRGY AnD LoW eMIssIon teCHnoLoGY 26 tHe noRtHeRn InstItUte 26 tHe Rese

258

Handbook of actuators and edge alignment sensors  

SciTech Connect (OSTI)

This actuator and sensor handbook was developed during a cooperative project between the NASA-Marshall Space Flight Center, the SDI-Directed Energy Program and LLNL. The common purpose of the joint effort was to develop precision actuators and sensors for the NASA initiated SpacE Laser ENE-rgy Program (SELENE). The purpose of the SELENE Program is to develop a highly cost effective segmented adaptive optics system for beaming laser power directly to spacecraft in earth orbit.

Krulewich, D A

1992-11-01T23:59:59.000Z

259

UC Energy Week 2010 May 10-12, 2010  

E-Print Network [OSTI]

UC Energy Week 2010 May 10-12, 2010 Inventing a New Energy Future Biomass Energy Geothermal Energy Solar Energy Wind Energy & Integrated Renewables InventIng a new energy Future UC EnErgy WEEk 2010 May 10­12, 2010 rgy intEgratEd rEnEWaBlEs Biomass EnErgy gEothErmal En nErgy gEothErmal EnErgy

260

Datasheet Fujitsu EsPRiMO E7936 E85+ DEsktOP PC Page 1 / 7 http://ts.fujitsu.com/esPRIMO  

E-Print Network [OSTI]

it infrastructure intel ¬ģ vProTM technology eneRgy savIng Low power consumption and low costs, without any loss in performance State-of-the-art technology, low energy-consuming processors, up to 87% efficient power supply DVi Extension Adapter NViDiA¬ģ Geforce¬ģ 9300GE display port low profile, 512 MB NViDiA¬ģ Geforce¬ģ 9300GE

Fiebig, Peter

Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

Currently there is no canola insurance policy for New Jersey. If you are interested however, in protecting your investment there are some options. If you have 3 years of prior yield records  

E-Print Network [OSTI]

Currently there is no canola insurance policy for New Jersey. If you are interested however, in protecting your investment there are some options. If you have 3 years of prior yield records for canola agent will help you request protection from RMA (Risk Manage- ment Agency) to transfer a canola crop

Goodman, Robert M.

262

Profiling translatomes of discrete cell populations resolves altered cellular priorities during hypoxia in Arabidopsis  

Science Journals Connector (OSTI)

...small subunit (pRBCS1A) Cotyledon and leaf epidermis Cuticular wax gene (pCER5) Cotyledon and leaf guard cells K + channel (pKAT1...publicly available CEL files (21-25) were analyzed using the pipeline described above. The RMA normalization step was always applied...

Angelika Mustroph; M. Eugenia Zanetti; Charles J. H. Jang; Hans E. Holtan; Peter P. Repetti; David W. Galbraith; Thomas Girke; Julia Bailey-Serres

2009-01-01T23:59:59.000Z

263

ProtEx: a toolkit for the analysis of distributed real-time systems  

E-Print Network [OSTI]

and queuing policies present in a system. In this thesis we present a methodology to extend the traditional RMA approach by allowing general characterization of workload and flexible modeling of resources. We realize our approaches within ProtEx, a toolkit...

Meylan, Yves Damien Meylan

2012-06-07T23:59:59.000Z

264

(mobile ) (xml ) 2001 12 ------  

E-Print Network [OSTI]

Act HIPAA 21CFR 11 RMA DOD 5015.2-STD - Sarbanes-Oxley Gramm-Leach-Bliley #12;(Gramm HIPAA Protected Health Information PHI PHI PHI PHI HIPAA PHI HIPAA #12; HIPAA 25 10 1.2.4. FDA FDA (Food and Drug Administration) 21 CFR (Code of Federal Regulations) Part 11

265

Prof. Dr. Metin Heper (Siyaset Bilimi Blm), doktoras>n> 1971'de Syracuse  

E-Print Network [OSTI]

√ľniversitelerinde araflt>rmac>l>k yapm>flt>r. Bilkent √?niversitesi'nde >rma M√ľd√ľrl√ľ¬§√ľ'nde dan>flmanl>k, Michigan State ile Ball State √ľniversitelerinde √∂¬§retim √ľyeli¬§i yapm>fl olan Dr. Aydo¬§an, Bilkent √?niversitesi'nde ¬§> ile

G√ľrel, Levent

266

E-Print Network 3.0 - abstracts search period Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

the period you wish to search. 12;2 PsycINFO user guide September 2002 Enter your search term or terms... PsycINFO user guide citations summaries abstracts journal...

267

Probing the extended emission-line region in 3C 171 with high-frequency radio polarimetry  

Science Journals Connector (OSTI)

......assuming it is cospatial with the EELR, would be 1010 Mo. 1 See http://info.aoc.nrao.edu/vla/html/highfreq/hffastswitch.html 2 See http://info.aoc.nrao.edu/vla/html/refpt.shtml Acknowledgments: The National Radio......

M.J. Hardcastle

2003-02-21T23:59:59.000Z

268

Dark Fiber Testbed  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

US) 1 510-486-7600 (Globally) 1 510-486-7607 (Globally) Report Network Problems: trouble@es.net Provide Web Site Feedback: info@es.net Dark Fiber Testbed Info on dark fiber testbed...

269

The Case for an Informed Path Selection  

E-Print Network [OSTI]

Université catholique de Louvain IP Networking Lab - http://inl.info.ucl.ac.be April 24th, 2008 1 #12 of IDIPS is available - http://inl.info.ucl.ac.be 14 #12;15 #12;

Bonaventure, Olivier

270

O. Bonaventure, 2007ISP-model 1 Issues in modelling ISP networks  

E-Print Network [OSTI]

François Bruno Quoitin Université catholique de Louvain Louvain-la-Neuve, Belgium http://inl, available form http://inl.info.ucl.ac.be Totem toolbox : http://totem.info.ucl.ac.b

Bonaventure, Olivier

271

Experimenting with Multipath TCP Sebastien Barre*, Olivier Bonaventure*  

E-Print Network [OSTI]

selection heuristics To download MPTCP for Linux: http://inl.info.ucl.ac.be/mptcp Acknowledegments in this document. http://inl.info.ucl.ac.be/mptcp sebastien.barre@uclouvain.be #12;

Bonaventure, Olivier

272

Appears in Proc. Third International Workshop on Self Adaptive Software Rosslyn, VA, June 2003  

E-Print Network [OSTI]

Honeywell Laboratories musliner@htc.honeywell.com Robert P. Goldman SIFT, LLC rpgoldman@sift.info Kurt D

Krebsbach, Kurt D.

273

MA 16100  

E-Print Network [OSTI]

MA 16100, Fall 2014. Plane Analytic Geometry And Calculus I. Course Info. Syllabus ∑ Emergency Preparedness Syllabus Attachment ∑ Course Calendar†...

274

National Nuclear Physics Summer School (NNPSS) 2011  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Important Dates Topics and Lecturers Check-inLocal Info Accommodations Travel Cost Program Contacts Organizers Lecture Notes Sponsors...

275

Platform Computing Inc. 3760 14th Avenue  

E-Print Network [OSTI]

: (905) 948-9975 email: info@platform.com www.platform.com Platform Computing Launches Networking Site

Buyya, Rajkumar

276

 U.S. Department of Energy Strategic Plan  

Broader source: Energy.gov (indexed) [DOE]

U.S. Department of Energy Strategic Plan U.S. Department of Energy Strategic Plan the DePaRtment of eneRGy stRateGIc Plan The Department of Energy (DOE) has a rich and diverse history with its lineage tracing back to the Manhattan Project and the race to develop an atomic bomb during World War II. Following that war, Congress created the Atomic Energy Commission (1946) to take control over the scientific and industrial complex supporting the Manhattan Project and to maintain civilian government control over atomic research and development. The Department of Energy Organization Act, which created DOE, was enacted in 1977 and DOE officially

277

The effect of bubble growth dynamics on the performance of a gas evolving electrode  

E-Print Network [OSTI]

THE EFFECT OF BUBBLE GRONTH D'rgiAMI CS ON THE PE' FOi&ilANCE OF A GAS EVOLVING ELECTRODE A Thesis By MOHAMMAD SHAMSUL HAgUE Submitted to the Graduate College of the Texas Alg& University in Partial ful fi llment of the requirements... for the degree o, MASTER OF SCIENCE Aug us t 1967 Major Subject: CHEMICAL ENGINEERING THE EFFFCT OF BUBBLE GROI'JTH DYNAMICS ON THE PERFOR1ANCE OF A GAS EVOLVING ELECTRODE A Thesis YiOHPJiINAD SHCivISUL HAQUE Approved as to style and content by...

Haque, Mohammad Shamsul

2012-06-07T23:59:59.000Z

278

Nutritive value of forage species in the Rio Grande Plain of Texas for white-tailed deer (Odocoileus virginianus texanus) and domestic livestock  

E-Print Network [OSTI]

NUTRIT IVE VALUE OF FORAGE SPEC IES IN THE RI 0 GRANDE PLAIN OF TEXAS FOR WHITE-TAILED DEER (ODOCOILEUS VIRG I NIANUS TEXANUS) AND DOMESTIC LIVESTOCK A Thesis GREGORY WILLIAM LYNCH Submitted to the Graduate College of' Texas AEM University... in partial fulfillment of the requirement f' or the degree of MASTER OF SCIENCE May 1977 Major Subject: Wildl ife and Fisheries Sciences NUTRI TI VE VALUE OF FORAGE SPECIES I N THE RIO GRANDE PLAIN OF TEXAS FOR WHITE-TAILED DEER (ODOCOILEUS VI RGI NIANUS...

Lynch, Gregory William

2012-06-07T23:59:59.000Z

279

M  

Broader source: Energy.gov (indexed) [DOE]

. i~~~,q&,g$.nu%f En*rgy . i~~~,q&,g$.nu%f En*rgy , . Washington, DC 20685 M d c t of1Columbia PubIic Service Conrmision ) Docket No. EGO5101 Oo h ~ r n b e r 24 20Q5, the S m e h r y issued Department af3nergy @OE) Order No. 20245-3, On January W , 2006, David K . Pay lor, Director of the -onwealth of Ykghb's Dqmhnent of E n m u Quality, and t h C * ofAlexandria, V i r g i 3 l i a &mitt4 ~ W S f~mbearing of Ordm NO. 262-05-3 CUII&~ t b M h t FO~XIUC R h r C u x e m W Shltion. Also on h m y 19,2006, the District of Columbia Public S&m &&ion submitted a reqws4 for clarification or, in the dkmtivq rdmuiq. j .' of Omler No. 20245-3. The t h e rehearing reqwsts we~e submitted pursuant t o sation 3 I3 afthe F B d d Power Act, 16 U.S.C. 8241. On F h w y 87,2006, in Odw No,ZU2- 06-1, rehearing of Order No. 202-053 was granted fiw the Iimited purpose of W

280

Document (501k)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

9 Named Ranges 96 Project Inputs HTGR Project Fractions HTGR Cost Basis Commodity Prices Economic Inputs IRR Analysis List Info Results Summary Sensitivity Analysis BraytonCost CA...

Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

E-Print Network 3.0 - activation state insights Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

- ment the state of the visualization at the time an insight occurs. Of course, an exploration process... Evaluating an InfoVis Technique Using Insight Reports Markus...

282

--No Title--  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Missouri and University of Tennessee have identified the genes required for bacterial mercury methylation. Image by Thomas Splettstoesser info@scistyle.com Researchers from Oak...

283

CTI-Private Financing Advisory Network | Open Energy Information  

Open Energy Info (EERE)

to get more RE and climate friendly projects financed and thereby to accelerate technology transfer under the UNFCCC." 1 The website provides general info and updates, an...

284

Key Word List Administrative  

E-Print Network [OSTI]

Self-Service Energy Efficiency Environment / Sustainability Ethics / Integrity Evaluation - Employee Attitudes Employee Development Employee Info Employee Misconduct/Termination Employee Recognition Employee

Fernandez, Eduardo

285

Data:Bd89b540-bda4-4bfb-9256-4e037b5532a9 | Open Energy Information  

Open Energy Info (EERE)

Description: Additional Info: Applicability: This schedule is applicable to the consumption of electrical energy for commercial or industrial uses, or for domestic...

286

NERSC User Demographics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

2013 2012 2011 2010 Careers Visitor Info Web Policies Home About NERSC Usage Demographics NERSC Usage Demographics NERSC Usage Demographics 2013 2013 NERSC Usage by...

287

Cheap acoustics as a learning methodology London South Bank University, FESBE, Borough Road, SE1 0AA London, UK  

E-Print Network [OSTI]

, Revit:Ecotect, Google Sketchup, ARTA, and winMLS. Through info4education.co.uk the students have access

Paris-Sud XI, Université de

288

SPIDERS Fort Carson Industry Day  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

20% 25% 30% 35% 40% 45% Info Tech BankingFinance Dams FoodAgriculture Communications Health Care Transportation Nuclear Government Chemical Crit Manufacturing Commercial...

289

1 | T H E A U S T R A L I A N N A T I O N A L U N I V E R S I T Y M I N U T E S  

E-Print Network [OSTI]

Dave Richardson (Chair) ATTENDING James Ashton (CECS), James Blanden (Enterprise Systems), Jo Bryant & Communications), Kathy Collier (AD Scholarly Info Res Mgmt), Dominy Evans (AD Enterprise Services), Anita Fitch

290

NETL Overview  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

* Grid operators have new resource options - Reduce peak load and prices through demand response - Improve grid reliability - Ancillary services Today Tomorrow Little or no info,...

291

E-Print Network 3.0 - active nuclear material Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Powered by Explorit Topic List Advanced Search Sample search results for: active nuclear material Page: << < 1 2 3 4 5 > >> 1 Contact Info: Pavel Oblozinsky Summary: physics...

292

FCRPS Hydro Projects (generation/hydro)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Information Kiosk Current Hydrological Info Fish Funding Agreement FCRPS Definitions Wind Power Monthly GSP BPA White Book Dry Year Tools Firstgov Federal Columbia River Power...

293

Data:E9d72d0c-f8be-470d-afca-297aef377a7f | Open Energy Information  

Open Energy Info (EERE)

0521 End date if known: Rate name: Residential Rates - Two Residential Units - One Meter Sector: Residential Description: Additional Info: The Minimum monthly charge of 5.40...

294

Data:975f76e7-e706-4f8a-95ee-5ab43a42922c | Open Energy Information  

Open Energy Info (EERE)

0521 End date if known: Rate name: Residential Rates - Three Residential Units - One Meter Sector: Residential Description: Additional Info: The Minimum monthly charge of 8.10...

295

ARRA Projects Chart | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Chart More Documents & Publications ARRA Project Info Combined 0112110.xls Missouri Recovery Act State Memo The Promise and Challenge of Algae as Renewable Sources of Biofuels...

296

A Path to Successful Energy Retrofits: Early Collaboration through Integrated Project Delivery Teams  

E-Print Network [OSTI]

Parrish, PhD KDParrish@lbl.gov EERE Information Center1-877-EERE-INFO (1-877-337-3463) www.eere.energy.gov/

Parrish, Kristen

2014-01-01T23:59:59.000Z

297

Guide to Setting Thermal Comfort Criteria and Minimizing Energy Use in Delivering Thermal Comfort  

E-Print Network [OSTI]

Berkeley, CA 94720 CMRegnier@lbl.gov EERE Information Center1-877-EERE-INFO (1-877-337-3463) www.eere.energy.gov/

Regnier, Cindy

2014-01-01T23:59:59.000Z

298

Chris Tracy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

info@es.net Chris Tracy Christopher (Chris) Thomas Tracy Network Engineer Network Engineering Services Group CTracy@es.net Chris Tracy has worked in computing and...

299

Data:00b49e12-6650-4565-bc32-b0dc8c851fd9 | Open Energy Information  

Open Energy Info (EERE)

date: 20130101 End date if known: Rate name: RESIDENTIAL FARM RATE SCHEDULE - F1 Sector: Residential Description: Additional Info: Applicability: This schedule is...

300

Fermilab | Science  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

feature photo feature photo feature photo feature photo feature photo Science Navbar Toggle About Quick Info Science History Organization Photo and Video Gallery Diversity...

Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

1547.ps  

E-Print Network [OSTI]

Dec 18, 2006 ... tic; [objt,Xt,yt,Zt,info] = mysdps(blk,A,C,b); t = toc;. >> tic; [fL, Y, dl] = vsdplow(blk,A,

302

Power Services Site Help & Information (pbl/main)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Help Power Services Site Map Searching for Text Other Navigation Aids PDF File Info Firstgov Power Services Web Site Help & Information Links to Help Pages: Power Services Site...

303

You are Here System (help/navigation)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Navigation Aids > Help Power Services Site Map Searching for Text Other Navigation Aids PDF File Info Firstgov Power Services Site Navigation Aids "You Are Here" System Under...

304

E-Print Network 3.0 - algimantas gradeckas lilija Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Sciences and Ecology 6 Werner Lehne, 10.5.2010 StudienbroInfo Mai2010 Summary: .Sc.M.Sc.Dipl. Wirtschaftsmathematik: StudienkoordinatorinStudienfachberaterin...

305

Visiting NERSC  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Visitor Info Visitor Information NERSC is located at Berkeley Lab's Oakland Scientific Facility (OSF) at 415 20th Street ("Thomas L Berkley Way") at Franklin Street in downtown...

306

Alice Koniges  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

David Turner Harvey Wasserman Woo-Sun Yang Zhengji Zhao Org Chart NERSC History NERSC Stakeholders NERSC Usage Demographics Careers Visitor Info Web Policies Home About Staff...

307

Selected Recent Publications and Presentations  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

David Turner Harvey Wasserman Woo-Sun Yang Zhengji Zhao Org Chart NERSC History NERSC Stakeholders NERSC Usage Demographics Careers Visitor Info Web Policies Home About Staff...

308

Alliant Energy Interstate Power and Light (Electric) - Business...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

State Government Savings Category Heat Pumps Lighting Maximum Rebate See program web site Program Info State Minnesota Program Type Utility Rebate Program Rebate Amount New...

309

SPARK! 2012 | ornl.gov  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Magnetic Filtration Process - Sherrill Advanced Credentialing For Trusted Networks - Sims Content Recommendation Solution - Tech Info Consumers - Morris Spark 2012 Request For...

310

Site Transition Guidance | Department of Energy  

Office of Environmental Management (EM)

Transition Guidance More Documents & Publications EM Recovery Act Lessons Learned (Johnson) Info-Exch 2012 - Thomas Johnson Presentation EM Recovery Act Lessons Learned...

311

RHIC | Image Library  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

arrow See the RHIC collection on Flickr | Note: to see photo descriptions, click "show info" in the player window after pressing play....

312

E-Print Network 3.0 - agilent dna microarrays Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Microarray experiments aim Source: Laforest, Frdrique - Laboratoire d'InfoRmatique en Image et Systmes d'information, Universit Claude Bernard (Lyon I) Collection: Computer...

313

GLOSSARY OF COMMITTEE ABBREVIATIONS: ACA: Advisory Committee on Athletics  

E-Print Network [OSTI]

) Commercialization of Intellectual Property Rights SRC, FCC F Senate (action) Conflict Resolution Process for Student Academic Complaints SCSA, SSCC St Senate (info) Copyright SCFA, SCC U

Amin, S. Massoud

314

Factsheets | The Ames Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

disruptions. Image Rare Earths Info Card This handy pocket card highlights the rare earth elements on the front and provides information on the back concerning Ames...

315

Alliant Energy Interstate Power and Light - Residential Renewable...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Eligibility Residential Savings Category Photovoltaics Solar Water Heat Maximum Rebate Solar Thermal Water Heater: 750 Program Info State Iowa Program Type Utility Rebate...

316

MA 15300  

E-Print Network [OSTI]

PowerPoints, Video Lessons and Outlines ∑ Supplemental Instruction Info ∑ Tutoring/Assistance Opportunities ∑ Chapter 1 of Textbook ∑ Even Answers to Book†...

317

STOCHASTIC ION HEATING BY A PERPENDICULARLY PROPAGATING ELECTROSTATIC WAVE  

E-Print Network [OSTI]

Plasma Research Report , PRR 76/24 July 1976 Link: http://charles.karney.info/biblio/karney77c.html #12

Karney, Charles

318

Microhole Array | Open Energy Information  

Open Energy Info (EERE)

data using small-diameter downhole tools designed for slim holes. Additional Info CostTime Dependency: Microholes cost less to drill than traditional wellbores, delivering...

319

Slide11 | OSTI, US Dept of Energy, Office of Scientific and Technical...  

Office of Scientific and Technical Information (OSTI)

when full bibliographical control is not feasible. Most Science Info Is in the Deep Web. Federated search drills down to the deep Web where scientific databases reside. Unlike...

320

APPENDIX A:  

National Nuclear Security Administration (NNSA)

Watson Submitted to Sandia Site Office, Gorn, Caughey Info Copy Only Albuquerque - Local Air Pollution Control RegulationsAir Permits No Change - Report is sent through the...

Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

E-Print Network 3.0 - air pollutants occupational Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

info@pacinst.org www.pacinst.org Summary: will be the greatest beneficiary of air pollution improvements in terms of occupational safety and health. The Pacific......

322

Department of Mathematics: Course Page  

E-Print Network [OSTI]

Course Info. Ground Rules ∑ Syllabus. Resources. Past Exam Archive. Assignments. WebAssign Login ∑ WebAssign Help ∑ Connection Errors. Course†...

323

Vantage Pomona Heights | Open Energy Information  

Open Energy Info (EERE)

EIS at na for na Environmental Impact Statement for the Vanage to Pomona Heights 239kV Transmission Line Project General NEPA Document Info Energy Sector Transmission...

324

One Nevada | Open Energy Information  

Open Energy Info (EERE)

One Nevada EIS at na for NA Final Environmental Impact Statement for the One Nevada Transmission Line Project (ON Line Project) General NEPA Document Info Energy Sector...

325

Slide02 | OSTI, US Dept of Energy, Office of Scientific and Technical...  

Office of Scientific and Technical Information (OSTI)

Three Topics Relating to Nano Info Diffusion We see three complementary approaches to improve information sharing and awareness Modeling - It's possible. Metadata - numeric data,...

326

Slide15 | OSTI, US Dept of Energy, Office of Scientific and Technical...  

Office of Scientific and Technical Information (OSTI)

Slide 15: In Summary: Three Points on Nano Info Diffusion -Modeling - it's possible -Metadata - numeric data, unlike textual data, requires metadata to ensure access -Stewardship -...

327

Slide02 | OSTI, US Dept of Energy, Office of Scientific and Technical...  

Office of Scientific and Technical Information (OSTI)

Slide 2: Three Topics Relating to Nano Info Diffusion We see three complementary approaches to improve information sharing and awareness - Modeling - it's possible - Metadata -...

328

Dr. Daniel Giammar | Photosynthetic Antenna Research Center  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

2014 Dr. Daniel Giammar The Chemistry and Engineering for Producing and Supplying Clean Drinking Water Original Event Info: November 22, 2014 - 10:30am Brauer Hall 012,...

329

In the News | Photosynthetic Antenna Research Center  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

2014 Dr. Daniel Giammar The Chemistry and Engineering for Producing and Supplying Clean Drinking Water Original Event Info: Read more about Dr. Daniel Giammar July 31, 2014 The...

330

Southline Transmission Line | Open Energy Information  

Open Energy Info (EERE)

Impact Statement for the Southline Transmission Line Project General NEPA Document Info Energy Sector Transmission Environmental Analysis Type EIS Applicant Southline...

331

E-Print Network 3.0 - agro-industrial products materiels Sample...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Mackenzie Summary: Poverty Alleviation through Cleaner Energy from Agro- industries in Africa (PACEAA) - 10 countries S... :www.applesonline.info 12;Two large UNEPGEF...

332

C117_05_13  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

OSTI--C117 (0513) Search: * Deep web databases * Thousands of authoritative science websites * Content from 15 federal science agencies * 200 million pages of science info and...

333

A.A. 2014/2015 LM-41 -Medicina e chirurgia  

E-Print Network [OSTI]

A.A. 2014/2015 LM-41 - Medicina e chirurgia Info Generali Presentazione del Corso INFO Generali Classe LM-41 Medicina e chirurgia Nome inglese Medicine and Surgery Lingua in cui si tiene il corso italiano Indirizzo internet del corso di laurea http://www.medicina.unict.it/ Presidente del CdS PALMERI

Bella, Giampaolo

334

Computer Science ~ BA AFFILIATION PROCEDURES~  

E-Print Network [OSTI]

Technical Electives: 3000+ (3+ crs) from application areas: CS; Bio; Chem; Math; Econ; Psych; etc. [only one Specialization: Three 3000+ courses (3+ crs) from same subject area. CS courses, LING 4474, INFO 4302, INFO 3300, ECON 3130(beginning fall 2013)/ ECON 3190(prior to fall 2013), ENGRD 2700 or MATH 4710 (Taking a 3000

Keinan, Alon

335

Getting Started Advanced Search for Funding Opportunities  

E-Print Network [OSTI]

Getting Started Advanced Search for Funding Opportunities For Assistance Delete Criteria to Update Search Funding ­ Finding Additional Sources Saving and Printing SPIN Search Results Past funding opportunities can be searched in InfoEd to: · find opportunities that were added prior to your account set

Duchowski, Andrew T.

336

x1 EVENTS EVENT HANDLING * 1. Event Handling. This file describe the main event loop, and most of the fu*  

E-Print Network [OSTI]

. The Expose event. + voidicon_expose(win_p); 8. void icon_expose(win_p p) { inti ( p! data.nr; p_outer_windowpane( p! type= diag _icon_win? &info!dw[i]! pane: &info!pw[i]* *! pane; display _icon_graphics(pane! icon, pane!title, pane!visibility); if ((p! type= diag

van Leeuwen, Marc

337

Information Commons Help Desk Internet / Connectivity Wireless Access  

E-Print Network [OSTI]

Information Commons Help Desk Internet / Connectivity ¬Ľ Wireless Access ID #1912 Connecting in the Username and Password fields.5. Info Commons Help Desk - Connecting to the UofT wireless netwo... http://help on this entry Info Commons Help Desk - Connecting to the UofT wireless netwo... http://help

Boonstra, Rudy

338

test1 - Datasets - OpenEI Datasets  

Open Energy Info (EERE)

test1 This is only a test Data and Resources TEST1.1com TESTING More info Go to resource doe test1 test2 test Additional Info Field Value Catalog OpenEI Origination Date 2014-11-12...

339

Geographical Distribution of Biomass Carbon in Tropical Southeast Asian  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

3. Files in this numeric data package 3. Files in this numeric data package File File size Projection number File name (kbytes) File description type File type 1 ndp068.txt 94 Descriptive file (i.e., this n/a ASCII text document) 2 Biomass.e00 59,468 Exported ARC/INFO gridded Albers ARC/INFO (3.75-km) estimates of actual export GRID and potential biomass carbon 3 Biomassx.e00 1,534 Exported ARC/INFO gridded Geographic ARC/INFO (0.25-degree) estimates of export GRID actual and potential biomass carbon 4 ac.dat 24,607 ASCII file of ungenerated Albers GRIDASCII ARC/INFO gridded (3.75- ASCII data

340

Dispersion by chemical reaction of Rocky Mountain Arsenal Basin F waste soils  

SciTech Connect (OSTI)

Many military installations have soil contamination problems that range from heavy metals to petroleum products. Rocky Mountain Arsenal (RMA) Basin F contains high concentrations of salts, heavy metals, ammonia, urea, and organics. The Dispersion by Chemical Reaction (DCR) process leads to a reduction in the mobility of the organic and inorganic constituents by first removing volatile constituents via steam stripping and volatilization, then trapping the nonvolatile contaminants in a nonmobile phase (microencapsulation), and finally compacting the treated material into large soil bodies (macroencapsulation). This report summarizes the results of the DCR testing of soil-amended Basin F sludge from RMA. The primary focus of this study is on pesticide leachability. The DCR process used to treat the Basin F waste soil produced a dry, homogeneous, soil-like material with desirable physical properties that on compaction achieved the following remediation goals: reduction of all leachable volatiles to nondetectable levels, confinement of all metals to below RCRA TCLP levels, and a decrease in pesticide leachability to levels approaching RCRA standards. For example, endrin TCLP concentration was reduced from 74 microgram/L to 20-28 microgram/L (regulatory limit = 20 ug/L). In several cases, reductions in pesticide leachability could be attributed to simple dilution with the calcium oxide (CaO) reagent. However in other cases, microencapsulation and/or macroencapsulation also played a role in reducing pesticide leachability. Additional work is necessary to optimize the amounts of lime-milk, hydrophobic CaO, and benign oil used in the processing of RMA Basin F waste soils. Ideally, the optimum design should achieve the regulatory and client goals, while minimizing materials handling, energy, and reagent inputs.

Payne, J.R.; Marion, G.M.

1997-02-01T23:59:59.000Z

Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

MIDC: Links  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Links Links Other Data Collection Activities Baseline Surface Radiation Network (BSRN) Clear Sky Forcast for NREL/SRRL (or other locations) Colorado Dept. of Public Health & Environment: Air Quality Index (AQI) Reporting System Colorado State University: USDA UV-B Monitoring and Research Program European Skynet Radiometers network (ESR) Jefferson County, Colorado: Jeffco Weather Station NOAA: Climate Monitoring & Diagnostics Laboratory (CMDL) NREL OTF: Reference Meteorological and Irradiance System (RMIS) NREL RReDC: Cooperative Networks for Renewable Resource Measurements (CONFRRM) NREL RReDC: NASA Remote Sensing Validation Data: Saudi Arabia Rocky Mountain Arsenal (RMA): National Wildlife Refuge Sandia National Laboratories: Photovoltaic Systems Evaluation

342

TDAG Research - Argonne National Laboratories, Materials Sicence Division  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Research Research TDAG Research Background information Originally Environmental Chemistry Team Started in early 90s Field or "On Site" Analytical Method Development Field GC & MS, Mobile Lab (at DOE & DOD sites) Portable XRF (Pb, Hg, As) Chemical Sensors Site Investigations Analysis of environmental samples Analytical Method Development Chemical agent determination (Projects at DPG, APG, RMA) Environmental analysis (EPA methods) Process analysis (CAMDS, AMTEX) Current Capabilities Neutron Activation Facility - Dedicated to NAUTICAS Project for the ONR, but may be available for other projects. (Homeland security, Catalysis studies) ICP/MS Lab - Perkin Elmer. Used for trace characterization of metals GC/MS Lab - Perkin Elmer Clarus 600 GC/MS system. Used for

343

AVAILABLE ONLINE AT: INITIATED BY:  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

the Chief Information Officer the Chief Information Officer U.S. Department of Energy ORDER Washington, D.C. Approved: 5-16-2011 SUBJECT: DEPARTMENT OF ENERGY CYBER SECURITY PROGRAM 1. PURPOSE. To set forth requirements and responsibilities for a Departmental Cyber Security Program (CSP) that protects information and information systems for the Department of Energy (DOE). The CSP requires a Risk Management Approach (RMA) that includes: analysis of threats/risks; risk-based decisions considering security, cost and mission effectiveness; and implementation consistent with guidelines from the National Institute of Standards and Technology (NIST) and Committee on National Security Systems (CNSS) cyber requirements, processes and protections. DOE Oversight is

344

Site plan safety submission for sampling, monitoring, decontamination of GB agent - north plant Rocky Mountain Arsenal. Volume 1  

SciTech Connect (OSTI)

The scope of this site plan safety submission (SPSS), includes: sampling plan to determine if GB is a contaminant in equipment and piping used in the production and demil processes; monitoring plan for personnel involved in the sampling effort; decon plan for personnel, equipment, and piping should contamination be identified. Additional sections and appendices include: historical use of bldg 1501, 1503, 1504, 1506, 1601, 1602, 1603, 1606; chemical information on GB; safety requirements; medical requirements and first aid procedures; piping drawings; rma sop's for sampling, monitoring, and decon.

Not Available

1988-10-01T23:59:59.000Z

345

Managing environmental information in the age of outsourcing.  

SciTech Connect (OSTI)

As more data gathering, analysis, and tracking tasks are outsourced the need for multiple contractors and military personnel to input, update, access, store, and track Mormation is becoming critical to efficient functioning and managing of environmental projects and programs at military installations. This paper presents two case studies detailing the way two organizations--the Rocky Mountain Arsenal (RMA) in Colorado, and the 611th Air Support Group (611 ASG) in Alaska--are managing complex data using web-based technology. RMA is involved in one of the largest environmental cleanup programs in the Department of Defense. As such, large volumes of environmental data and documents must be generates stored, and tracked. Often these documents are prepared by multiple contractors and are reviewed by several parties or groups. To manage environmental information and to ensure that it meets compliance requirements more efficiently, RMA has developed an electronic document tracking and distribution system. This system allows access to up-to-date information, including a detailed review of all pertinent regulatory and other requirements at RMA. The dynamic system includes milestones, review deadlines, submission deadlines, and other requirements for managing the environmental program. The 611 ASG manages more than 30 remote installations in Alaska, many of which are operated by contractor personnel. These installations contain hundreds of buildings that are constantly being modified because of exposure to harsh arctic climates; some of them have been determined to be eligible for the National Register of Historic Places. To meet regulatory requirements for cultural resources management as well as engineering requirements for upkeep of buildings, a database was developed to store and analyze building data. The database has a web-based interface that allows anyone with the correct access codes to input new data, modify existing data, or query the database using a number of standard reports. This system allows the 611 ASG to centrally manage its building information while also permitting installation contractors to update and use data through the Internet from their remote locations.

Perkins, S.; Smith, K.; Whorton, M.; Williams, G.

1999-03-08T23:59:59.000Z

346

Rotational micro-CT using a clinical C-arm angiography gantry  

SciTech Connect (OSTI)

Rotational angiography (RA) gantries are used routinely to acquire sequences of projection images of patients from which 3D renderings of vascular structures are generated using Feldkamp cone-beam reconstruction algorithms. However, these systems have limited resolution (<4 lp/mm). Micro-computed tomography (micro-CT) systems have better resolution (>10 lp/mm) but to date have relied either on rotating object imaging or small bore geometry for small animal imaging, and thus are not used for clinical imaging. The authors report here the development and use of a 3D rotational micro-angiography (RMA) system created by mounting a micro-angiographic fluoroscope (MAF) [35 {mu}m pixel, resolution >10 lp/mm, field of view (FOV)=3.6 cm] on a standard clinical FPD-based RA gantry (Infinix, Model RTP12303J-G9E, Toshiba Medical Systems Corp., Tustin, CA). RA image sequences are obtained using the MAF and reconstructed. To eliminate artifacts due to image truncation, lower-dose (compared to MAF acquisition) full-FOV (FFOV) FPD RA sequences (194 {mu}m pixel, FOV=20 cm) were also obtained to complete the missing data. The RA gantry was calibrated using a helical bead phantom. To ensure high-quality high-resolution reconstruction, the high-resolution images from the MAF were aligned spatially with the lower-dose FPD images, and the pixel values in the FPD image data were scaled to match those of the MAF. Images of a rabbit with a coronary stent placed in an artery in the Circle of Willis were obtained and reconstructed. The MAF images appear well aligned with the FPD images (average correlation coefficient before and after alignment: 0.65 and 0.97, respectively) Greater details without any visible truncation artifacts are seen in 3D RMA (MAF-FPD) images than in those of the FPD alone. The FWHM of line profiles of stent struts (100 {mu}m diameter) are approximately 192{+-}21 and 313{+-}38 {mu}m for the 3D RMA and FPD data, respectively. In addition, for the dual-acquisition 3D RMA, FFOV FPD data need not be of the highest quality, and thus may be acquired at lower dose compared to a standard FPD acquisition. These results indicate that this system could provide the basis for high resolution images of regions of interest in patients with a reduction in the integral dose compared to the standard FPD approach.

Patel, V.; Hoffmann, K. R.; Ionita, C. N.; Keleshis, C.; Bednarek, D. R.; Rudin, S. [Toshiba Stroke Research Center, Department of Physics, State University of New York at Buffalo, Buffalo, New York 14214 (United States); Toshiba Stroke Research Center, Department of Neurosurgery, Department of Physics, Department of Physiology and Biophysics, Department of Mechanical and Aerospace Engineering, and Department of Computer Science, State University of New York at Buffalo, Buffalo, New York 14214 (United States); Toshiba Stroke Research Center, Department of Neurosurgery, State University of New York at Buffalo, Buffalo, New York 14214 (United States); Toshiba Stroke Research Center, Department of Electrical Engineering, State University of New York at Buffalo, Buffalo, New York 14214 (United States); Toshiba Stroke Research Center, Department of Radiology, Department of Neurosurgery, Department of Physics, and Department of Physiology and Biophysics, State University of New York at Buffalo, Buffalo, New York 14214 (United States); Toshiba Stroke Research Center, Department of Radiology, Department of Neurosurgery, Department of Physiology and Biophysics, Department of Mechanical and Aerospace Engineering, and Department of Electrical Engineering, State University of New York at Buffalo, Buffalo, New York 14214 (United States)

2008-10-15T23:59:59.000Z

347

EERE PROJECT MANAGEMENT CENTER NEPA DETERMINATION RECIPIENT  

Broader source: Energy.gov (indexed) [DOE]

!, !, u.s. DEPARThIENT OFENI'RGY EERE PROJECT MANAGEMENT CENTER NEPA DETERMINATION RECIPIENT :Advanced Magnet Lab, Inc. STATE : FL PROJECf TITLE: A Lightweight, Direct Drive, Fully Superconducting Generator for large Wind Turbines Page 1 of3 Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number CID Number DE-FOA-0000439 DE-EEOOOS140 GFO-OOOS140-003 G05140 Based on my review of the information concerning tbe proposed action, as NEPA Compliance Officer (authorized under OOE Order 451.1A), I have made the following determination : ex. EA, EIS APPENDIX AND NUMBER: Description: 83.6 Small-scale research and de ve lopment, labo ratory o perations, and pilot projects Siting. construction, modification, operation. and decommiSSioning of facilities for smaliscale research

348

EERE PROJECT MANAGEMENT CENTER NEPA DI!Tl!RlInNATION RECIPIENT:Ohio Department of Development  

Broader source: Energy.gov (indexed) [DOE]

,",C:'Fn. ,",C:'Fn. : ..... ! . u.s. DEPARTMI!NI OFI!Nl!RGY EERE PROJECT MANAGEMENT CENTER NEPA DI!Tl!RlInNATION RECIPIENT:Ohio Department of Development PROJECT TITLE: SEP ARRA - French Creek Bioenergy Page I of3 ~'" @ STATE: OH Funding Opportunity Announcement Number Procurement Instrument Number NEPA Control Number em Number EEOOOO165 GF0-0000165-022 GOO Based on my review of the Information concerning tbe proposed .cliontlls NEPA Compliance Officer (authoru.ed under DOE Order 4St.IA).1 bave made the following dete ... minatton: ex. EA, [IS APPENDIX AND NUMBER: Description: 85.1 Actions to conserve energy, demonstrate potential energy conservation, and promote energy-efficiency that do not increase the indoor concentrations of potentially harmful substances. These actions may involve financial and technical

349

Strengthening Cyber Security  

Broader source: Energy.gov (indexed) [DOE]

E E n E rgyB i z November/December 2008 ¬Ľ TECHNOLOGY FRONTIER (Guest OpiniOn) remOte attaCks On systems that control power production and distribution are no longer hypothetical events. At least four utilities have been subjected to extortion demands by criminals who used the Internet to infect the utilities' computers and caused or threatened power outages. Cyber attacks have been used to disrupt power equipment in several regions outside the United States. In at least one case, the disruption caused a power outage affecting multiple cities. These are criminal acts, but nation-states are actively targeting utility computers, as well, so that in time of war they can turn off their adversary's power. While all this is happening, most executives in the

350

Appendix B: CArBon dioxide CApture teChnology SheetS R&D CollaboRations  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

R&D CollaboRations R&D CollaboRations B-556 R&D CollaboRations U.s. DepaRtment of eneRgy aDvanCeD CaRbon DioxiDe CaptURe R&D pRogRam: teChnology UpDate, may 2013 paRtneRship foR Co 2 CaptURe primary project goals The University of North Dakota Energy and Environmental Research Center (UNDEERC) is conducting pilot-scale testing to demonstrate and evaluate a range of carbon dioxide (CO 2 ) capture technologies to develop key technical and economic information that can be used to examine the feasibility of capture technologies as a function of fuel type and system configuration. technical goals * Integrate a high-efficiency flexible capture system with existing pilot-scale combustion

351

FY 2007 Secretary Rollout  

Broader source: Energy.gov (indexed) [DOE]

Budget Budget DOE: Energy, Science, and Security February 6, 2006 1 Guiding Principles * Advancing our National Security * Reducing Dependence on Foreign Oil * Increasing Economic Competitiveness through Scientific Discovery * Honoring our Commitments * Managing for Excellence Supporting our Nation's Highest Priorities 2 DOE Budget : FY 2006 and FY 2007 ($ in Billions) National Security $9.1 Energy and Environm ent $9.9 Science $3.6 Corporate M anagem ent $1.0 FY 2006 Appropriation $23.6 Billion FY 2007 Request $23.6 Billion FY 2007 request is level with FY 2006 In real terms, $0.5 billion below FY 2006 National Se curity $9.3 Ene rgy and Environm e nt $9.2 Science $4.1 Corporate M anage m ent $1.0 3 FY 2007 DOE Budget Breakout By Organization ($ in Millions) -$3 $983 $986 $1,002 Corporate Management/FERC

352

RECIPIENT:Gwinnett Co, GA  

Broader source: Energy.gov (indexed) [DOE]

Gwinnett Co, GA Gwinnett Co, GA u.s DEPARUIENT OFENllRGY EERE PROJECT MANAGEMENT CENTER NllPA DETERl\JINATION PROJECr TITLE: Gwinnett Co, GA EEC8G Page I or2 STATE: GA Funding Opportunity Announcement Number Procu~ment Instrument Number N[PA Control Number CID Number DE-EEOOOOS05.005 0 Based on my review ortbe information concerning tbe proposed action, as NEPA Compliance Officer (authorized under DOE Order 4SI.IA), I bave made the following determination: ex, EA, EIS APPENDIX AND NUMBER: Description: 8 5.1 Actions to conserve energy, demonstrate potential energy conservation, and promote energy-efficiency that do not increase the indoor concentrations of potentially harmful substances. These actions may involve financial and technical assistance to individuals (such as builders, owners, consultants, designers), organizations (such as utilities), and state

353

DOE/ER/06035--7  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

06035--7 06035--7 DE85 014321 Technical Progress Report SUPERSONIC METAL CLUSTER BEAMS Department of Ene'rgy Contract No. DE-AS0548ER06035 For Period 3-16-w through 4-l-85 Principal Investigator: R. E. Smalley DISCLAIMER This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government nor any agency thereof, nor any of their emptoyecs, makes any warranty, express or implied, or assumes any legal liability or rcspond- bility for the accuracy, completeness, or usefulness of any information, apparatus, product, or process disclosed, or represents that its use would not infringe privately owned rights. Refer- ence herein to any specific commercial product, process, or service by trade name, trademark,

354

NUCLEAR REGULATORY COMMISSION WASHINGTON, D. C. 20555  

Office of Legacy Management (LM)

REGULATORY COMMISSION REGULATORY COMMISSION WASHINGTON, D. C. 20555 JAN 2 2 1982 -/ Departmznt'of Ene,rgy ATTN : Dr. William E. Mott, Director Environmental and Safety Engineering Division (EP-32) Washington, D.C. 20545 Dear Dr. Mott: Enclosed is the list of contaminated'or potentially contaminated sites that I promised to send you during our recent meeting. The sites have been broken down into the followi,ng four categories: 1. Sites with known contamination that have never been 1 icensed. 2. Formerly licensed sites with known contamination. 3. Currently licensed sites that are being decontaminated prior to decoronissioning. 4. A list of formerly licensed sites that need to be visited to determine if they have been properly decontaminated prior to decommissioning.

355

Oregon Wave Energy Trust OWET | Open Energy Information  

Open Energy Info (EERE)

Trust OWET Trust OWET Jump to: navigation, search Name Oregon Wave Energy Trust (OWET) Place Portland, Oregon Zip 97207 Product String representation "The Oregon Wave ... rgy generation." is too long. Coordinates 45.511795¬į, -122.675629¬į Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":45.511795,"lon":-122.675629,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

356

Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 8822  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

e e rgy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 8822 1 OCT 1 8 2012 Mr. John E. Kieling. Chief Hazardous Waste Bureau New Mexico Envi ronment Department 2905 Rodeo Park Drive Easl. Building 1 Sanla Fe. New Mexico 87505-6303 Subject: Tran smittal of Waste Isolation Pilot Plant An nual Reports Dear Mr. Kieling . The purpose of this letter is to provide you with the following annual reports as required by Ihe Wasle Isola li on Pilol Planl Hazardous Was le Facilily Permil No. NM4890139086- TSDF . Part 4. Seclion 4.6.1.2. * W aste Isolalion Pilot Planl Geolechnica l Analysis Report for July 2010 - June 2011 . DOEIWI PP-12-3464 . Volumes 1 and 2 * Assessment of the Short-Term Stability of the 12 Foot Explosion Isolation Wa lls in Panel 1 and 2. November 20

357

S A V A N N A H R I V E R S I T E  

Broader source: Energy.gov (indexed) [DOE]

Excerpts from Excerpts from "Strengthening Energy Security through Federal Partnerships" 67 ENE RGY The Military Engineer * No. 676 The need to shrink depen dence on fos- sil fuels is not a new conce pt in the na- tion's energy discus sion, nor is the need to invest in clean, renew able energy . But the challe nge of how to deliver solar, bioma ss, wind, wave, geothe rmal and other power genera tion techno logies in a cost effecti ve, large-s cale mann er-an d meet the chang - ing energy deman ds of the nation -is a very curren t one indeed . Throu gh a partne rship with the U.S. Army Corps of Engin eers (USAC E) Sa- vanna h Distri ct, Depar tment of Energ y (DOE ), Savan nah River Nation al Labor a- tory (SRNL ) and other federa l entitie s, the South east Energ y Initiat ive (SEEI) is pro- active

358

The Honorable Richard M  

Office of Legacy Management (LM)

\ \ : Department of,Eni?rgy' 1 ~, ' , . Washington. DC 20585 \ 1;. ,"' ' .I .: :.:.3.* .I..,~.. .I ., . ..I..4 ., The Honorable Richard M . Daley, Jr. 121 N. LaSalle Street; Chicago, Illinois. 60602 Dear Mayor Daley: Secretary of'Energy Hazel O'Leary has announced a new approach to openness in the Department-of Energy (DOE) and its communications with the public. In support of this initiative, we are pleased to forward the enclosed information related to the .former Armour Research Foundation, of Illinois. Institute of Technology site'in your jur,isdiction,that,~performed work for DOE'spredecessor agencies. This informatio~n is ,provided for your information,-use, and retention. ,_' DOE's Formerly Utilized.Sites Remedial Action Program (FUSRAP)' is responsible

359

Energy  

Office of Legacy Management (LM)

..) ".. ..) ".. _,; ,' . ' , ,; Depar?.me.nt ,of.' Energy Washington; DC 20585 : . ' , - $$ o"\ ' ~' ,' DEC ?;$ ;y4,,, ~ ' .~ The Honorable John Kalwitz , 200 E. Wells Street Milwaukee, W~isconsin 53202, . . i :. Dear,Mayor 'Kalwitz: " . " Secretary of Energy Hazel' O'Leary has announceha new,approach 'to,openness in " the Department of Ene~rgy (DOE) and its communications with'the public. In -. support of~this initiative, we areipleased to forward the enclosed information related to the Milwaukee Ai.rport site in your jurisdiction that performed work, for DOE orits predecessor agencies. information; use, and retention. ., This information .is provided for your '/ ,' DOE's Formerly Utilized Sites Remedial:'Action~'Prog&is responsible for ,"'

360

CA.0  

Office of Legacy Management (LM)

of_f$ergy of_f$ergy Washington, DC 20545 *. CA.0 MAY 2 9 1987 .r ,. Hr. Carl Schafer Director of Environmental Poli,cy Office of the Deputy Assistant Secretary of Defense for Installations Pentagon . ..&&&.@.&&;-D.C. 20301 Dear Mr.~:Schafer: As you know, the Department of Ene,rgy (DOE) is implementing a program to identify sites that may be radiologically contaminated as a result of DOE predecessor operations and to correct any pioblems associated with this contamination if there is DOE authority to do so. Reviews of historical materials from the Manhattan Engineer District (MED) and Atomic Energy Commission (AEC) era conducted in support of this program have identified number of active and former Department of Defense (DOD) installations and

Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

B{sub K}-parameter from N{sub f}=2 twisted mass lattice QCD  

SciTech Connect (OSTI)

We present an unquenched N{sub f}=2 lattice computation of the B{sub K} parameter which controls K{sup 0}-K{sup 0} oscillations. A partially quenched setup is employed with two maximally twisted dynamical (sea) light Wilson quarks, and valence quarks of both the maximally twisted and the Osterwalder-Seiler variety. Suitable combinations of these two kinds of valence quarks lead to a lattice definition of the B{sub K} parameter which is both multiplicatively renormalizable and O(a) improved. Employing the nonperturbative RI-MOM scheme, in the continuum limit and at the physical value of the pion mass we get B{sub K}{sup RGI}=0.729{+-}0.030, a number well in line with the existing quenched and unquenched determinations.

Constantinou, M.; Panagopoulos, H.; Skouroupathis, A.; Stylianou, F. [Department of Physics, University of Cyprus, P.O. Box 20537, Nicosia CY-1678 (Cyprus); Dimopoulos, P. [Dipartimento di Fisica, Sapienza, Universita di Roma, Piazzale A. Moro, I-00185 Rome (Italy); Frezzotti, R.; Rossi, G. C. [Dipartimento di Fisica, Universita di Roma, 'Tor Vergata' Via della Ricerca Scientifica 1, I-00133 Rome (Italy); INFN, Sezione di 'Tor Vergata' c/o Dipartimento di Fisica, Universita di Roma 'Tor Vergata' Via della Ricerca Scientifica 1, I-00133 Rome (Italy); Jansen, K. [DESY, Zeuthen Platanenallee 6, D-15738 Zeuthen (Germany); Gimenez, V. [Departament de Fisica Teorica and IFIC, Univ. de Valencia-CSIC, Dr. Moliner 50, E-46100 Valencia (Spain); Lubicz, V. [Dipartimento di Fisica, Universita di Roma, Tre Via della Vasca Navale 84, I-00146 Rome (Italy); INFN, Sezione di Roma Tre c/o Dipartimento di Fisica, Universita di Roma, Tre Via della Vasca Navale 84, I-00146 Rome (Italy); Mescia, F. [Departament d'Estructura i Constituents de la Materia, Universitat de Barcelona, 6a pianta, Diagonal 647 E-08028 Barcelona (Spain); Papinutto, M. [Laboratoire de Physique Subatomique et de Cosmologie, UJF/CNRS-IN2P3/INPG, 53 rue des Martyrs, 38026 Grenoble (France); Simula, S. [INFN, Sezione di Roma Tre c/o Dipartimento di Fisica, Universita di Roma, Tre Via della Vasca Navale 84, I-00146 Rome (Italy); Vladikas, A. [INFN, Sezione di 'Tor Vergata' c/o Dipartimento di Fisica, Universita di Roma 'Tor Vergata' Via della Ricerca Scientifica 1, I-00133 Rome (Italy)

2011-01-01T23:59:59.000Z

362

ARM - Publications: Science Team Meeting Documents  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Cloud-Resolving Simulations of Boundary-Layer Cloud Regimes with a Cloud-Resolving Simulations of Boundary-Layer Cloud Regimes with a Third-Order Turbulence Cheng, A.(a,b) and Xu, K.-M.(a), Atmospheric Sciences, NASA Langley Research Center (a), Hampton University (b) Twelfth Atmospheric Radiation Measurement (ARM) Science Team Meeting LES (large eddy simulation) models can explicitly resolve large turbulent eddies, which contain m ost of the turbulent kinetic energy and do most of the transport in the boundary layer. These edd ies have to be parameterized in cloud-resolving models (CRMs), which have much coarser resolution . A sophisticated turbulent parameterization is needed in order to produce adequate simulations o f cloud processes in CRMs. Most CRMs use a one- and a half-order prognostic turbulent kinetic ene rgy closure. Third-order

363

SI Group Scheduling Page  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Personnel On-Call Page Beamline Validation Schedule Group Organizational Chart Reviews Presentations Group Scheduling Page Project Scheduling Information Ops Scheduling Info Project / Scheduling Info APS fy2005 Annual Schedule ( html ) PSS Validation Schedule APS fy2006 Annual Schedule (html) PSS Validation Teams Latest Machine Studies Schedule (pdf) (html) New Builds Schedule (For SI GROUP Reference Only) Parasitic Beam Operations Schedule Ops Scheduling Page Shutdown Information Work Schedules August/September Shutdown Shutdown Work List Validation Schedule Safety Info Work Request Links ISM Core Functions Enter / Search Work Requests APS Safety Page Modify / Approve Work Requests Radiation Safety Policy APS TMS Training Profiles MSDS Search This page maintained by Joe Budz

364

REEGLE - Clean Energy Information Gateway | Open Energy Information  

Open Energy Info (EERE)

REEGLE - Clean Energy Information Gateway REEGLE - Clean Energy Information Gateway (Redirected from Reegle Search Engine for Renewable Energy and Energy Efficiency) Jump to: navigation, search Tool Summary LAUNCH TOOL Name: reegle.info - clean energy information portal Agency/Company /Organization: Renewable Energy and Energy Efficiency Partnership (REEEP) Sector: Climate, Energy Focus Area: Renewable Energy, Biomass, Energy Efficiency, People and Policy, Solar, Wind Phase: Evaluate Options, Prepare a Plan, Develop Finance and Implement Projects Topics: Background analysis, Implementation, Low emission development planning, -LEDS, Policies/deployment programs Resource Type: Dataset, Maps, Publications Website: www.reegle.info/ Web Application Link: www.reegle.info/ RelatedTo: REEEP Toolkits

365

IBM Blue Gene Parallel Supercomputer, Brookhaven National Laboratory, (BNL)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

L L Overview Simple Example: Compile, Link, Run Compiler Invocation Compile and Link Tips Batch Job Submission Applications Support Math Libraries MPI Version IBM Fortran Blue Gene & Linux Manuals (IBM Redbooks) Much of the info you need will be in the Linux manual, but there is also some Blue Gene-specific info in the Blue Gene manual. Current Fortran compiler version number can be determined on fen by typing: ls /opt/ibmcmp/xlf/bg, will be highest number listed. IBM C/C++ Blue Gene & Linux Manuals (IBM Redbooks) Much of the info you need will be in the Linux manual, but there is also some Blue Gene-specific info in the Blue Gene manual. Linux Manual: Go to XL C/C++ for Linux, choose the Product Library link, then select current version number in tab at page top. (Current C/C++

366

RHIC II Science Workshop  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Working Groups and Convenors Working Groups and Convenors The purpose of these Working Groups is to provide an organized way for the community to refine the science agenda for the RHIC II upgrades, and make a compelling case for these upgrades to the broad nuclear physics community. A document summarizing the Working Group results, with a sharp focus on the science case for RHIC II, will be produced early in 2006. Electromagnetic Probes Convenors: Ralf Rapp, Zhangbu Xu, Gabor David Email list info Website Heavy Flavor Convenors: Ramona Vogt, Thomas Ullrich, Tony Frawley Email list info Website High pT Convenors: Denes Molnar, Saskia Mioduszewski, Kirill Filimonov Internal working group web page Email list info Equation of State Convenors: Steffen Bass, Julia Velkovska, Helen Caines Email list info

367

Template:ExplorationTechnique | Open Energy Information  

Open Energy Info (EERE)

'ExplorationTechnique' template. To define a new Exploration 'ExplorationTechnique' template. To define a new Exploration Technique, please use the Exploration Technique Form. Parameters Definition - A link to the OpenEI definition of the technique (optional) ExplorationGroup - ExplorationSubGroup - ParentExplorationTechnique - parent technique for relationship tree LithologyInfo - the type of lithology information this technique could provide StratInfo - the type of stratigraphic and/or structural information this technique could provide HydroInfo - the type of hydrogeology information this technique could provide ThermalInfo - the type of temperature information this technique could provide EstimatedCostLowUSD - the estimated value only of the low end of the cost range (units described in CostUnit) EstimatedCostMedianUSD - the estimated value only of the median cost

368

Template:ExplorationGroup | Open Energy Information  

Open Energy Info (EERE)

ExplorationGroup ExplorationGroup Jump to: navigation, search This is the 'ExplorationGroup' template. To define a new Exploration Technique, please use the Exploration Group Form. Parameters Definition - A link to the OpenEI definition of the technique (optional) ExplorationGroup - ExplorationSubGroup - LithologyInfo - the type of lithology information this technique could provide StratInfo - the type of stratigraphic and/or structural information this technique could provide HydroInfo - the type of hydrogeology information this technique could provide ThermalInfo - the type of temperature information this technique could provide EstimatedCostLowUSD - the estimated value only of the low end of the cost range (units described in CostUnit) EstimatedCostMedianUSD - the estimated value only of the median cost

369

Network  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Site Feedback: info@es.net About ESnet A Nationwide Platform for Science Discovery The Energy Sciences Network (ESnet) is a high-performance, unclassified national network built to...

370

Document (194k)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

8 Named Ranges 19 HTGR Cost Summary List Info HTGR Capital Cost O&Ms Yearly Fuel Cost Decomissioning Full Results Correlations CEPCI CEPCIYEAR CycChoice HeatorPower IRT Number PCyc...

371

New Products  

Science Journals Connector (OSTI)

...Finally, as a personal pipetting system, Liquidator 96 fits any benchtop or laminar-flow cabinet making it suitable for cleanroom conditions. Mettler Toledo For info: 800-472-4646 www.mt.com/liquidator Electronically submit your new product...

2014-01-03T23:59:59.000Z

372

E-Print Network 3.0 - alpha -fetoprotein controls Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Engineering ; Mathematics 65 NetInfo Editions 4.x User Manual Summary: and Internet addresses: alpha 192.42.172.1 bravo 192.42.172.2 charlie 192.42.172.3 Two of the...

373

E-Print Network 3.0 - alpha 1-microglobulin destroys Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Technologies and Information Sciences 4 NetInfo Editions 4.x User Manual Summary: and Internet addresses: alpha 192.42.172.1 bravo 192.42.172.2 charlie 192.42.172.3 Two of the...

374

E-Print Network 3.0 - alpha -chloro ethers Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Technologies and Information Sciences 31 NetInfo Editions 4.x User Manual Summary: and Internet addresses: alpha 192.42.172.1 bravo 192.42.172.2 charlie 192.42.172.3 Two of the...

375

E-Print Network 3.0 - alpha indirect conversion Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Technologies and Information Sciences 77 NetInfo Editions 4.x User Manual Summary: and Internet addresses: alpha 192.42.172.1 bravo 192.42.172.2 charlie 192.42.172.3 Two of the...

376

E-Print Network 3.0 - alpha -reductase activity Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Biology and Medicine ; Chemistry 82 NetInfo Editions 4.x User Manual Summary: and Internet addresses: alpha 192.42.172.1 bravo 192.42.172.2 charlie 192.42.172.3 Two of the...

378

Modelo Hidrulico Operacional del Oeste de Puerto Rico  

E-Print Network [OSTI]

más reciente para la modelación de sistemas complejos de redes de tuberías, InfoWater. La modelación

Gilbes, Fernando

379

Response Against Hacking and Malicious Code in P2P  

Science Journals Connector (OSTI)

We have analyzed attacks on and threats to information security, and analyzed information security service in order to provide safe P2P service from these threats. And we have proposed a method to provide info...

Wongoo Lee; Sijung Kim; Bonghan Kim

2006-01-01T23:59:59.000Z

380

Maps & Web Mapping: An Introduction to Cartography Edition (2015)  

E-Print Network [OSTI]

Maps & Web Mapping: An Introduction to Cartography 1st Edition (2015) By Keith Clarke Links Showcase Site http://www.pearsonhighered.com/clarke-1e-info/index.html Catalog Link Maps & Web Mapping

Clarke, Keith

Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

K&L GATES LLP 1601 K STREET, N.W.  

Broader source: Energy.gov (indexed) [DOE]

July 17, 2014). 10 U.S. ENERGY INFO. ADMIN., Review of Emerging Resources: U.S. Shale Gas and Shale Oil Plays (2011). 8 DC-9824999 v1 No person shall export any natural gas...

382

Last Updated 3.22.2013 NIH Activitiesand Resources  

E-Print Network [OSTI]

Measure Up? Speaker: James Marshall, Ph.D., Department of Educational Technology, San Diego State University 1:00- 2:00 p.m. Online Register / More Info 11/15/2012 Converting SMEs (Subject Matter Experts

Rau, Don C.

383

Microsoft Word - ISDAC_orientation_pkt.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

If you have any questions please feel free to contact Debbie at 509.392.1854. Contents Cell Phone Numbers Fairbanks * Campaign Info Site Locations in Fairbanks Badging and...

384

E-Print Network 3.0 - accomplishing expanded civilian Sample...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

as some of the best in the Navy. The Tech Co n- nection expanded its summer camp program and other... civilians. Please call 656-2734 for info. Child Development...

385

ESnet History  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

(Globally) 1 510-486-7607 (Globally) Report Network Problems: trouble@es.net Provide Web Site Feedback: info@es.net ESnet History View ESnet's 25-year anniversary timeline in...

386

Microsoft Office Outlook - Memo Style  

National Nuclear Security Administration (NNSA)

are the liquid fuel usages and amounts used at RSL (we have info on liquid fuel storage tanks)? Do they only store jet JP-8 fuel and no other liquid fuels? RSL have a total of 9...

387

Heart Donít Panic! Hack it!  

Science Journals Connector (OSTI)

It seems appropriate that the Ars Electronica, whose overarching motto this year is ďInfoWarĒ, would host a ďHackertreffĒ (Hackersí meeting) as part of the Festival. The time is right: hackers are back. And si...

Patrice Riemens

1998-01-01T23:59:59.000Z

388

Physics Today News Picks: A unified picture of laser ... http://blogs.physicstoday.org/newspicks/2008/05/a_uni... 1 of 4 05/26/2008 10:15 AM  

E-Print Network [OSTI]

Telescope ¬Ľ Request product info COMPANY SPOTLIGHT CCD and TDI free seminar Learn about CCD devices Today on May 6, 2008 10:00 AM | Permalink SEARCH Search this blog: Search #12;

Rotter, Stefan

389

Slide12 | OSTI, US Dept of Energy, Office of Scientific and Technical...  

Office of Scientific and Technical Information (OSTI)

right volume of a journal, and examine each article one at a time. For relevant articles, I had to copy the citation info by hand and also capture the meat of the article by hand....

390

Counter-Based Power Modeling Methods: Top-Down vs. Bottom-Up  

Science Journals Connector (OSTI)

......fundamental properties. The benefits of having a single model...IEEE/ACM Int. Conf. Grid Computing (GRID) 2010, Piscataway...Bellosa, F. (2000) The Benefits of Event: Driven Energy...info/. [39] SBSIF. SMART specification rev.1......

Ramon Bertran; Marc Gonzŗlez; Xavier Martorell; Nacho Navarro; Eduard Ayguadť

2013-02-01T23:59:59.000Z

391

In Proceedings of the Symposium on Virtual Reality Software and Technology (VRST-97), Lausanne, Switzerland, September 1517, 1997, pp. 8794  

E-Print Network [OSTI]

), 81925 Munich, Germany EE Dept., California Inst. of Technology, MC 136-93, Pasadena, CA 91125 Autodesk-2100 Dept of Comp & Info Science, IUPUI, 723 W. Michigan St, Indianapolis, IN 46202-5132 Email: dieter.koller@autodesk

Barr, Al

392

Dr. Joseph Cullen | Photosynthetic Antenna Research Center  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Cullen March 22, 2013 Dr. Joseph Cullen "Measuring the Environmental Benefits of Wind Power" Published: March 22, 2013 Original Event info: March 19, 2013 12:00 pm - 1:00 pm...

393

nanoscience nanoelectronics  

E-Print Network [OSTI]

tags: toRSS nanoscience energy nanoelectronics nanomechanics Nanowires Exhibit Giant.info/#[[Nanowires%20Exhibit%... 1/2 #12;Related news list by date, most recent first: nanoscience energy

Espinosa, Horacio D.

394

MANUALE MATLAB A cura di Giuseppe Ciaburro  

E-Print Network [OSTI]

MANUALE MATLAB A cura di Giuseppe Ciaburro http://www.ciaburro.it info@ciaburro.it #12;Indice 1 Introduzione 4 1.1 Matlab . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 2 Fondamenti di Matlab 7 2.1 Capacit`a di Matlab

De Marchi, Stefano

395

Switchgrass: a Valuable Biomass Crop for Energy  

Science Journals Connector (OSTI)

The editor, Andrea Monti, assembled a group of distinguished authors who have not only provided comprehensive documentation of research conducted on switchgrass, but also unique and valuable analyses of this info...

David Bransby

2012-09-01T23:59:59.000Z

396

2008 Annual Merit Review Results Summary - 8. High Efficiency...  

Broader source: Energy.gov (indexed) [DOE]

technically - there was lots of "info" presented but this reviewer didn't see any clear identification of where the target is and how close they are to achieving it. One final...

397

E-Print Network 3.0 - arcview gis extension Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

of Military Lands (970) 491-2748 cemml@cemml.colostate.edu Summary: using GPS, and spatial data development. ArcInfo, ArcView, ERDAS Imagine, and GRASS are some of the...

398

Culture du corps et technosciences : vers une ę mise ŗ niveau Ľ technique de líhumain? Analyse des reprťsentations du corps soutenues par le mouvement transhumaniste.  

E-Print Network [OSTI]

??LíintťrÍt marquť portť actuellement aux recherches NBIC (nano-bio-info-cognitivo technologies) visant líoptimisation des capacitťs humaines augure díun profond bouleversement dans nos reprťsentations du corps humain etÖ (more)

Robitaille, MichŤle

2008-01-01T23:59:59.000Z

399

H2 Safety Snapshot - Vol. 2, Issue 2, July 2011  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

of Energy Fuel Cell Technologies Program (www.h2bestpractices.orgsafetyplanning) u FMEA Info Centre, a non-commercial web-based inventory dedicated to the promotion of FMEA...

400

New Clues in Predicting Alzheimer's Disease  

ScienceCinema (OSTI)

Theres a new clue in the search to identify the harbingers of Alzheimers disease. More info: http://newscenter.lbl.gov/feature-stories/2008/12/16/predict-alzheimers-disease/

Jagust, William

2013-05-29T23:59:59.000Z

Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

QuickStart: Learn DAX Basics in 30 Owen Duncan  

E-Print Network [OSTI]

. Why is DA It's easy to PivotCharts critical sale inventory d important c data. When line info o it. You can ev AX formulas. Bu date ranges? O mulas provide formulas will he e real business cel

Hunt, Galen

402

PDF File Information (pbl/help)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Services Site Help > Help Power Services Site Map Searching for Text Other Navigation Aids PDF File Info Firstgov PDF File Information Many of the documents available on the Power...

403

Power Services Site Navigation Aids (pbl/help)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Help Power Services Site Map Searching for Text Other Navigation Aids PDF File Info Firstgov Power Services Site Navigation Aids In addition to the Power Services Site Map and the...

404

OpenEI Community - planning  

Open Energy Info (EERE)

Kicks Off http:en.openei.orgcommunityblogdetailed-planning-kicks

Skype call this morning to discuss details. †More info coming soon

http:en.openei.org...

405

High-Performance Scalable Information Service for the ATLAS Experiment  

E-Print Network [OSTI]

makes this facility very attractive for supporting the ATLASIS) facility has been developed in the scope of the ATLASATLAS/is/RunParams/RunParams.RunInfo One has to take into account that this facility

Kolos, S; Boutsioukis, G; Hauser, R

2012-01-01T23:59:59.000Z

406

Microsoft Word - Other Template.docx  

National Nuclear Security Administration (NNSA)

Edleman 2010 Edleman, A., U.S. Department of Energy, 2010, Personal communication (email) to J. Carilli, U.S. Department of Energy, et al., "RE: Request for GTCC info," January 25...

407

Data:603d6a66-67c9-4aa6-ae2a-3c75d6e9df5f | Open Energy Information  

Open Energy Info (EERE)

Firm Power Rate Sector: Residential Description: Source or reference: http:www.bpa.govFinanceRateInformationRatesInfoPower2014%20Power%20Rate%20Schedules%28FINAL%29.p...

408

Geologic Map of the Valles Caldera | Open Energy Information  

Open Energy Info (EERE)

of the Valles CalderaInfo GraphicMapChart Abstract The Valles caldera, located in the heart of the Jemez Mountains in north-central New Mexico, is the worlds premier example...

409

Geothermal/Geochemical Database | Open Energy Information  

Open Energy Info (EERE)

Jump to: navigation, search OpenEI Reference LibraryAdd to library Chart: GeothermalGeochemical DatabaseInfo GraphicMapChart Author Nevada Bureau of Mines and Geology Published...

410

Aeromagnetic map | Open Energy Information  

Open Energy Info (EERE)

map Jump to: navigation, search OpenEI Reference LibraryAdd to library Map: Aeromagnetic mapInfo GraphicMapChart Cartographer Zietz and Kirby Published U.S. Geological Survey,...

411

University Identity Standards a manual for building a stronger identity  

E-Print Network [OSTI]

Communication and Marketing (UCAM) Rev.10.07 #12;2 UNM brand redesign UCAM (University Communication). quick info #12;1 UNM brand redesign table of contents University Identity Standards Table of Contents..................................................................................................... 2 Image & Identity

New Mexico, University of

412

V-149: Microsoft Internet Explorer Object Access Bug Lets Remote...  

Broader source: Energy.gov (indexed) [DOE]

CDwnBindInfo Object Reuse Flaw Lets Remote Users Execute Arbitrary Code U-047: Siemens Automation License Manager Bugs Let Remote Users Deny Service or Execute Arbitrary Code...

413

T-699: EMC AutoStart Buffer Overflows Let Remote Users Execute...  

Broader source: Energy.gov (indexed) [DOE]

EMC AutoStart Technical Info EMC Support Addthis Related Articles U-047: Siemens Automation License Manager Bugs Let Remote Users Deny Service or Execute Arbitrary Code T-639:...

414

Site Name : Las Cabras permanent stationAuthor : Sylvain, Marianne, Max Site Code :C A B R date : year 2010 month 03 day 11  

E-Print Network [OSTI]

). Battery : Lucas (12V 75Ah). Power connection : Solar pannels 20w * 2 (parallel plug). Security infos the antenna and solar panels from the horses. . CABR 2/4 #12;CABR 1-2-3 : installation. 4- vue from

Vigny, Christophe

415

Inside this issue: Cultivating Cumberland  

E-Print Network [OSTI]

. Meeting Info NJ Soybean Board Producer Mtg. Community Garden Conf. 3 AMP for On-Farm Direct Marketing customized food safety plans, streamlining the process to achieving Good Agricultural Practices certification

Goodman, Robert M.

416

Weitzlab Cleanroom User Guidelines initial draft 30 MAR 2010 by MBR  

E-Print Network [OSTI]

by MTG CONTACT INFO General questions: Ralph Sperling, sperling@seas.harvard.edu Supplies: Assaf Rotem the spin coater, or any other process that could throw off debris. These are in a tray on the wall

417

Risk Analysis 101: Fooled by local robustness . . . again!  

E-Print Network [OSTI]

Sep 24, 2012 ... It is remarkable to what length some risk analysts would go to argue for the use of info-gap's .... In other words, although the set of acceptable.

2012-09-24T23:59:59.000Z

418

1 ACIT Meeting Notes Advisory Committee for Information Technology  

E-Print Network [OSTI]

sets beyond what have been done prior, proprietary info, image manipulation, 3D visualizations, 3D printing for analytic work. · What about support for new faculty? o Expectations are higher. What is being

California at Santa Cruz, University of

419

Interpretive geothermal heat flow map of Colorado | Open Energy...  

Open Energy Info (EERE)

Interpretive geothermal heat flow map of Colorado Jump to: navigation, search OpenEI Reference LibraryAdd to library Map: Interpretive geothermal heat flow map of ColoradoInfo...

420

RAPID/Roadmap/1-WA-a | Open Energy Information  

Open Energy Info (EERE)

Contact" button in the form to provide the contact info, and use the "Add RAPID Roadmap Section" button to provide the roadmap section the contact is associated with. This page's...

Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

BPA-2012-00551-FOIA Request  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Sent: Tuesday, January 10, 2012 11:40 AM To: FOIA Subject: Re: BPA FOIA request Hello, I have not received this info requested and the time allowed has expired. Please...

422

Documentation and evaluation of MŲssbauer data for minerals  

Science Journals Connector (OSTI)

More than 2,500 MŲssbauer spectroscopic studies on minerals have been published since 1960. These papers contain approximately 8,000 sets of MŲssbauer mineral data on at least 400 different minerals. This info...

John G. Stevens; Airat Khasanov; J. William Miller; Herman PollakÖ

423

Property in Personal Data: Second Life of an Old Idea in the Age of Cloud Computing, Chain Informatisation, and Ambient Intelligence  

Science Journals Connector (OSTI)

This contribution proposes to re-examine a familiar idea of property rights in personal data in view of the recent developments in information technology and practices. It shows that, as a result of chain info...

Nadezhda Purtova

2011-01-01T23:59:59.000Z

424

Dienstgebude: Ludwigstr. 27/I, Zi. G 109  

E-Print Network [OSTI]

.physik.uni-muenchen.de/studium/infos_studium/studienberatung Zentrale Studienberatung Studienentscheidung, Studienwahl, Fächerangebot der LMU, Zulassung und Numerus Clausus, Fächerkombinationen, Studienorganisation, formale Fragen rund ums Studium Ludwigstr 27/I, Zi. G

Hofmann, Martin

425

GIS by ESRITM Understanding Map Projections  

E-Print Network [OSTI]

GIS by ESRITM Understanding Map Projections Melita Kennedy and Steve Kopp #12;Copyright © 19942000 in the European Community. ArcInfo, ArcGIS, GIS by ESRI, and the ESRI Press logo are trademarks of Environmental

Ahmad, Sajjad

426

E-Print Network 3.0 - automated military unit Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

and tools... .574.5700 | 310.574.5752 fax | info@ict.usc.edu Military Terrain for Games Pipeline 4.11 Commercial gaming... generated military terrain for use in virtual training...

427

Zentrum fr Graduiertenstudien (ZGS) Bergische Universitt Wuppertal  

E-Print Network [OSTI]

.gesaonline.de Wuppertaler Tafel ( ) Kontakt: Werth 50 * 42275 Wuppertal * 0049 (0)202. 434441 * www.wuppertaler-tafel.de E-Mail: info@wuppertaler-tafel.de : www.tele

Bongartz, Klaus

428

CAMPUS TUTORING RESOURCE GUIDE ACCESS Williston Hall Room 100 PH: (815) 753-0203  

E-Print Network [OSTI]

CAMPUS TUTORING RESOURCE GUIDE ACCESS ­ Williston Hall ­ Room 100 PH: (815) 753-0203 http ACCY 206, 207, 288 ACCESS/PAL Tutoring Various Locations and times 753-0203 For Info Williston 100 Mon

Karonis, Nicholas T.

429

Geologic Map of the Jemez Mountains, New Mexico | Open Energy...  

Open Energy Info (EERE)

MexicoInfo GraphicMapChart Abstract Abstract unavailable Cartographers Robert Leland Smith, Roy A. Bailey and Clarence Samuel Ross Published U.S. Geological Survey, 1970 DOI Not...

430

OpenEI Community - power user  

Open Energy Info (EERE)

helpful information for OpenEI wiki authors

Enabling developers to use energy web services on OpenEI, REEGLE.info, Data.gov and across the web.† We help developers...

431

Integrated Biorefinery Process  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Concept Proof Commercial Sustainability Information Resources Office of Biomass Program, Web Site: http:www1.eere.energy.govbiomass EERE Info Center - www1.eere.energy.gov...

432

E-Print Network 3.0 - air movement impact Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Oakland, CA 94612 510.251.1600 info@pacinst.org www.pacinst.org Summary: ). Including air pollution as a screening criterion acknowledges the health impacts borne by...

433

Nano-Punk For Tomorrow's People  

E-Print Network [OSTI]

Nano-Punk for Tomorrowís People By Christopher NewfieldMikhail Rocoís NBIC (nano- bio-info-cognitive) convergenceset in a Victorian-style nano era. Why Victorian? Perhaps

Newfield, Chris

2006-01-01T23:59:59.000Z

434

advanced search RESEARCH TOOLS  

E-Print Network [OSTI]

( K $ K : Copyright © The Economist Newspaper Limited 2006. All rights reserved. Advertising Info Expressions of Interest for The Development of a New Lignite Mining Facility and Associated New Electric

Boult, Terrance E.

435

American Society of Mammalogists Movements and Denning Habits of a Badger  

E-Print Network [OSTI]

& Conditions of Use, available at . http://www.jstor.org/page/info/about/policies/terms.jsp JSTOR is a not in the Netherlands. Thesis, Rijks-Univ., Utrecht, Netherlands (from Biolo. Abstracts,1953). DAVIS,W. H. 1966

Minnesota, University of

436

244.ps  

E-Print Network [OSTI]

Dec 9, 2000 ... on a Sun Ultra 2 with two UltraSPARC 300 MHz CPUs and 256 MB .... [5] J.E. Beasley, \\OR-Library," http://mscmga.ms.ic.ac.uk/info.html. [6] D.C.†...

2000-12-09T23:59:59.000Z

437

IFT2015 Miklos Csuros 6 septembre 2011 2 Liste cha^inee  

E-Print Network [OSTI]

'op¬īeration essentielle search(k) qui retourne l'info associ¬īee avec la cl¬īe k, et l'op¬īeration d'ajouter un nouveau paire) qui contient aussi un ou deux liens sur le noeud suivant et/ou pr¬īec¬īedent dans la liste. Chaque ¬īel implanter le TA dictionnaire, on peut utiliser des noeuds avec champs (key, info, next). SEARCH

Cs√ľr√∂s, Mikl√≥s

438

Implementation of a Geographic Information System for municipal water quality assurance  

E-Print Network [OSTI]

1994). Numerous other local agencies have ARC/INFO GIS programs in place, including King County (which contains the Green River watershed), Pierce County, and the City of Seattle. The King County Surface Water Management group has already begun... 1994). Numerous other local agencies have ARC/INFO GIS programs in place, including King County (which contains the Green River watershed), Pierce County, and the City of Seattle. The King County Surface Water Management group has already begun...

Murphy, Eileen Marie

2012-06-07T23:59:59.000Z

439

Vendor Look Up NUFinancials  

E-Print Network [OSTI]

@northwestern.edu © 2012 Northwestern University Page 2 of 3 SC025 Vendor Info Query-Expanded Search Enter Prompts/Search and NUFinancials. Security access forms and instructions are located on the Project Café website at http://cafe.northwestern.edu/security/ There are 2 different ways to look up Vendor information: Method 1: Using Cognos SC025 Vendor Info Query

Shull, Kenneth R.

440

MHK Technologies | Open Energy Information  

Open Energy Info (EERE)

MHK Technologies MHK Technologies Jump to: navigation, search << Return to the MHK database homepage Click one of the following Marine Hydrokinetic Technologies for more information: Loading... 14 MW OTECPOWER Aegir Dynamo AirWEC Anaconda bulge tube drives turbine AquaBuoy Aquanator Aquantis Archimedes Wave Swing Atlantis AN 150 Atlantis AR 1000 Atlantis AS 400 Atlantisstrom BOLT Lifesaver Benkatina Turbine Blue Motion Energy marine turbine Bluetec Brandl Generator C Plane C Wave C5 CETO Wave Energy Technology Centipod Closed Cycle OTEC CoRMaT Cross Flow Turbine Current Catcher Current Electric Generator Current Power CurrentStar DEXA Wave Converter Davidson Hill Venturi DHV Turbine Deep Gen Tidal Turbines Deep Green Deep Ocean Water Application Facility DOWAF Deep Water Pipelines Deep water capable hydrokinetic turbine

Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

RFP Invitation Letter  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

0, 2013 0, 2013 Subject: Question and Answer Set 4 Trinity and NERSC-8 Computing Platforms Project LA-UR-13-26565 Greetings: Interested parties are advised of the following questions or concerns that have been submitted to the Trinity and NERSC-8 Project team and to the accompanying Project responses below: Question/Issue 1 Will both ACES and NERSC be able to return failed hard disk drives or should vendors include "hard drive retention" in their proposals? Project Response 1 NERSC: Hard drives for NERSC-8 can be returned as part of the standard repair process. TRINITY: Any electronic component of the system that is capable of retaining user data during a powered-off state will not be returned to the vendor as part of the RMA process. The scope of parts not

442

Microsoft Word - o205.1b2-26-13  

Broader source: Energy.gov (indexed) [DOE]

the Chief Information Officer the Chief Information Officer U.S. Department of Energy ORDER Washington, D.C. Approved: 5-16-2011 Chg 1: 12-7-2012 Chg 2: 3-11-2013 SUBJECT: DEPARTMENT OF ENERGY CYBER SECURITY PROGRAM 1. PURPOSE. To set forth requirements and responsibilities for a Departmental Cyber Security Program (CSP) that protects information and information systems for the Department of Energy (DOE). The CSP requires a Risk Management Approach (RMA) that includes: analysis of threats/risks; risk-based decisions considering security, cost and mission effectiveness; and implementation consistent with guidelines from the National Institute of Standards and Technology (NIST) and Committee on National Security Systems (CNSS) cyber requirements, processes and protections. DOE Oversight is

443

Literature research and review of groundwater quality and treatment systems for basin F Rocky Mountain Arsenal. Final engineering report  

SciTech Connect (OSTI)

The purposes of this report are to review applicable literature and previous RMA studies and recommend a ground water treatment system for Basin F that can treat organics using activated carbon and/or an alternative and is capable of removing Cl and F. The technologies are compared for ability to meet treatment goals; capital and operating costs; and treatment flexibility. Findings and recommendations include best alternative to GAC for removal of organics is UV-catalyzed ozonation; best method for the removal of Cl and F appears to be electrodialysis followed by vapor compression evaporation; and Basin F interim response ground water treatment system should include lime softening and Mn removal for pretreatment and UV-ozone and GAC for organic.

NONE

1987-06-01T23:59:59.000Z

444

2010-2035 Metropolitan Transportation Plan  

E-Print Network [OSTI]

Carter Creek Riva Ridge River Oaks Hilt on Cam elo t Arn old Fri ed a Sm ith Lin coln Col leg e Wild Horse Run Pat e Ind epe nde nce Old Jone s Ea st S H 2 1 Sy ste m Qu ail R un Cro ssw ind Sto ne City Can terb ury Wo odv ille Dar tmo uth En ter pri... dfre e Cor tez Verd e 24th Oak woo d Ma in Don a Arbo les Aza lea No rma nd Gla cie r Nim itz App le Plu m Au stin 's C olo ny Azt ec Mc Arth ur 15t h Mi ds um me r Laurel Oa k Barak Win dsw ept Pecan Ridge Jus tine Cla rk Vier a Luz a Me ado wbr ook Co...

Bryan/College Station Metropolitan Planning Organization

2009-12-02T23:59:59.000Z

445

Building 251 Radioactive Waste Characterization by Process Knowledge  

SciTech Connect (OSTI)

Building 251 is the Lawrence Livermore National Laboratory Heavy Elements Facility. Operations that involved heavy elements with uncontained radioisotopes including transuranic elements took place inside of glove boxes and fume hoods. These operations included process and solution chemistry, dissolutions, titrations, centrifuging, etc., and isotope separation. Operations with radioactive material which presently take place outside of glove boxes include storage, assaying, packing and unpacking and inventory verification. Wastes generated inside glove boxes will generally be considered TRU or Greater Than Class C (GTCC). Wastes generated in the RMA, outside glove boxes, is presumed to be low level waste. This process knowledge quantification method may be applied to waste generated anywhere within or around B251. The method is suitable only for quantification of waste which measures below the MDA of the Blue Alpha meter (i.e. only material which measures as Non-Detect with the blue alpha is to be characterized by this method).

Dominick, J L

2002-05-29T23:59:59.000Z

446

DoD 5015.02-STD  

Broader source: Energy.gov (indexed) [DOE]

DoD 5015.02-STD DoD 5015.02-STD ELECTRONIC RECORDS MANAGEMENT SOFTWARE APPLICATIONS DESIGN CRITERIA STANDARD April 25, 2007 ASSISTANT SECRETARY OF DEFENSE FOR NETWORKS AND INFORMATION INTEGRATION/ DEPARTMENT OF DEFENSE CHIEF INFORMATION OFFICER DoD 5015.02-STD, April 25, 2007 1 FOREWORD FOREWORD This Standard is reissued under the authority of DoD Directive 5015.2, "Department of Defense Records Management Program," March 6, 2000, (Reference (a)) which provides implementing and procedural guidance on the management of records in the Department of Defense. It sets forth mandatory baseline functional requirements for Records Management Application (RMA) software used by the DoD Components in implementing their records management programs;

447

Materials Compatibility and Aging for Flux and Cleaner Combinations.  

SciTech Connect (OSTI)

A materials study of high reliability electronics cleaning is presented here. In Phase 1, mixed type substrates underwent a condensed contaminants application to view a worst- case scenario for unremoved flux with cleaning agent residue for parts in a silicone oil filled environment. In Phase 2, fluxes applied to copper coupons and to printed wiring boards underwent gentle cleaning then accelerated aging in air at 65% humidity and 30 O C. Both sets were aged for 4 weeks. Contaminants were no-clean (ORL0), water soluble (ORH1 liquid and ORH0 paste), and rosin (RMA; ROL0) fluxes. Defluxing agents were water, solvents, and engineered aqueous defluxers. In the first phase, coupons had flux applied and heated, then were placed in vials of oil with a small amount of cleaning agent and additional coupons. In the second phase, pairs of copper coupons and PWB were hand soldered by application of each flux, using tin-lead solder in a strip across the coupon or a set of test components on the PWB. One of each pair was cleaned in each cleaning agent, the first with a typical clean, and the second with a brief clean. Ionic contamination residue was measured before accelerated aging. After aging, substrates were removed and a visual record of coupon damage made, from which a subjective rank was applied for comparison between the various flux and defluxer combinations; more corrosion equated to higher rank. The ORH1 water soluble flux resulted in the highest ranking in both phases, the RMA flux the least. For the first phase, in which flux and defluxer remained on coupons, the aqueous defluxers led to worse corrosion. The vapor phase cleaning agents resulted in the highest ranking in the second phase, in which there was no physical cleaning. Further study of cleaning and rinsing parameters will be required.

Archuleta, Kim; Piatt, Rochelle

2015-01-01T23:59:59.000Z

448

Bibtexcitationinfo | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

Miscellaneous ¬Ľ BibTex Citation Info Miscellaneous ¬Ľ BibTex Citation Info Advanced Scientific Computing Research (ASCR) ASCR Home About Research Facilities Science Highlights Benefits of ASCR Funding Opportunities Advanced Scientific Computing Advisory Committee (ASCAC) News & Resources ASCR Discovery Monthly News Roundup News Archives ASCR Program Documents ASCR Workshops and Conferences ASCR Presentations 100Gbps Science Network Related Links Contact Information Advanced Scientific Computing Research U.S. Department of Energy SC-21/Germantown Building 1000 Independence Ave., SW Washington, DC 20585 P: (301) 903-7486 F: (301) 903-4846 E: sc.ascr@science.doe.gov More Information ¬Ľ Miscellaneous BibTex Citation Info Print Text Size: A A A RSS Feeds FeedbackShare Page @TechReport{MAPD, author = {W.~Philip Kegelmeyer and

449

Joint Theory Institute  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Program General Info Program General Info Registration Info Directions to Argonne Dynamics of Symmetry Breaking A Workshop sponsored by the ANL/UChicago Joint Theory Institute April 13-17, 2009 Argonne National Laboratory, IL The Joint Theory Institute (JTI) is a multi-disciplinary research institution jointly supported at the University of Chicago and Argonne National Laboratory to enhance collaborative research between both institutions in the broad area of theory. This year JTI sponsors a workshop the aim of which is to explore the dynamics of symmetry breaking in a broad range of systems from nuclear physics to string theory, using theoretical insights such as Dyson-Schwinger equations formalism, gauge/gravity duality and lattice QCD. We will focus on systems which exhibit dynamical symmetry breaking and will cover topics essential for understanding nonperturbative QCD and physics of quark-gluon plasma.

450

Geothermal: Advanced Search  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Advanced Search Advanced Search Geothermal Technologies Legacy Collection Help/FAQ | Site Map | Contact Us | Admin Log On Home/Basic Search About Publications Advanced Search New Hot Docs News Related Links You may need to turn on Javascript in your browser to use the Find Subject and Find Author features. Sort By: Relevance Publication Date System Entry Date Document Type Title Research Org Sponsoring Org OSTI Identifier Report Number DOE Contract Number Ascending Descending Enter search criteria into as few or as many fields as desired. Search In For Term(s) (Place phrase in "double quotes") All Fields: Bibliographic Data: Full Text: Creator/Author Select : Title: Subject Select : Identifier Numbers: Journal Info.: Conference Info.: Patent Info.: Research Org.: Sponsoring Org.:

451

REEGLE - Clean Energy Information Gateway | Open Energy Information  

Open Energy Info (EERE)

REEGLE - Clean Energy Information Gateway REEGLE - Clean Energy Information Gateway Jump to: navigation, search Tool Summary LAUNCH TOOL Name: reegle.info - clean energy information portal Agency/Company /Organization: Renewable Energy and Energy Efficiency Partnership (REEEP) Sector: Climate, Energy Focus Area: Renewable Energy, Biomass, Energy Efficiency, People and Policy, Solar, Wind Phase: Evaluate Options, Prepare a Plan, Develop Finance and Implement Projects Topics: Background analysis, Implementation, Low emission development planning, -LEDS, Policies/deployment programs Resource Type: Dataset, Maps, Publications Website: www.reegle.info/ Web Application Link: www.reegle.info/ RelatedTo: REEEP Toolkits Cost: Free OpenEI Keyword(s): energy data, policy, regulation, open data, LOD, tagging

452

Forestry Policies (Virginia) | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Virginia) Virginia) Forestry Policies (Virginia) < Back Eligibility Agricultural Commercial Developer Savings Category Solar Buying & Making Electricity Wind Program Info State Virginia Program Type Environmental Regulations Provider Virginia Department of Forestry Virginia's forests are managed by the Virginia Department of Forestry. In 2010 the Department issued its Statewide Assessment of Forest Resources and Strategic Plan documents: http://www.dof.virginia.gov/info/print/2010-State-Assessment.pdf http://www.dof.virginia.gov/info/print/2010-Strategic-Plan.pdf The Department has also issued a concise reference of the State Forestry Laws: http://www.dof.virginia.gov/resources/pub-2005-Va-Forestry-Laws.pdf State incentives for forest biomass energy are currently limited to the

453

SSRL28 Abstract Submission  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Visitor Info Visitor Info General Info Need more information? Contact: Cathy Knotts Manager, URA SSRL, MS 99 2575 Sand Hill Road Menlo Park, CA 94025 28th Annual Stanford Synchrotron Radiation Laboratory Users' Meeting Menlo Park, California USA October 17-19, 2001 Oral Abstract Submissions - Due August 24 Poster Abstract Submissions - Due September 28 Users are invited to submit abstracts highlighting research activities conducted over the past year at SSRL for poster presentations at the Users' Meeting. Please use the abstract submission form via the web. POSTER SESSION Posters will be displayed throughout the meeting and will be highlighted during a poster session and reception on Thursday, October 19. The poster session will be located just steps away from the main auditorium and the vendor display area. Users presenting posters must also register for the Users' Meeting.

454

National Action Plan on Demand Response  

Broader source: Energy.gov (indexed) [DOE]

6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 ACTUAL FORECAST National Action Plan on Demand Response the feDeRal eneRgy RegulatoRy commission staff 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 12 6 3 9 National Action Plan on Demand Response THE FEDERAL ENERGY REGULATORY COMMISSION STAFF June 17, 2010 Docket No. AD09-10 Prepared with the support of The Brattle Group * GMMB * Customer Performance Group Definitive Insights * Eastern Research Group The opinions and views expressed in this staff report do not necessarily represent those of the Federal Energy Regulatory Commission, its Chairman, or individual Commissioners, and are not binding on the Commission.

455

UNITED STATES ATOMIC ENERGY C O M M ISSION WASHINGTON 25. D. C.  

Office of Legacy Management (LM)

w - w - 1 .' " . . . - --,.* : * . UNITED STATES ATOMIC ENERGY C O M M ISSION WASHINGTON 25. D. C. $. _,._^. :\ SOUFtCE K47'FXIAL LICPJWS Liaense No. C-3Ll7 D8tidr kmmber 10, 1%5 SouthamRwwarah Inatituta 917 south 20th 3-t BlrRdngh88 5, Alabaa Attontlon: Hr. Ibak8 WhIta, Jr. Oontlom onr Pursuant to tbo At0810 IBerm Aot of 19% ard Saotion 163.21 of thr, Co& of Faderal Regulrtlon8, fit18 10 - Atonlc B m rgy, Chaptar 1, P*rt 40 - Cbntrolof Sourco Xakrlal,~u are horubylla~srd to ncalrcr powem ion of rnd/or title tro fUty-flvo (55) pound8 of rm. flned m ura nw1tar1al during tbo tan, of this liconeo fmm prooorm rs and dlrtrlbutorr liaOn8m d by the Atorio l&mrgy Corm i881on, for u8e in roeamchoa pXWF4Wt1.8 of umn1u~-l1~idata~fuo1 l lmnte, You l rafurtherlIc8n8od to trum

456

V  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

. 1.1 I . COO-30.72-25 11 t 1 Hadronic Form Factors in Asymptotically Free Field Theories David J. Gross and S.B. Treiman Joseph Henry Labor atorie s of Physics -NOTICE- Pri nce ton Uni ver sit y 1 1 This repor t was prep ared as an acco unt of work 1 Pri nce ton , New Jer sey 1 spons ored by the Unite d State s Gove rnme nt. Neith er 1 1 the Un ited Sta tes nor the Un ited Sta tes Ato mic Ene rgy I 08 54 0 1 j Comm issi on, nor any of thei r empl oyee s, nor any of I the ir con trac tors , sub con trac tors , or the ir em plo yee s, 111 ¬Ľtti' R'111 wou ld not infr inge priv ate ly own ed righ ts. 1 - .3 ABSTRACT The breakdown of Bjorken scaling in asymptotically free gauge theories of the strong interactions is explored for its implications on the large q2 behavior of nucleon form factors.

457

Internal Technical Report, Hydrothermal Injection Program - East Mesa 1983-84 Test Data  

SciTech Connect (OSTI)

This report presents a test data index and a data plots for a series of 12 drawdown and tracer injection-withdrawal tests in porous-media aquifers at the East Mesa Geothermal Field located in the Imperial Valley near El Centro, California. Test and instrumentation summaries are also provided. The first 10 of these tests were completed during July and August 1983. The remaining 2 tests were completed in February 1984, after a 6-month quiescent period, in which tracers were left in the reservoir. The test wells used were 56-30 and 56-19, with 38-30 supplying water for the injection phase and 52-29 used as a disposal well during the backflowing of the test wells. Six other wells in the surrounding area were measured periodically for possible hydrologic effects during testing. It is not the intent of this report to supply analyzed data, but to list the uninterpreted computer stored data available for analysis. The data have been examined only to the extent to ensure that they are reasonable and internally consistent. This data is stored on permanent files at the Idaho National Engineering Laboratory (INEL) Cyber Computer Complex. The main processors for this complex are located at the Computer Science Center (CSC) in Idaho Falls, Idaho. The Hydrothermal Injection Test program, funded by the Department of Energy, was a joint effort between EG and G Idaho, Inc., the University of Utah Research Institute (UURI) and Republic Geothermal, Inc. (RGI) of Santa Fe Springs, California.

Freiburger, R.M.

1984-09-01T23:59:59.000Z

458

Integrated Geothermal Well Testing: Test Objectives and Facilities  

SciTech Connect (OSTI)

A new and highly integrated geothermal well test program was designed for three geothermal operators in the US (MCR, RGI and Mapco Geothermal). This program required the design, construction and operation of new well test facilities. The main objectives of the test program and facilities are to investigate the critical potential and worst problems associated with the well and produced fluids in a period of approximately 30 days. Field and laboratory investigations are required to determine and quantify the problems of fluid production, utilization and reinjection. The facilities are designed to handle a flow rate from a geothermal well of one million pounds per hour at a wellhead temperature of approximately 268 C (515 F). The facilities will handle an entire spectrum of temperature and rate conditions up to these limits. All pertinent conditions for future fluid exploitations can be duplicated with these facilities, thus providing critical information at the very early stages of field development. The new well test facilities have been used to test high temperature, liquid-dominated geothermal wells in the Imperial Valley of California. The test facilities still have some problems which should be solvable. The accomplishments of this new and highly integrated geothermal well test program are described in this paper.

Nicholson, R. W.; Vetter, O. J.

1981-01-01T23:59:59.000Z

459

Domain wall QCD with physical quark masses  

E-Print Network [OSTI]

We present results for several light hadronic quantities ($f_\\pi$, $f_K$, $B_K$, $m_{ud}$, $m_s$, $t_0^{1/2}$, $w_0$) obtained from simulations of 2+1 flavor domain wall lattice QCD with large physical volumes and nearly-physical pion masses at two lattice spacings. We perform a short, O(3)%, extrapolation in pion mass to the physical values by combining our new data in a simultaneous chiral/continuum `global fit' with a number of other ensembles with heavier pion masses. We use the physical values of $m_\\pi$, $m_K$ and $m_\\Omega$ to determine the two quark masses and the scale - all other quantities are outputs from our simulations. We obtain results with sub-percent statistical errors and negligible chiral and finite-volume systematics for these light hadronic quantities, including: $f_\\pi$ = 130.2(9) MeV; $f_K$ = 155.5(8) MeV; the average up/down quark mass and strange quark mass in the $\\overline {\\rm MS}$ scheme at 3 GeV, 2.997(49) and 81.64(1.17) MeV respectively; and the neutral kaon mixing parameter, $B_K$, in the RGI scheme, 0.750(15) and the $\\overline{\\rm MS}$ scheme at 3 GeV, 0.530(11).

RBC; UKQCD collaborations; :; T. Blum; P. A. Boyle; N. H. Christ; J. Frison; N. Garron; R. J. Hudspith; T. Izubuchi; T. Janowski; C. Jung; A. Juettner; C. Kelly; R. D. Kenway; C. Lehner; M. Marinkovic; R. D. Mawhinney; G. McGlynn; D. J. Murphy; S. Ohta; A. Portelli; C. T. Sachrajda; A. Soni

2014-11-25T23:59:59.000Z

460

Prof  

Gasoline and Diesel Fuel Update (EIA)

466 466 (91) Prof iles of Fore ign Dire ct Inve stme nt in U. S. Ene rgy 1991 i i 11 i lit Information Adnfil- I i II IIIII III IIIII III IIIII III __ __ _i i linn iiiI I Ill lll lll lll ll II Hill! I April 1993 L, This publication and other Energy Information Administration (EIA) publications may be purchased from the Superintendent of Documents, U.S. Government Printing Office. All telephone orders should be directed to: U.S. Government Printing Office McPherson Square Bookstore 1510H Street, N.W. Washington, DC 20005 (202)653-2050 FAX (202)376-5055 9 a.m. to 5 p.m., eastern time, M-F Superintendent of Documents U.S. Government Printing Office Washington, DC 20402 (202)783-3238 FAX (202)512-2233 8 a.m. to 5 p.m., eastern time, M-F All mail orders should be directed to: U.S. Government Printing Office

Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

Forest Creek Wind Farm | Open Energy Information  

Open Energy Info (EERE)

Creek Wind Farm Creek Wind Farm Jump to: navigation, search Name Forest Creek Wind Farm Facility Forest Creek Wind Farm Sector Wind energy Facility Type Commercial Scale Wind Facility Status In Service Owner E.On Climate & Renewables Developer E.On Climate & Renewables/RGI Energy Purchaser Luminant Location Glasscock and Sterling Counties TX Coordinates 31.937348¬į, -101.312513¬į Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":31.937348,"lon":-101.312513,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}

462

E/EIA  

U.S. Energy Information Administration (EIA) Indexed Site

E/EIA E/EIA -0278 U.S. Depa rtme nt of Energ y Energ y Inform ation Admi nistra tion Assis tant Admi nistra tor for Progr am Deve lopme nt Office of the Cons umpt ion Data Syste m June 1981 01377 9 = 4530 : FED Non res ide ntia l Bui ldin gs u/w & Ene rgy Con sum ptio n Sur vey : Fu el Ch ara cte ris tic s an d Co ns erv ati on Pra cti ces Prepared by: Lynn D. Patinkin, Phillip Windell, Dwight: K. French, Leigh Carleton, Lynda T. Carlson, Kenneth A. Vagts, Leslie Whitaker, Tom Woteki, Wilbert Laird, and Laura Wong. IMPORTANT NOTICE As required by government regulation, EIA will conduct the annual review of our mailing list during the next several weeks. If you are on the mailing list, you will soon receive a post card listing your name and address as they appear on our files. If you wish to continue to receive our publications, you must mail

463

CAIRS Registration Form 6-19-12  

Broader source: Energy.gov (indexed) [DOE]

COMPUTERIZED ACCIDENT/INCIDENT REPORTING SYSTEM COMPUTERIZED ACCIDENT/INCIDENT REPORTING SYSTEM HSS InfoCenter Helpline 301-903-8358 * 1-800-473-4375 Internet: HSS.infocenter@hq.doe.gov Recordkeeping and Reporting Web Page: http://www.hss.doe.gov/SESA/Analysis/cairs/index.html REGISTRATION FORM User Registration for (Circle one or both): CAIRS CAIRS DATA ENTRY Completed registration request should be sent by facsimile to HSS InfoCenter at (301) 903-9823 (Type or Print) 1. Name________________________________________________________________________ Birth date ______/ _______ (Last) (First) (Middle Initial) (Month) (Day) 2. Job title _____________________________________________________________________________________________ 3. Company name_______________________________________________________________________________________

464

import gov.nasa.jpf.Config;1 import gov.nasa.jpf.PropertyListenerAdapter;  

E-Print Network [OSTI]

import gov.nasa.jpf.Config;1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 import gov.nasa.jpf.PropertyListenerAdapter; import gov.nasa.jpf.VM; import gov.nasa.jpf.jvm.ClassInfo; import gov.nasa.jpf.jvm.ElementInfo; import

Hagiya, Masami

465

The integration of digitized images, databases, and inventory protocol in an inventory updating program  

E-Print Network [OSTI]

: NRIUPDATER USER'S GUIDE APPENDIX B: NRIUPDATER HELP FILE SOURCE 49 61 APPENDIX C: SUPPLEMENTAL PROGRAM "DRAWMAP. C" 79 APPENDIX D: NRIUPDATER. EXE PROGRAM SOURCE APPENDIX E: MAP. EXE PROGRAM SOURCE 83 110 VITA 163 LIST OF TABLES Table 1 GRAPHIC... FILE COMPARISON 2 DATABASE FILE CONTENTS 3 ARC/INFO COMMANDS USED TO EXPORT PAT FILES 4 ARC/INFO COMMANDS TO GENERATE ASCII MAP DRAWING FILES 5 TIC FILE CONTENTS 6 LINE FILE CONTENTS 7 POINT FILE CONTENTS Page 20 25 26 30 31 32 32 LIST...

Wright, Charles Timothy

1993-01-01T23:59:59.000Z

466

Dept. of Psychology Majors Advising  

E-Print Network [OSTI]

Dept. of Psychology Majors Advising Summer 2011 Whether you are choosing courses or deciding on Psychology as your major, a faculty advisor can help you plan your degree and ensure you meet all.rockman@uwinnipeg.ca E-mail for an appt. Contact the Psychology Department Assistant for info

Martin, Jeff

467

The Genome Database Organism-centered listing of available genomic sequence records and projects  

E-Print Network [OSTI]

The Genome Database Organism-centered listing of available genomic sequence records and projects http://www.ncbi.nlm.nih.gov/genome National Center for Biotechnology Information · National Library | NCBI Genome | Last Update August 19, 2013 Contact: info@ncbi.nlm.nih.gov Scope Since 2011, the Genome

Levin, Judith G.

468

FOR IMMEDIATE RELEASE December 18, 2009  

E-Print Network [OSTI]

, the world's largest producer and exporter of crude oil. Brody was selected by KFUPM for this visit based Excellence in Information Assurance from the National Security Agency and the Department of Homeland Security, and knowledge of information assurance (IA) and information security (InfoSec) through educational programs

New Mexico, University of

469

Deutsches Terahertz-Zentrum e.V. Anschrift: Philipps-Universitt Marburg, Fachbereich Physik, Hans-Meerwein-Str., MZG-C6, 35032 Marburg  

E-Print Network [OSTI]

Deutsches Terahertz-Zentrum e.V. Anschrift: Philipps-Universität Marburg, Fachbereich Physik, Hans Deutsches Terahertz-Zentrum e.V. Anschrift: Philipps-Universität Marburg, Fachbereich Physik, Hans.terahertzcenter.de E-Mail: info@terahertzcenter.de #12;Deutsches Terahertz-Zentrum e.V. Anschrift: Philipps

Schubart, Christoph

470

Open Source Search: A Data Mining Platform Wray Buntine  

E-Print Network [OSTI]

with the extensive collection of open source software developed in the GNU project. Linux is now starting to get use://www.alvis.info. #12;Microsoft is now actively engaged in political, hardware and software standards efforts to develop, and "because we can," because search is one of the great grand challenge problems and we

Myllymäki, Petri

471

High-Diversity Cooperative Spectrum Sensing in Cognitive Radio Networks  

E-Print Network [OSTI]

High-Diversity Cooperative Spectrum Sensing in Cognitive Radio Networks Guobing Li1,2, Alfonso Cano2 and Shihua Zhu1 1 School of Elect. and Info. Engr., Xi'an Jiaotong University, Xi'an, Shaanxi-mails: {gbli, szhu}@mail.xjtu.edu.cn; alfonso@umn.edu Abstract--This paper develops a cooperative scheme among

Pleite, Alfonso Cano

472

HIGH-THROUGHPUT COOPERATIVE TRANSMISSIONS USING ADAPTIVE COMPLEX-FIELD NETWORK CODING  

E-Print Network [OSTI]

HIGH-THROUGHPUT COOPERATIVE TRANSMISSIONS USING ADAPTIVE COMPLEX-FIELD NETWORK CODING Guobing Li1 , Alfonso Cano2 , and Georgios B. Giannakis2 1 School of Elect. and Info. Engr., Xi'an Jiaotong University. In this pa- per, a novel cooperation protocol is developed based on adap- tive complex-field wireless network

Pleite, Alfonso Cano

473

Seattle University Recreation Position Description  

E-Print Network [OSTI]

Seattle University Recreation Position Description Title: Marketing Manager Date: 8/6/12 Purpose of Position To manage and coordinate all marketing efforts for University Recreation with primary Content Development · Info boards and frames · Promotional materials #12;Seattle University Recreation

Carter, John

474

Bill Bradbury Jennifer Anders  

E-Print Network [OSTI]

by the Shoshone-Bannock Tribes of the Fort Hall Indian Reservation and the Shoshone-Paiute Tribes of the Duck Valley Indian Reservation, and is not covered in this agreement. The agreement would also provide habitat and builds on the efficiencies pioneered there. #12;More Info: See attached Power Point document

475

Advance Standing Reference Guide AUSTRALIAN NATIONAL UNIVERSITY TEMASEK POLYTECHNIC  

E-Print Network [OSTI]

Intelligent Building Technology Clean Energy Aerospace Electronics 4 yrs 2 yrs Provided students continue at ANU Pre-Requisites Bachelor of Information Technology Computer Engineering Internet Computing Info-Communication Information Technology Mobile and Wireless Computing Cyber and Digital Security 3 yrs 1.5 yrs 1.5 years 3

Zhou, Xiangyun "Sean"

476

Gender: male female Term GPA Term GPA Term GPA CUMULATIVE GPA  

E-Print Network [OSTI]

,4321,4411,4450,4621,4701,5150,5410,5450,6670 Technical Electives: 3000+ (3+ crs) from application areas: CS; Bio; Chem; Math; Econ; Psych; etc. [only one or No External Specialization: Three 3000+ courses (3+ crs) from same subject area. CS courses, LING 4474, INFO 3100, ECON 3190, ENGRD 2700 or MATH 4710 (Taking a 3000+ level course strongly recommended.) 1 Note

Keinan, Alon

477

Argonne Director Eric Isaacs talks about ARRA funding at Argonne  

SciTech Connect (OSTI)

Argonne is set to receive over $150 million in stimulus funds. Director Eric Isaacs describes how these funds will be put to good useóhiring employees and contractors, cleaning up the nuclear footprint, and investing in technologies for America's future. More info on Argonne and ARRA here: http://www.anl.gov/recovery/index.html

Isaacs, Eric

2009-01-01T23:59:59.000Z

478

Richard Gerber! NERSC User Services NUG Teleconference  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

December 2013 --- 1 --- December 1 2, 2 013 Connection Info --- 2 --- Connec*on I nfo Topic: N UG W eb C onference Date a nd T ime: Thursday, D ec. 1 2, 2 013 1 1:00 a m, P acific...

479

The EFMN is financed by the European Commission DG Research. It is part of a series of initiatives intended to provide a `Knowledge Sharing Platform' for policy makers in the European Union. More information on the EFMN and on the Knowledge Sharing Platfo  

E-Print Network [OSTI]

intended to provide a `Knowledge Sharing Platform' for policy makers in the European Union. More information on the EFMN and on the Knowledge Sharing Platform is provided at WWW.EFMN.INFO WWW- nipulating and applying materials, components and systems with new physical, chemical and biological

480

The EFMN is financed by the European Commission DG Research. It is part of a series of initiatives intended to provide a `Knowledge Sharing Platform' for policy makers in the European Union. More information on the EFMN and on the Knowledge Sharing Platfo  

E-Print Network [OSTI]

intended to provide a `Knowledge Sharing Platform' for policy makers in the European Union. More information on the EFMN and on the Knowledge Sharing Platform is provided at WWW.EFMN.INFO WWW are able to capturing infor- mation on the chemical composition, texture and morphology, large

Note: This page contains sample records for the topic "rgy info rma" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

BCS News  

Science Journals Connector (OSTI)

...News BCS News 4 Computer Bulletin June 1997 News For more info on the BCS point your Web browser at http://www.bcs.org.uk/ The new Engineering Council now operates in partnership with the engineering institutions and the first year has......

BCS News

1997-06-01T23:59:59.000Z

482

10/19/12 Networked Control Challenges and Applica:ons  

E-Print Network [OSTI]

Trends Info Web Sensor Web Ac:on Web · Internet · WWW · Ubiquitous compu the loop · Cri:cal infrastructures · Humans in the loop Monitoring natural gas emissions of the global fossil fuel combus:on [Interna:onal Transport

Johansson, Karl Henrik

483

This Provisional PDF corresponds to the article as it appeared upon acceptance. Fully formatted PDF and full text (HTML) versions will be made available soon.  

E-Print Network [OSTI]

://www.biomedcentral.com/info/authors/ BMC Medical Research Methodology © 2013 Moran and Solomon This is an open access article distributed generating process BMC Medical Research Methodology 2013, 13:66 doi:10.1186/1471-2288-13-66 John L Moran (john.moran@adelaide.edu.au) Patricia J Solomon (patty.solomon@adelaide.edu.au) ISSN 1471-2288 Article

Solomon, Patty

484

CEWEP -Confederation of European Waste-to-Energy Plants Boulevard Clovis 12A  

E-Print Network [OSTI]

CEWEP - Confederation of European Waste-to- Energy Plants Boulevard Clovis 12A B-1000 Brussels Tel. : +32 (0)2 770 63 11 Fax : +32 (0)2 770 68 14 info@cewep.eu www.cewep.eu 1 Waste-to-Energy: towards recovery CEWEP welcomes that `energy recovery' should cover the use of waste for generating energy through

Columbia University

485

7th European RTD Framework Program (2007 -2013)  

E-Print Network [OSTI]

not belong to one or more large enterprises. Funding of: Research for SMEs solving technological problems Technologies (ICT)Information & Communication Technologies (ICT) 9,080 M 9,080 M Nanotechnologies, Materials for excellent trans-national research projects and networks European Technology Platforms (ETPs) [more info

Pinsky, Ross

486

MAUI HIGH PERFORMANCE COMPUTING CENTER 550 Lipoa Parkway, Kihei-Maui, HI 96753  

E-Print Network [OSTI]

MAUI HIGH PERFORMANCE COMPUTING CENTER i 550 Lipoa Parkway, Kihei-Maui, HI 96753 (808) 879-5077 · Fax: (808) 879-5018 E-mail: info@mhpcc.hpc.mil URL: www.mhpcc.hpc.mil MAUI HIGH PERFORMANCE COMPUTING This is the fourteenth annual edition of Maui High Performance Computing Center's (MHPCC) Application Briefs which

Olsen, Stephen L.

487

Portland State University Confidentiality and Information Management Policy and Procedures  

E-Print Network [OSTI]

Portland State University Confidentiality and Information Management Policy and Procedures I:\\Staff\\DEV\\Office\\KATRINA\\WEB\\Policies Page\\Info Mgmt Policy & Procedures.doc 8/15/2008 PORTLAND STATE UNIVERSITY CONFIDENTIALITY and INFORMATION MANAGEMENT POLICY and PROCEDURES Confidentiality and Information Management Policy Information

Bertini, Robert L.

488

UCR 05/2013 Washington Academic Internship Program  

E-Print Network [OSTI]

: Address: City: State: Zip: Home Phone: ( ) Cell Phone: ( ) Work Phone: ( ) Email: Permanent Address (if: Address: City: State: Zip: Home Phone: ( ) Cell Phone: ( ) Work Phone: ( ) Email: #12;UCR 05/2013 Do you different from above): Address: City: State: Zip: Phone: ( ) Emergency Contact Info: Name: Relationship

489

UCR 09/2014 Washington Academic Internship Program  

E-Print Network [OSTI]

: Home Phone: ( ) Cell Phone: ( ) Work Phone: ( ) Email: Permanent Address (if different from above: Zip: Home Phone: ( ) Cell Phone: ( ) Work Phone: ( ) Email: #12;UCR 09/2014 Do you currently receive): Address: City: State: Zip: Phone: ( ) Emergency Contact Info: Name: Relationship: Address: City: State

490

Version: September 2012 1 Key Words: list up to four AND check relevant boxes  

E-Print Network [OSTI]

Materials Science Info & Communications Tech Energy Society & Culture Environment Aboriginal/Indigenous Issues Yes No Does This Project Require Research Ethics Board: CDHA Dalhousie IWK Animals Biohazards Name Date Medical Research Development Office Print Name Date VP Research or Delegate CDHA/IWK When

Brownstone, Rob

491

Subject: FW: O U 052226Z ARMY WEST NILE VIRUS (WNV) CONTROL PROGRAM Importance: High  

E-Print Network [OSTI]

RUERSWA. ZNR UUUUU ZYW ZOC ZEO T ALL US ARMY REPS AND ACTIVITIES O 052226Z AUG 02 FM DA WASHINGTON DC//DAMO-AOC-CAT// TO RUEADWD/DA WASHINGTON DC//DAMO-AOC-CAT// ALARACT INFO RUEADWD/DA WASHINGTON DC//DAMO-ODM/DAMO-AOC

US Army Corps of Engineers

492

VCSEL Meeting 1 April 15, 2011  

E-Print Network [OSTI]

University Reliability statistics on AOC and ULM VCSEL arrays Analysis of 9 channels on opto to humidity resistance Info courtesy of Michal Z. #12;K.K. Gan VCSEL Meeting 3 AOC Reliability Data sort) #12;K.K. Gan VCSEL Meeting 4 AOC vs. ULM Reliability Data both claim their VCSELs

Gan, K. K.

493

Geographical Information Systems: An Effective Rural ITS Planning, Deployment and Evaluation Tool  

E-Print Network [OSTI]

corridor; the Western Transportation Institute (WTI) is to provide a feasibility assessment, evaluation Resources Inc., ARC-INFO software, WTI is defining problems; prioritizing problems; identifying existing and traffic operations personell. Through the use of GIS, WTI will be able to develop scenarios

McGowen, Patrick

494

MSU Faculty Advisor's Checklist Prepping for Advising  

E-Print Network [OSTI]

MSU Faculty Advisor's Checklist Prepping for Advising √? Read the Advising chapter in the New Faculty Handbook and "Reminders for Advisors" flyer. √? Get to know the Advisor's Toolkit. √? Look over semester (in Advisor's Toolkit). √? Become familiar with Advisor Dashboard (MyInfo>Secure Area

Dyer, Bill

495

Jaspreet Parmar of Prince Rupert NORTH COAST 2011  

E-Print Network [OSTI]

Marketing Mary Rose Ciotoli BEd Education Tina Demings BEd Education Brandon Haldane BComm Accounting Dawn-info@unbc.ca UNBC Highlights 2011 Bioenergy Underway Christy Clark was only days into her job as BC Premier when she travelled to UNBC to participate in the official opening of the University's Bioenergy Plant. The facility

Northern British Columbia, University of

496

HOTEL ACCOMMODATIONS SUMMER EUROPEAN ACADEMY 2014 Passau (Germany, Bavaria)  

E-Print Network [OSTI]

HOTEL ACCOMMODATIONS SUMMER EUROPEAN ACADEMY 2014 Passau (Germany, Bavaria): Hotel Weisser Hase: +49 851 9211 100 info@weisser-hase.de Munich (Germany, Bavaria): NH Deutscher Kaiser http://www.nh Germany Tel. +49 89 54 530 Email: nhdeutscherkaiser@nh-hotels.com Garmisch (Germany, Bavaria): Garmischer

Berm√ļdez, Jos√© Luis

497

Frontiers in Catalysis Science and Engineering Materials Science  

E-Print Network [OSTI]

, it is imperative to develop new processes for effective use of energy and to develop sustainable and clean energy in synthesizing novel metal oxide nanostructures for energy harvest and storage will also be discussed. More info Professor, Department of Chemistry & Biochemistry Abstract Energy is not only the driver for improving

498

Agency Links Agency Links and Proposal Development Resources  

E-Print Network [OSTI]

Broader Impact Review Criterion (GPG 13.1) NSF - Biosketch Template NSF - Postdoc Mentoring Plan Template Webcast Merit Review Criteria Resources (Effective Jan 14, 2013) Data Management Plan - Info from NSF National Science Foundation NIH Standard Deadlines NIH 424 R&R application instructions NIH - Proposal

Mather, Patrick T.

499

Biennial Reports on Action Plan At the end of the 8-year, formal program review process, each program will be asked to  

E-Print Network [OSTI]

Biennial Reports on Action Plan At the end of the 8-year, formal program review process, each 2004-05, an action plan was developed on the basis of the review committee's recommendations administrators. That action plan should be posted on your InfoWeb Program Review Management website. Every two

Buckel, Jeffrey A.

500

. RESEARCH PAPER . SCIENCE CHINA  

E-Print Network [OSTI]

. RESEARCH PAPER . SCIENCE CHINA Information Sciences January 2013, Vol. 56 012104:1­012104:10 doi: 10.1007/s11432-012-4616-5 c Science China Press and Springer-Verlag Berlin Heidelberg 2012 info, Tsinghua University, Beijing 100084, China; 2Beijing Aerospace Control Center, Beijing 100094, China; 3

Paris-Sud XI, Université de