National Library of Energy BETA

Sample records for results miles driven

  1. Chapter 3. Vehicle-Miles Traveled

    U.S. Energy Information Administration (EIA) Indexed Site

    3. Vehicle-Miles Traveled Chapter 3. Vehicle-Miles Traveled Vehicle-miles traveled--the number of miles that residential vehicles are driven--is probably the most important...

  2. Results of the radiological survey at Two Mile Creek, Tonawanda, New York (TNY002)

    SciTech Connect (OSTI)

    Murray, M.E.; Rodriguez, R.E.; Uziel, M.S.

    1997-08-01

    At the request of the US Department of Energy (DOE), a team from Oak Ridge National Laboratory conducted a radiological survey at Two Mile Creek, Tonawanda, New York. The survey was performed in November 1991 and May 1996. The purpose of the survey was to determine if radioactive materials from work performed under government contract at the Linde Air Products Division of Union Carbide Corporation, Tonawanda, New York, had been transported into the creek. The survey included a surface gamma scan in accessible areas near the creek and the collection of soil, sediment, and core samples for radionuclide analyses. Survey results indicate that no significant material originating at the Linde plant is presently in the creek. Three of the 1991 soil sample locations on the creek bank and one near the lake contained slightly elevated concentrations of {sup 238}U with radionuclide distributions similar to that found in materials resulting from former processing activities at the Linde site.

  3. Robin Miles

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Robin Miles Mechanical Engineer Robin Miles is an expert at targeting You've been at the Lab 15 years. Where did you start out? I first worked at the LLNL Microfabrication Facility Microtechnology Center where I came to work on NA-22, a DOE program to reduce threats to national security through developing new and novel technology. I was group leader for microfluidics (control of fluids on a sub-millimeter scale) in the bioengineering group. We built systems around sensors for biological and

  4. Miles Hand Grenade

    DOE Patents [OSTI]

    Harrington, John J.; Buttz, James H.; Maish, Alex B.; Page, Ray R.; Metcalf, Herbert E.

    2005-11-15

    A simulated grenade for MILES-type simulations generates a unique RF signal and a unique audio signal. A detector utilizes the time between receipt of the RF signal and the slower-traveling audio signal to determine the distance between the detector and the simulated grenade.

  5. Fact #860 February 16, 2015 Relationship of Vehicle Miles of Travel and the Price of Gasoline

    Broader source: Energy.gov [DOE]

    The prices of gasoline and diesel fuel affect the transportation sector in many ways. For example, fuel prices can impact the number of miles driven and affect the choices consumers make when...

  6. Miles Electric Vehicles | Open Energy Information

    Open Energy Info (EERE)

    Electric Vehicles Jump to: navigation, search Name: Miles Electric Vehicles Place: Santa Monica, California Zip: 90405 Sector: Vehicles Product: California-based developer of...

  7. Mile High: Order (2012-SE-4501)

    Broader source: Energy.gov [DOE]

    DOE ordered Mile High Equipment, LLC to pay a $17,525 civil penalty after finding Mile High had manufactured and distributed in commerce in the U.S. approximately 109 units of lce-O-Matic brand automatic commercial ice maker basic model ICE2106 FW, HW, a noncompliant product.

  8. Mile High: Noncompliance Determination (2012-SE-4501)

    Broader source: Energy.gov [DOE]

    DOE issued a Notice of Noncompliance Determination to Mile High Equipment, LLC finding that Ice-O-Matic brand automatic commercial ice maker basic model ICE2106 FW, HW does not comport with the energy conservation standards.

  9. Mile High: Proposed Penalty (2012-SE-4501)

    Broader source: Energy.gov [DOE]

    DOE alleged in a Notice of Proposed Civil Penalty that Mile High Equipment, LLC manufactured and distributed noncompliant Ice-O-Matic brand automatic commercial ice maker basic model ICE2106 FW, HW in the U.S.

  10. Compound and Elemental Analysis At Seven Mile Hole Area (Larson...

    Open Energy Info (EERE)

    Seven Mile Hole Area (Larson, Et Al., 2009) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Compound and Elemental Analysis At Seven Mile Hole...

  11. Alternative Fuels Data Center: Oregon Celebrates 200 Miles of Electric

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Highways Oregon Celebrates 200 Miles of Electric Highways to someone by E-mail Share Alternative Fuels Data Center: Oregon Celebrates 200 Miles of Electric Highways on Facebook Tweet about Alternative Fuels Data Center: Oregon Celebrates 200 Miles of Electric Highways on Twitter Bookmark Alternative Fuels Data Center: Oregon Celebrates 200 Miles of Electric Highways on Google Bookmark Alternative Fuels Data Center: Oregon Celebrates 200 Miles of Electric Highways on Delicious Rank

  12. Pennsylvania Nuclear Profile - Three Mile Island

    U.S. Energy Information Administration (EIA) Indexed Site

    Three Mile Island" "Unit","Summer capacity (mw)","Net generation (thousand mwh)","Summer capacity factor (percent)","Type","Commercial operation date","License expiration date" 1,805,"6,634",94.1,"PWR","application/vnd.ms-excel","application/vnd.ms-excel" ,805,"6,634",94.1

  13. March 28, 1979: Three Mile Island | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 28, 1979: Three Mile Island March 28, 1979 A partial meltdown of the core occurs at one of the two reactors at the Three Mile Island nuclear power plant near Harrisburg, ...

  14. Full Useful Life (120,000 miles) Exhaust Emission Performance...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Full Useful Life (120,000 miles) Exhaust Emission Performance of a NOx Adsorber and Diesel ... with Ultralow-Sulfur Fuel Full Useful Life (120,000 miles) Exhaust Emission ...

  15. Salt Wells, Eight Mile Flat | Open Energy Information

    Open Energy Info (EERE)

    Eight Mile Flat Jump to: navigation, search OpenEI Reference LibraryAdd to library Web Site: Salt Wells, Eight Mile Flat Abstract Abstract unavailable. Author Nevada Bureau...

  16. Fact #860 February 16, 2015 Relationship of Vehicle Miles of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fact 860 February 16, 2015 Relationship of Vehicle Miles of Travel and the Price of Gasoline - Dataset Excel file and dataset for Relationship of Vehicle Miles of Travel and the ...

  17. Focus Series: Denver Energy Advisor Program Helps Homeowners Go the Extra Mile in Mile-High City

    Broader source: Energy.gov [DOE]

    Focus Series: Denver Energy Advisor Program Helps Homeowners Go the Extra Mile in Mile-High City, a publication of the U.S. Department of Energy's Better Buildings Program.

  18. Benchmarking Non-Hardware Balance of System (Soft) Costs for U.S. Photovoltaic Systems Using a Data-Driven Analysis from PV Installer Survey Results

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Benchmarking Non-Hardware Balance of System (Soft) Costs for U.S. Photovoltaic Systems Using a Data-Driven Analysis from PV Installer Survey Results November 2012 Benchmarking Non-Hardware Balance of System (Soft) Costs for U.S. Photovoltaic Systems Using a Data-Driven Analysis from PV Installer Survey Results NREL is a national laboratory of the U.S. Department of Energy, Office of Energy Efficiency and Renewable Energy, operated by the Alliance for Sustainable Energy, LLC. Contract No.

  19. Analysis of Three Mile Island-Unit 2 accident

    SciTech Connect (OSTI)

    Not Available

    1980-03-01

    The Nuclear Safety Analysis Center (NSAC) of the Electric Power Research Institute has analyzed the Three Mile Island-2 accident. Early results of this analysis were a brief narrative summary, issued in mid-May 1979 and an initial version of this report issued later in 1979 as noted in the Foreword. The present report is a revised version of the 1979 report, containing summaries, a highly detailed sequence of events, a comparison of that sequence of events with those from other sources, 25 appendices, references and a list of abbreviations and acronyms. A matrix of equipment and system actions is included as a folded insert.

  20. Methodology for Calculating Cost-per-Mile for Current and Future Vehicle Powertrain Technologies, with Projections to 2024: Preprint

    SciTech Connect (OSTI)

    Ruth, M.; Timbario, T. A.; Timbario, T. J.; Laffen, M.

    2011-01-01

    Currently, several cost-per-mile calculators exist that can provide estimates of acquisition and operating costs for consumers and fleets. However, these calculators are limited in their ability to determine the difference in cost per mile for consumer versus fleet ownership, to calculate the costs beyond one ownership period, to show the sensitivity of the cost per mile to the annual vehicle miles traveled (VMT), and to estimate future increases in operating and ownership costs. Oftentimes, these tools apply a constant percentage increase over the time period of vehicle operation, or in some cases, no increase in direct costs at all over time. A more accurate cost-per-mile calculator has been developed that allows the user to analyze these costs for both consumers and fleets. The calculator was developed to allow simultaneous comparisons of conventional light-duty internal combustion engine (ICE) vehicles, mild and full hybrid electric vehicles (HEVs), and fuel cell vehicles (FCVs). This paper is a summary of the development by the authors of a more accurate cost-per-mile calculator that allows the user to analyze vehicle acquisition and operating costs for both consumer and fleets. Cost-per-mile results are reported for consumer-operated vehicles travelling 15,000 miles per year and for fleets travelling 25,000 miles per year.

  1. Vegetation survey of Pen Branch and Four Mile Creek wetlands

    SciTech Connect (OSTI)

    Not Available

    1992-01-01

    One hundred-fifty plots were recently sampled (vegetational sampling study) at the Savannah River Site (SRS). An extensive characterization of the vascular flora, in four predetermined strata (overstory, Understory, shrub layer, and ground cover), was undertaken to determine dominance, co-dominance, and the importance value (I.V.) of each species. These results will be used by the Savannah River Laboratory (SRL) to evaluate the environmental status of Four Mile Creek, Pen Branch, and two upland pine stands. Objectives of this study were to: Describe in detail the plant communities previously mapped with reference to the topography and drainage, including species of plants present: Examine the successional trends within each sampling area and describe the extent to which current vegetation communities have resulted from specific earlier vegetation disturbances (e.g., logging and grazing); describe in detail the botanical field techniques used to sample the flora; describe the habitat and location of protected and/or rare species of plants; and collect and prepare plant species as herbarium quality specimens. Sampling was conducted at Four Mile Creek and Pen Branch, and in two upland pine plantations of different age growth.

  2. Vegetation survey of Pen Branch and Four Mile Creek wetlands

    SciTech Connect (OSTI)

    Not Available

    1992-10-01

    One hundred-fifty plots were recently sampled (vegetational sampling study) at the Savannah River Site (SRS). An extensive characterization of the vascular flora, in four predetermined strata (overstory, Understory, shrub layer, and ground cover), was undertaken to determine dominance, co-dominance, and the importance value (I.V.) of each species. These results will be used by the Savannah River Laboratory (SRL) to evaluate the environmental status of Four Mile Creek, Pen Branch, and two upland pine stands. Objectives of this study were to: Describe in detail the plant communities previously mapped with reference to the topography and drainage, including species of plants present: Examine the successional trends within each sampling area and describe the extent to which current vegetation communities have resulted from specific earlier vegetation disturbances (e.g., logging and grazing); describe in detail the botanical field techniques used to sample the flora; describe the habitat and location of protected and/or rare species of plants; and collect and prepare plant species as herbarium quality specimens. Sampling was conducted at Four Mile Creek and Pen Branch, and in two upland pine plantations of different age growth.

  3. Entiat 4Mile WELLs Completion Report, 2006.

    SciTech Connect (OSTI)

    Malinowksi, Richard

    2007-01-01

    The Entiat 4-mile Wells (Entiat 4-mile) project is located in the Entiat subbasin and will benefit Upper Columbia steelhead, spring Chinook and bull trout. The goal of this project is to prevent juvenile fish from being diverted into an out-of-stream irrigation system and to eliminate impacts due to the annual maintenance of an instream pushup dam. The objectives include eliminating a surface irrigation diversion and replacing it with two wells, which will provide Bonneville Power Administration (BPA) and the Bureau of Reclamation (Reclamation) with a Federal Columbia River Power System (FCRPS) BiOp metric credit of one. Wells were chosen over a new fish screen based on biological benefits and costs. Long-term biological benefits are provided by completely eliminating the surface diversion and the potential for fish entrainment in a fish screen. Construction costs for a new fish screen were estimated at $150,000, which does not include other costs associated with implementing and maintaining a fish screening project. Construction costs for a well were estimated at $20,000 each. The diversion consisted of a pushup dam that diverted water into an off-channel pond. Water was then pumped into a pressurized system for irrigation. There are 3 different irrigators who used water from this surface diversion, and each has multiple water right claims totaling approximately 5 cfs. Current use was estimated at 300 gallons per minute (approximately 0.641 cfs). Some irrigated acreage was taken out of orchard production less than 5 years ago. Therefore, approximately 6.8 acre-feet will be put into the State of Washington Trust Water Right program. No water will be set aside for conservation savings. The construction of the two irrigation wells for three landowners was completed in September 2006. The Lower Well (Tippen/Wick) will produce up to 175 gpm while the Upper Well (Griffith) will produce up to 275 gpm during the irrigation season. The eight inch diameter wells were developed to a depth of 75 feet and 85 feet, respectively, and will be pumped with Submersible Turbine pumps. The irrigation wells have been fitted with new electric boxes and Siemens flowmeters (MAG8000).

  4. Petroleum Reduction Strategies to Reduce Vehicle Miles Traveled

    Broader source: Energy.gov [DOE]

    For reducing greenhouse gas emissions, the table below describes petroleum reduction strategies to reduce vehicle miles traveled, as well as guidance and best practices for each strategy.

  5. Seven Mile Hill Wind Farm | Open Energy Information

    Open Energy Info (EERE)

    www.wsgs.uwyo.eduTopicsEnergyResourceswind.aspx http:renewableenergydev.comredwind-power-seven-mile-hill-wind-energy-project Retrieved from "http:en.openei.orgw...

  6. Innovative Cell Materials and Designs for 300 Mile Range EVs

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Innovative Cell Materials and Design for 300 Mile Range EVs Yimin Zhu, PDPI OneD Material, LLC (former Nanosys Energy Storage) Palo Alto, California June 16 20, 2014 DOE Vehicle ...

  7. China has 6,000-mile pipeline system

    SciTech Connect (OSTI)

    Ming, S.

    1983-08-01

    A dramatic change has taken place in China's oil transport system, with pipelines replacing tank-cars as the most important means of transport for crude oil and petroleum products. According to Petroleum Ministry officials, the volume of crude oil carried by China's pipeline system increased from 23.2 percent in 1971 to 65.6 percent in 1981, while the volume delivered by tank-cars declined from 61.11 percent to 8.4 percent. The remainder was transported by tankers. China's 9,700 km (6,000-mile) pipeline network includes 5,600 km (3,500 miles) designed to carry crude oil and more than 600 km (375 miles) for petroleum products, plus 3,400 km (2,100 miles), mostly in Sichuan province, for natural gas.

  8. "Table 11. Fuel Economy, Selected Survey Years (Miles Per Gallon...

    U.S. Energy Information Administration (EIA) Indexed Site

    Fuel Economy, Selected Survey Years (Miles Per Gallon)" ,"Survey Years" ,1983,1985,1988,1991,1994,2001 "Total",15.1,16.1,18.3,19.3,19.8,20.2 "Household Characteristics" "Census...

  9. Seven Mile, Ohio: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    article is a stub. You can help OpenEI by expanding it. Seven Mile is a village in Butler County, Ohio. It falls under Ohio's 8th congressional district.12 References ...

  10. Rock Sampling At Seven Mile Hole Area (Larson, Et Al., 2009)...

    Open Energy Info (EERE)

    Seven Mile Hole Area (Larson, Et Al., 2009) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Rock Sampling At Seven Mile Hole Area (Larson, Et...

  11. Isotopic Analysis At Seven Mile Hole Area (Larson, Et Al., 2009...

    Open Energy Info (EERE)

    Seven Mile Hole Area (Larson, Et Al., 2009) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Isotopic Analysis At Seven Mile Hole Area (Larson, Et...

  12. Field Mapping At Seven Mile Hole Area (Larson, Et Al., 2009)...

    Open Energy Info (EERE)

    Seven Mile Hole Area (Larson, Et Al., 2009) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Field Mapping At Seven Mile Hole Area (Larson, Et...

  13. Summary Report of Commercial reactor Criticality Data for Three Mile Island Unit 1

    SciTech Connect (OSTI)

    Larry B. Wimmer

    2001-08-29

    The objective of the ''Summary Report of Commercial Reactor Criticality Data for Three Mile Island Unit I'' is to present the CRC data for the TMI-1 reactor. Results from the CRC evaluations will support the development and validation of the neutronics models used for criticality analyses involving commercial spent nuclear fuel. These models and their validation are discussed in the ''Disposal Criticality Analysis Methodology Topical Report'' (YMP 2000).

  14. New York Nuclear Profile - Nine Mile Point Nuclear Station

    U.S. Energy Information Administration (EIA) Indexed Site

    Nine Mile Point Nuclear Station" "Unit","Summer capacity (mw)","Net generation (thousand mwh)","Summer capacity factor (percent)","Type","Commercial operation date","License expiration date" 1,630,"5,294",95.9,"BWR","application/vnd.ms-excel","application/vnd.ms-excel"

  15. Fact #729: May 28, 2012 Secondary Household Vehicles Travel Fewer Miles

    Broader source: Energy.gov [DOE]

    When a household has more than one vehicle, the secondary vehicles travel fewer miles than the primary vehicle. In a two-vehicle household, the second vehicle travels less than half of the miles...

  16. How much are Chevrolet Volts in The EV Project driven in EV Mode?

    SciTech Connect (OSTI)

    John Smart

    2013-08-01

    This report summarizes key conclusions from analysis of data collected from Chevrolet Volts participating in The EV Project. Topics include how many miles are driven in EV mode, how far vehicles are driven between charging events, and how much energy is charged from the electric grid per charging event.

  17. Early dismantlement of Three Mile Island Unit 2

    SciTech Connect (OSTI)

    Byrne, J.; Heisey, K.A.

    1996-12-31

    Three Mile Island Unit 2 (TMI-2) nuclear station ceased commercial operation following the March 1979 accident. Following completion of an extensive cleanup effort that included removal and shipment of the damaged core, the U.S. Nuclear Regulatory Commission issued a possession-only license (POL) amendment on September 14, 1993. Postdefueling monitored storage (PDMS) technical specifications were issued on December 28, 1993. Entry into PDMS required that the licensee demonstrate that the plant was in a safe and stable condition and posed no risk to public health and safety.

  18. Lessons Learned from Three Mile Island Packaging, Transportation and Disposition that Apply to Fukushima Daiichi Recovery

    SciTech Connect (OSTI)

    Layne Pincock; Wendell Hintze; Dr. Koji Shirai

    2012-07-01

    Following the massive earthquake and resulting tsunami damage in March of 2011 at the Fukushima Daiichi nuclear power plant in Japan, interest was amplified for what was done for recovery at the Three Mile Island Unit 2 (TMI-2) in the United States following its meltdown in 1979. Many parallels could be drawn between to two accidents. This paper presents the results of research done into the TMI-2 recovery effort and its applicability to the Fukushima Daiichi cleanup. This research focused on three topics: packaging, transportation, and disposition. This research work was performed as a collaboration between Japan’s Central Research Institute of Electric Power Industry (CRIEPI) and the Idaho National Laboratory (INL). Hundreds of TMI-2 related documents were searched and pertinent information was gleaned from these documents. Other important information was also obtained by interviewing employees who were involved first hand in various aspects of the TMI-2 cleanup effort. This paper is organized into three main sections: (1) Transport from Three Mile Island to Central Facilities Area at INL, (2) Transport from INL Central Receiving Facility to INL Test Area North (TAN) and wet storage at TAN, and (3) Transport from TAN to INL Idaho Nuclear Technology and Engineering Center (INTEC) and Dry Storage at INTEC. Within each of these sections, lessons learned from performing recovery activities are presented and their applicability to the Fukushima Daiichi nuclear power plant cleanup are outlined.

  19. Annual Radiological Environmental Monitoring Program Report for the Three Mile Island, Unit 2, Independent Spent Fuel Storage Installation

    SciTech Connect (OSTI)

    G. G. Hall

    2000-02-01

    This report presents the results of the 1999 Radiological Environmental Monitoring Program conducted in accordance with 10 CFR 72.44 for the Three Mile Island, Unit 2, Independent Spent Fuel Storage Installation. A description of the facility and the monitoring program is provided. The results of monitoring the two predominant radiation exposure pathways, potential airborne radioactivity releases and direct radiation exposure, indicate facility operation has not contributed to any increase in the estimated maximum potential dose commitment to the general public.

  20. Annual Radiological Environmental Monitoring Program Report for the Three Mile Island, Unit 2, Independent Spent Fuel Storage Installation

    SciTech Connect (OSTI)

    Hall, Gregory Graham

    2002-02-01

    This report presents the results of the 2001 Radiological Environmental Monitoring Program conducted in accordance with 10 CFR 72.44 for the Three Mile Island, Unit 2, Independent Spent Fuel Storage Installation. A description of the facility and the monitoring program is provided. The results of monitoring the two predominant radiation exposure pathways, potential airborne radioactivity releases and direct radiation exposure, indicate the facility operation has not contributed to any increase in the estimated maximum potential dose commitment to the general public.

  1. Annual Radiological Environmental Monitoring Program Report for the Three Mile Island, Unit 2, Independent Spent Fuel Storage Installation (2005)

    SciTech Connect (OSTI)

    Hall, Gregory Graham

    2001-02-01

    This report presents the results of the 2000 Radiological Environmental Monitoring Program conducted in accordance with 10 CFR 72.44 for the Three Mile Island, Unit 2, Independent Spent Fuel Storage Installation. A description of the facility and the monitoring program is provided. The results of monitoring the two predominant radiation exposure pathways, potential airborne radioactivity releases and direct radiation exposure, indicate the facility operation has not contributed to any increase in the estimated maximum potential dose commitment to the general public.

  2. Annual Radiological Environmental Monitoring Program Report for the Three Mile Island - Unit 2 Independent Spent Fuel Storage Installation

    SciTech Connect (OSTI)

    Gregory G. Hall

    2003-02-01

    This report presents the results of the 2002 Radiological Environmental Monitoring Program conducted in accordance with 10 CFR 72.44 for the Three Mile Island, Unit 2, Independent Spent Fuel Storage Installation. A description of the facility and the monitoring program is provided. The results of monitoring the two predominant radiation exposure pathways, potential airborne radioactivity releases and direct radiation exposure, indicate the facility operation has not contributed to any increase in the estimated maximum potential dose commitment to the general public.

  3. Annual Radiological Environmental Monitoring Program Report for the Three Mile Island, Unit 2, Independent Spent Fuel Storage Installation

    SciTech Connect (OSTI)

    Hall, Gregory Graham

    2001-02-01

    This report presents the results of the 2000 Radiological Environmental Monitoring Program conducted in accordance with 10 CFR 72.44 for the Three Mile Island, Unit 2, Independent Spent Fuel Storage Installation. A description of the facility and the monitoring program is provided. The results of monitoring the two predominant radiation exposure pathways, potential airborne radioactivity releases and direct radiation exposure, indicate the facility operation has not contributed to any increase in the estimated maximum potential dose commitment to the general public.

  4. Are We Forgetting the Lessons From the Accident at Three Mile Island Unit 2, March 1979: A Case Study

    SciTech Connect (OSTI)

    Christie, Bob; Johnson, David H.

    2002-07-01

    The accident at Three Mile Island Unit 2 in March 1979 resulted in major changes to the way emergency procedures were written and operators were trained at nuclear commercial electric generating units. These changes had a major impact on the public health risk of nuclear electric generating units. The record over the last 20 years has been excellent. For approximately 2000 reactor years of operation since 1979, there have been no accidents equivalent to TMI Unit 2 in the USA. Other factors have had an influence on this excellent record but it is clear that more efficient emergency procedures and better operator training had a significant impact on the excellent record achieved over the last 20 plus years. Abnormal events still occur at the nuclear commercial electric generating units in the USA and these events have the potential for causing damage to the reactor core. In some cases, the emergency procedures used in abnormal events and the training received by the operators of the nuclear units have not been based on the lessons learned from the accident at Three Mile Island. The following paper describes one such case. It is clear to the authors of this paper that further changes should be made to make sure that the lessons learned from the accident at Three Mile Island Unit 2 in 1979 are implemented and not forgotten. (authors)

  5. Benchmarking Non-Hardware Balance of System (Soft) Costs for U.S. Photovoltaic Systems Using a Data-Driven Analysis from PV Installer Survey Results

    SciTech Connect (OSTI)

    Ardani, K.; Barbose, G.; Margolis, R.; Wiser, R.; Feldman, D.; Ong, S.

    2012-11-01

    This report presents results from the first U.S. Department of Energy (DOE) sponsored, bottom-up data-collection and analysis of non-hardware balance-of-system costs--often referred to as 'business process' or 'soft' costs--for residential and commercial photovoltaic (PV) systems.

  6. Fact #903: December 14, 2015 Vehicle Miles of Travel is up in 2015 -

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Dataset | Department of Energy 03: December 14, 2015 Vehicle Miles of Travel is up in 2015 - Dataset Fact #903: December 14, 2015 Vehicle Miles of Travel is up in 2015 - Dataset Excel file and dataset for Vehicle Miles of Travel is up in 2015 File fotw#903_web.xlsx More Documents & Publications Project Reports for Salish and Kootenai Tribes, Confederated Tribes of the Flathead Reservation: S&K Holding Company - 2004 Project 2015 GTO Peer Review U.S. LNG Imports and Exports

  7. Preliminary Results of Mono-energetic Electron Beams from a Laser-plasma Accelerator Driven by 200 TW Femto Second Pulses

    SciTech Connect (OSTI)

    Taki, R.; Kameshima, T.; An, W. M.; Hua, J. F.; Huang, W. H.; Tang, C. X.; Gu, Y. Q.; Guo, Y.; Hong, W.; Jiao, C. Y.; Lin, Y. Z.; Liu, H. J.; Peng, H. S.; Sun, L.; Tang, C. M.; Wang, X. D.; Wen, T. S.; Wen, X. L.; Wu, Y. C.; Zhang, B. H.

    2006-11-27

    Relativistic mono-energetic electron beams have been demonstrated by worldwide laser-plasma accelerator experiments in the range of a few tens TW. Laser-plasma accelerator experiment has been carried out with 200TW, 30fs Ti:Sapphire laser pulses focused on helium gas-jets with F/8.7 optics. Intense mono-energetic electron beams have been produced in the energy range of 30 to 150 MeV by controlling plasma length and density precisely. Images of Thomson scattering and fluorescence side scattering from plasma indicate highly relativistic effects such as a long self-channeling and filamentation as well as energetic electron deflection and intense backward Raman scattering. Preliminary results of the first laser-plasma accelerator experiment in the range of 200TW femto second pulses are presented.

  8. 51-Mile Hydroelectric Power Project Demonstration of new methodologies to reduce the LCOE for small, hydropower development

    Broader source: Energy.gov [DOE]

    51-Mile Hydroelectric Power Project Demonstration of new methodologies to reduce the LCOE for small, hydropower development

  9. Fact #728: May 21, 2012 Average Trip Length is Less Than Ten Miles

    Broader source: Energy.gov [DOE]

    The average trip length (one-way) is 9.7 miles according to the 2009 Nationwide Personal Transportation Survey. Trip lengths vary by the purpose of the trip. Shopping and family/personal business...

  10. Fact #640: September 13, 2010 Monthly Trends in Vehicle Miles of Travel

    Broader source: Energy.gov [DOE]

    Vehicle travel in the U.S. varies by month. There are many reasons for this, including the fact that some months are shorter than others. The vehicle miles of travel (VMT) recorded in February is...

  11. Fact #552: January 5, 2009 Vehicle Miles of Travel by Region

    Broader source: Energy.gov [DOE]

    Total vehicle miles of travel (VMT) in the U.S. have declined from 2007 to 2008. The latest data available, September 2008, shows a 4.4% decline in travel that varies by region. Comparing September...

  12. 100,000-Mile Evaluation of Transit Buses Operated on Biodiesel...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Evaluation of Transit Buses Operated on Biodiesel Blends (B20) 100,000-Mile Evaluation of Transit Buses Operated on Biodiesel Blends (B20) Presentation given at DEER 2006, ...

  13. Fact #670: April 11, 2011 Vehicle-Miles of Travel Rises in 2010

    Broader source: Energy.gov [DOE]

    The preliminary estimates from the Federal Highway Administration show that vehicle-miles of travel (VMT) increased slightly in 2010 over the previous year, but have not surpassed the peak of 3.03...

  14. Table 5.1. U.S. Number of Vehicles, Vehicle-Miles, Motor Fuel...

    U.S. Energy Information Administration (EIA) Indexed Site

    Table 5.1. U.S. Number of Vehicles, Vehicle-Miles, Motor Fuel Consumption and Expenditures, 1994 (Continued) 1993 Household and 1994 Vehicle Characteristics RSE Column Factor:...

  15. Fact #903: December 14, 2015 Vehicle Miles of Travel is up in...

    Broader source: Energy.gov (indexed) [DOE]

    Vehicle Miles of Travel is up in 2015 File fotw903web.xlsx More Documents & Publications Project Reports for Salish and Kootenai Tribes, Confederated Tribes of the Flathead ...

  16. Bureaucracy in crisis: Three Mile Island, the shuttle Challenger, and risk assessment

    SciTech Connect (OSTI)

    Casamayou, M.H.

    1995-07-01

    This book is a study in organizational theory about how technological bureaucracies perceive, communicate about, and respond to potential risks to public safety, using Three mile island and the Challenger accident as examples.

  17. Table 5.1. U.S. Number of Vehicles, Vehicle-Miles, Motor Fuel...

    U.S. Energy Information Administration (EIA) Indexed Site

    Energy Information AdministrationHousehold Vehicles Energy Consumption 1994 43 Table 5.1. U.S. Number of Vehicles, Vehicle-Miles, Motor Fuel Consumption and Expenditures, 1994...

  18. Long-term Decline of Aggregate Fuel Use per Cargo-ton-mile of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Long-term Decline of Aggregate Fuel Use per Cargo-ton-mile of Commercial Trucking; A Key Enabler of Expanded U.S. Trade and Economic Growth Poster presentation at the 2007 Diesel ...

  19. Operational and Environmental Monitoring Within a Three-Mile Radius of Project Rulison

    Office of Legacy Management (LM)

    FIRST QUARTER 20 08 REPORT Operational and Environmental Monitoring Within a Three-Mile Radius of Project Rulison Prepared by: A U G U S T 2 0 0 8 FIRST QUARTER 2008 REPORT OPERATIONAL AND ENVIRONMENTAL MONITORING WITHIN A THREE-MILE RADIUS OF PROJECT RULISON Prepared for: Noble Energy Production, Inc. Prepared by: URS Corporation 8181 East Tufts Avenue Denver, CO 80237 August 12, 2008 First Quarter 2008 Report August 2008 i TABLE OF CONTENTS Page 1 Introduction

  20. 1982 worldwide pipeline construction will top 21,900 miles, $9. 5 billion

    SciTech Connect (OSTI)

    Hall, D.

    1982-07-01

    Reports that pipeline construction slowed slightly in 1982 because of lowered economic activity worldwide, with an upturn forecast for 1983. Explains that need for new pipelines to transport increasing amounts of oil and gas energy now being discovered, plus use of pipelines to transport other commodities in increasing amounts, has created a backlog of demand for facilities. Indicates that commodities suited for pipeline transport and getting consideration include crude oil; refined products; natural gas liquids; LPG; coal slurries; carbon dioxide (used for enhanced oil recovery); chemicals such as ammonia, ethane, ethylene, and similar petrochemical feedstocks; industrial gases such as oxygen, nitrogen; and solids slurries such as ores, wood chips, and other non-soluble minerals, even items such as wood chips and wood pulp for paper-making. Reveals that there are 10,396 miles of coal slurry pipeline planned for the US and 500 miles in Canada. Major US projects underway in the gas pipeline field include the 797-mile, 36-in. Trailblazer system in Nebraska, Wyoming, Colorado, and Utah. Products/ LPG/NGL pipelines underway include 105 miles of dual 4 and 6-in. line in Kansas. Crude pipeline activity includes 100 miles of 12-in. in California and 80 miles of 4 thru 40-in. in Alaska on the North Slope. Updates plans in Canada, Scotland, Denmark, Ireland, France, the Middle East, Australia, Southeast Asia, Mexico, South America and the USSR.

  1. Review of Destructive Assay Methods for Nuclear Materials Characterization from the Three Mile Island (TMI) Fuel Debris

    SciTech Connect (OSTI)

    Carla J. Miller

    2013-09-01

    This report provides a summary of the literature review that was performed and based on previous work performed at the Idaho National Laboratory studying the Three Mile Island 2 (TMI-2) nuclear reactor accident, specifically the melted fuel debris. The purpose of the literature review was to document prior published work that supports the feasibility of the analytical techniques that were developed to provide quantitative results of the make-up of the fuel and reactor component debris located inside and outside the containment. The quantitative analysis provides a technique to perform nuclear fuel accountancy measurements

  2. Cancer incidence among residents of the Three Mile Island accident area: 1982-1995

    SciTech Connect (OSTI)

    Han, Yueh-Ying; Youk, Ada O.; Sasser, Howell; Talbott, Evelyn O.

    2011-11-15

    Background: The Pennsylvania Department of Health established a registry of the Three Mile Island (TMI) nuclear power plant accident in 1979. Over 93% of the population present on the day of the accident within a 5-mile radius was enrolled and interviewed. We used the registry to investigate the potential cancer risk from low-dose radiation exposure among the TMI population. Methods: Cancer incidence data among the TMI cohort were available from 1982 to 1995. Because more than 97% of the population were white and few cancer cases were reported for those younger than 18 years of age, we included whites of age 18 years and older (10,446 men and 11,048 women) for further analyses. Cox regression models were used to estimate the relative risk (RR) per 0.1 m Sv and 95% confident interval (CI) of cancer by radiation-related exposures. The cancers of interest were all malignant neoplasms, cancer of bronchus, trachea, and lung, cancer of lymphatic and hematopoietic tissues, leukemia, and female breast. Results: Among men and women, there was no evidence of an increased risk for all malignant neoplasms among the TMI cohort exposed to higher maximum and likely {gamma} radiation (RR=1.00, 95% CI=0.97, 1.01 and RR=0.99, 95% CI=0.94, 1.03, respectively) after adjusting for age, gender, education, smoking, and background radiation. Elevation in risk was noted for cancer of the bronchus, trachea, and lung in relation to higher background radiation exposure (RR=1.45, 95% CI=1.02-2.05 at 8.0-8.8 {mu}R/h compared to 5.2-7.2 {mu}R/h). An increased risk of leukemia was found among men exposed to higher maximum and likely {gamma} radiation related to TMI exposure during the ten days following the accident (RR=1.15, 95% CI=1.04, 1.29 and RR=1.36, 95% CI=1.08, 1.71, respectively). This relationship was not found in women. Conclusion: Increased cancer risks from low-level radiation exposure within the TMI cohort were small and mostly statistically non-significant. However, additional follow-up on this population is warranted, especially to explore the increased risk of leukemia found in men.

  3. To Pluto and Beyond: Powering New Horizons' 3-Billion-Mile Journey |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy To Pluto and Beyond: Powering New Horizons' 3-Billion-Mile Journey To Pluto and Beyond: Powering New Horizons' 3-Billion-Mile Journey July 15, 2015 - 11:23am Addthis This image of Pluto, taken by New Horizons after a 9 1/2-year journey, is our highest-resolution photo of the dwarf planet since its discovery by Clyde Tombaugh in 1930. | Photo courtesy of NASA. This image of Pluto, taken by New Horizons after a 9 1/2-year journey, is our highest-resolution photo of the

  4. NUREG-0668 MASTER* TITLE LIST PUBLICLY AVAILABLE DOCUMENTS THREE MILE ISLAND UNIT 2

    Office of Scientific and Technical Information (OSTI)

    RECSIVEP ev Tin JUN 11157^; NUREG-0668 MASTER* TITLE LIST PUBLICLY AVAILABLE DOCUMENTS THREE MILE ISLAND UNIT 2 DOCKET 50-320 Cumulated to May 21,1979 Office of Administration U. S. Nuclear Regulatory Commission NUREG-0668 TITLE LIST PUBLICLY AVAILABLE DOCUMENTS THREE MILE ISLAND UNIT 2 DOCKET 50-320 Cumulated to M a y 2 1 , 1979 Division of Technical Information and Document Control Office of Administration U. S. Nuclear Regulatory Commission Washington, D.C. 20555 . CONTENTS Page Preface. v

  5. Vehicle routing for the last mile of power system restoration

    SciTech Connect (OSTI)

    Bent, Russell W; Coffrin, Carleton; Van Hentenryck, Pascal

    2010-11-23

    This paper studied a novel problem in power system restoration: the Power Restoration Vehicle Routing Problem (PRVRP). The goal of PRVRPs is to decide how coordinate repair crews effectively in order to recover from blackouts as fast as possible after a disaster has occurred. PRVRPs are complex problems that combine vehicle routing and power restoration scheduling problems. The paper proposed a multi-stage optimization algorithm based on the idea of constraint injection that meets the aggressive runtime constraints necessary for disaster recovery. The algorithms were validated on benchmarks produced by the Los Alamos National Laboratory, using the infrastructure of the United States. The disaster scenarios were generated by state-of-the-art hurricane simulation tools similar to those used by the National Hurricane Center. Experimental results show that the constraint-injection algorithms can reduce the blackouts by 50% or more over field practices. Moreover, the results show that the constraint-injection algorithm using large neighborhood search over a blackbox simulator provide competitive quality and scales better than using a MIP solver on the subproblems.

  6. Fact #616: March 29, 2010 Household Vehicle-Miles of Travel by Trip Purpose

    Broader source: Energy.gov [DOE]

    In 2009, getting to and from work accounted for about 27% of household vehicle-miles of travel (VMT). Work-related business was 8.4% of VMT in 2001, but declined to 6.7% in 2009, possibly due to...

  7. Fact #860 February 16, 2015 Relationship of Vehicle Miles of Travel and the

    Broader source: Energy.gov (indexed) [DOE]

    Price of Gasoline - Dataset | Department of Energy Relationship of Vehicle Miles of Travel and the Price of Gasoline File fotw#860_web.xlsx More Documents & Publications Fact #906: January 4, 2016 VMT and the Price of Gasoline Typically Move in Opposition - Dataset 2012 Data File 2013 Wind Technologies Market Report Data

  8. Transformer failure and common-mode loss of instrument power at Nine Mile Point Unit 2 on August 13, 1991

    SciTech Connect (OSTI)

    Not Available

    1991-10-01

    On August 13, 1991, at Nine Mile Point Unit 2 nuclear power plant, located near Scriba, New York, on Lake Ontario, the main transformer experienced an internal failure that resulted in degraded voltage which caused the simultaneous loss of five uninterruptible power supplies, which in turn caused the loss of several nonsafety systems, including reactor control rod position indication, some reactor power and water indication, control room annunciators, the plant communications system, the plant process computer, and lighting at some locations. The reactor was subsequently brought to a safe shutdown. Following this event, the US Nuclear Regulatory Commission dispatched an Incident Investigation Team to the site to determine what happened, to identify the probable causes, and to make appropriate findings and conclusions. This report describes the incident, the methodology used by the team in its investigation, and presents and the team's findings and conclusions. 59 figs., 14 tabs.

  9. A reevaluation of cancer incidence near the Three Mile Island nuclear plant: The collision of evidence and assumptions

    SciTech Connect (OSTI)

    Wing, S.; Richardson, D.; Armstrong, D.; Crawford-Brown, D.

    1997-01-01

    Previous studies concluded that there was no evidence that the 1979 nuclear accident at Three Mile Island (TMI) affected cancer incidence in the surrounding area; however, there were logical and methodological problems in earlier reports that led us to reconsider data previously collected. A 10-mile area around TMI was divided into 69 study tracts, which were assigned radiation dose estimates based on radiation readings and models of atmospheric dispersion. Incident cancers from 1975 to 1985 were ascertained from hospital records and assigned to study tracts. Associations between accident doses and incidence rates of leukemia, lung cancer, and all cancer were assessed using relative dose estimates calculated by the earlier investigators. Adjustments were made for age, sex, socioeconomic characteristics, and preaccident variation in incidence. Considering a 2-year latency, the estimated percent increase per dose unit {plus_minus} standard error was 0.020 {plus_minus} 0.012 for all cancer, 0.082 {plus_minus} 0.032 for lung cancer, and 0.116 {plus_minus} 0.067 for leukemia. Adjustment for socioeconomic variables increased the estimates to 0.034 {plus_minus} 0.013, 0.103 {plus_minus} 0.035, and 0.139 {plus_minus} 0.073 for all cancer, lung cancer, and leukemia, respectively. Associations were generally larger considering a 5-year latency, but were based on smaller numbers of cases. Results support the hypothesis that radiation doses are related to increased cancer incidence around TMI. The analysis avoids medical detection bias, but suffers from inaccurate dose classification; therefore, results may underestimate the magnitude of the association between radiation and cancer incidence. These associations would not be expected, based on previous estimates of near-background levels of radiation exposure following the accident. 35 refs., 3 tabs.

  10. Nondestructive techniques for assaying fuel debris in piping at Three Mile Island Unit 2

    SciTech Connect (OSTI)

    Vinjamuri, K.; McIsaac, C.V.; Beller, L.S.; Isaacson, L.; Mandler, J.W.; Hobbins, R.R. Jr.

    1981-11-01

    Four major categories of nondestructive techniques - ultrasonic, passive gamma ray, infrared detection, and remote video examination - have been determined to be feasible for assaying fuel debris in the primary coolant system of the Three Mile Island Unit 2 (TMI-2) Reactor. Passive gamma ray detection is the most suitable technique for the TMI-2 piping; however, further development of this technique is needed for specific application to TMI-2.

  11. Reactor engineering support of operations at Three Mile Island nuclear station

    SciTech Connect (OSTI)

    Tropasso, R.T.

    1995-12-31

    The purpose of this paper is to detail the activities in which plant nuclear engineering personnel provide direct support to plant operations. The specific activities include steady-state, transient, and shutdown/refueling operation support as well as special project involvement. The paper is intended to describe the experiences at Three Mile Island (TMI) in which significant benefit to the success of the activity is achieved through the support of the nuclear engineers.

  12. Science-Driven Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Science-Driven Network Requirements for ESnet Update to the 2002 Office of Science Networking Requirements Workshop Report February 21, 2006 1-1 Science-Driven Network Requirements for ESnet Update to the 2002 Office of Science Networking Requirements Workshop Report February 21, 2006 Contributors Paul Adams, LBNL (Advanced Light Source) Shane Canon, ORNL (NLCF) Steven Carter, ORNL (NLCF) Brent Draney, LBNL (NERSC) Martin Greenwald, MIT (Magnetic Fusion Energy) Jason Hodges, ORNL (Spallation

  13. Fact #848: November 24, 2014 Nearly Three-Fourths of New Cars have Fuel Economy above 25 Miles per Gallon

    Broader source: Energy.gov [DOE]

    In 1975, only three percent of all new cars had a fuel economy above 25 miles per gallon (mpg), but by 2014, 73% did. Great improvements were made in the fuel economy of cars from 1975 to 1985, so...

  14. EIS-0025: Miles City-New Underwood 230-kV Electrical Transmission Line, Montana, North Dakota, and South Dakota

    Broader source: Energy.gov [DOE]

    The U.S. Department of Energy’s Western Area Power Administration prepared this statement to assess the environmental and socioeconomic implications of its proposed action to construct a 3.28-mile, 230-kV transmission line between Miles City and Baker, Montana, Hettinger, North Dakota, and New Underwood, South Dakota, in Custer and Fallon Counties in Montana, Adams, Bowman, and Slope Counties in North Dakota and Meade, Pennington, and Perkins Counties in South Dakota.

  15. Compilation of Earthquakes from 1850-2007 within 200 miles of the Idaho National Laboratory

    SciTech Connect (OSTI)

    N. Seth Carpenter

    2010-07-01

    An updated earthquake compilation was created for the years 1850 through 2007 within 200 miles of the Idaho National Laboratory. To generate this compilation, earthquake catalogs were collected from several contributing sources and searched for redundant events using the search criteria established for this effort. For all sets of duplicate events, a preferred event was selected, largely based on epicenter-network proximity. All unique magnitude information for each event was added to the preferred event records and these records were used to create the compilation referred to as “INL1850-2007”.

  16. Examination of claims of Miles et al. in Pons-Fleischmann-type cold fusion experiments

    SciTech Connect (OSTI)

    Jones, S.E.; Hansen, L.D.

    1995-05-04

    In cold fusion experiments conducted at the Naval Research Laboratory in China Lake, M. H. Miles and co-workers claim to have produced excess heat correlated with helium-4 production, X-rays, and Geiger-counter excitation. However, scrutiny of the claims shows that unreliable calorimetric and nuclear-product detection methods were used. Moreover, inconsistencies and errors are found in the data and data analysis. The juxtaposition of several poor techniques and inconsistent data does not make a compelling case for cold fusion. We conclude that the evidence for cold fusion from these efforts is far from compelling. 20 refs., 2 figs., 2 tabs.

  17. Laboratory measurement verification of laser hazard analysis for miles weapon simulators used in force on force exercises.

    SciTech Connect (OSTI)

    Augustoni, Arnold L.

    2006-08-01

    Due to the change in the batteries used with the Small Arm Laser Transmitters (SALT) from 3-volts dc to 3.6-volts dc and changes to SNL MILES operating conditions, the associated laser hazards of these units required re-evaluation to ensure that the hazard classification of the laser emitters had not changed as well. The output laser emissions of the SNL MILES, weapon simulators and empire guns, used in Force-On-Force (FOF) training exercises, was measured in accordance to the ANSI Standard Z136.4-2005, ''Recommended Practice for Laser Safety Measurements for Hazard Evaluation''. The laser hazard class was evaluated in accordance with the ANSI Standard Z136.1-2000, ''Safe Use of Lasers'', using ''worst'' case conditions associated with these MILES units. Laser safety assessment was conducted in accordance with the ANSI Standard Z136.6-2005, ''Safe Use of Lasers Outdoors''. The laser hazard evaluation of these MILES laser emitters was compared to and supersedes SAND Report SAND2002-0246, ''Laser Safety Evaluation of the MILES and Mini MILES Laser Emitting Components'', which used ''actual'' operating conditions of the laser emitters at the time of its issuance.

  18. Vehicle Technologies Office Merit Review 2015: Electric Vehicle Mile Traveled (eVMT): On-road Results and Analysis

    Broader source: Energy.gov [DOE]

    Presentation given by Idaho National Laboratory at 2015 DOE Hydrogen and Fuel Cells Program and Vehicle Technologies Office Annual Merit Review and Peer Evaluation meeting about Electric Vehicle...

  19. CURRENT APPLICATIONS OF THREE MILE ISLAND-2 CORE AND DEBRIS HANDLING AT THE IDAHO NATIONAL LABORATORY

    SciTech Connect (OSTI)

    Carmack, William Jonathan; Braase, Lori Ann

    2015-09-01

    Fuel recovery from severe accidents requires careful planning and execution. The Idaho National Laboratory played a key role in the Three Mile Island (TMI) fuel and core recovery. This involved technology development to locate and handle the damaged fuel; characterization of fuel and debris; analysis of fuel interaction with structural components and materials; development of fuel drying technology for long-term storage. However, one of the critical activities from the TMI project was the extensive effort document all the activities and archive the reports and photos. A historical review of the TMI project at the INL leads to the identification of current applications and considerations for facility designs, fuel handling, robotic applications, material characterization, etc.

  20. Percolation Cooling of the Three Mile Island Unit 2 Lower Head by Way of Thermal Cracking and Gap Formation

    SciTech Connect (OSTI)

    Thomsen, K.L.

    2002-01-15

    Two partial models have been developed to elucidate the Three Mile Island Unit 2 lower head coolability by water percolation from above into the thermally cracking debris bed and into a gap between the debris and the wall. The bulk permeability of the cracked top crust is estimated based on simple fracture mechanics and application of Poiseuille's law to the fractures. The gap is considered as an abstraction representing an initially rugged interface, which probably expanded by thermal deformation and cracking in connection with the water ingress. The coupled flow and heat conduction problem for the top crust is solved in slab geometry based on the two-phase Darcy equations together with quasi-steady mass and energy conservation equations. The resulting water penetration depth is in good agreement with the depth of the so-called loose debris bed. The lower-head and bottom-crust problem is treated analogously by a two-dimensional axisymmetric model. The notion of a gap is maintained as a useful concept in the flow analysis. Simulations show that a central hot spot with a peak wall temperature of 1075 to 1100 deg. C can be obtained, but the quenching rates are not satisfactory. It is concluded that a three-dimensional model with an additional mechanism to explain the sudden water ingress to the hot spot center would be more appropriate.

  1. Wave-driven

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    driven dynamo action in spherical magnetohydrodynamic systems K. Reuter, 1 F. Jenko, 1 A. Tilgner, 2 and C. B. Forest 3 1 Max-Planck-Institut für Plasmaphysik, EURATOM Association, Boltzmannstraße 2, D-85748 Garching, Germany 2 Institute of Geophysics, University of Göttingen, Friedrich-Hund-Platz 1, 37077 Göttingen, Germany 3 Department of Physics, University of Wisconsin-Madison, 1150 University Avenue, Madison, Wisconsin 53706, USA ͑Received 22 September 2009; published 11 November

  2. Fact #913: February 22, 2016 The Most Common Warranty for Plug-In Vehicle Batteries is 8 Years/100,000 Miles- Dataset

    Broader source: Energy.gov [DOE]

    Excel file and dataset for The Most Common Warranty for Plug-In Vehicle Batteries is 8 Years/100,000 Miles

  3. Fact #848: November 24, 2014 Nearly Three-Fourths of New Cars have Fuel Economy above 25 Miles per Gallon- Dataset

    Broader source: Energy.gov [DOE]

    Excel file with dataset for Fact #848: November 24, 2014 Nearly Three-Fourths of New Cars have Fuel Economy above 25 Miles per Gallon

  4. Fact #854 January 5, 2015 Driving Ranges for All-Electric Vehicles in Model Year 2014 Vary from 62 to 265 Miles – Dataset

    Broader source: Energy.gov [DOE]

    Excel file with dataset for Driving Ranges for All-Electric Vehicles in Model Year 2014 Vary from 62 to 265 Miles

  5. EA-1985: Virginia Offshore Wind Technology Advancement Project (VOWTAP), 24 nautical miles offshore of Virginia Beach, Virginia

    Broader source: Energy.gov [DOE]

    DOE is proposing to fund Virginia Electric and Power Company's Virginia Offshore Wind Technology Advancement Project (VOWTAP). The proposed VOWTAP project consists of design, construction and operation of a 12 megawatt offshore wind facility located approximately 24 nautical miles off the coast of Virginia Beach, VA on the Outer Continental Shelf.

  6. Muscle-driven nanogenerators

    DOE Patents [OSTI]

    Wang, Zhong L.; Yang, Rusen

    2011-03-01

    In a method of generating electricity, a plurality of living cells are grown on an array of piezoelectric nanowires so that the cells engage the piezoelectric nanowires. Induced static potentials are extracted from at least one of the piezoelectric nanowires when at least one of the cells deforms the at least one of the piezoelectric nanowires. A cell-driven electrical generator that includes a substrate and a plurality of spaced-apart piezoelectric nanowires disposed on the substrate. A plurality of spaced-apart conductive electrodes interact with the plurality of piezoelectric nanowires. A biological buffer layer that is configured to promote growth of cells is disposed on the substrate so that cells placed on the substrate will grow and engage the piezoelectric nanowires.

  7. Historical summary of the Three Mile Island Unit 2 core debris transportation campaign

    SciTech Connect (OSTI)

    Schmitt, R.C.; Tyacke, M.J.; Quinn, G.J.

    1993-03-01

    Transport of the damaged core materials from the Unit 2 reactor of the Three Mile Island Nuclear Power Station (TMI-2) to the Idaho National Engineering Laboratory (INEL) for examination and storage presented many technical and institutional challenges, including assessing the ability to transport the damaged core; removing and packaging core debris in ways suitable for transport; developing a transport package that could both meet Federal regulations and interface with the facilities at TMI-2 and the INEL; and developing a transport plan, support logistics, and public communications channels suited to the task. This report is a historical summary of how the US Department of Energy addressed those challenges and transported, received, and stored the TMI-2 core debris at the INEL. Subjects discussed include preparations for transport, loading at TMI-2, institutional issues, transport operations, receipt and storage at the INEL, governmental inquiries/investigations, and lessons learned. Because of public attention focused on the TMI-2 Core Debris Transport Program, the exchange of information between the program and public was extensive. This exchange is a focus for parts of this report to explain why various operations were conducted as they were and why certain technical approaches were employed. And, because of that exchange, the program may have contributed to a better public understanding of such actions and may contribute to planning and execution of similar future actions.

  8. Evaluation of the Three Mile Island Unit 2 reactor building decontamination process

    SciTech Connect (OSTI)

    Dougherty, D.; Adams, J. W.

    1983-08-01

    Decontamination activities from the cleanup of the Three Mile Island Unit 2 Reactor Building are generating a variety of waste streams. Solid wastes being disposed of in commercial shallow land burial include trash and rubbish, ion-exchange resins (Epicor-II) and strippable coatings. The radwaste streams arising from cleanup activities currently under way are characterized and classified under the waste classification scheme of 10 CFR Part 61. It appears that much of the Epicor-II ion-exchange resin being disposed of in commerical land burial will be Class B and require stabilization if current radionuclide loading practices continue to be followed. Some of the trash and rubbish from the cleanup of the reactor building so far would be Class B. Strippable coatings being used at TMI-2 were tested for leachability of radionuclides and chelating agents, thermal stability, radiation stability, stability under immersion and biodegradability. Actual coating samples from reactor building decontamination testing were evaluated for radionuclide leaching and biodegradation.

  9. Laser-driven fusion reactor

    DOE Patents [OSTI]

    Hedstrom, J.C.

    1973-10-01

    A laser-driven fusion reactor consisting of concentric spherical vessels in which the thermonuclear energy is derived from a deuterium-tritium (D + T) burn within a pellet'', located at the center of the vessels and initiated by a laser pulse. The resulting alpha -particle energy and a small fraction of the neutron energy are deposited within the pellet; this pellet energy is eventually transformed into sensible heat of lithium in a condenser outside the vessels. The remaining neutron energy is dissipated in a lithium blanket, located within the concentric vessels, where the fuel ingredient, tritium, is also produced. The heat content of the blanket and of the condenser lithium is eventually transferred to a conventional thermodynamic plant where the thermal energy is converted to electrical energy in a steam Rankine cycle. (Official Gazette)

  10. Analysis of the Three Mile Island submerged demineralizer system vessel burial data

    SciTech Connect (OSTI)

    Jasen, W.G.; Amir, S.J.

    1989-09-01

    The Submerged Demineralizer System (SDS) was used during the Three Mile Island (TMI) nuclear reactor cleanup to remove cesium and strontium from contaminated water. The SDS vessels are 2-ft-in diameter and 4-ft tall stainless steel cylinders containing up to 60 kCi of radioactive cesium and strontium loaded on damp zeolite. The water in the damp zeolite absorbs some of the ionizing radiation and decomposes to hydrogen and oxygen by a process called radiolysis. Gas generation rates approaching 1 L/h (Quinn et al. 1984) have been calculated and measured for some of these loaded vessels. Each of the SDS vessels contains a catalyst bed to recombine the available hydrogen and oxygen back to water. Tests have proven this hydrogen control method to be highly effective, even under very wet (but unsubmerged) conditions. Nineteen SDS vessels, packaged one at a time in a shielded and licensed shipping cask, were shipped to Rockwell Hanford Operations (Rockwell). Collectively, these vessels contain approximately 7,500 kCi of radioactive material. Sixteen vessels were transloaded into concrete overpacks and buried at the Hanford Site. The contents of the other three vessels were vitrified at Pacific Northwest Laboratory. Subsequent to placement of the SDS vessels in the burial grounds, DOE Order 5820.2A (DOE 1988) was issued in September 1988. This order requires wastes to be evaluated against 10 CFR 61.55 for radioactivity above greater-than-class C(GTCC) limits. Fourteen of the sixteen vessels buried at the Hanford Site have been determined to be GTCC waste. 5 refs., 3 figs., 3 tabs.

  11. Fluid driven reciprocating apparatus

    DOE Patents [OSTI]

    Whitehead, J.C.

    1997-04-01

    An apparatus is described comprising a pair of fluid driven pump assemblies in a back-to-back configuration to yield a bi-directional pump. Each of the pump assemblies includes a piston or diaphragm which divides a chamber therein to define a power section and a pumping section. An intake-exhaust valve is connected to each of the power sections of the pump chambers, and function to direct fluid, such as compressed air, into the power section and exhaust fluid therefrom. At least one of the pistons or diaphragms is connected by a rod assembly which is constructed to define a signal valve, whereby the intake-exhaust valve of one pump assembly is controlled by the position or location of the piston or diaphragm in the other pump assembly through the operation of the rod assembly signal valve. Each of the pumping sections of the pump assemblies are provided with intake and exhaust valves to enable filling of the pumping section with fluid and discharging fluid therefrom when a desired pressure has been reached. 13 figs.

  12. Fluid driven recipricating apparatus

    DOE Patents [OSTI]

    Whitehead, John C.

    1997-01-01

    An apparatus comprising a pair of fluid driven pump assemblies in a back-to-back configuration to yield a bi-directional pump. Each of the pump assemblies includes a piston or diaphragm which divides a chamber therein to define a power section and a pumping section. An intake-exhaust valve is connected to each of the power sections of the pump chambers, and function to direct fluid, such as compressed air, into the power section and exhaust fluid therefrom. At least one of the pistons or diaphragms is connected by a rod assembly which is constructed to define a signal valve, whereby the intake-exhaust valve of one pump assembly is controlled by the position or location of the piston or diaphragm in the other pump assembly through the operation of the rod assembly signal valve. Each of the pumping sections of the pump assemblies are provided with intake and exhaust valves to enable filling of the pumping section with fluid and discharging fluid therefrom when a desired pressure has been reached.

  13. Terahertz-driven linear electron acceleration

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Nanni, Emilio A.; Huang, Wenqian R.; Hong, Kyung-Han; Ravi, Koustuban; Fallahi, Arya; Moriena, Gustavo; Dwayne Miller, R. J.; Kärtner, Franz X.

    2015-10-06

    The cost, size and availability of electron accelerators are dominated by the achievable accelerating gradient. Conventional high-brightness radio-frequency accelerating structures operate with 30–50 MeVm-1 gradients. Electron accelerators driven with optical or infrared sources have demonstrated accelerating gradients orders of magnitude above that achievable with conventional radio-frequency structures. However, laser-driven wakefield accelerators require intense femtosecond sources and direct laser-driven accelerators suffer from low bunch charge, sub-micron tolerances and sub-femtosecond timing requirements due to the short wavelength of operation. Here we demonstrate linear acceleration of electrons with keV energy gain using optically generated terahertz pulses. Terahertz-driven accelerating structures enable high-gradient electron/proton acceleratorsmore » with simple accelerating structures, high repetition rates and significant charge per bunch. As a result, these ultra-compact terahertz accelerators with extremely short electron bunches hold great potential to have a transformative impact for free electron lasers, linear colliders, ultrafast electron diffraction, X-ray science and medical therapy with X-rays and electron beams.« less

  14. Terahertz-driven linear electron acceleration

    SciTech Connect (OSTI)

    Nanni, Emilio A.; Huang, Wenqian R.; Hong, Kyung-Han; Ravi, Koustuban; Fallahi, Arya; Moriena, Gustavo; Dwayne Miller, R. J.; Kärtner, Franz X.

    2015-10-06

    The cost, size and availability of electron accelerators are dominated by the achievable accelerating gradient. Conventional high-brightness radio-frequency accelerating structures operate with 30–50 MeVm-1 gradients. Electron accelerators driven with optical or infrared sources have demonstrated accelerating gradients orders of magnitude above that achievable with conventional radio-frequency structures. However, laser-driven wakefield accelerators require intense femtosecond sources and direct laser-driven accelerators suffer from low bunch charge, sub-micron tolerances and sub-femtosecond timing requirements due to the short wavelength of operation. Here we demonstrate linear acceleration of electrons with keV energy gain using optically generated terahertz pulses. Terahertz-driven accelerating structures enable high-gradient electron/proton accelerators with simple accelerating structures, high repetition rates and significant charge per bunch. As a result, these ultra-compact terahertz accelerators with extremely short electron bunches hold great potential to have a transformative impact for free electron lasers, linear colliders, ultrafast electron diffraction, X-ray science and medical therapy with X-rays and electron beams.

  15. Salinity driven oceanographic upwelling

    DOE Patents [OSTI]

    Johnson, David H.

    1986-01-01

    The salinity driven oceanographic upwelling is maintained in a mariculture device that includes a long main duct in the general shape of a cylinder having perforated cover plates at each end. The mariculture device is suspended vertically in the ocean such that one end of the main duct is in surface water and the other end in relatively deep water that is cold, nutrient rich and relatively fresh in comparison to the surface water which is relatively warm, relatively nutrient deficient and relatively saline. A plurality of elongated flow segregating tubes are disposed in the main duct and extend from the upper cover plate beyond the lower cover plate into a lower manifold plate. The lower manifold plate is spaced from the lower cover plate to define a deep water fluid flow path to the interior space of the main duct. Spacer tubes extend from the upper cover plate and communicate with the interior space of the main duct. The spacer tubes are received in an upper manifold plate spaced from the upper cover plate to define a surface water fluid flow path into the flow segregating tubes. A surface water-deep water counterflow is thus established with deep water flowing upwardly through the main duct interior for discharge beyond the upper manifold plate while surface water flows downwardly through the flow segregating tubes for discharge below the lower manifold plate. During such counterflow heat is transferred from the downflowing warm water to the upflowing cold water. The flow is maintained by the difference in density between the deep water and the surface water due to their differences in salinity. The upwelling of nutrient rich deep water is used for marifarming by fertilizing the nutrient deficient surface water.

  16. Salinity driven oceanographic upwelling

    DOE Patents [OSTI]

    Johnson, D.H.

    1984-08-30

    The salinity driven oceanographic upwelling is maintained in a mariculture device that includes a long main duct in the general shape of a cylinder having perforated cover plates at each end. The mariculture device is suspended vertically in the ocean such that one end of the main duct is in surface water and the other end in relatively deep water that is cold, nutrient rich and relatively fresh in comparison to the surface water which is relatively warm, relatively nutrient deficient and relatively saline. A plurality of elongated flow segregating tubes are disposed in the main duct and extend from the upper cover plate beyond the lower cover plate into a lower manifold plate. The lower manifold plate is spaced from the lower cover plate to define a deep water fluid flow path to the interior space of the main duct. Spacer tubes extend from the upper cover plate and communicate with the interior space of the main duct. The spacer tubes are received in an upper manifold plate spaced from the upper cover plate to define a surface water fluid flow path into the flow segregating tubes. A surface water-deep water counterflow is thus established with deep water flowing upwardly through the main duct interior for discharge beyond the upper manifold plate while surface water flows downwardly through the flow segregating tubes for discharge below the lower manifold plate. During such counterflow heat is transferred from the downflowing warm water to the upflowing cold water. The flow is maintained by the difference in density between the deep water and the surface water due to their differences in salinity. The upwelling of nutrient rich deep water is used for marifarming by fertilizing the nutrient deficient surface water. 1 fig.

  17. Laser Driven Dynamic Loading of Condensed Matter

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Laser Driven Dynamic Loading of Condensed Matter Laser Driven Dynamic Loading of Condensed Matter Advanced diagnostics of experiments covering many orders of magnitude in strain ...

  18. Laser-driven fusion etching process

    DOE Patents [OSTI]

    Ashby, C.I.H.; Brannon, P.J.; Gerardo, J.B.

    1987-08-25

    The surfaces of solids are etched by a radiation-driven chemical reaction. The process involves exposing a substrate coated with a layer of a reactant material on its surface to radiation, e.g., a laser, to induce localized melting of the substrate which results in the occurrence of a fusion reaction between the substrate and coating material. The resultant reaction product and excess reactant salt are then removed from the surface of the substrate with a solvent which is relatively inert towards the substrate. The laser-driven chemical etching process is especially suitable for etching ionic substrates, e.g., LiNbO/sub 3/, such as used in electro-optical/acousto-optic devices. It is also suitable for applications wherein the etching process is required to produce an etched ionic substrate having a smooth surface morphology or when a very rapid etching rate is desired.

  19. Laser-driven fusion etching process

    DOE Patents [OSTI]

    Ashby, Carol I. H.; Brannon, Paul J.; Gerardo, James B.

    1989-01-01

    The surfaces of solid ionic substrates are etched by a radiation-driven chemical reaction. The process involves exposing an ionic substrate coated with a layer of a reactant material on its surface to radiation, e.g. a laser, to induce localized melting of the substrate which results in the occurrance of a fusion reaction between the substrate and coating material. The resultant reaction product and excess reactant salt are then removed from the surface of the substrate with a solvent which is relatively inert towards the substrate. The laser-driven chemical etching process is especially suitable for etching ionic salt substrates, e.g., a solid inorganic salt such as LiNbO.sub.3, such as used in electro-optical/acousto-optic devices. It is also suitable for applications wherein the etching process is required to produce an etched ionic substrate having a smooth surface morphology or when a very rapid etching rate is desired.

  20. Laser driven compact ion accelerator

    DOE Patents [OSTI]

    Tajima, Toshiki

    2005-03-15

    A laser driven compact ion source including a light source that produces an energy pulse, a light source guide that guides the energy pulse to a target and produces an ion beam. The ion beam is transported to a desired destination.

  1. AVTA: 2009 Vantage Neighborhood Electric Vehicle Testing Results

    Broader source: Energy.gov [DOE]

    The Vehicle Technologies Office's Advanced Vehicle Testing Activity carries out testing on a wide range of advanced vehicles and technologies on dynamometers, closed test tracks, and on-the-road. These results provide benchmark data that researchers can use to develop technology models and guide future research and development. The following reports describe testing results of two 2009 Vantage neighborhood electric vehicles (a pickup truck style and a van style). Neighborhood electric vehicles reach speeds of no more than 35 miles per hour and are only allowed on roads with speed limits of up to 35 miles per hour. This research was conducted by Idaho National Laboratory.

  2. AVTA: 2010 Electric Vehicles International Neighborhood Electric Vehicle Testing Results

    Broader source: Energy.gov [DOE]

    The Vehicle Technologies Office's Advanced Vehicle Testing Activity carries out testing on a wide range of advanced vehicles and technologies on dynamometers, closed test tracks, and on-the-road. These results provide benchmark data that researchers can use to develop technology models and guide future research and development. The following reports describe testing results of the 2010 Electric Vehicles International neighborhood electric vehicle. Neighborhood electric vehicles reach speeds of no more than 35 miles per hour and are only allowed on roads with speed limits of up to 35 miles per hour. This research was conducted by Idaho National Laboratory.

  3. AVTA: 2013 BRP Neighborhood Electric Vehicle Testing Results

    Broader source: Energy.gov [DOE]

    The Vehicle Technologies Office's Advanced Vehicle Testing Activity carries out testing on a wide range of advanced vehicles and technologies on dynamometers, closed test tracks, and on-the-road. These results provide benchmark data that researchers can use to develop technology models and guide future research and development. The following reports describe testing results of the 2013 BRP neighborhood electric vehicle. Neighborhood electric vehicles reach speeds of no more than 35 miles per hour and are only allowed on roads with speed limits of up to 35 miles per hour. This research was conducted by Idaho National Laboratory.

  4. Re-evaluation of Spent Nuclear Fuel Assay Data for the Three Mile Island Unit 1 Reactor and Application to Code Validation

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Gauld, Ian C.; Giaquinto, J. M.; Delashmitt, J. S.; Hu, Jianwei; Ilas, Germina; Haverlock, T. J.; Romano, Catherine E.

    2016-01-01

    Destructive radiochemical assay measurements of spent nuclear fuel rod segments from an assembly irradiated in the Three Mile Island unit 1 (TMI-1) pressurized water reactor have been performed at Oak Ridge National Laboratory (ORNL). Assay data are reported for five samples from two fuel rods of the same assembly. The TMI-1 assembly was a 15 X 15 design with an initial enrichment of 4.013 wt% 235U, and the measured samples achieved burnups between 45.5 and 54.5 gigawatt days per metric ton of initial uranium (GWd/t). Measurements were performed mainly using inductively coupled plasma mass spectrometry after elemental separation via highmore » performance liquid chromatography. High precision measurements were achieved using isotope dilution techniques for many of the lanthanides, uranium, and plutonium isotopes. Measurements are reported for more than 50 different isotopes and 16 elements. One of the two TMI-1 fuel rods measured in this work had been measured previously by Argonne National Laboratory (ANL), and these data have been widely used to support code and nuclear data validation. Recently, ORNL provided an important opportunity to independently cross check results against previous measurements performed at ANL. The measured nuclide concentrations are used to validate burnup calculations using the SCALE nuclear systems modeling and simulation code suite. These results show that the new measurements provide reliable benchmark data for computer code validation.« less

  5. Re-evaluation of Spent Nuclear Fuel Assay Data for the Three Mile Island Unit 1 Reactor and Application to Code Validation

    SciTech Connect (OSTI)

    Gauld, Ian C.; Giaquinto, J. M.; Delashmitt, J. S.; Hu, Jianwei; Ilas, Germina; Haverlock, T. J.; Romano, Catherine E.

    2016-01-01

    Destructive radiochemical assay measurements of spent nuclear fuel rod segments from an assembly irradiated in the Three Mile Island unit 1 (TMI-1) pressurized water reactor have been performed at Oak Ridge National Laboratory (ORNL). Assay data are reported for five samples from two fuel rods of the same assembly. The TMI-1 assembly was a 15 X 15 design with an initial enrichment of 4.013 wt% 235U, and the measured samples achieved burnups between 45.5 and 54.5 gigawatt days per metric ton of initial uranium (GWd/t). Measurements were performed mainly using inductively coupled plasma mass spectrometry after elemental separation via high performance liquid chromatography. High precision measurements were achieved using isotope dilution techniques for many of the lanthanides, uranium, and plutonium isotopes. Measurements are reported for more than 50 different isotopes and 16 elements. One of the two TMI-1 fuel rods measured in this work had been measured previously by Argonne National Laboratory (ANL), and these data have been widely used to support code and nuclear data validation. Recently, ORNL provided an important opportunity to independently cross check results against previous measurements performed at ANL. The measured nuclide concentrations are used to validate burnup calculations using the SCALE nuclear systems modeling and simulation code suite. These results show that the new measurements provide reliable benchmark data for computer code validation.

  6. First time nuclear material detection by one short-pulse-laser-driven

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    neutron source Science & Innovation » Technical Articles » First time nuclear material detection by one short-pulse-laser-driven neutron source First time nuclear material detection by one short-pulse-laser-driven neutron source The results obtained are the first experimental demonstration of active interrogation of nuclear material by a short pulse laser driven neutron source. April 3, 2013 TRIDENT pulse The results obtained are the first experimental demonstration of active

  7. Disposal demonstration of a high integrity container (HIC) containing an EPICOR-II prefilter from Three Mile Island

    SciTech Connect (OSTI)

    McConnell, J.W. Jr.; Tyacke, M.J.; Schmitt, R.C.; Reno, H.W.

    1985-02-01

    A high integrity container (HIC) was developed, tested, and certified for use in disposing of unusual low-level radioactive waste from Three Mile Island Unit 2 (TMI-2). The work was coordinated by EG and G Idaho, Inc. and funded by the US Department of Energy. A disposal demonstration using an HIC containing an EPICOR-II prefilter from TMI-2 was completed at the commercial disposal facility in the State of Washington. A Certification of Compliance was issued by the Department of Social and Health Services of the State of Washington to use the HIC in disposing of up to 50 EPICOR-II prefilters. That Certification of Compliance was issued after rigorous review of the HIC design and test program by the State and by the US Nuclear Regulatory Commission. This report describes the processes of loading, transporting, and disposing of the demonstration HIC and briefly describes the design, testing, and approval effort leading up to the demonstration.

  8. Transporting TMI-2 (Three Mile Island Unit 2) core debris to INEL: Public safety and public response

    SciTech Connect (OSTI)

    Schmitt, R.C.; Reno, H.W.; Young, W.R.; Hamric, J.P.

    1987-01-01

    This paper describes the approach taken by the US Department of Energy (DOE) to ensure that public safety is maintained during transport of core debris from the Unit-2 reactor at the Three Mile Island Nuclear Power Station near Harrisburg, PA, to the Idaho National Engineering Laboratory near Idaho Falls, ID. It provides up-to-date information about public response to the transport action and discusses DOE's position on several institutional issues. The authors advise that planners of future transport operations be prepared for a multitude of comments from all levels of federal, state, and local governments, special interest groups, and private citizens. They also advise planners to keep meticulous records concerning all informational transactions.

  9. Performance of Gas-Engine Driven Heat Pump Unit

    SciTech Connect (OSTI)

    Abdi Zaltash; Randy Linkous; Randall Wetherington; Patrick Geoghegan; Ed Vineyard; Isaac Mahderekal; Robert Gaylord

    2008-09-30

    Air-conditioning (cooling) for buildings is the single largest use of electricity in the United States (U.S.). This drives summer peak electric demand in much of the U.S. Improved air-conditioning technology thus has the greatest potential impact on the electric grid compared to other technologies that use electricity. Thermally-activated technologies (TAT), such as natural gas engine-driven heat pumps (GHP), can provide overall peak load reduction and electric grid relief for summer peak demand. GHP offers an attractive opportunity for commercial building owners to reduce electric demand charges and operating expenses. Engine-driven systems have several potential advantages over conventional single-speed or single-capacity electric motor-driven units. Among them are variable speed operation, high part load efficiency, high temperature waste heat recovery from the engine, and reduced annual operating costs (SCGC 1998). Although gas engine-driven systems have been in use since the 1960s, current research is resulting in better performance, lower maintenance requirements, and longer operating lifetimes. Gas engine-driven systems are typically more expensive to purchase than comparable electric motor-driven systems, but they typically cost less to operate, especially for commercial building applications. Operating cost savings for commercial applications are primarily driven by electric demand charges. GHP operating costs are dominated by fuel costs, but also include maintenance costs. The reliability of gas cooling equipment has improved in the last few years and maintenance requirements have decreased (SCGC 1998, Yahagi et al. 2006). Another advantage of the GHP over electric motor-driven is the ability to use the heat rejected from the engine during heating operation. The recovered heat can be used to supplement the vapor compression cycle during heating or to supply other process loads, such as water heating. The use of the engine waste heat results in greater operating efficiency compared to conventional electric motor-driven units (SCGC 1998). In Japan, many hundreds of thousands of natural gas-driven heat pumps have been sold (typically 40,000 systems annually) (Yahagi et al. 2006). The goal of this program is to develop dependable and energy efficient GHPs suitable for U.S. commercial rooftop applications (the single largest commercial product segment). This study describes the laboratory performance evaluation of an integrated 10-ton GHP rooftop unit (a 900cc Daihatsu-Aisin natural gas engine) which uses R410A as the refrigerant (GEDAC No.23). ORNL Thermally-Activated Heat Pump (TAHP) Environmental Chambers were used to evaluate this unit in a controlled laboratory environment.

  10. Accelerating Science Driven System Design With RAMP

    SciTech Connect (OSTI)

    Wawrzynek, John

    2015-05-01

    Researchers from UC Berkeley, in collaboration with the Lawrence Berkeley National Lab, are engaged in developing an Infrastructure for Synthesis with Integrated Simulation (ISIS). The ISIS Project was a cooperative effort for “application-driven hardware design” that engages application scientists in the early parts of the hardware design process for future generation supercomputing systems. This project served to foster development of computing systems that are better tuned to the application requirements of demanding scientific applications and result in more cost-effective and efficient HPC system designs. In order to overcome long conventional design-cycle times, we leveraged reconfigurable devices to aid in the design of high-efficiency systems, including conventional multi- and many-core systems. The resulting system emulation/prototyping environment, in conjunction with the appropriate intermediate abstractions, provided both a convenient user programming experience and retained flexibility, and thus efficiency, of a reconfigurable platform. We initially targeted the Berkeley RAMP system (Research Accelerator for Multiple Processors) as that hardware emulation environment to facilitate and ultimately accelerate the iterative process of science-driven system design. Our goal was to develop and demonstrate a design methodology for domain-optimized computer system architectures. The tangible outcome is a methodology and tools for rapid prototyping and design-space exploration, leading to highly optimized and efficient HPC systems.

  11. Actively driven thermal radiation shield

    DOE Patents [OSTI]

    Madden, Norman W. (Livermore, CA); Cork, Christopher P. (Pleasant Hill, CA); Becker, John A. (Alameda, CA); Knapp, David A. (Livermore, CA)

    2002-01-01

    A thermal radiation shield for cooled portable gamma-ray spectrometers. The thermal radiation shield is located intermediate the vacuum enclosure and detector enclosure, is actively driven, and is useful in reducing the heat load to mechanical cooler and additionally extends the lifetime of the mechanical cooler. The thermal shield is electrically-powered and is particularly useful for portable solid-state gamma-ray detectors or spectrometers that dramatically reduces the cooling power requirements. For example, the operating shield at 260K (40K below room temperature) will decrease the thermal radiation load to the detector by 50%, which makes possible portable battery operation for a mechanically cooled Ge spectrometer.

  12. Performance-Driven Interface Contract Enforcement for Scientific Components

    SciTech Connect (OSTI)

    Dahlgren, T L

    2007-10-01

    Performance-driven interface contract enforcement research aims to improve the quality of programs built from plug-and-play scientific components. Interface contracts make the obligations on the caller and all implementations of the specified methods explicit. Runtime contract enforcement is a well-known technique for enhancing testing and debugging. However, checking all of the associated constraints during deployment is generally considered too costly from a performance stand point. Previous solutions enforced subsets of constraints without explicit consideration of their performance implications. Hence, this research measures the impacts of different interface contract sampling strategies and compares results with new techniques driven by execution time estimates. Results from three studies indicate automatically adjusting the level of checking based on performance constraints improves the likelihood of detecting contract violations under certain circumstances. Specifically, performance-driven enforcement is better suited to programs exercising constraints whose costs are at most moderately expensive relative to normal program execution.

  13. Tier 2 Useful Life (120,000 miles) Exhaust Emission Results for a NOx Adsorber and Diesel Particle Filter Equipped Light-Duty Diesel Vehicle

    SciTech Connect (OSTI)

    Tatur, M.; Tomazic, D.; Thornton, M.; Orban, J.; Slone, E.

    2006-05-01

    Investigates the emission control system performance and system desulfurization effects on regulated and unregulated emissions in a light-duty diesel engine.

  14. Driven Morse oscillator: Classical chaos, quantum theory, and photodissociation

    SciTech Connect (OSTI)

    Goggin, M.E.; Milonni, P.W.

    1988-02-01

    We compare the classical and quantum theories of a Morse oscillator driven by a sinusoidal field, focusing attention on multiple-photon excitation and dissociation. In both the classical and quantum theories the threshold field strength for dissociation may be estimated fairly accurately on the basis of classical resonance overlap, and the classical and quantum results for the threshold are in good agreement except near higher-order classical resonances and quantum multiphoton resonances. We discuss the possibility of ''quantum chaos'' in such driven molecular systems and use the Morse oscillator to test the manifestations of classical resonance overlap suggested semiclassically.

  15. Suppression of energetic particle driven instabilities with HHFW heating

    SciTech Connect (OSTI)

    Fredrickson, E. D.; Taylor, G.; Bertelli, N.; Darrow, D. S.; Gorelenkov, N.; Kramer, G.; Liu, D.; Crocker, N. A.; Kubota, S.; White, R.

    2015-01-01

    In plasmas in the National Spherical Torus Experiment (NSTX) [Ono et al., Nucl. Fusion 40 (2000) 557] heated with neutral beams, the beam ions typically excite Energetic Particle Modes (EPMs or fishbones), and Toroidal, Global or Compressional Alfvén Eigenmodes (TAE, GAE, CAE). These modes can redistribute the energetic beam ions, altering the beam driven current profile and the plasma heating profile, or they may affect electron thermal transport or cause losses of the beam ions. In this paper we present experimental results where these instabilities, driven by the super-thermal beam ions, are suppressed with the application of High Harmonic Fast Wave heating.

  16. Suppression of energetic particle driven instabilities with HHFW heating

    SciTech Connect (OSTI)

    Fredrickson, E. D.; Taylor, G.; Bertelli, N.; Darrow, D. S.; Gorelenkov, N.; Kramer, G.; Liu, D.; Crocker, N. A.; Kubota, S.; White, R.

    2015-01-01

    In plasmas in the National Spherical Torus Experiment (NSTX) [Ono et al., Nucl. Fusion 40 (2000) 557] heated with neutral beams, the beam ions typically excite Energetic Particle Modes (EPMs or fishbones), and Toroidal, Global or Compressional Alfvn Eigenmodes (TAE, GAE, CAE). These modes can redistribute the energetic beam ions, altering the beam driven current profile and the plasma heating profile, or they may affect electron thermal transport or cause losses of the beam ions. In this paper we present experimental results where these instabilities, driven by the super-thermal beam ions, are suppressed with the application of High Harmonic Fast Wave heating.

  17. Alkali-vapor magnetic resonance driven by fictitious radiofrequency fields

    SciTech Connect (OSTI)

    Zhivun, Elena; Wickenbrock, Arne; Patton, Brian; Budker, Dmitry

    2014-11-10

    We demonstrate an all-optical {sup 133}Cs scalar magnetometer, operating in nonzero magnetic field, in which the magnetic resonance is driven by an effective oscillating magnetic field provided by the AC Stark shift of an intensity-modulated laser beam. We achieve a projected shot-noise-limited sensitivity of 1.7fT/√(Hz) and measure a technical noise floor of 40fT/√(Hz). These results are essentially identical to a coil-driven scalar magnetometer using the same setup. This all-optical scheme offers advantages over traditional coil-driven magnetometers for use in arrays and in magnetically sensitive fundamental physics experiments, e.g., searches for a permanent electric dipole moment of the neutron.

  18. Data Driven Quality Assurance and Quality Control

    Broader source: Energy.gov [DOE]

    "Data Driven Quality Assurance & Quality Control," Patrick Roche, Conservation Services Group. Provides an overview of data QA/QC system design.

  19. Light-driven phase shifter

    DOE Patents [OSTI]

    Early, James W. (Los Alamos, NM)

    1990-01-01

    A light-driven phase shifter is provided for modulating a transmission light beam. A gaseous medium such as argon is provided with electron energy states excited to populate a metastable state. A tunable dye laser is selected with a wavelength effective to deplete the metastable electron state and may be intensity modulated. The dye laser is directed through the gaseous medium to define a first optical path having an index of refraction determined by the gaseous medium having a depleted metastable electron state. A transmission laser beam is also directed through the gaseous medium to define a second optical path at least partially coincident with the first optical path. The intensity of the dye laser beam may then be varied to phase modulate the transmission laser beam.

  20. miles-99.PDF

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    that gives the quiet air fall spectrum of the entire population of cloud ... Method The Doppler spectrum measured by a cloud radar is the convolution of the quiet air ...

  1. Butterfly Floquet Spectrum in Driven SU(2) Systems

    SciTech Connect (OSTI)

    Wang Jiao [Temasek Laboratories, National University of Singapore, 117542 (Singapore); Department of Physics, Institute of Theoretical Physics and Astrophysics, Xiamen University, Xiamen 361005 (China); Gong Jiangbin [Department of Physics and Center of Computational Science and Engineering, National University of Singapore, 117542 (Singapore); NUS Graduate School for Integrative Sciences and Engineering, Singapore 117597 (Singapore)

    2009-06-19

    The Floquet spectrum of a class of driven SU(2) systems is shown to display a butterfly pattern with multifractal properties. The level crossing between Floquet states of the same parity or different parities is studied. The results are relevant to studies of fractal statistics, quantum chaos, coherent destruction of tunneling, and the validity of mean-field descriptions of Bose-Einstein condensates.

  2. The Nuclear Accident at Three Mile Island a Practical Lesson in the Fundamental Importance of Effective Communications

    SciTech Connect (OSTI)

    DeVine Jr, J.C.

    2008-07-01

    The Three Mile Island Unit 2 (TMI-2) accident in March 1979 had a profound effect on the course of commercial nuclear generation in the United States and around the world. And while the central elements of the accident were matters of nuclear engineering, design and operations, its consequences were compounded, and in some respects superseded, by extraordinarily ineffective communications by all parties at all levels. Communications failures during the accident and its aftermath caused misunderstanding, distrust, and incorrect emergency response - and seeded or reinforced public opposition to nuclear power that persists to this day. There are communications lessons from TMI that have not yet been fully learned, and some that once were learned but are now gradually being forgotten. The more glaring TMI communications problems were in the arena of external interactions and communications among the plant owner, the Nuclear Regulatory Commission (NRC), the media, and the public. Confusing, fragmented, and contradictory public statements early in the accident, regardless of cause, undermined all possibility for reasonable discourse thereafter. And because the TMI accident was playing out on a world stage, the breakdown in public trust had long term and widespread implications. At the plant site, both TMI-2 cleanup and restart of the undamaged TMI-1 unit met with years of public and political criticism, and attendant regulatory pressure. Across the nation, public trust in nuclear power and those who operate it plummeted, unquestionably contributing to the 25+ year hiatus in new plant orders. There were other, less visible but equally important, consequences of ineffective communications at TMI. The unplanned 'precautionary' evacuation urged by the governor two days after the accident - a life changing, traumatic event for thousands of residents - was prompted primarily by misunderstandings and miscommunications regarding the condition of the plant. And today, nearly 30 years after the event, many in our nuclear industry have insufficient knowledge or regard for the underlying nuclear safety vulnerabilities revealed by the accident, in part because these have not been well explained. From this single, compelling experience, many lessons can be drawn. Some of these were recognized early and taken to heart by those who own and operate nuclear plants - but over time, respect for their importance has given way somewhat to the seemingly more urgent practicalities of plant cost, schedule and production goals. In other cases, the lessons have remained largely obscure. This paper will describe in greater detail the communications aspects of the TMI accident, lessons that can be drawn from them, and their implications on current and future nuclear facility operation. The paper reflects the author's personal, direct experience as part of the accident response team and subsequent cleanup operations at TMI. In summary: The Three Mile Accident was the most severe nuclear accident in U.S. history. It also is perhaps the most studied industrial accident of any kind in U.S. history. Exhaustive examinations of the public health consequences of the accident show convincingly that the effects of radioactivity releases, if any, were imperceptibly low. It is generally agreed, however, that there have been perceptible health consequences from the TMI-2 accident - those linked to stress. Stress to members of the public, particularly those living near the plant, was unquestionably high. And for some the combination of rumor, confusion, contradictory reports and uncertainty, all leading to an evacuation recommendation from the governor, took a toll. It could be argued that the ineffective internal and external communications during the course of the event were as influential to the outcome as the equipment and operational breakdowns that are now so well understood. And for that reason alone, this accident points out that communications capabilities - staffing, systems, facilities, training - can be as important to protection of the public, the plant an

  3. Review of the state of criticality of the Three Mile Island Unit 2 core and reactor vessel

    SciTech Connect (OSTI)

    Stratton, W.R. )

    1987-04-15

    The events during the early hours of the Three Mile Island Unit 2 (TMI-2) accident on March 28, 1979 caused the fuel in the reactor core to crumble or disintegrate, and then subside into a rubble structure more compact that its normal configuration. The present height of the core is about seven feet, five feet less than its normal configuration of 12 feet. With the same boron content and some or all of the control rod and burnable poison rod material as the normal core configuration, the collapsed structure is calculated to be more reactive. However, the reactor is assuredly subcritical at present because of the extraordinarily high boron concentration maintained in the coolant water. Four additional and different physical models are discussed briefly in the report to illustrate the margin of subcriticality, to provide a better estimate of the neutron multiplication factor, and to provide some understanding of the criticality effects of the important parameters. Two different finite, cylindrical models of a collapsed core are also presented in this report. The conclusion of this review is that the reactor is now very far subcritical with a boron concentration of 4350 ppM or more, and no conceivable rearrangement of fuel can create a critical state. Careful administrative control to maintain the boron concentration of the reactor coolant close to 5000 ppM, and controls to rigorously exclude addition of unborated water to the primary system, provide additional assurance that subcriticality will be maintained. The immediate corollary is that the defueling of the reactor vessel can proceed as planned, with complete confidence that such operations will remain subcritical. 20 refs.

  4. Lower head creep rupture failure analysis associated with alternative accident sequences of the Three Mile Island Unit 2

    SciTech Connect (OSTI)

    Sang Lung, Chan

    2004-07-01

    The objective of this lower head creep rupture analysis is to assess the current version of MELCOR 1.8.5-RG against SCDAP/RELAP5 MOD 3.3kz. The purpose of this assessment is to investigate the current MELCOR in-vessel core damage progression phenomena including the model for the formation of a molten pool. The model for stratified molten pool natural heat transfer will be included in the next MELCOR release. Presently, MELCOR excludes the gap heat-transfer model for the cooling associated with the narrow gap between the debris and the lower head vessel wall. All these phenomenological models are already treated in SCDAP/RELAP5 using the COUPLE code to model the heat transfer of the relocated debris with the lower head based on a two-dimensional finite-element-method. The assessment should determine if current MELCOR capabilities adequately cover core degradation phenomena appropriate for the consolidated MELCOR code. Inclusion of these features should bring MELCOR much closer to a state of parity with SCDAP/RELAP5 and is a currently underway element in the MELCOR code consolidation effort. This assessment deals with the following analysis of the Three Mile Island Unit 2 (TMI-2) alternative accident sequences. The TMI-2 alternative accident sequence-1 includes the continuation of the base case of the TMI-2 accident with the Reactor Coolant Pumps (RCP) tripped, and the High Pressure Injection System (HPIS) throttled after approximately 6000 s accident time, while in the TMI-2 alternative accident sequence-2, the reactor coolant pumps is tripped after 6000 s and the HPIS is activated after 12,012 s. The lower head temperature distributions calculated with SCDAP/RELAP5 are visualized and animated with open source visualization freeware 'OpenDX'. (author)

  5. Revisiting Insights from Three Mile Island Unit 2 Postaccident Examinations and Evaluations in View of the Fukushima Daiichi Accident

    SciTech Connect (OSTI)

    Joy Rempe; Mitchell Farmer; Michael Corradini; Larry Ott; Randall Gauntt; Dana Powers

    2012-11-01

    The Three Mile Island Unit 2 (TMI-2) accident, which occurred on March 28, 1979, led industry and regulators to enhance strategies to protect against severe accidents in commercial nuclear power plants. Investigations in the years after the accident concluded that at least 45% of the core had melted and that nearly 19 tonnes of the core material had relocated to the lower head. Postaccident examinations indicate that about half of that material formed a solid layer near the lower head and above it was a layer of fragmented rubble. As discussed in this paper, numerous insights related to pressurized water reactor accident progression were gained from postaccident evaluations of debris, reactor pressure vessel (RPV) specimens, and nozzles taken from the RPV. In addition, information gleaned from TMI-2 specimen evaluations and available data from plant instrumentation were used to improve severe accident simulation models that form the technical basis for reactor safety evaluations. Finally, the TMI-2 accident led the nuclear community to dedicate considerable effort toward understanding severe accident phenomenology as well as the potential for containment failure. Because available data suggest that significant amounts of fuel heated to temperatures near melting, the events at Fukushima Daiichi Units 1, 2, and 3 offer an unexpected opportunity to gain similar understanding about boiling water reactor accident progression. To increase the international benefit from such an endeavor, we recommend that an international effort be initiated to (a) prioritize data needs; (b) identify techniques, samples, and sample evaluations needed to address each information need; and (c) help finance acquisition of the required data and conduct of the analyses.

  6. Are GRACE-era Terrestrial Water Trends Driven by Anthropogenic...

    Office of Scientific and Technical Information (OSTI)

    Are GRACE-era Terrestrial Water Trends Driven by Anthropogenic Climate Change? Citation Details In-Document Search Title: Are GRACE-era Terrestrial Water Trends Driven by ...

  7. Convectively driven PCR thermal-cycling (Patent) | DOEPatents

    Office of Scientific and Technical Information (OSTI)

    Convectively driven PCR thermal-cycling Title: Convectively driven PCR thermal-cycling A polymerase chain reaction system provides an upper temperature zone and a lower temperature ...

  8. Pressure-Driven Quantum Criticality in Iron-Selenide Superconductors...

    Office of Scientific and Technical Information (OSTI)

    Pressure-Driven Quantum Criticality in Iron-Selenide Superconductors Title: Pressure-Driven Quantum Criticality in Iron-Selenide Superconductors Authors: Guo, Jing ; Chen, Xiao-Jia ...

  9. Requirements-Driven Diesel Catalyzed Particulate Trap Design...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Requirements-Driven Diesel Catalyzed Particulate Trap Design and Optimization Requirements-Driven Diesel Catalyzed Particulate Trap Design and Optimization 2005 Diesel Engine ...

  10. Accelerator-driven subcritical fission in molten salt core: Closing...

    Office of Scientific and Technical Information (OSTI)

    Accelerator-driven subcritical fission in molten salt core: Closing the nuclear fuel cycle for green nuclear energy Citation Details In-Document Search Title: Accelerator-driven ...

  11. Driven Skyrmions and Dynamical Transitions in Chiral Magnets...

    Office of Scientific and Technical Information (OSTI)

    Driven Skyrmions and Dynamical Transitions in Chiral Magnets Citation Details In-Document Search Title: Driven Skyrmions and Dynamical Transitions in Chiral Magnets Authors: Lin, ...

  12. Engine Driven Combined Heat and Power: Arrow Linen Supply, December...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Engine Driven Combined Heat and Power: Arrow Linen Supply, December 2008 Engine Driven Combined Heat and Power: Arrow Linen Supply, December 2008 This paper describes the Arrow ...

  13. United States Industrial Motor-Driven Systems Market Assessment...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Motor-Driven Systems Market Assessment: Charting a Roadmap to Energy Savings for Industry United States Industrial Motor-Driven Systems Market Assessment: Charting a Roadmap to ...

  14. Building America Case Study: Field Performance of Inverter-Driven...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Performance of Inverter-Driven Heat Pumps in Cold Climates Connecticut, Massachusetts, and Vermont PROJECT INFORMATION Project Name: Field Performance of Inverter-Driven Heat Pumps ...

  15. Density driven structural transformations in amorphous semiconductor

    Office of Scientific and Technical Information (OSTI)

    clathrates (Journal Article) | SciTech Connect Density driven structural transformations in amorphous semiconductor clathrates Citation Details In-Document Search Title: Density driven structural transformations in amorphous semiconductor clathrates Authors: Tulk, C.A. ; dos Santos, A.M. ; Neuefeind, J.C. ; Molaison, J.J. ; Sales, B.C. ; Honkimäki, V. [1] ; ESRF) [2] + Show Author Affiliations (ORNL) ( Publication Date: 2015-09-22 OSTI Identifier: 1221429 Resource Type: Journal Article

  16. Density driven structural transformations in amorphous semiconductor

    Office of Scientific and Technical Information (OSTI)

    clathrates (Journal Article) | SciTech Connect Density driven structural transformations in amorphous semiconductor clathrates Citation Details In-Document Search Title: Density driven structural transformations in amorphous semiconductor clathrates The pressure induced crystalline collapse at 14.7 GPa and polyamorphic structures of the semiconductor clathrate Sr8Ga16Ge30 are reported up to 35 GPa. In-situ total scattering measurements under pressure allow the direct microscopic inspection

  17. Laser Driven Dynamic Loading of Condensed Matter

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Laser Driven Dynamic Loading of Condensed Matter Laser Driven Dynamic Loading of Condensed Matter Advanced diagnostics of experiments covering many orders of magnitude in strain rate Contact Eric Loomis (505) 665-3196 Email Dynamic materials experiments over a wide range of strain rates are essential to studying constitutive relations (e.g., plasticity), damage (e.g., spall), equations of state, phase transitions and kinetics, and novel materials. The Trident laser facility supplies unique,

  18. Nanoparticle-Driven Assembly of Highly Conducting Hybrid Block Copolymer

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Electrolytes - Joint Center for Energy Storage Research January 13, 2015, Research Highlights Nanoparticle-Driven Assembly of Highly Conducting Hybrid Block Copolymer Electrolytes (Top) The addition of 2 wt% nanoparticles (SEO-LiTFSI-POSS-2) results in an increase in ionic conductivity. STEM images show the bicontinuous morphology of the electrolyte with 2 wt% of nanoparticles. (Bottom) The value of morphology factor, f, for SEO-LiTFSI-POSS-2 is close to unity, the value expected for an

  19. Data flow machine for data driven computing

    DOE Patents [OSTI]

    Davidson, George S.; Grafe, Victor G.

    1995-01-01

    A data flow computer which of computing is disclosed which utilizes a data driven processor node architecture. The apparatus in a preferred embodiment includes a plurality of First-In-First-Out (FIFO) registers, a plurality of related data flow memories, and a processor. The processor makes the necessary calculations and includes a control unit to generate signals to enable the appropriate FIFO register receiving the result. In a particular embodiment, there are three FIFO registers per node: an input FIFO register to receive input information form an outside source and provide it to the data flow memories; an output FIFO register to provide output information from the processor to an outside recipient; and an internal FIFO register to provide information from the processor back to the data flow memories. The data flow memories are comprised of four commonly addressed memories. A parameter memory holds the A and B parameters used in the calculations; an opcode memory holds the instruction; a target memory holds the output address; and a tag memory contains status bits for each parameter. One status bit indicates whether the corresponding parameter is in the parameter memory and one status but to indicate whether the stored information in the corresponding data parameter is to be reused. The tag memory outputs a "fire" signal (signal R VALID) when all of the necessary information has been stored in the data flow memories, and thus when the instruction is ready to be fired to the processor.

  20. Data flow machine for data driven computing

    DOE Patents [OSTI]

    Davidson, G.S.; Grafe, V.G.

    1988-07-22

    A data flow computer and method of computing is disclosed which utilizes a data driven processor node architecture. The apparatus in a preferred embodiment includes a plurality of First-In-First-Out (FIFO) registers, a plurality of related data flow memories, and a processor. The processor makes the necessary calculations and includes a control unit to generate signals to enable the appropriate FIFO register receiving the result. In a particular embodiment, there are three FIFO registers per node: an input FIFO register to receive input information from an outside source and provide it to the data flow memories; an output FIFO register to provide output information from the processor to an outside recipient; and an internal FIFO register to provide information from the processor back to the data flow memories. The data flow memories are comprised of four commonly addressed memories. A parameter memory holds the A and B parameters used in the calculations; an opcode memory holds the instruction; a target memory holds the output address; and a tag memory contains status bits for each parameter. One status bit indicates whether the corresponding parameter is in the parameter memory and one status bit to indicate whether the stored information in the corresponding data parameter is to be reused. The tag memory outputs a ''fire'' signal (signal R VALID) when all of the necessary information has been stored in the data flow memories, and thus when the instruction is ready to be fired to the processor. 11 figs.

  1. Data flow machine for data driven computing

    SciTech Connect (OSTI)

    Davidson, G.S.; Grafe, V.G.

    1995-11-07

    A data flow computer is disclosed which utilizes a data driven processor node architecture. The apparatus in a preferred embodiment includes a plurality of First-In-First-Out (FIFO) registers, a plurality of related data flow memories, and a processor. The processor makes the necessary calculations and includes a control unit to generate signals to enable the appropriate FIFO register receiving the result. In a particular embodiment, there are three FIFO registers per node: an input FIFO register to receive input information form an outside source and provide it to the data flow memories; an output FIFO register to provide output information from the processor to an outside recipient; and an internal FIFO register to provide information from the processor back to the data flow memories. The data flow memories are comprised of four commonly addressed memories. A parameter memory holds the A and B parameters used in the calculations; an opcode memory holds the instruction; a target memory holds the output address; and a tag memory contains status bits for each parameter. One status bit indicates whether the corresponding parameter is in the parameter memory and one status but to indicate whether the stored information in the corresponding data parameter is to be reused. The tag memory outputs a ``fire`` signal (signal R VALID) when all of the necessary information has been stored in the data flow memories, and thus when the instruction is ready to be fired to the processor. 11 figs.

  2. A DATA-DRIVEN MODEL FOR THE GLOBAL CORONAL EVOLUTION

    SciTech Connect (OSTI)

    Feng Xueshang; Jiang Chaowei; Xiang Changqing; Zhao Xuepu; Wu, S. T. E-mail: cwjiang@spaceweather.ac.cn E-mail: xpzhao@sun.stanford.edu

    2012-10-10

    This work is devoted to the construction of a data-driven model for the study of the dynamic evolution of the global corona that can respond continuously to the changing of the photospheric magnetic field. The data-driven model consists of a surface flux transport (SFT) model and a global three-dimensional (3D) magnetohydrodynamic (MHD) coronal model. The SFT model is employed to produce the global time-varying and self-consistent synchronic snapshots of the photospheric magnetic field as the input to drive our 3D numerical global coronal AMR-CESE-MHD model on an overset grid of Yin-Yang overlapping structure. The SFT model and the 3D global coronal model are coupled through the boundary condition of the projected characteristic method. Numerical results of the coronal evolution from 1996 September 4 to October 29 provide a good comparison with multiply observed coronal images.

  3. Density gradient effects on transverse shear driven lower hybrid waves

    SciTech Connect (OSTI)

    DuBois, Ami M.; Thomas, Edward; Amatucci, William E.; Ganguli, Gurudas

    2014-06-15

    Shear driven instabilities are commonly observed in the near-Earth space, particularly in boundary layer plasmas. When the shear scale length (L{sub E}) is much less than the ion gyro-radius (?{sub i}) but greater than the electron gyro-radius (?{sub e}), the electrons are magnetized in the shear layer, but the ions are effectively un-magnetized. The resulting shear driven instability, the electron-ion hybrid (EIH) instability, is investigated in a new interpenetrating plasma configuration in the Auburn Linear EXperiment for Instability Studies. In order to understand the dynamics of magnetospheric boundary layers, the EIH instability is studied in the presence of a density gradient located at the boundary layer between two plasmas. This paper reports on a recent experiment in which electrostatic lower hybrid waves are identified as the EIH instability, and the effect of a density gradient on the instability properties are investigated.

  4. Suppression of energetic particle driven instabilities with HHFW heating

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Fredrickson, E. D.; Taylor, G.; Bertelli, N.; Darrow, D. S.; Gorelenkov, N.; Kramer, G.; Liu, D.; Crocker, N. A.; Kubota, S.; White, R.

    2015-01-01

    In plasmas in the National Spherical Torus Experiment (NSTX) [Ono et al., Nucl. Fusion 40 (2000) 557] heated with neutral beams, the beam ions typically excite Energetic Particle Modes (EPMs or fishbones), and Toroidal, Global or Compressional Alfvén Eigenmodes (TAE, GAE, CAE). These modes can redistribute the energetic beam ions, altering the beam driven current profile and the plasma heating profile, or they may affect electron thermal transport or cause losses of the beam ions. In this paper we present experimental results where these instabilities, driven by the super-thermal beam ions, are suppressed with the application of High Harmonic Fastmore » Wave heating.« less

  5. Communicating Results

    Broader source: Energy.gov [DOE]

    Communicating Results: Provide exam results to participants, as well as information regarding any conditions that may require follow-up medical care with their personal physicians or specialists, and provide information regarding possible compensation for work-related illnesses.

  6. Energy Management for Motor-Driven Systems | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Management for Motor-Driven Systems Energy Management for Motor-Driven Systems This document assists in establishing an energy management plan, identifying energy savings opportunities, and designing a motor improvement plan. PDF icon Energy Management for Motor-Driven Systems (June 1997) More Documents & Publications Eliminate Voltage Unbalance Optimizing Your Motor-Driven System Continuous Energy Improvement in Motor Driven Systems - A Guidebook for Industry

  7. Gas engine driven chiller development and economics

    SciTech Connect (OSTI)

    Koplow, M.D.; Searight, E.F.; Panora, R.

    1986-03-01

    The TECOGEN Division of Thermo Electron Corporation has developed a nominal 150 ton engine driven chiller system under the sponsorship of the Gas Research Institute. The system incorporates an engine directly driving a screw compressor to produce about 130 tons of cooling capacity and a single effect absorption chiller driven by hot water recovered from engine heat to produce another 30 tons of cooling capacity. An economic analysis shows that it will be possible to recover the cost premium of engine driven chiller systems in most US cities in 3 years or less with the O and M savings of these systems when this cost premium is $30 per ton. 4 references, 13 figures, 5 tables.

  8. Fission fragment driven neutron source

    DOE Patents [OSTI]

    Miller, Lowell G.; Young, Robert C.; Brugger, Robert M.

    1976-01-01

    Fissionable uranium formed into a foil is bombarded with thermal neutrons in the presence of deuterium-tritium gas. The resulting fission fragments impart energy to accelerate deuterium and tritium particles which in turn provide approximately 14 MeV neutrons by the reactions t(d,n).sup.4 He and d(t,n).sup.4 He.

  9. United States Industrial Motor-Driven Systems Market Assessment: Charting a

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Roadmap to Energy Savings for Industry | Department of Energy Motor-Driven Systems Market Assessment: Charting a Roadmap to Energy Savings for Industry United States Industrial Motor-Driven Systems Market Assessment: Charting a Roadmap to Energy Savings for Industry This paper is an overview of the results of a market assessment commissioned by the DOE Motor Challenge program in 1995 to better understand the characteristics of the installed population of motor systems in the manufacturing

  10. Observation of Fine Structures in Laser-Driven Electron Beams Using

    Office of Scientific and Technical Information (OSTI)

    Coherent Transition Radiation (Journal Article) | SciTech Connect SciTech Connect Search Results Journal Article: Observation of Fine Structures in Laser-Driven Electron Beams Using Coherent Transition Radiation Citation Details In-Document Search Title: Observation of Fine Structures in Laser-Driven Electron Beams Using Coherent Transition Radiation We have measured the coherent optical transition radiation emitted by an electron beam from laser-plasma interaction. The measurement of the

  11. A hybrid Rayleigh-Taylor-current-driven coupled instability in a

    Office of Scientific and Technical Information (OSTI)

    magnetohydrodynamically collimated cylindrical plasma with lateral gravity (Journal Article) | SciTech Connect SciTech Connect Search Results Journal Article: A hybrid Rayleigh-Taylor-current-driven coupled instability in a magnetohydrodynamically collimated cylindrical plasma with lateral gravity Citation Details In-Document Search This content will become publicly available on March 22, 2017 Title: A hybrid Rayleigh-Taylor-current-driven coupled instability in a magnetohydrodynamically

  12. Explosively driven air blast in a conical shock tube

    SciTech Connect (OSTI)

    Stewart, Joel B. Pecora, Collin

    2015-03-15

    Explosively driven shock tubes present challenges in terms of safety concerns and expensive upkeep of test facilities but provide more realistic approximations to the air blast resulting from free-field detonations than those provided by gas-driven shock tubes. Likewise, the geometry of conical shock tubes can naturally approximate a sector cut from a spherically symmetric blast, leading to a better agreement with the blast profiles of free-field detonations when compared to those provided by shock tubes employing constant cross sections. The work presented in this article documents the design, fabrication, and testing of an explosively driven conical shock tube whose goal was to closely replicate the blast profile seen from a larger, free-field detonation. By constraining the blast through a finite area, large blasts (which can add significant damage and safety constraints) can be simulated using smaller explosive charges. The experimental data presented herein show that a close approximation to the free-field air blast profile due to a 1.5 lb charge of C4 at 76 in. can be achieved by using a 0.032 lb charge in a 76-in.-long conical shock tube (which translates to an amplification factor of nearly 50). Modeling and simulation tools were used extensively in designing this shock tube to minimize expensive fabrication costs.

  13. Laser driven hydrodynamic instability experiments

    SciTech Connect (OSTI)

    Remington, B.A.; Weber, S.V.; Haan, S.W.; Kilkenny, J.D.; Glendinning, S.G.; Wallace, R.J.; Goldstein, W.H.; Wilson, B.G.; Nash, J.K.

    1992-12-07

    We have conducted an extensive series of experiments on the Nova laser to measure hydrodynamic instabilities in planar foils accelerated by x-ray ablation. Single mode experiments allow a measurement of the fundamental growth rates from the linear well into the nonlinear regime; multimode foils allow an assessment of the degree of mode coupling; and surface-finish experiments allow a measurement of the evolution of a broad spectrum of random initial modes. Experimental results and comparisons with theory and simulations are presented.

  14. Microwave-driven ultraviolet light sources

    DOE Patents [OSTI]

    Manos, Dennis M.; Diggs, Jessie; Ametepe, Joseph D.

    2002-01-29

    A microwave-driven ultraviolet (UV) light source is provided. The light source comprises an over-moded microwave cavity having at least one discharge bulb disposed within the microwave cavity. At least one magnetron probe is coupled directly to the microwave cavity.

  15. Light modulated electron beam driven radiofrequency emitter

    DOE Patents [OSTI]

    Wilson, M.T.; Tallerico, P.J.

    1979-10-10

    The disclosure relates to a light modulated electron beam-driven radiofrequency emitter. Pulses of light impinge on a photoemissive device which generates an electron beam having the pulse characteristics of the light. The electron beam is accelerated through a radiofrequency resonator which produces radiofrequency emission in accordance with the electron, hence, the light pulses.

  16. Explosive Results

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Explosive National Security Science Latest Issue:April 2016 past issues All Issues » submit Explosive Results Scientists at Los Alamos are solving national security challenges, from the threat of toothpaste-tube bombs on airliners to ensuring the safety of our nuclear stockpile. April 1, 2016 Explosive Results To test whether a travel-toothpaste-tube-sized bomb could bring down an airliner, Los Alamos scientists tried to blow a hole through half-inch-thick aircraft-grade aluminum using an

  17. Instabilities driven by ion drag

    SciTech Connect (OSTI)

    Goree, J.; Samsonov, D.

    1998-10-21

    When ions stream past a charged dust particle, their trajectories are deflected, resulting in the ion drag force, F{sub i}. This force scales as the square of the particle charge, and therefore as the square of the particle diameter, in contrast to the Coulomb force QE which scales linearly with particle diameter. When the particle has a negative charge, the two forces point in opposite directions. The net force, which is the sum of these two forces, will then reverse direction at a critical particle size. In a series of experiments, it is shown that this effect leads to an instability. Particles are grown in an rf sputtering plasma, so that their diameter and therefore charge increase with time. The dust cloud is confined by the electrostatic force QE, due to global electric fields in the discharge. As the charge grows, the confinement equilibrium abruptly becomes unstable to very-low-frequency modes, in which the dust number density is modulated. The instability begins as the 'filamentary mode,' and then develops into a 'great void,' which is a centimeter-size region free of dust particles. Because the plasma is a gas discharge with electron-impact ionization, this void is able to persist, due to a flow of ions originating in the center of the void, where there is a higher electron density due to the absence of electron depletion on dust.

  18. Simulation of E-Cloud Driven Instability And Its Attenuation...

    Office of Scientific and Technical Information (OSTI)

    Simulation of E-Cloud Driven Instability And Its Attenuation Using a Feedback System in the CERN SPS Citation Details In-Document Search Title: Simulation of E-Cloud Driven ...

  19. Simulation of E-Cloud Driven Instability And Its Attenuation...

    Office of Scientific and Technical Information (OSTI)

    of E-Cloud Driven Instability And Its Attenuation Using a Feedback System in the CERN SPS Citation Details In-Document Search Title: Simulation of E-Cloud Driven Instability...

  20. Interaction Driven Subgap Spin Exciton in the Kondo Insulator...

    Office of Scientific and Technical Information (OSTI)

    Interaction Driven Subgap Spin Exciton in the Kondo Insulator SmB 6 Title: Interaction Driven Subgap Spin Exciton in the Kondo Insulator SmB 6 Authors: Fuhrman, W. T. ; Leiner, J. ...

  1. Solvable model of a strongly driven micromaser

    SciTech Connect (OSTI)

    Lougovski, P.; Walther, H.; Casagrande, F.; Lulli, A.; Englert, B.-G.; Solano, E.

    2004-02-01

    We study the dynamics of a micromaser where the pumping atoms are strongly driven by a resonant classical field during their transit through the cavity mode. We derive a master equation for this strongly driven micromaser, involving the contributions of the unitary atom-field interactions and the dissipative effects of a thermal bath. We find analytical solutions for the temporal evolution and the steady state of this system by means of phase-space techniques, providing an unusual solvable model of an open quantum system, including pumping and decoherence. We derive closed expressions for all relevant expectation values, describing the statistics of the cavity field and the detected atomic levels. The transient regime shows the buildup of mixtures of mesoscopic fields evolving towards a super-Poissonian steady-state field that, nevertheless, yields atomic correlations that exhibit stronger nonclassical features than the conventional micromaser.

  2. A signature for turbulence driven magnetic islands

    SciTech Connect (OSTI)

    Agullo, O.; Muraglia, M.; Benkadda, S.; Poyé, A.; Yagi, M.; Garbet, X.; Sen, A.

    2014-09-15

    We investigate the properties of magnetic islands arising from tearing instabilities that are driven by an interchange turbulence. We find that such islands possess a specific signature that permits an identification of their origin. We demonstrate that the persistence of a small scale turbulence maintains a mean pressure profile, whose characteristics makes it possible to discriminate between turbulence driven islands from those arising due to an unfavourable plasma current density gradient. We also find that the island poloidal turnover time, in the steady state, is independent of the levels of the interchange and tearing energy sources. Finally, we show that a mixing length approach is adequate to make theoretical predictions concerning island flattening in the island rotation frame.

  3. Optimizing Your Motor-Driven System | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Your Motor-Driven System Optimizing Your Motor-Driven System This fact sheet presents an overview of electric drive systems and highlights common ways you can improve motor system efficiency and reliability. By optimizing the efficiency of your motor-driven systems, you can increase productivity while saving significant amounts of energy and money. PDF icon Optimizing Your Motor Driven System (September 1996) More Documents & Publications When to Purchase Premium Efficiency Motors Energy

  4. Electrically Driven Technologies for Radioactive Aerosol Abatement

    SciTech Connect (OSTI)

    David W. DePaoli; Ofodike A. Ezekoye; Costas Tsouris; Valmor F. de Almeida

    2003-01-28

    The purpose of this research project was to develop an improved understanding of how electriexecy driven processes, including electrocoalescence, acoustic agglomeration, and electric filtration, may be employed to efficiently treat problems caused by the formation of aerosols during DOE waste treatment operations. The production of aerosols during treatment and retrieval operations in radioactive waste tanks and during thermal treatment operations such as calcination presents a significant problem of cost, worker exposure, potential for release, and increased waste volume.

  5. Chaos control of parametric driven Duffing oscillators

    SciTech Connect (OSTI)

    Jin, Leisheng; Mei, Jie; Li, Lijie, E-mail: L.Li@swansea.ac.uk [College of Engineering, Swansea University, Swansea SA2 8PP (United Kingdom)

    2014-03-31

    Duffing resonators are typical dynamic systems, which can exhibit chaotic oscillations, subject to certain driving conditions. Chaotic oscillations of resonating systems with negative and positive spring constants are identified to investigate in this paper. Parametric driver imposed on these two systems affects nonlinear behaviours, which has been theoretically analyzed with regard to variation of driving parameters (frequency, amplitude). Systematic calculations have been performed for these two systems driven by parametric pumps to unveil the controllability of chaos.

  6. Wave-driven Countercurrent Plasma Centrifuge

    SciTech Connect (OSTI)

    A.J. Fetterman and N.J. Fisch

    2009-03-20

    A method for driving rotation and a countercurrent flow in a fully ionized plasma centrifuge is described. The rotation is produced by radiofrequency waves near the cyclotron resonance. The wave energy is transferred into potential energy in a manner similar to the ? channeling effect. The countercurrent flow may also be driven by radiofrequency waves. By driving both the rotation and the flow pattern using waves instead of electrodes, physical and engineering issues may be avoided.

  7. Current-Driven Filament Instabilities in Relativistic Plasmas. Final report

    SciTech Connect (OSTI)

    Chuang Ren

    2013-02-13

    This grant has supported a study of some fundamental problems in current- and flow-driven instabilities in plasmas and their applications in inertial confinement fusion (ICF) and astrophysics. It addressed current-driven instabilities and their roles in fast ignition, and flow-driven instabilities and their applications in astrophysics.

  8. Design of Stirling-driven vapor-compression system

    SciTech Connect (OSTI)

    Kagawa, N.

    1998-07-01

    Stirling engines have many unique advantages including higher thermal efficiencies, preferable exhaust gas characteristics, multi-fuel usage, and low noise and vibration. On the other hand, heat pump systems are very attractive for space heating and cooling and industrial usage because of their potential to save energy. Especially, there are many environmental merits of Stirling-driven vapor-compression (SDVC) systems. This paper introduces a design method for the SDVC based on reliable mathematical methods for Stirling and Rankine cycles with reliable thermophysical information for refrigerants. The model treats a kinematic Stirling engine and a scroll compressor coupled by a belt. Some experimental coefficients are used to formulate the SDVC items. The obtained results show the performance behavior of the SDVC in detail. The measured performance of the actual system agrees with the calculated results. Furthermore, the calculated results indicate attractive SDVC performance using alternative refrigerants.

  9. Advanced motor driven clamped borehole seismic receiver

    DOE Patents [OSTI]

    Engler, Bruce P.; Sleefe, Gerard E.; Striker, Richard P.

    1993-01-01

    A borehole seismic tool including a borehole clamp which only moves perpendicular to the borehole. The clamp is driven by an electric motor, via a right angle drive. When used as a seismic receiver, the tool has a three part housing, two of which are hermetically sealed. Accelerometers or geophones are mounted in one hermetically sealed part, the electric meter in the other hermetically sealed part, and the clamp and right angle drive in the third part. Preferably the tool includes cable connectors at both ends. Optionally a shear plate can be added to the clamp to extend the range of the tool.

  10. Advanced motor driven clamped borehole seismic receiver

    DOE Patents [OSTI]

    Engler, B.P.; Sleefe, G.E.; Striker, R.P.

    1993-02-23

    A borehole seismic tool is described including a borehole clamp which only moves perpendicular to the borehole. The clamp is driven by an electric motor, via a right angle drive. When used as a seismic receiver, the tool has a three part housing, two of which are hermetically sealed. Accelerometers or geophones are mounted in one hermetically sealed part, the electric motor in the other hermetically sealed part, and the clamp and right angle drive in the third part. Preferably the tool includes cable connectors at both ends. Optionally a shear plate can be added to the clamp to extend the range of the tool.

  11. Energy-beam-driven rapid fabrication system

    DOE Patents [OSTI]

    Keicher, David M.; Atwood, Clinton L.; Greene, Donald L.; Griffith, Michelle L.; Harwell, Lane D.; Jeantette, Francisco P.; Romero, Joseph A.; Schanwald, Lee P.; Schmale, David T.

    2002-01-01

    An energy beam driven rapid fabrication system, in which an energy beam strikes a growth surface to form a molten puddle thereon. Feed powder is then injected into the molten puddle from a converging flow of feed powder. A portion of the feed powder becomes incorporated into the molten puddle, forcing some of the puddle contents to freeze on the growth surface, thereby adding an additional layer of material. By scanning the energy beam and the converging flow of feed powder across the growth surface, complex three-dimensional shapes can be formed, ready or nearly ready for use. Nearly any class of material can be fabricated using this system.

  12. Fiber optic mounted laser driven flyer plates

    DOE Patents [OSTI]

    Paisley, Dennis L. (Santa Fe, NM)

    1991-01-01

    A laser driven flyer plate where the flyer plate is deposited directly onto the squared end of an optical fiber. The plasma generated by a laser pulse drives the flyer plate toward a target. In another embodiment, a first metal layer is deposited onto the squared end of an optical fiber, followed by a layer of a dielectric material and a second metal layer. The laser pulse generates a plasma in the first metal layer, but the plasma is kept away from the second metal layer by the dielectric layer until the pressure reaches the point where shearing occurs.

  13. Accelerator driven sub-critical core

    DOE Patents [OSTI]

    McIntyre, Peter M; Sattarov, Akhdiyor

    2015-03-17

    Systems and methods for operating an accelerator driven sub-critical core. In one embodiment, a fission power generator includes a sub-critical core and a plurality of proton beam generators. Each of the proton beam generators is configured to concurrently provide a proton beam into a different area of the sub-critical core. Each proton beam scatters neutrons within the sub-critical core. The plurality of proton beam generators provides aggregate power to the sub-critical core, via the proton beams, to scatter neutrons sufficient to initiate fission in the sub-critical core.

  14. Fiber optic mounted laser driven flyer plates

    SciTech Connect (OSTI)

    Paisley, D.L.

    1990-12-31

    This invention is comprised of a laser driven flyer plate where the flyer plate is deposited directly onto the squared end of an optical fiber. The plasma generated by a laser pulse drives the flyer plate toward a target. In another embodiment, a first metal layer is deposited onto the squared end of an optical fiber, followed by a layer of a dielectric material and a second metal layer. The laser pulse generates a plasma in the first metal layer, but the plasma is kept away from the second metal layer by the dielectric layer until the pressure reaches the point where shearing occurs. 2 figs.

  15. Fiber optic mounted laser driven flyer plates

    SciTech Connect (OSTI)

    Paisley, D.L.

    1991-07-09

    A laser driven flyer plate is described where the flyer plate is deposited directly onto the squared end of an optical fiber. The plasma generated by a laser pulse drives the flyer plate toward a target. In another embodiment, a first metal layer is deposited onto the squared end of an optical fiber, followed by a layer of a dielectric material and a second metal layer. The laser pulse generates a plasma in the first metal layer, but the plasma is kept away from the second metal layer by the dielectric layer until the pressure reaches the point where shearing occurs.

  16. Fiber optic mounted laser driven flyer plates

    SciTech Connect (OSTI)

    Paisley, D.L.

    1990-01-01

    This invention is comprised of a laser driven flyer plate where the flyer plate is deposited directly onto the squared end of an optical fiber. The plasma generated by a laser pulse drives the flyer plate toward a target. In another embodiment, a first metal layer is deposited onto the squared end of an optical fiber, followed by a layer of a dielectric material and a second metal layer. The laser pulse generates a plasma in the first metal layer, but the plasma is kept away from the second metal layer by the dielectric layer until the pressure reaches the point where shearing occurs. 2 figs.

  17. Flux-driven simulations of turbulence collapse

    SciTech Connect (OSTI)

    Park, G. Y.; Kim, S. S.; Jhang, Hogun; Rhee, T.; Diamond, P. H.; Xu, X. Q.

    2015-03-15

    Using three-dimensional nonlinear simulations of tokamak turbulence, we show that an edge transport barrier (ETB) forms naturally once input power exceeds a threshold value. Profiles, turbulence-driven flows, and neoclassical coefficients are evolved self-consistently. A slow power ramp-up simulation shows that ETB transition is triggered by the turbulence-driven flows via an intermediate phase which involves coherent oscillation of turbulence intensity and E×B flow shear. A novel observation of the evolution is that the turbulence collapses and the ETB transition begins when R{sub T} > 1 at t = t{sub R} (R{sub T}: normalized Reynolds power), while the conventional transition criterion (ω{sub E×B}>γ{sub lin} where ω{sub E×B} denotes mean flow shear) is satisfied only after t = t{sub C} ( >t{sub R}), when the mean flow shear grows due to positive feedback.

  18. Numerical investigation on target implosions driven by radiation ablation and shock compression in dynamic hohlraums

    SciTech Connect (OSTI)

    Xiao, Delong; Sun, Shunkai; Zhao, Yingkui; Ding, Ning; Wu, Jiming; Dai, Zihuan; Yin, Li; Zhang, Yang; Xue, Chuang

    2015-05-15

    In a dynamic hohlraum driven inertial confinement fusion (ICF) configuration, the target may experience two different kinds of implosions. One is driven by hohlraum radiation ablation, which is approximately symmetric at the equator and poles. The second is caused by the radiating shock produced in Z-pinch dynamic hohlraums, only taking place at the equator. To gain a symmetrical target implosion driven by radiation ablation and avoid asymmetric shock compression is a crucial issue in driving ICF using dynamic hohlraums. It is known that when the target is heated by hohlraum radiation, the ablated plasma will expand outward. The pressure in the shocked converter plasma qualitatively varies linearly with the material temperature. However, the ablation pressure in the ablated plasma varies with 3.5 power of the hohlraum radiation temperature. Therefore, as the hohlraum temperature increases, the ablation pressure will eventually exceed the shock pressure, and the expansion of the ablated plasma will obviously weaken the shock propagation and decrease its velocity after propagating into the ablator plasma. Consequently, longer time duration is provided for the symmetrical target implosion driven by radiation ablation. In this paper these processes are numerically investigated by changing drive currents or varying load parameters. The simulation results show that a critical hohlraum radiation temperature is needed to provide a high enough ablation pressure to decelerate the shock, thus providing long enough time duration for the symmetric fuel compression driven by radiation ablation.

  19. Generating a fractal butterfly Floquet spectrum in a class of driven SU(2) systems

    SciTech Connect (OSTI)

    Wang Jiao [Department of Physics and Institute of Theoretical Physics and Astrophysics, Xiamen University, Xiamen 361005 (China); Temasek Laboratories, National University of Singapore, Singapore 117542 (Singapore); Gong Jiangbin [Department of Physics and Center of Computational Science and Engineering, National University of Singapore, Singapore 117542 (Singapore); NUS Graduate School for Integrative Sciences and Engineering, Singapore 117597 (Singapore)

    2010-02-15

    A scheme for generating a fractal butterfly Floquet spectrum, first proposed by Wang and Gong [Phys. Rev. A 77, 031405(R) (2008)], is extended to driven SU(2) systems such as a driven two-mode Bose-Einstein condensate. A class of driven systems without a link with the Harper-model context is shown to have an intriguing butterfly Floquet spectrum. The found butterfly spectrum shows remarkable deviations from the known Hofstadter's butterfly. In addition, the level crossings between Floquet states of the same parity and between Floquet states of different parities are studied and highlighted. The results are relevant to studies of fractal statistics, quantum chaos, and coherent destruction of tunneling, as well as the validity of mean-field descriptions of Bose-Einstein condensates.

  20. Track C - Market-Driven Research Solutions | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    C - Market-Driven Research Solutions Track C - Market-Driven Research Solutions Presentations from Track C, Market-Driven Research Solutions of the U.S. Department of Energy Building America program's 2012 Residential Energy Efficiency Stakeholder Meeting are provided below as Adobe Acrobat PDFs. These presentations for this track covered the following topics: Outreach Initiatives; Case Studies; Technical Approach to Home Energy Management; Valuing Energy Efficiency; Software Accuracy Issues in

  1. Molten salt considerations for accelerator-driven subcritical fission to

    Office of Scientific and Technical Information (OSTI)

    close the nuclear fuel cycle (Journal Article) | SciTech Connect Molten salt considerations for accelerator-driven subcritical fission to close the nuclear fuel cycle Citation Details In-Document Search Title: Molten salt considerations for accelerator-driven subcritical fission to close the nuclear fuel cycle The host salt selection, molecular modeling, physical chemistry, and processing chemistry are presented here for an accelerator-driven subcritical fission in a molten salt core

  2. Experimental evidence of space charge driven resonances in high...

    Office of Scientific and Technical Information (OSTI)

    Experimental evidence of space charge driven resonances in high intensity linear accelerators Citation Details In-Document Search Title: Experimental evidence of space charge ...

  3. CESC-Webinar: Building an Innovation and Entrepreneurship Driven...

    Open Energy Info (EERE)

    Innovation and Entrepreneurship Driven Economy: How Policies Can Foster Risk Capital Investment in Renewable Energy Jump to: navigation, search Tool Summary LAUNCH TOOL Name:...

  4. Energy Department Launches New Data-Driven Initiative to Help...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    The open source software application fills a major market need for data-driven energy efficiency program design and implementation, allowing cities and states to combine, manage, ...

  5. Molten salt considerations for accelerator-driven subcritical...

    Office of Scientific and Technical Information (OSTI)

    to close the nuclear fuel cycle Citation Details In-Document Search Title: Molten salt considerations for accelerator-driven subcritical fission to close the nuclear fuel cycle ...

  6. Network-Driven Demand Side Management Website | Open Energy Informatio...

    Open Energy Info (EERE)

    URI: cleanenergysolutions.orgcontentnetwork-driven-demand-side-management Language: English Policies: "Deployment Programs,Regulations" is not in the list of possible...

  7. Community-Driven Development Decision Tools for Rural Development...

    Open Energy Info (EERE)

    (CDD) investment programmes as a way to further enabling rural poor people to overcome poverty in WCA." References "Community-Driven Development Decision Tools" Retrieved from...

  8. Characterization of Heat-Wave Propagation through Laser-Driven...

    Office of Scientific and Technical Information (OSTI)

    Characterization of Heat-Wave Propagation through Laser-Driven Ti-Doped Underdense Plasma Citation Details In-Document Search Title: Characterization of Heat-Wave Propagation...

  9. Save Energy Now in Your Motor-Driven Systems

    SciTech Connect (OSTI)

    2006-01-01

    This DOE Industrial Technologies Program fact sheet describes how manufacturing plants can save energy and money by making energy efficiency improvements to their industrial motor-driven systems.

  10. Ion temperature gradient driven turbulence with strong trapped...

    Office of Scientific and Technical Information (OSTI)

    driven turbulence with strong trapped ion resonance is presented. The role of trapped ion granulations, clusters of trapped ions correlated by precession resonance, is the focus. ...

  11. Continuous Energy Improvement in Motor Driven Systems - A Guidebook...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    More Documents & Publications Energy Management for Motor-Driven Systems Premium Efficiency Motor Selection and Application Guide - A Handbook for Industry MotorMaster+ User Manual

  12. Betatron Radiation from a Beam Driven Plasma Source Litos, M...

    Office of Scientific and Technical Information (OSTI)

    Betatron Radiation from a Beam Driven Plasma Source Litos, M.; Corde, S.; SLAC 43 PARTICLE ACCELERATORS; ACCELERATION; ACCELERATORS; BETATRON OSCILLATIONS; BETATRONS;...

  13. Active Interrogation of Sensitive Nuclear Material Using Laser Driven Neutron Beams

    SciTech Connect (OSTI)

    Favalli, Andrea; Roth, Markus

    2015-05-01

    An investigation of the viability of a laser-driven neutron source for active interrogation is reported. The need is for a fast, movable, operationally safe neutron source which is energy tunable and has high-intensity, directional neutron production. Reasons for the choice of neutrons and lasers are set forth. Results from the interrogation of an enriched U sample are shown.

  14. EMSP Final Report: Electrically Driven Technologies for Radioactive Aerosol Abatement

    SciTech Connect (OSTI)

    DePaoli, D.W.

    2003-01-22

    The purpose of this research project was to develop an improved understanding of how electrically driven processes, including electrocoalescence, acoustic agglomeration, and electric filtration, may be employed to efficiently treat problems caused by the formation of aerosols during DOE waste treatment operations. The production of aerosols during treatment and retrieval operations in radioactive waste tanks and during thermal treatment operations such as calcination presents a significant problem of cost, worker exposure, potential for release, and increased waste volume. There was anecdotal evidence in the literature that acoustic agglomeration and electrical coalescence could be used together to change the size distribution of aerosol particles in such a way as to promote easier filtration and less frequent maintenance of filtration systems. As such, those electrically driven technologies could potentially be used as remote technologies for improved treatment; however, existing theoretical models are not suitable for prediction and design. To investigate the physics of such systems, and also to prototype a system for such processes, a collaborative project was undertaken between Oak Ridge National Laboratory (ORNL) and the University of Texas at Austin (UT). ORNL was responsible for the larger-scale prototyping portion of the project, while UT was primarily responsible for the detailed physics in smaller scale unit reactors. It was found that both electrical coalescence and acoustic agglomeration do in fact increase the rate of aggregation of aerosols. Electrical coalescence requires significantly less input power than acoustic agglomeration, but it is much less effective in its ability to aggregate/coalesce aerosols. The larger-scale prototype showed qualitatively similar results as the unit reactor tests, but presented more difficulty in interpretation of the results because of the complex multi-physics coupling that necessarily occur in all larger-scale system tests. An additional finding from this work is that low-amplitude oscillation may provide an alternative, non-invasive, non-contact means of controlling settling and/or suspension of solids. Further investigation would be necessary to evaluate its utility for radioactive waste treatment applications. This project did not uncover a new technology for radioactive waste treatment. While it may be possible that an efficient electrically driven technology for aerosol treatment could be developed, it appears that other technologies, such as steel and ceramic HEPA filters, can suitably solve this problem. If further studies are to be undertaken, additional fundamental experimentation and modeling is necessary to fully capture the physics; in addition, larger-scale tests are needed to demonstrate the treatment of flowing gas streams through the coupling of acoustic agglomeration with electrocoalescence.

  15. IEMDC - In-Line Electric Motor Driven Compressor

    SciTech Connect (OSTI)

    Michael J. Crowley

    2004-03-31

    This report covers the fifth quarter (01/01/04 to 03/31/04) of the In-Line Electric Motor Driven Compressor (IEMDC) project. Design efforts on the IEMDC continued with compressor efforts focused on performing aerodynamic analyses. These analyses were conducted using computational fluid dynamics. Compressor efforts also entailed developing mechanical designs of components through the use of solid models and working on project deliverables. Electric motor efforts focused on the design of the magnetic bearing system, motor pressure housing, and the motor-compressor interface. The mechanical evaluation of the main interface from both the perspective of the compressor manufacturer and electric motor manufacturer indicates that an acceptable design has been achieved. All mechanical and aerodynamic design efforts have resulted in considerable progress being made towards the completion of the compressor and electric motor design and towards the successful completion of the IEMDC unit.

  16. Final Environmental Assessment for the Proposed Consolidation of Certain Dynamic Experimentation Activities at the Two-Mile Mesa Complex Los Alamos National Laboratory, Los Alamos, New Mexico

    SciTech Connect (OSTI)

    N /A

    2003-11-03

    The National Environmental Policy Act of 1969 (NEPA) requires Federal agency officials to consider the environmental consequences of their proposed actions before decisions are made. In complying with NEPA, the United States (U.S.) Department of Energy (DOE), National Nuclear Security Administration (NNSA), follows the Council on Environmental Quality regulations (40 CFR 1500-1508) and DOE's NEPA implementing procedures (10 CFR 1021). The purpose of an environmental assessment (EA) is to provide Federal decision makers with sufficient evidence and analysis to determine whether to prepare an environmental impact statement (EIS) or issue a Finding of No Significant Impact. Los Alamos National Laboratory (LANL) is a national security laboratory located at Los Alamos, New Mexico, that comprises about 40 square miles (mi{sup 2}) (103.6 square kilometers [km{sup 2}]) of buildings, structures, and forested land (Figure 1). It is administered by NNSA for the Federal government and is managed and operated under contract by the University of California (UC). The NNSA must make a decision whether to consolidate and construct new facilities for the Dynamic Experimentation Division (DX) to create a central core area of facilities, including offices, laboratories, and other support structures, at LANL's Two-Mile Mesa Complex, which comprises portions of Technical Area (TA) 6, TA-22, and TA-40. This Proposed Action would involve constructing new buildings; consolidating existing operations and offices; enhancing utilities, roads, and security infrastructure; and demolishing or removing older buildings, structures, and transportables at various technical areas used by DX (Figure 2). This EA has been prepared to assess the potential environmental consequences of this proposed construction, operational consolidation, and demolition project. The objectives of this EA are to (1) describe the underlying purpose and need for NNSA action; (2) describe the Proposed Action and identify and describe any reasonable alternatives that satisfy the purpose and need for agency action; (3) describe baseline environmental conditions at LANL; (4) analyze the potential indirect, direct, and cumulative effects to the existing environment from implementation of the Proposed Action, and (5) compare the effects of the Proposed Action with the No Action Alternative and other reasonable alternatives. For the purposes of compliance with NEPA, reasonable alternatives are identified as being those that meet NNSA's purpose and need for action by virtue of timeliness, appropriate technology, and applicability to LANL. The EA process provides NNSA with environmental information that can be used in developing mitigative actions, if necessary, to minimize or avoid adverse effects to the quality of the human environment and natural ecosystems should NNSA decide to proceed with implementing the Proposed Action at LANL. Ultimately, the goal of NEPA, and this EA, is to aid NNSA officials in making decisions based on an understanding of environmental consequences and in taking actions that protect, restore, and enhance the environment.

  17. A colalborative environment for information driven safeguards

    SciTech Connect (OSTI)

    Scott, Mark R; Michel, Kelly D

    2010-09-15

    For two decades, the IAEA has recognized the need for a comprehensive and strongly integrated Knowledge Management system to support its Information Driven Safeguards activities. In the past, plans for the development of such a system have progressed slowly due to concerns over costs and feasibility. In recent years, Los Alamos National Laboratory has developed a knowledge management system that could serve as the basis for an IAEA Collaborative Environment (ICE). The ICE derivative knowledge management system described in this paper addresses the challenge of living in an era of information overload coupled with certain knowledge shortfalls. The paper describes and defines a system that is flexible, yet ensures coordinated and focused collaboration, broad data evaluation capabilities, architected and organized work flows, and improved communications. The paper and demonstration of ICE will utilize a hypothetical scenario to highlight the functional features that facilitate collaboration amongst and between information analysts and inspectors. The scenario will place these two groups into a simulated planning exercise for a safeguards inspection drawing upon past data acquisitions, inspection reports, analyst conclusions, and a coordinated walk-through of a 3-D model of the facility. Subsequent to the conduct of the simulated facility inspection, the detection of an anomaly and pursuit of follow up activities will illustrate the event notification, information sharing, and collaborative capabilities of the system. The use of a collaborative environment such as ICE to fulfill the complicated knowledge management demands of the Agency and facilitate the completion of annual State Evaluation Reports will also be addressed.

  18. Accelerator Driven Nuclear Energy: The Thorium Option

    ScienceCinema (OSTI)

    Raja, Rajendran

    2010-01-08

    Conventional nuclear reactors use enriched Uranium as fuel and produce nuclear waste which needs to be stored away for over 10,000 years.   At the current rate of use, existing sources of Uranium will last for 50-100 years.  We describe a solution to the problem that uses particle accelerators to produce fast neutrons that can be used to burn existing nuclear waste and produce energy.  Such systems, initially proposed by Carlo Rubbia and collaborators in the 1990's, are being seriously considered by many countries as a possible solution to the green energy problem.  Accelerator driven reactors operate in a sub-critical regime and, thus, are safer and can obtain energy from plentiful elements such as Thorium-232 and Uranium-238. What is missing is the high intensity (10MW) accelerator that produces 1 GeV protons. We will describe scenarios which if implemented will make such systems a reality.  

  19. Target buffer assessment for accelerator driven transmuters.

    SciTech Connect (OSTI)

    Gohar, Y.

    2002-10-08

    Accelerator driven transmuters use a buffer region to protect the structural and the cladding materials of the transmuter from the radiation damage caused by the high-energy spallation neutrons, to accommodate the coolant channels of the self cooled targets, and to have an insignificant effect on the neutron utilization for the transmutation process. These functions are contradicting with respect to the buffer thickness. An extension of the target region in the axial direction (the proton beam direction) is also required to act as a neutron multiplier for the forward component of the high-energy spallation neutrons and a reflector to minimize the neutron leakage. The buffer assessment was performed as a function of its thickness with different proton energies for a self-cooled Lead-Bismuth Eutectic and a sodium-cooled tungsten targets. The analyses show that the number of generated neutrons per proton has a low sensitivity to the buffer thickness. However, the number of neutrons reaching the transmuter is significantly reduced as the buffer thickness is increased. The transmuter neutrons dominate the nuclear responses in the structural material outside the target buffer. The length of the axial target extension is determined as a function of the proton beam energy.

  20. Accelerator Driven Nuclear Energy: The Thorium Option

    SciTech Connect (OSTI)

    Raja, Rajendran

    2009-03-18

    Conventional nuclear reactors use enriched Uranium as fuel and produce nuclear waste which needs to be stored away for over 10,000 years.   At the current rate of use, existing sources of Uranium will last for 50-100 years.  We describe a solution to the problem that uses particle accelerators to produce fast neutrons that can be used to burn existing nuclear waste and produce energy.  Such systems, initially proposed by Carlo Rubbia and collaborators in the 1990's, are being seriously considered by many countries as a possible solution to the green energy problem.  Accelerator driven reactors operate in a sub-critical regime and, thus, are safer and can obtain energy from plentiful elements such as Thorium-232 and Uranium-238. What is missing is the high intensity (10MW) accelerator that produces 1 GeV protons. We will describe scenarios which if implemented will make such systems a reality.  

  1. Query-Driven Visualization and Analysis

    SciTech Connect (OSTI)

    Ruebel, Oliver; Bethel, E. Wes; Prabhat, Mr.; Wu, Kesheng

    2012-11-01

    This report focuses on an approach to high performance visualization and analysis, termed query-driven visualization and analysis (QDV). QDV aims to reduce the amount of data that needs to be processed by the visualization, analysis, and rendering pipelines. The goal of the data reduction process is to separate out data that is "scientifically interesting'' and to focus visualization, analysis, and rendering on that interesting subset. The premise is that for any given visualization or analysis task, the data subset of interest is much smaller than the larger, complete data set. This strategy---extracting smaller data subsets of interest and focusing of the visualization processing on these subsets---is complementary to the approach of increasing the capacity of the visualization, analysis, and rendering pipelines through parallelism. This report discusses the fundamental concepts in QDV, their relationship to different stages in the visualization and analysis pipelines, and presents QDV's application to problems in diverse areas, ranging from forensic cybersecurity to high energy physics.

  2. Finite Element Results Visualization for Unstructured Grids

    Energy Science and Technology Software Center (OSTI)

    1996-07-15

    GRIZ is a general-purpose post-processing application supporting interactive visualization of finite element analysis results on unstructured grids. In addition to basic pseudocolor renderings of state variables over the mesh surface, GRIZ provides modern visualization techniques such as isocontours and isosurfaces, cutting planes, vector field display, and particle traces. GRIZ accepts both command-line and mouse-driven input, and is portable to virtually any UNIX platform which provides Motif and OpenGl libraries.

  3. THE MORPHOLOGY AND DYNAMICS OF JET-DRIVEN SUPERNOVA REMNANTS: THE CASE OF W49B

    SciTech Connect (OSTI)

    Gonzlez-Casanova, Diego F.; De Colle, Fabio; Ramirez-Ruiz, Enrico; Lopez, Laura A.

    2014-02-01

    The circumstellar medium (CSM) of a massive star is modified by its winds before a supernova (SN) explosion occurs, and thus the evolution of the resulting supernova remnant (SNR) is influenced by both the geometry of the explosion as well as the complex structure of the CSM. Motivated by recent work suggesting the SNR W49B was a jet-driven SN expanding in a complex CSM, we explore how the dynamics and the metal distributions in a jet-driven explosion are modified by the interaction with the surrounding environment. In particular, we perform hydrodynamical calculations to study the dynamics and explosive nucleosynthesis of a jet-driven SN triggered by the collapse of a 25 M {sub ?} Wolf-Rayet star and its subsequent interaction with the CSM up to several hundred years following the explosion. We find that although the CSM has small-scale effects on the structure of the SNR, the overall morphology and abundance patterns are reflective of the initial asymmetry of the SN explosion. Thus, we predict that jet-driven SNRs, such as W49B, should be identifiable based on morphology and abundance patterns at ages up to several hundred years, even if they expand into a complex CSM environment.

  4. The evolution of information-driven safeguards

    SciTech Connect (OSTI)

    Budlong-sylvester, Kory W; Pilat, Joseph F

    2010-10-14

    From the adoption of the Model Additional Protocol and integrated safeguards in the 1990s, to current International Atomic Energy Agency (IAEA) efforts to deal with cases of noncompliance, the question of how the Agency can best utilize all the information available to it remains of great interest and increasing importance. How might the concept of 'information-driven' safeguards (IDS) evolve in the future? The ability of the Agency to identify and resolve anomalies has always been important and has emerged as a core Agency function in recent years as the IAEA has had to deal with noncompliance in Iran and the Democratic People's Republic of Korea (DPRK). Future IAEA safeguards implementation should be designed with the goal of facilitating and enhancing this vital capability. In addition, the Agency should utilize all the information it possesses, including its in-house assessments and expertise, to direct its safeguards activities. At the State level, knowledge of proliferation possibilities is currently being used to guide the analytical activities of the Agency and to develop inspection plans. How far can this approach be extended? Does it apply across State boundaries? Should it dictate a larger fraction of safeguards activities? Future developments in IDS should utilize the knowledge resident within the Agency to ensure that safeguards resources flow to where they are most needed in order to address anomalies first and foremost, but also to provide greater confidence in conclusions regarding the absence of undeclared nuclear activities. The elements of such a system and related implementation issues are assessed in this paper.

  5. Comparison between kinetic-ballooning-mode-driven turbulence and ion-temperature-gradient-driven turbulence

    SciTech Connect (OSTI)

    Maeyama, S. Nakata, M.; Miyato, N.; Yagi, M.; Ishizawa, A.; Watanabe, T.-H.; Idomura, Y.

    2014-05-15

    Electromagnetic turbulence driven by kinetic ballooning modes (KBMs) in high-? plasma is investigated based on the local gyrokinetic model. Analysis of turbulent fluxes, norms, and phases of fluctuations shows that KBM turbulence gives narrower spectra and smaller phase factors than those in ion-temperature-gradient (ITG)-driven turbulence. This leads to the smaller transport fluxes in KBM turbulence than those in ITG turbulence even when they have similar linear growth rates. From the analysis of the entropy balance relation, it is found that the entropy transfer from ions to electrons through the field-particle interactions mainly drives electron perturbations, which creates radial twisted modes by rapid parallel motions of electrons in a sheared magnetic geometry. The nonlinear coupling between the dominant unstable mode and its twisted modes is important for the saturation of KBM turbulence, in contrast to the importance of zonal flow shearing in ITG turbulence. The coupling depends on the flux-tube domain with the one-poloidal-turn parallel length and on the torus periodicity constraint.

  6. UNIFYING THE ZOO OF JET-DRIVEN STELLAR EXPLOSIONS

    SciTech Connect (OSTI)

    Lazzati, Davide; Blackwell, Christopher H.; Morsony, Brian J.; Begelman, Mitchell C.

    2012-05-01

    We present a set of numerical simulations of stellar explosions induced by relativistic jets emanating from a central engine sitting at the center of compact, dying stars. We explore a wide range of durations of the central engine activity, two candidate stellar progenitors, and two possible values of the total energy release. We find that even if the jets are narrowly collimated, their interaction with the star unbinds the stellar material, producing a stellar explosion. We also find that the outcome of the explosion can be very different depending on the duration of the engine activity. Only the longest-lasting engines result in successful gamma-ray bursts. Engines that power jets only for a short time result in relativistic supernova (SN) explosions, akin to observed engine-driven SNe such as SN2009bb. Engines with intermediate durations produce weak gamma-ray bursts, with properties similar to nearby bursts such as GRB 980425. Finally, we find that the engines with the shortest durations, if they exist in nature, produce stellar explosions that lack sizable amounts of relativistic ejecta and are therefore dynamically indistinguishable from ordinary core-collapse SNe.

  7. Controllable positive exchange bias via redox-driven oxygen migration

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Gilbert, Dustin A.; Olamit, Justin; Dumas, Randy K.; Kirby, B. J.; Grutter, Alexander J.; Maranville, Brian B.; Arenholz, Elke; Borchers, Julie A.; Liu, Kai

    2016-03-21

    We report that ionic transport in metal/oxide heterostructures offers a highly effective means to tailor material properties via modification of the interfacial characteristics. However, direct observation of ionic motion under buried interfaces and demonstration of its correlation with physical properties has been challenging. Using the strong oxygen affinity of gadolinium, we design a model system of GdxFe1-x/NiCoO bilayer films, where the oxygen migration is observed and manifested in a controlled positive exchange bias over a relatively small cooling field range. The exchange bias characteristics are shown to be the result of an interfacial layer of elemental nickel and cobalt, amore » few nanometres in thickness, whose moments are larger than expected from uncompensated NiCoO moments. This interface layer is attributed to a redox-driven oxygen migration from NiCoO to the gadolinium, during growth or soon after. Ultimately, these results demonstrate an effective path to tailoring the interfacial characteristics and interlayer exchange coupling in metal/oxide heterostructures.« less

  8. Similarity-Driven Discovery of Zeolite Materials for Adsorption...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Similarity-Driven Discovery of Zeolite Materials for Adsorption-Based Separations Previous Next List Richard L. Martin, Thomas F. Willems, Li-Chiang Lin, Jihan Kim, Joseph A....

  9. Menu Driven Program Determining Properties of Aqueous Lithium Bromide Solutions

    Energy Science and Technology Software Center (OSTI)

    1992-12-09

    LIMENU is a menu driven program written to compute seven physical properties of a lithium bromide-water solution and three physical properties of water, and to display two plots.

  10. Wave-driven Countercurrent Plasma Centrifuge | Princeton Plasma Physics Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Wave-driven Countercurrent Plasma Centrifuge This is an invention allowing the production of rotation and countercurrent flow patterns in a plasma centrifuge using radiofrequency waves No.: M-801 Inventor(s): Nathaniel J Fisch

  11. Residential Network Members Support New Data-Driven Initiative...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    The open-source software application fills a major market need for data-driven energy efficiency program design and implementation. A SEED user can import data sources, such as ...

  12. Quantum-mechanical aspects of classically chaotic driven systems

    SciTech Connect (OSTI)

    Milonni, P.W.; Ackerhalt, J.R.; Goggin, M.E.

    1987-01-01

    This paper treats atoms and molecules in laser fields as periodically driven quantum systems. The paper concludes by determining that stochastic excitation is possible in quantum systems with quasiperiodic driving. 17 refs. (JDH)

  13. Simple, Ethanol-Driven Synthesis of Core-Shell Nanoparticles...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Find More Like This Return to Search Simple, Ethanol-Driven Synthesis of Core-Shell ... This "green" synthesis method uses ethanol - a simple solvent for metal precursors "as the ...

  14. Mission Driven Science at Argonne | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mission Driven Science at Argonne Share Description Mission driven science at Argonne means applying science and scientific knowledge to a physical and "real world" environment. Examples include testing a theoretical model through the use of formal science or solving a practical problem through the use of natural science. At the laboratory, our materials scientists are leading the way in producing energy solutions today that could help reduce and remove the energy crisis of tomorrow.

  15. Using laser-driven neutrons to stop nuclear smugglers

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Using laser-driven neutrons to stop nuclear smugglers Using laser-driven neutrons to stop nuclear smugglers Researchers have successfully demonstrated for the first time that laser-generated neutrons can be enlisted as a useful tool in the War on Terror. June 4, 2013 A burst of laser energy 50 times greater than the worldwide output of electrical power slams into an extremely thin foil target to produce neutrons at Los Alamos National Laboratory's TRIDENT laser facility during a recent

  16. Electronically- and crystal-structure-driven magnetic structures and

    Office of Scientific and Technical Information (OSTI)

    physical properties of RScSb (R = rare earth) compounds. A neutron diffraction, magnetization and heat capacity study (Journal Article) | SciTech Connect Electronically- and crystal-structure-driven magnetic structures and physical properties of RScSb (R = rare earth) compounds. A neutron diffraction, magnetization and heat capacity study Citation Details In-Document Search Title: Electronically- and crystal-structure-driven magnetic structures and physical properties of RScSb (R = rare

  17. Continuous Energy Improvement in Motor Driven Systems - A Guidebook for

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industry | Department of Energy Energy Improvement in Motor Driven Systems - A Guidebook for Industry Continuous Energy Improvement in Motor Driven Systems - A Guidebook for Industry This guidebook provides a step-by-step approach to developing a motor system energy-improvement action plan. An action plan includes which motors should be repaired or replaced with higher efficiency models, recommendations on maintaining a spares inventory, and discussion of improvements in maintenance

  18. Entropy-driven structure and dynamics in carbon nanocrystallites (Journal

    Office of Scientific and Technical Information (OSTI)

    Article) | SciTech Connect Journal Article: Entropy-driven structure and dynamics in carbon nanocrystallites Citation Details In-Document Search Title: Entropy-driven structure and dynamics in carbon nanocrystallites New carbon composite materials are being developed that contain carbon nanocrystallites in the range of 5 17 A in radius dispersed within an amorphous carbon matrix. Evaluating the applicability of these materials for use in battery electrodes requires a molecular-level

  19. Experimental evidence of space charge driven resonances in high intensity

    Office of Scientific and Technical Information (OSTI)

    linear accelerators (Journal Article) | SciTech Connect Experimental evidence of space charge driven resonances in high intensity linear accelerators Citation Details In-Document Search Title: Experimental evidence of space charge driven resonances in high intensity linear accelerators Authors: Jeon, Dong-O Publication Date: 2016-01-12 OSTI Identifier: 1235762 Grant/Contract Number: AC05-00OR22725 Type: Published Article Journal Name: Physical Review Accelerators and Beams Additional Journal

  20. NREL Demonstrates Light-Driven Process for Enzymatic Ammonia Production:

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Carbon emissions and energy requirements reduced with new approach | Department of Energy Demonstrates Light-Driven Process for Enzymatic Ammonia Production: Carbon emissions and energy requirements reduced with new approach NREL Demonstrates Light-Driven Process for Enzymatic Ammonia Production: Carbon emissions and energy requirements reduced with new approach April 21, 2016 - 4:03pm Addthis News release from the National Renewable Energy Laboratory, April 21 A new process using light to

  1. Department of Energy Announces First Entry for Market- Driven

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    High-Efficiency Commercial Air Conditioners Challenge | Department of Energy First Entry for Market- Driven High-Efficiency Commercial Air Conditioners Challenge Department of Energy Announces First Entry for Market- Driven High-Efficiency Commercial Air Conditioners Challenge October 4, 2011 - 12:02pm Addthis Washington, D.C. - The U.S. Department of Energy (DOE) today announced that it has received the first official submission by a manufacturer to a voluntary challenge for a new

  2. Computational study of the shock driven instability of a multiphase

    Office of Scientific and Technical Information (OSTI)

    particle-gas system (Journal Article) | SciTech Connect Journal Article: Computational study of the shock driven instability of a multiphase particle-gas system Citation Details In-Document Search This content will become publicly available on February 1, 2017 Title: Computational study of the shock driven instability of a multiphase particle-gas system This paper considers the interaction of a shock wave with a multiphase particle-gas system which creates an instability somewhat similar to

  3. Electronically- and crystal-structure-driven magnetic structures and

    Office of Scientific and Technical Information (OSTI)

    physical properties of RScSb (R = rare earth) compounds. A neutron diffraction, magnetization and heat capacity study (Journal Article) | SciTech Connect Electronically- and crystal-structure-driven magnetic structures and physical properties of RScSb (R = rare earth) compounds. A neutron diffraction, magnetization and heat capacity study Citation Details In-Document Search Title: Electronically- and crystal-structure-driven magnetic structures and physical properties of RScSb (R = rare

  4. Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts Print Wednesday, 28 January 2009 00:00 Catalytic systems based on bimetallic particles with controlled size, composition, and structure dispersed on a high-surface-area support are widely used for catalytic reforming, pollution control, alcohol oxidation, and electrocatalysis in fuel cells. Owing to the nanoscale size of the particles, the modification of the

  5. Scenario-Driven Training | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scenario-Driven Training Scenario-Driven Training An initial entry team member assesses the overall hazards in a clandestine lab. Y-12's Nuclear and Radiological Field Training Center equips military units, as well as federal, state and local emergency response agencies with the hands-on skills and knowledge they need to safely detect, safeguard and handle real nuclear and radiological sources. To test their skills, Y-12 has developed training exercises that include the following scenarios:

  6. Uniaxial stress-driven coupled grain boundary motion in hexagonal

    Office of Scientific and Technical Information (OSTI)

    close-packed metals: A molecular dynamics study (Journal Article) | SciTech Connect Uniaxial stress-driven coupled grain boundary motion in hexagonal close-packed metals: A molecular dynamics study Citation Details In-Document Search This content will become publicly available on January 1, 2017 Title: Uniaxial stress-driven coupled grain boundary motion in hexagonal close-packed metals: A molecular dynamics study Authors: Zong, Hongxiang ; Ding, Xiangdong ; Lookman, Turab ; Li, Ju ; Sun,

  7. Experimental Study of Current-Driven Turbulence During Magnetic Reconnection

    SciTech Connect (OSTI)

    Miklos Porkolab; Jan Egedal-Pedersen; William Fox

    2010-08-31

    CMPD Final Report Experimental Study of Current-Driven Turbulence During Magnetic Reconnection Miklos Porkolab, PI, Jan Egedal, co-PI, William Fox, graduate student. This is the final report for Grant DE-FC02-04ER54786, ?¢????MIT Participation in the Center for Multiscale Plasma Dynamics,?¢??? which was active from 8/1/2004 to 7/31/2010. This Grant supported the thesis work of one MIT graduate student, William Fox, The thesis research consisted of an experimental study of the fluctuations arising during magnetic reconnection in plasmas on the Versatile Toroidal Facility (VTF) at MIT Plasma Science and Fusion Center (PSFC). The thesis was submitted and accepted by the MIT physics Department, ?¢????W. Fox, Experimental Study of Current-Driven Turbulence During Magnetic Reconnection, Ph.D. Thesis, MIT (2009)?¢???. In the VTF experiment reconnection and current-sheet formation is driven by quickly changing currents in a specially arranged set of internal conductors. Previous work on this device [Egedal, et al, PRL 98, 015003, (2007)] identified a ?¢????spontaneous?¢??? reconnection regime. In this work fluctuations were studied using impedance-matched, high-bandwidth Langmuir probes. Strong, broadband fluctuations, with frequencies extending from near the lower-hybrid frequency [fLH = (fcefci)1/2] to the electron cyclotron frequency fce were found to arise during the reconnection events. Based on frequency and wavelength measurements, lower-hybrid waves and Trivelpiece-Gould waves were identified. The lower-hybrid waves are easiest to drive with strong perpendicular drifts or gradients which arise due to the reconnection events; an appealing possibility is strong temperature gradients. The Trivelpiece-Gould modes can result from kinetic, bump-on-tail instability of a runaway electron population energized by the reconnection events. We also observed that the turbulence is often spiky, consisting of discrete positive-potential spikes, which were identified as ?¢????electron phase-space holes,?¢??? a class of nonlinear solitary wave known to evolve from a strong beam-on-tail instability. We established that fast electrons were produced by magnetic reconnection. Overall, these instabilities were found to be a consequence of reconnection, specifically the strong energization of electrons, leading to steep gradients in both coordinate- and velocity-space. Estimates (using quasi-linear theory) of the anomalous resistivity due to these modes did not appear large enough to substantially impact the reconnection process. Relevant publications: ?¢???¢ W. Fox, M. Porkolab, et al, Phys. Rev. Lett. 101, 255003 (2008). ?¢???¢ W. Fox, M. Porkolab, et al, Phys. Plasmas 17, 072303, (2010).

  8. SUPERNOVAE AND AGN DRIVEN GALACTIC OUTFLOWS

    SciTech Connect (OSTI)

    Sharma, Mahavir; Nath, Biman B. E-mail: biman@rri.res.in

    2013-01-20

    We present analytical solutions for winds from galaxies with a Navarro-Frank-White (NFW) dark matter halo. We consider winds driven by energy and mass injection from multiple supernovae (SNe), as well as momentum injection due to radiation from a central black hole. We find that the wind dynamics depends on three velocity scales: (1) v{sub *}{approx}( E-dot / 2 M-dot ){sup 1/2} describes the effect of starburst activity, with E-dot and M-dot as energy and mass injection rate in a central region of radius R; (2) v {sub .} {approx} (GM {sub .}/2R){sup 1/2} for the effect of a central black hole of mass M {sub .} on gas at distance R; and (3) v{sub s}=(GM{sub h} / 2Cr{sub s}){sup 1/2}, which is closely related to the circular speed (v{sub c} ) for an NFW halo, where r{sub s} is the halo scale radius and C is a function of the halo concentration parameter. Our generalized formalism, in which we treat both energy and momentum injection from starbursts and radiation from the central active galactic nucleus (AGN), allows us to estimate the wind terminal speed to be (4v {sup 2} {sub *} + 6({Gamma} - 1)v {sub .} {sup 2} - 4v {sup 2} {sub s}){sup 1/2}, where {Gamma} is the ratio of force due to radiation pressure to gravity of the central black hole. Our dynamical model also predicts the following: (1) winds from quiescent star-forming galaxies cannot escape from 10{sup 11.5} M {sub Sun} {<=} M{sub h} {<=} 10{sup 12.5} M {sub Sun} galaxies; (2) circumgalactic gas at large distances from galaxies should be present for galaxies in this mass range; (3) for an escaping wind, the wind speed in low- to intermediate-mass galaxies is {approx}400-1000 km s{sup -1}, consistent with observed X-ray temperatures; and (4) winds from massive galaxies with AGNs at Eddington limit have speeds {approx}> 1000 km s{sup -1}. We also find that the ratio [2v {sup 2} {sub *} - (1 - {Gamma})v {sub .} {sup 2}]/v {sup 2} {sub c} dictates the amount of gas lost through winds. Used in conjunction with an appropriate relation between M {sub .} and M{sub h} and an appropriate opacity of dust grains in infrared (K band), this ratio has the attractive property of being minimum at a certain halo mass scale (M{sub h} {approx} 10{sup 12}-10{sup 12.5} M {sub Sun }) that signifies the crossover of AGN domination in outflow properties from starburst activity at lower masses. We find that stellar mass for massive galaxies scales as M {sub *}{proportional_to}M {sup 0.26} {sub h}, and for low-mass galaxies, M {sub *}{proportional_to}M {sup 5/3} {sub h}.

  9. An opinion-driven behavioral dynamics model for addictive behaviors

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Moore, Thomas W.; Finley, Patrick D.; Apelberg, Benjamin J.; Ambrose, Bridget K.; Brodsky, Nancy S.; Brown, Theresa J.; Husten, Corinne; Glass, Robert J.

    2015-04-08

    We present a model of behavioral dynamics that combines a social network-based opinion dynamics model with behavioral mapping. The behavioral component is discrete and history-dependent to represent situations in which an individual’s behavior is initially driven by opinion and later constrained by physiological or psychological conditions that serve to maintain the behavior. Additionally, individuals are modeled as nodes in a social network connected by directed edges. Parameter sweeps illustrate model behavior and the effects of individual parameters and parameter interactions on model results. Mapping a continuous opinion variable into a discrete behavioral space induces clustering on directed networks. Clusters providemore » targets of opportunity for influencing the network state; however, the smaller the network the greater the stochasticity and potential variability in outcomes. Furthermore, this has implications both for behaviors that are influenced by close relationships verses those influenced by societal norms and for the effectiveness of strategies for influencing those behaviors.« less

  10. Direct match data flow memory for data driven computing

    DOE Patents [OSTI]

    Davidson, G.S.; Grafe, V.G.

    1997-10-07

    A data flow computer and method of computing is disclosed which utilizes a data driven processor node architecture. The apparatus in a preferred embodiment includes a plurality of First-In-First-Out (FIFO) registers, a plurality of related data flow memories, and a processor. The processor makes the necessary calculations and includes a control unit to generate signals to enable the appropriate FIFO register receiving the result. In a particular embodiment, there are three FIFO registers per node: an input FIFO register to receive input information form an outside source and provide it to the data flow memories; an output FIFO register to provide output information from the processor to an outside recipient; and an internal FIFO register to provide information from the processor back to the data flow memories. The data flow memories are comprised of four commonly addressed memories. A parameter memory holds the A and B parameters used in the calculations; an opcode memory holds the instruction; a target memory holds the output address; and a tag memory contains status bits for each parameter. One status bit indicates whether the corresponding parameter is in the parameter memory and one status bit to indicate whether the stored information in the corresponding data parameter is to be reused. The tag memory outputs a ``fire`` signal (signal R VALID) when all of the necessary information has been stored in the data flow memories, and thus when the instruction is ready to be fired to the processor. 11 figs.

  11. Direct match data flow memory for data driven computing

    DOE Patents [OSTI]

    Davidson, George S.; Grafe, Victor Gerald

    1997-01-01

    A data flow computer and method of computing is disclosed which utilizes a data driven processor node architecture. The apparatus in a preferred embodiment includes a plurality of First-In-First-Out (FIFO) registers, a plurality of related data flow memories, and a processor. The processor makes the necessary calculations and includes a control unit to generate signals to enable the appropriate FIFO register receiving the result. In a particular embodiment, there are three FIFO registers per node: an input FIFO register to receive input information form an outside source and provide it to the data flow memories; an output FIFO register to provide output information from the processor to an outside recipient; and an internal FIFO register to provide information from the processor back to the data flow memories. The data flow memories are comprised of four commonly addressed memories. A parameter memory holds the A and B parameters used in the calculations; an opcode memory holds the instruction; a target memory holds the output address; and a tag memory contains status bits for each parameter. One status bit indicates whether the corresponding parameter is in the parameter memory and one status bit to indicate whether the stored information in the corresponding data parameter is to be reused. The tag memory outputs a "fire" signal (signal R VALID) when all of the necessary information has been stored in the data flow memories, and thus when the instruction is ready to be fired to the processor.

  12. Measurement of pulsed-power-driven magnetic fields via proton deflectometry

    SciTech Connect (OSTI)

    Mariscal, D.; McGuffey, C.; Valenzuela, J.; Beg, F. N.; Wei, M. S.; Chittenden, J. P.; Niasse, N.; Presura, R.; Haque, S.; Wallace, M.; Arias, A.; Covington, A.; Sawada, H.; Wiewior, P.

    2014-12-01

    Measuring magnetic field and current distribution in Z-pinch plasma systems is crucial to the validation of Z-pinch theory. In this letter, the demonstration of proton deflectometry to pulsed-power-driven loads at the mega-amp scale is presented, which is capable of making more detailed field maps in high-density regions of plasmas. In this method, a laser-driven, broad-spectrum, MeV-energy proton beam is directed through a pulsed-power-driven plasma system, and the resulting deflections are measured to examine configuration of magnetic fields and to infer the currents that support them. The technique was first demonstrated on simple short-circuit loads, and the results are in excellent agreement with numerical simulations providing reliable estimates of the field and current configurations. It was then applied to a more complex—radial foil—plasma load. The measurements show unexpected proton deflections that exhibit the complexity of the plasma load and that with further analysis will reveal details about the current and magnetic field topology in this complex configuration.

  13. Uniform heating of materials into the warm dense matter regime with laser-driven quasimonoenergetic ion beams

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Bang, W.; Albright, B. J.; Bradley, P. A.; Vold, E. L.; Boettger, J. C.; Fernández, J. C.

    2015-12-01

    In a recent experiment at the Trident laser facility, a laser-driven beam of quasimonoenergetic aluminum ions was used to heat solid gold and diamond foils isochorically to 5.5 and 1.7 eV, respectively. Here theoretical calculations are presented that suggest the gold and diamond were heated uniformly by these laser-driven ion beams. According to calculations and SESAME equation-of-state tables, laser-driven aluminum ion beams achievable at Trident, with a finite energy spread of ΔE/E~20%, are expected to heat the targets more uniformly than a beam of 140-MeV aluminum ions with zero energy spread. As a result, the robustness of the expected heatingmore » uniformity relative to the changes in the incident ion energy spectra is evaluated, and expected plasma temperatures of various target materials achievable with the current experimental platform are presented.« less

  14. Uniform heating of materials into the warm dense matter regime with laser-driven quasimonoenergetic ion beams

    SciTech Connect (OSTI)

    Bang, W.; Albright, B. J.; Bradley, P. A.; Vold, E. L.; Boettger, J. C.; Fernández, J. C.

    2015-12-01

    In a recent experiment at the Trident laser facility, a laser-driven beam of quasimonoenergetic aluminum ions was used to heat solid gold and diamond foils isochorically to 5.5 and 1.7 eV, respectively. Here theoretical calculations are presented that suggest the gold and diamond were heated uniformly by these laser-driven ion beams. According to calculations and SESAME equation-of-state tables, laser-driven aluminum ion beams achievable at Trident, with a finite energy spread of ΔE/E~20%, are expected to heat the targets more uniformly than a beam of 140-MeV aluminum ions with zero energy spread. As a result, the robustness of the expected heating uniformity relative to the changes in the incident ion energy spectra is evaluated, and expected plasma temperatures of various target materials achievable with the current experimental platform are presented.

  15. Transition state theory for laser-driven reactions

    SciTech Connect (OSTI)

    Kawai, Shinnosuke; Bandrauk, Andre D.; Jaffe, Charles; Bartsch, Thomas; Palacian, Jesus; Uzer, T.

    2007-04-28

    Recent developments in transition state theory brought about by dynamical systems theory are extended to time-dependent systems such as laser-driven reactions. Using time-dependent normal form theory, the authors construct a reaction coordinate with regular dynamics inside the transition region. The conservation of the associated action enables one to extract time-dependent invariant manifolds that act as separatrices between reactive and nonreactive trajectories and thus make it possible to predict the ultimate fate of a trajectory. They illustrate the power of our approach on a driven Henon-Heiles system, which serves as a simple example of a reactive system with several open channels. The present generalization of transition state theory to driven systems will allow one to study processes such as the control of chemical reactions through laser pulses.

  16. Nematic-driven anisotropic electronic properties of underdoped detwinned Ba

    Office of Scientific and Technical Information (OSTI)

    ( Fe 1 - x Co x ) 2 As 2 revealed by optical spectroscopy (Journal Article) | SciTech Connect Nematic-driven anisotropic electronic properties of underdoped detwinned Ba ( Fe 1 - x Co x ) 2 As 2 revealed by optical spectroscopy Citation Details In-Document Search Title: Nematic-driven anisotropic electronic properties of underdoped detwinned Ba ( Fe 1 - x Co x ) 2 As 2 revealed by optical spectroscopy Authors: Mirri, C. ; Dusza, A. ; Bastelberger, S. ; Chu, J.-H. ; Kuo, H.-H. ; Fisher, I. R.

  17. Betatron radiation from a beam driven plasma source

    SciTech Connect (OSTI)

    Litos, M.; Corde, S.

    2012-12-21

    Photons produced by the betatron oscillation of electrons in a beam-driven plasma wake provide a uniquely intense and high-energy source of hard X-rays and gamma rays. This betatron radiation is interesting not only for its high intensity and spectral characteristics, but also because it can be used as a diagnostic for beam matching into the plasma, which is critical for maximizing the energy extraction efficiency of a plasma accelerator stage. At SLAC, gamma ray detection devices have been installed at the dump area of the FACET beamline where the betatron radiation from the plasma source used in the E200 plasma wakefield acceleration experiment may be observed. The ultra-dense, high-energy beam at FACET (2 Multiplication-Sign 10{sup 10} electrons, 20 Multiplication-Sign 20{mu}m{sup 2} spot, 20 - 100{mu}m length, 20GeV energy) when sent into a plasma source with a nominal density of {approx} 1 Multiplication-Sign 10{sup 17} cm{sup -3} will generate synchrotron-like spectra with critical energies well into the tens of MeV. The intensity of the radiation can be increased by introducing a radial offset to the centroid of the witness bunch, which may be achieved at FACET through the use of a transverse deflecting RF cavity. The E200 gamma ray detector has two main components: a 30 Multiplication-Sign 35cm{sup 2} phosphorescent screen for observing the transverse extent of the radiation, and a sampling electromagnetic calorimeter outfitted with photodiodes for measuring the on-axis spectrum. To estimate the spectrum, the observed intensity patterns across the calorimeter are fit with a Gaussian-integrated synchrotron spectrum and compared to simulations. Results and observations from the first FACET user run (April-June 2012) are presented.

  18. RELAP5/MOD2 Overview and Developmental. Assessment Results from TMl-1 Plant Transient Analysis

    SciTech Connect (OSTI)

    Lin, J. C.; Tsai, C. C.; Ransom, V. H.; Johnsen, G. W.

    2013-02-01

    RELAP5/MOD2 is a new version of the RELAP5 thermal-hydraulic computer code containing improved modeling features that provide a generic capability for pressurized water reactor transient simulation. The objective of this paper is to provide code users with an overview of the code and to report developmental assessment results obtained from a Three Mile Island Unit One plant transient analysis. The assessment shows that the injection of highly sub-cooled water into a high-pressure primary coolant system does not cause unphysical results or pose a problem for RELAP5/MOD2. (author)

  19. TIDALLY DRIVEN DYNAMOS IN A ROTATING SPHERE

    SciTech Connect (OSTI)

    Cébron, D.; Hollerbach, R. E-mail: r.hollerbach@leeds.ac.uk

    2014-07-01

    Large-scale planetary or stellar magnetic fields generated by a dynamo effect are mostly attributed to flows forced by buoyancy forces in electrically conducting fluid layers. However, these large-scale fields may also be controlled by tides, as previously suggested for the star τ-boo, Mars, or the early Moon. By simulating a small local patch of a rotating fluid, Barker and Lithwick have recently shown that tides can drive small-scale dynamos by exciting a hydrodynamic instability, the so-called elliptical (or tidal) instability. By performing global magnetohydrodynamic simulations of a rotating spherical fluid body, we investigate if this instability can also drive the observed large-scale magnetic fields. We are thus interested in the dynamo threshold and the generated magnetic field in order to test if such a mechanism is relevant for planets and stars. Rather than solving the problem in a geometry deformed by tides, we consider a spherical fluid body and add a body force to mimic the tidal deformation in the bulk of the fluid. This allows us to use an efficient spectral code to solve the magnetohydrodynamic problem. We first compare the hydrodynamic results with theoretical asymptotic results and numerical results obtained in a truly deformed ellipsoid, which confirms the presence of elliptical instability. We then perform magnetohydrodynamic simulations and investigate the dynamo capability of the flow. Kinematic and self-consistent dynamos are finally simulated, showing that the elliptical instability is capable of generating a dipole-dominated large-scale magnetic field in global simulations of a fluid rotating sphere.

  20. Batteryless magneto-driven portable radiac

    DOE Patents [OSTI]

    Waechter, D.A.; Bjarke, G.O.; Trujillo, F.; Wolf, M.A.; Umbarger, C.J.

    1984-10-19

    A hand-powerd alternator for generating an alternating voltage provides same through a rectifier to a high capacity capacitor which stores the resultant dc voltage and drives a voltage regulator to provide a constant low voltage output for a portable radiation detection instrument. The instrument includes a Geiger-Mueller detector tube whose output is fed to a pulse detector and then through an event counter and LCD driver circuit to an LCD bar graph for visual display. An audio driver and an audio output is also provided. All circuitry used is low power so that the capacitor can be readily charged to a sufficient level to provide power for at least 30 minutes. A low voltage indicator is provided on the LCD display to indicate the need for manual recharging.

  1. Batteryless magneto-driven portable radiac

    DOE Patents [OSTI]

    Waechter, David A.; Bjarke, George O.; Trujillo, Faustin; Wolf, Michael A.; Umbarger, C. John

    1986-01-01

    A hand-powered alternator for generating an alternating voltage provides same through a rectifier to a high capacity capacitor which stores the resultant dc voltage and drives a voltage regulator to provide a constant low voltage output for a portable radiation detection instrument. The instrument includes a Geiger-Muller detector tube whose output is fed to a pulse detector and then through an event counter and LCD driver circuit to an LCD bar graph for visual display. An audio driver and an audio output is also provided. All circuitry used is low power so that the capacitor can be readily charged to a sufficient level to provide power for at least 30 minutes. A low voltage indicator is provided on the LCD display to indicate the need for manual recharging.

  2. Characterization of laser-driven shock waves in solids using a fiber optic pressure probe

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Cranch, Geoffrey A.; Lunsford, Robert; Grun, Jacob; Weaver, James; Compton, Steve; May, Mark; Kostinski, Natalie

    2013-11-08

    Measurement of laser-driven shock wave pressure in solid blocks of polymethyl methacrylate is demonstrated using fiber optic pressure probes. Three probes based on a fiber Fabry–Perot, fiber Bragg grating, and interferometric fiber tip sensor are tested and compared. Shock waves are generated using a high-power laser focused onto a thin foil target placed in close proximity to the test blocks. The fiber Fabry–Perot sensor appears capable of resolving the shock front with a rise time of 91 ns. As a result, the peak pressure is estimated, using a separate shadowgraphy measurement, to be 3.4 GPa.

  3. Efficient Feature-Driven Visualization of Large-Scale Scientific Data

    SciTech Connect (OSTI)

    Lu, Aidong

    2012-12-12

    Very large, complex scientific data acquired in many research areas creates critical challenges for scientists to understand, analyze, and organize their data. The objective of this project is to expand the feature extraction and analysis capabilities to develop powerful and accurate visualization tools that can assist domain scientists with their requirements in multiple phases of scientific discovery. We have recently developed several feature-driven visualization methods for extracting different data characteristics of volumetric datasets. Our results verify the hypothesis in the proposal and will be used to develop additional prototype systems.

  4. High-intensity laser-driven proton acceleration enhancement from hydrogen containing ultrathin targets

    SciTech Connect (OSTI)

    Dollar, F.; Reed, S. A.; Matsuoka, T.; Bulanov, S. S.; Chvykov, V.; Kalintchenko, G.; McGuffey, C.; Rousseau, P.; Thomas, A. G. R.; Willingale, L.; Yanovsky, V.; Krushelnick, K.; Maksimchuk, A.; Litzenberg, D. W.

    2013-09-30

    Laser driven proton acceleration experiments from micron and submicron thick targets using high intensity (2 10{sup 21} W/cm{sup 2}), high contrast (10{sup ?15}) laser pulses show an enhancement of maximum energy when hydrogen containing targets were used instead of non-hydrogen containing. In our experiments, using thin (<1?m) plastic foil targets resulted in maximum proton energies that were consistently 20%100% higher than when equivalent thickness inorganic targets, including Si{sub 3}N{sub 4} and Al, were used. Proton energies up to 20 MeV were measured with a flux of 10{sup 7} protons/MeV/sr.

  5. Sub-100 ps laser-driven dynamic compression of solid deuterium...

    Office of Scientific and Technical Information (OSTI)

    Journal Article: Sub-100 ps laser-driven dynamic compression of solid deuterium with a 40 J laser pulse Citation Details In-Document Search Title: Sub-100 ps laser-driven ...

  6. Save Energy Now in Your Motor-Driven Systems | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Motor-Driven Systems Save Energy Now in Your Motor-Driven Systems This fact sheet describes how manufacturing plants can save energy and money by making energy efficiency ...

  7. Design and optimization of a bi-axial vibration-driven electromagnetic...

    Office of Scientific and Technical Information (OSTI)

    Design and optimization of a bi-axial vibration-driven electromagnetic generator Citation Details In-Document Search Title: Design and optimization of a bi-axial vibration-driven ...

  8. Bioenergy Demand in a Market Driven Forest Economy (U.S. South...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Bioenergy Demand in a Market Driven Forest Economy (U.S. South) Bioenergy Demand in a Market Driven Forest Economy (U.S. South) Breakout Session 1A: Biomass Feedstocks for the...

  9. A Beam Driven Plasma-Wakefield Linear Collider: From Higgs Factory...

    Office of Scientific and Technical Information (OSTI)

    A Beam Driven Plasma-Wakefield Linear Collider: From Higgs Factory to Multi-TeV Citation Details In-Document Search Title: A Beam Driven Plasma-Wakefield Linear Collider: From Higgs ...

  10. Beam-dynamics driven design of the LHeC energy-recovery linac...

    Office of Scientific and Technical Information (OSTI)

    Journal Article: Beam-dynamics driven design of the LHeC energy-recovery linac Citation Details In-Document Search Title: Beam-dynamics driven design of the LHeC energy-recovery ...

  11. Beam-dynamics driven design of the LHeC energy-recovery linac...

    Office of Scientific and Technical Information (OSTI)

    Beam-dynamics driven design of the LHeC energy-recovery linac Citation Details In-Document Search Title: Beam-dynamics driven design of the LHeC energy-recovery linac The LHeC ...

  12. IEMDC IN-LINE ELECTRIC MOTOR DRIVEN COMPRESSOR

    SciTech Connect (OSTI)

    Michael J. Crowley; Prem N. Bansal

    2004-10-01

    This report contains the final project summary and deliverables required by the award for the development of an In-line Electric Motor Driven Compressor (IEMDC). Extensive work was undertaken during the course of the project to develop the motor and the compressor section of the IEMDC unit. Multiple design iterations were performed to design an electric motor for operation in a natural gas environment and to successfully integrate the motor with a compressor. During the project execution, many challenges were successfully overcome in order to achieve the project goals and to maintain the system design integrity. Some of the challenges included limiting the magnitude of the compressor aerodynamic loading for appropriate sizing of the magnetic bearings, achieving a compact motor rotor size to meet the rotor dynamic requirements of API standards, devising a motor cooling scheme using high pressure natural gas, minimizing the impact of cooling on system efficiency, and balancing the system thrust loads for the magnetic thrust bearing. Design methods that were used on the project included validated state-of-the-art techniques such as finite element analysis and computational fluid dynamics along with the combined expertise of both Curtiss-Wright Electro-Mechanical Corporation and Dresser-Rand Company. One of the most significant areas of work undertaken on the project was the development of the unit configuration for the system. Determining the configuration of the unit was a significant step in achieving integration of the electric motor into a totally enclosed compression system. Product review of the IEMDC unit configuration was performed during the course of the development process; this led to an alternate design configuration. The alternate configuration is a modular design with the electric motor and compressor section each being primarily contained in its own pressure containing case. This new concept resolved the previous conflict between the aerodynamic flow passage requirements and electric motor requirements for support and utilities by bounding the flowpath within the compressor section. However most importantly, the benefits delivered by the new design remained the same as those proposed by the goals of the project. In addition, this alternate configuration resulted in the achievement of a few additional advantages over the original concept such as easier maintenance, operation, and installation. Interaction and feedback solicited from target clients regarding the unit configuration supports the fact that the design addresses industry issues regarding accessibility, maintainability, preferred operating practice, and increased reliability.

  13. Strongly driven one-atom laser and decoherence monitoring

    SciTech Connect (OSTI)

    Lougovski, P.; Casagrande, F.; Lulli, A.; Solano, E.

    2007-09-15

    We propose the implementation of a strongly driven one-atom laser, based on the off-resonant interaction of a three-level atom in {lambda} configuration with a single cavity mode and three laser fields. We show that the system can be described equivalently by a two-level atom resonantly coupled to the cavity and driven by a strong effective coherent field. The effective dynamics can be solved exactly, including a thermal field bath, allowing an analytical description of field statistics and entanglement properties. We also show the possible generation of quantum superposition (Schroedinger cat) states for the whole atom-field system and for the field alone after atomic measurement. We propose a way to monitor the system decoherence by measuring atomic populations. Finally, we confirm the validity of our model through numerical solutions.

  14. Continuous third harmonic generation in a terahertz driven modulated nanowire

    SciTech Connect (OSTI)

    Hamilton, Kathleen E. De, Amrit; Pryadko, Leonid P.; Kovalev, Alexey A.

    2015-06-07

    We consider the possibility of observing continuous third-harmonic generation using a strongly driven, single-band one-dimensional metal. In the absence of scattering, the quantum efficiency of frequency tripling for such a system can be as high as 93%. Combining the Floquet quasi-energy spectrum with the Keldysh Green's function technique, we derive a semiclassical master equation for a one-dimensional band of strongly and rapidly driven electrons in the presence of weak scattering by phonons. The power absorbed from the driving field is continuously dissipated by phonon modes, leading to a quasi-equilibrium in the electron distribution. We use the Kronig-Penney model with varying effective mass to establish the growth parameters of an InAs/InP nanowire near optimal for third harmonic generation at terahertz frequency range.

  15. Beam-driven acceleration in ultra-dense plasma media

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Shin, Young-Min

    2014-09-15

    Accelerating parameters of beam-driven wakefield acceleration in an extremely dense plasma column has been analyzed with the dynamic framed particle-in-cell plasma simulator, and compared with analytic calculations. In the model, a witness beam undergoes a TeV/m scale alternating potential gradient excited by a micro-bunched drive beam in a 1025 m-3 and 1.6 x 1028 m-3 plasma column. The acceleration gradient, energy gain, and transformer ratio have been extensively studied in quasi-linear, linear-, and blowout-regimes. The simulation analysis indicated that in the beam-driven acceleration system a hollow plasma channel offers 20 % higher acceleration gradient by enlarging the channel radius (r)morefrom 0.2 ?p to 0.6 ?p in a blowout regime. This paper suggests a feasibility of TeV/m scale acceleration with a hollow crystalline structure (e.g. nanotubes) of high electron plasma density.less

  16. LIMB-DARKENED RADIATION-DRIVEN WINDS FROM MASSIVE STARS

    SciTech Connect (OSTI)

    Cure, M.; Cidale, L.

    2012-10-01

    We calculated the influence of the limb-darkened finite-disk correction factor in the theory of radiation-driven winds from massive stars. We solved the one-dimensional m-CAK hydrodynamical equation of rotating radiation-driven winds for all three known solutions, i.e., fast, {Omega}-slow, and {delta}-slow. We found that for the fast solution, the mass-loss rate is increased by a factor of {approx}10%, while the terminal velocity is reduced about 10%, when compared with the solution using a finite-disk correction factor from a uniformly bright star. For the other two slow solutions, the changes are almost negligible. Although we found that the limb darkening has no effects on the wind-momentum-luminosity relationship, it would affect the calculation of synthetic line profiles and the derivation of accurate wind parameters.

  17. Driven and decaying turbulence simulations of low–mass star formation: From clumps to cores to protostars

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Offner, Stella S. R.; Klein, Richard I.; McKee, Christopher F.

    2008-10-20

    Molecular clouds are observed to be turbulent, but the origin of this turbulence is not well understood. As a result, there are two different approaches to simulating molecular clouds, one in which the turbulence is allowed to decay after it is initialized, and one in which it is driven. We use the adaptive mesh refinement (AMR) code, Orion, to perform high-resolution simulations of molecular cloud cores and protostars in environments with both driven and decaying turbulence. We include self-gravity, use a barotropic equation of state, and represent regions exceeding the maximum grid resolution with sink particles. We analyze the propertiesmore » of bound cores such as size, shape, line width, and rotational energy, and we find reasonable agreement with observation. At high resolution the different rates of core accretion in the two cases have a significant effect on protostellar system development. Clumps forming in a decaying turbulence environment produce high-multiplicity protostellar systems with Toomre Q unstable disks that exhibit characteristics of the competitive accretion model for star formation. In contrast, cores forming in the context of continuously driven turbulence and virial equilibrium form smaller protostellar systems with fewer low-mass members. Furthermore, our simulations of driven and decaying turbulence show some statistically significant differences, particularly in the production of brown dwarfs and core rotation, but the uncertainties are large enough that we are not able to conclude whether observations favor one or the other.« less

  18. NREL Demonstrates Light-Driven Process for Enzymatic Ammonia Production -

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Releases | NREL Demonstrates Light-Driven Process for Enzymatic Ammonia Production Carbon emissions and energy requirements reduced with new approach April 21, 2016 Image shows tubes of cadmium sulfide nanoparticles dissolved in water. A new process using light to reduce dinitrogen into ammonia, the main ingredient in chemical fertilizers could inspire development of new, more sustainable processes that eliminate the energy-intensive, lengthier processes now commonly in use. According

  19. LIQUID BUTANE FILLED LOAD FOR A LINER DRIVEN PEGASUS EXPERIMENT

    SciTech Connect (OSTI)

    M.A. SALAZAR; W. ANDERSON; ET AL

    2001-06-01

    A hydrogen rich, low density liquid, contained within the internal volume of a cylindrical liner, was requested of the Polymers and Coatings Group (MST-7) of the Los Alamos Materials Science Division for one of the last liner driven experiments conducted on the Los Alamos Pegasus facility. The experiment was a continuation of the Raleigh-Taylor hydrodynamics series of experiments and associated liners that have been described previously [1,2].

  20. Liquid butane filled load for a liner driven Pegasus experiment.

    SciTech Connect (OSTI)

    Salazar, M. A.; Armijo, E. V.; Anderson, W. E.; Atchison, W. L.; Bartos, J. J.; Garcia, F.; Randolph, B.; Sheppard, M. G.; Stokes, J. L.

    2001-01-01

    A hydrogen rich, low density liquid, contained within the internal volume of a cylindrical liner, was requested of the Polymers and Coatings Group (MST-7) of the Los Alamos Materials Science Division for one of the last liner driven experiments conducted on the Los Alamos Pegasus facility. The experiment (Fig.1) was a continuation of the Raleigh-Taylor hydrodynamics series of experiments and associated liners that have been described previously.

  1. Waste heat driven absorption refrigeration process and system

    DOE Patents [OSTI]

    Wilkinson, William H.

    1982-01-01

    Absorption cycle refrigeration processes and systems are provided which are driven by the sensible waste heat available from industrial processes and other sources. Systems are disclosed which provide a chilled water output which can be used for comfort conditioning or the like which utilize heat from sensible waste heat sources at temperatures of less than 170.degree. F. Countercurrent flow equipment is also provided to increase the efficiency of the systems and increase the utilization of available heat.

  2. Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts Print Catalytic systems based on bimetallic particles with controlled size, composition, and structure dispersed on a high-surface-area support are widely used for catalytic reforming, pollution control, alcohol oxidation, and electrocatalysis in fuel cells. Owing to the nanoscale size of the particles, the modification of the surface structure and composition that may occur when reaction conditions change can have dramatic

  3. Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts Print Catalytic systems based on bimetallic particles with controlled size, composition, and structure dispersed on a high-surface-area support are widely used for catalytic reforming, pollution control, alcohol oxidation, and electrocatalysis in fuel cells. Owing to the nanoscale size of the particles, the modification of the surface structure and composition that may occur when reaction conditions change can have dramatic

  4. Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts Print Catalytic systems based on bimetallic particles with controlled size, composition, and structure dispersed on a high-surface-area support are widely used for catalytic reforming, pollution control, alcohol oxidation, and electrocatalysis in fuel cells. Owing to the nanoscale size of the particles, the modification of the surface structure and composition that may occur when reaction conditions change can have dramatic

  5. Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts Print Catalytic systems based on bimetallic particles with controlled size, composition, and structure dispersed on a high-surface-area support are widely used for catalytic reforming, pollution control, alcohol oxidation, and electrocatalysis in fuel cells. Owing to the nanoscale size of the particles, the modification of the surface structure and composition that may occur when reaction conditions change can have dramatic

  6. Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts Print Catalytic systems based on bimetallic particles with controlled size, composition, and structure dispersed on a high-surface-area support are widely used for catalytic reforming, pollution control, alcohol oxidation, and electrocatalysis in fuel cells. Owing to the nanoscale size of the particles, the modification of the surface structure and composition that may occur when reaction conditions change can have dramatic

  7. Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts Print Catalytic systems based on bimetallic particles with controlled size, composition, and structure dispersed on a high-surface-area support are widely used for catalytic reforming, pollution control, alcohol oxidation, and electrocatalysis in fuel cells. Owing to the nanoscale size of the particles, the modification of the surface structure and composition that may occur when reaction conditions change can have dramatic

  8. Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts Print Catalytic systems based on bimetallic particles with controlled size, composition, and structure dispersed on a high-surface-area support are widely used for catalytic reforming, pollution control, alcohol oxidation, and electrocatalysis in fuel cells. Owing to the nanoscale size of the particles, the modification of the surface structure and composition that may occur when reaction conditions change can have dramatic

  9. Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts Print Catalytic systems based on bimetallic particles with controlled size, composition, and structure dispersed on a high-surface-area support are widely used for catalytic reforming, pollution control, alcohol oxidation, and electrocatalysis in fuel cells. Owing to the nanoscale size of the particles, the modification of the surface structure and composition that may occur when reaction conditions change can have dramatic

  10. Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts Print Catalytic systems based on bimetallic particles with controlled size, composition, and structure dispersed on a high-surface-area support are widely used for catalytic reforming, pollution control, alcohol oxidation, and electrocatalysis in fuel cells. Owing to the nanoscale size of the particles, the modification of the surface structure and composition that may occur when reaction conditions change can have dramatic

  11. User-Driven Sampling Strategies in Image Exploitation

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Harvey, Neal R.; Porter, Reid B.

    2013-12-23

    Visual analytics and interactive machine learning both try to leverage the complementary strengths of humans and machines to solve complex data exploitation tasks. These fields overlap most significantly when training is involved: the visualization or machine learning tool improves over time by exploiting observations of the human-computer interaction. This paper focuses on one aspect of the human-computer interaction that we call user-driven sampling strategies. Unlike relevance feedback and active learning sampling strategies, where the computer selects which data to label at each iteration, we investigate situations where the user selects which data is to be labeled at each iteration. User-drivenmore » sampling strategies can emerge in many visual analytics applications but they have not been fully developed in machine learning. We discovered that in user-driven sampling strategies suggest new theoretical and practical research questions for both visualization science and machine learning. In this paper we identify and quantify the potential benefits of these strategies in a practical image analysis application. We find user-driven sampling strategies can sometimes provide significant performance gains by steering tools towards local minima that have lower error than tools trained with all of the data. Furthermore, in preliminary experiments we find these performance gains are particularly pronounced when the user is experienced with the tool and application domain.« less

  12. Cathode fall model and current-voltage characteristics of field emission driven direct current microplasmas

    SciTech Connect (OSTI)

    Venkattraman, Ayyaswamy

    2013-11-15

    The post-breakdown characteristics of field emission driven microplasma are studied theoretically and numerically. A cathode fall model assuming a linearly varying electric field is used to obtain equations governing the operation of steady state field emission driven microplasmas. The results obtained from the model by solving these equations are compared with particle-in-cell with Monte Carlo collisions simulation results for parameters including the plasma potential, cathode fall thickness, ion number density in the cathode fall, and current density vs voltage curves. The model shows good overall agreement with the simulations but results in slightly overpredicted values for the plasma potential and the cathode fall thickness attributed to the assumed electric field profile. The current density vs voltage curves obtained show an arc region characterized by negative slope as well as an abnormal glow discharge characterized by a positive slope in gaps as small as 10 ?m operating at atmospheric pressure. The model also retrieves the traditional macroscale current vs voltage theory in the absence of field emission.

  13. Plug-in Hybrid Electric Vehicle Fuel Use Reporting Methods and Results

    SciTech Connect (OSTI)

    James E. Francfort

    2009-07-01

    The Plug-in Hybrid Electric Vehicle (PHEV) Fuel Use Reporting Methods and Results report provides real world test results from PHEV operations and testing in 20 United States and Canada. Examples are given that demonstrate the significant variations operational parameters can have on PHEV petroleum use. In addition to other influences, PHEV mpg results are significantly impacted by driver aggressiveness, cold temperatures, and whether or not the vehicle operator has charged the PHEV battery pack. The U.S. Department of Energys (DOEs) Advanced Vehicle Testing Activity (AVTA) has been testing plug-in hybrid electric vehicles (PHEVs) for several years. The AVTA http://avt.inl.gov/), which is part of DOEs Vehicle Technology Program, also tests other advanced technology vehicles, with 12 million miles of total test vehicle and data collection experience. The Idaho National Laboratory is responsible for conducting the light-duty vehicle testing of PHEVs. Electric Transportation Engineering Corporation also supports the AVTA by conducting PHEV and other types of testing. To date, 12 different PHEV models have been tested, with more than 600,000 miles of PHEV operations data collected.

  14. AN INTERPRETATION OF GLE71 CONCURRENT CME-DRIVEN SHOCK WAVE

    SciTech Connect (OSTI)

    Firoz, Kazi A.; Rodrguez-Pacheco, J.; Zhang, Q. M.; Gan, W. Q.; Li, Y. P.; Moon, Y.-J.; Kudela, K.; Park, Y.-D.; Dorman, Lev I. E-mail: firoz.kazi@uah.es

    2014-08-01

    Particle accelerations in solar flares and CME-driven shocks can sometimes result in very high-energy particle events (?1 GeV) that are known as ground level enhancements (GLEs). Recent studies on the first GLE event (GLE71 2012 May 17 01:50 UT) of solar cycle 24 suggested that CME-driven shock played a leading role in causing the event. To verify this claim, we have made an effort to interpret the GLE71 concurrent shock wave. For this, we have deduced the possible speed and height of the shock wave in terms of the frequency (MHz) of the solar radio type II burst and its drift rate (MHz min{sup 1}), and studied the temporal evolution of the particle intensity profiles at different heights of the solar corona. For a better perception of the particle acceleration in the shock, we have studied the solar radio type II burst with concurrent solar radio and electron fluxes. When the particle intensity profiles are necessarily shifted in time at ?1 AU, it is found that the growth phases of the electron and cosmic ray intensity fluxes are strongly correlated (>0.91; ?0.87) with the frequency drift rate of the type II burst, which is also consistent with the intensive particle accelerations at upper coronal heights (??0.80 R {sub S} < 1.10 R {sub S}). Thus, we conclude that the CME-driven shock was possibly capable of producing the high-energy particle event. However, since the peaks of some flare components are found to be strongly associated with the fundamental phase of the type II burst, the preceding flare is supposed to contribute to the shock acceleration process.

  15. ''A ground water resources study of a Pacific Ocean atoll - Tarawa, Gilbert Islands,'' by J. W. Lloyd, J. C. Miles, G. R. Chessmand, and S. F. Bugg

    SciTech Connect (OSTI)

    Wheatcraft, S.W.; Buddemeier, R.W.

    1981-10-01

    Several inherent problems in the methodology employed in the ground water resource study of Tarawa Atoll (Lloyd, et al., 1981) are described. Studies of Enewetak Atoll have provided data that require a significantly different conceptual model of the atoll hydrogeology system. Comparison of well, lagoon, and ocean tidal observations with a mathematical model that assumes horizontal tidal propagation indicates that the observed results are more consistent with a system that is controlled by vertical coupling between the unconsolidated surface aquifer and an underlying aquifer of more permeable limestone. This indicates that most fresh water recharged to the aquifer migrates downward and mixes with the sea water in a deeper aquifer providing easy exchange with the ocean. Lloyd, et al., do not take tidal mixing or vertical transport into account and it therefore seems likely that fresh water inventories are significantly overestimated. Failure to include these significant loss terms in the island water budget may also account for calculated heads above ground level. (JMT)

  16. Inertial Fusion Driven by Intense Heavy-Ion Beams

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    INERTIAL FUSION DRIVEN BY INTENSE HEAVY-ION BEAMS * W. M. Sharp # , A. Friedman, D. P. Grote, J. J. Barnard, R. H. Cohen, M. A. Dorf, S. M. Lund, L. J. Perkins, M. R. Terry, LLNL, Livermore, CA, USA B. G. Logan, F. M. Bieniosek, A. Faltens, E. Henestroza, J.-Y. Jung, J. W. Kwan, E. P. Lee, S. M. Lidia, P. A. Ni, L. L. Reginato, P. K. Roy, P. A. Seidl, J. H. Takakuwa, J.-L. Vay, W. L. Waldron, LBNL, Berkeley, CA, USA R. C. Davidson, E. P. Gilson, I. D. Kaganovich, H. Qin, E. Startsev, PPPL,

  17. A measurable force driven by an excitonic condensate

    SciTech Connect (OSTI)

    Hakio?lu, T.; zgn, Ege; Gnay, Mehmet

    2014-04-21

    Free energy signatures related to the measurement of an emergent force (?10{sup ?9}N) due to the exciton condensate (EC) in Double Quantum Wells are predicted and experiments are proposed to measure the effects. The EC-force is attractive and reminiscent of the Casimir force between two perfect metallic plates, but also distinctively different from it by its driving mechanism and dependence on the parameters of the condensate. The proposed experiments are based on a recent experimental work on a driven micromechanical oscillator. Conclusive observations of EC in recent experiments also provide a strong promise for the observation of the EC-force.

  18. Tracking the CME-driven shock wave on 2012 March 5 and radio triangulation of associated radio emission

    SciTech Connect (OSTI)

    Magdaleni?, J.; Marqu, C.; Mierla, M.; Zhukov, A. N.; Rodriguez, L.; Krupar, V.; Maksimovi?, M.; Cecconi, B.

    2014-08-20

    We present a multiwavelength study of the 2012 March 5 solar eruptive event, with an emphasis on the radio triangulation of the associated radio bursts. The main points of the study are reconstruction of the propagation of shock waves driven by coronal mass ejections (CMEs) using radio observations and finding the relative positions of the CME, the CME-driven shock wave, and its radio signatures. For the first time, radio triangulation is applied to different types of radio bursts in the same event and performed in a detailed way using goniopolarimetric observations from STEREO/Waves and WIND/Waves spacecraft. The event on 2012 March 5 was associated with a X1.1 flare from the NOAA AR 1429 situated near the northeast limb, accompanied by a full halo CME and a radio event comprising long-lasting interplanetary type II radio bursts. The results of the three-dimensional reconstruction of the CME (using SOHO/LASCO, STEREO COR, and HI observations), and modeling with the ENLIL cone model suggest that the CME-driven shock wave arrived at 1 AU at about 12:00 UT on March 7 (as observed by SOHO/CELIAS). The results of radio triangulation show that the source of the type II radio burst was situated on the southern flank of the CME. We suggest that the interaction of the shock wave and a nearby coronal streamer resulted in the interplanetary type II radio emission.

  19. Role of magnetic fluctuations in mode selection of magnetically driven instabilities

    SciTech Connect (OSTI)

    Dan, Jia-Kun Ren, Xiao-Dong; Huang, Xian-Bin; Ouyang, Kai; Chen, Guang-Hua

    2014-12-15

    The influences of magnetic fluctuations on quasiperiodic structure formation and fundamental wavelength selection of the instability have been studied using two 25-μm-diameter tungsten wires on a 100  ns rise time, 220 kA pulsed power facility. Two different load configurations were adopted to make end surfaces of electrodes approximately satisfy reflecting and absorbing boundary conditions, respectively. The experimental results that the fundamental wavelength in the case of absorbing boundary condition is about one half of that in the case of reflecting boundary condition have demonstrated that magnetic fluctuations appear to play a key role in mode selection of magnetically driven instabilities. The dominant wavelength should be proportional to magnetic field and inversely proportional to square root of mass density, provided that the magnetosonic wave propagating perpendicular to magnetic fields provides a leading candidate for magnetic fluctuations. Therefore, magnetic fluctuation is one of the three key perturbations, along with surface contaminants and surface roughness, that seeds magnetically driven instabilities.

  20. Misfit strain driven cation inter-diffusion across an epitaxial multiferroic thin film interface

    SciTech Connect (OSTI)

    Sankara Rama Krishnan, P. S.; Munroe, Paul; Nagarajan, V.; Morozovska, Anna N.; Eliseev, Eugene A.; Ramasse, Quentin M.; Kepaptsoglou, Demie; Liang, Wen-I.; Chu, Ying-Hao

    2014-02-07

    Cation intermixing at functional oxide interfaces remains a highly controversial area directly relevant to interface-driven nanoelectronic device properties. Here, we systematically explore the cation intermixing in epitaxial (001) oriented multiferroic bismuth ferrite (BFO) grown on a (001) lanthanum aluminate (LAO) substrate. Aberration corrected dedicated scanning transmission electron microscopy and electron energy loss spectroscopy reveal that the interface is not chemically sharp, but with an intermixing of ?2?nm. The driving force for this process is identified as misfit-driven elastic strain. Landau-Ginzburg-Devonshire-based phenomenological theory was combined with the Sheldon and Shenoy formula in order to understand the influence of boundary conditions and depolarizing fields arising from misfit strain between the LAO substrate and BFO film. The theory predicts the presence of a strong potential gradient at the interface, which decays on moving into the bulk of the film. This potential gradient is significant enough to drive the cation migration across the interface, thereby mitigating the misfit strain. Our results offer new insights on how chemical roughening at oxide interfaces can be effective in stabilizing the structural integrity of the interface without the need for misfit dislocations. These findings offer a general formalism for understanding cation intermixing at highly strained oxide interfaces that are used in nanoelectronic devices.

  1. 2004 User Survey Results

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    13 | Next 2004 User Survey Results Table of Contents Response Summary Respondent Demographics Overall Satisfaction and Importance All Satisfaction, Importance and Usefulness...

  2. 2006 User Survey Results

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    to provide overall comments about NERSC: Here are the survey results: Respondent Demographics Overall Satisfaction and Importance All Satisfaction, Importance and Usefulness...

  3. 2005 User Survey Results

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    10 | Next 2005 User Survey Results Table of Contents Response Summary Respondent Demographics All Satisfaction, Importance and Usefulness Ratings Hardware Resources Software...

  4. 2003 User Survey Results

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    10 | Next 2003 User Survey Results Table of Contents Response Summary Respondent Demographics Overall Satisfaction and Importance All Satisfaction Topics and Changes from...

  5. Big Problems. Big Results.

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    metal oxide in groundwater. The results are revealing new insights about microbiological activity and contaminant movement below the ground's surface. PNNL scientists invented...

  6. Aspect Ratio Effects in the Driven, Flux-Core Spheromak

    SciTech Connect (OSTI)

    Hooper, E B; Romero-Talam?s, C A; LoDestro, L L; Wood, R D; McLean, H S

    2009-03-02

    Resistive magneto-hydrodynamic simulations are used to evaluate the effects of the aspect ratio, A (length to radius ratio) in a spheromak driven by coaxial helicity injection. The simulations are benchmarked against the Sustained Spheromak Physics Experiment (SSPX) [R. D. Wood, et al., Nucl. Nucl. Fusion 45, 1582 (2005)]. Amplification of the bias ('gun') poloidal flux is fit well by a linear dependence (insensitive to A) on the ratio of gun current and bias flux above a threshold dependent on A. For low flux amplifications in the simulations the n = 1 mode is coherent and the mean-field geometry looks like a tilted spheromak. Because the mode has relatively large amplitude the field lines are open everywhere, allowing helicity penetration. Strongly-driven helicity injection at A {le} 1.4 in simulations generates reconnection events which open the magnetic field lines; this state is characteristic of SSPX. Near the spheromak tilt-mode limit, A {approx} 1.67 for a cylindrical flux conserver, the tilt approaches 90{sup o}; reconnection events are not generated up to the strongest drives simulated. The time-sequence of these events suggests that they are representative of a chaotic process. Implications for spheromak experiments are discussed.

  7. OBSERVATION OF MAGNETIC RECONNECTION DRIVEN BY GRANULAR SCALE ADVECTION

    SciTech Connect (OSTI)

    Zeng Zhicheng; Cao Wenda; Ji Haisheng

    2013-06-01

    We report the first evidence of magnetic reconnection driven by advection in a rapidly developing large granule using high spatial resolution observations of a small surge event (base size {approx} 4'' Multiplication-Sign 4'') with the 1.6 m aperture New Solar Telescope at the Big Bear Solar Observatory. The observations were carried out in narrowband (0.5 A) He I 10830 A and broadband (10 A) TiO 7057 A. Since He I 10830 A triplet has a very high excitation level and is optically thin, its filtergrams enable us to investigate the surge from the photosphere through the chromosphere into the lower corona. Simultaneous space data from the Atmospheric Imaging Assembly and Helioseismic and Magnetic Imager on board the Solar Dynamics Observatory were used in the analysis. It is shown that the surge is spatio-temporally associated with magnetic flux emergence in the rapidly developing large granule. During the development of the granule, its advecting flow ({approx}2 km s{sup -1}) squeezed the magnetic flux into an intergranular lane area, where a magnetic flux concentration was formed and the neighboring flux with opposite magnetic polarity was canceled. During the cancellation, the surge was produced as absorption in He I 10830 A filtergrams while simultaneous EUV brightening occurred at its base. The observations clearly indicate evidence of a finest-scale reconnection process driven by the granule's motion.

  8. Atmospheric escape by magnetically driven wind from gaseous planets

    SciTech Connect (OSTI)

    Tanaka, Yuki A.; Suzuki, Takeru K.; Inutsuka, Shu-ichiro

    2014-09-01

    We calculate the mass loss driven by magnetohydrodynamic (MHD) waves from hot Jupiters by using MHD simulations in one-dimensional flux tubes. If a gaseous planet has a magnetic field, MHD waves are excited by turbulence at the surface, dissipate in the upper atmosphere, and drive gas outflows. Our calculation shows that mass-loss rates are comparable to the observed mass-loss rates of hot Jupiters; therefore, it is suggested that gas flow driven by MHD waves can play an important role in the mass loss from gaseous planets. The mass-loss rate varies dramatically with the radius and mass of a planet: a gaseous planet with a small mass but an inflated radius produces a very large mass-loss rate. We also derive an analytical expression for the dependence of mass-loss rate on planet radius and mass that is in good agreement with the numerical calculation. The mass-loss rate also depends on the amplitude of the velocity dispersion at the surface of a planet. Thus, we expect to infer the condition of the surface and the internal structure of a gaseous planet from future observations of mass-loss rate from various exoplanets.

  9. Fluid-driven reciprocating apparatus and valving for controlling same

    DOE Patents [OSTI]

    Whitehead, John C. (Davis, CA); Toews, Hans G. (East Aurora, NY)

    1993-01-01

    A control valve assembly for alternately actuating a pair of fluid-driven free-piston devices by using fluid pressure communication therebetween. Each control valve is switched by a pressure signal depending on the state of its counterpart's piston. The communication logic is arranged to provide overlap of the forward strokes of the pistons, so that at least one of the pair will always be pressurized. Thus, uninterrupted pumping of liquid is made possible from a pair of free-piston pumps. In addition, the speed and frequency of piston stroking is entirely dependent on the mechanical power load applied. In the case of a pair of pumps, this enables liquid delivery at a substantially constant pressure over the full range of flow rates, from zero to maximum flow. One embodiment of the invention utilized two pairs of fluid-driven free-piston devices whereby a bipropellant liquid propulsion system may be operated, so as to provide continuous flow of both fuel and oxidizer liquids when used in rocket applications, for example.

  10. Development of a plasma driven permeation experiment for TPE

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Buchenauer, Dean; Kolasinski, Robert; Shimada, Masa; Donovan, David; Youchison, Dennis; Merrill, Brad

    2014-04-18

    Experiments on retention of hydrogen isotopes (including tritium) at temperatures less than 800 ?C have been carried out in the Tritium Plasma Experiment (TPE) at Idaho National Laboratory [1,2]. To provide a direct measurement of plasma driven permeation in plasma facing materials at temperatures reaching 1000 ?C, a new TPE membrane holder has been built to hold test specimens (=1 mm in thickness) at high temperature while measuring tritium permeating through the membrane from the plasma facing side. This measurement is accomplished by employing a carrier gas that transports the permeating tritium from the backside of the membrane to ionmore » chambers giving a direct measurement of the plasma driven tritium permeation rate. Isolation of the membrane cooling and sweep gases from TPE’s vacuum chamber has been demonstrated by sealing tests performed up to 1000 ?C of a membrane holder design that provides easy change out of membrane specimens between tests. Simulations of the helium carrier gas which transports tritium to the ion chamber indicate a very small pressure drop (~700 Pa) with good flow uniformity (at 1000 sccm). Thermal transport simulations indicate that temperatures up to 1000 ?C are expected at the highest TPE fluxes.« less

  11. Beam-driven acceleration in ultra-dense plasma media

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Shin, Young-Min

    2014-09-15

    Accelerating parameters of beam-driven wakefield acceleration in an extremely dense plasma column has been analyzed with the dynamic framed particle-in-cell plasma simulator, and compared with analytic calculations. In the model, a witness beam undergoes a TeV/m scale alternating potential gradient excited by a micro-bunched drive beam in a 1025 m-3 and 1.6 x 1028 m-3 plasma column. The acceleration gradient, energy gain, and transformer ratio have been extensively studied in quasi-linear, linear-, and blowout-regimes. The simulation analysis indicated that in the beam-driven acceleration system a hollow plasma channel offers 20 % higher acceleration gradient by enlarging the channel radius (r)more » from 0.2 Ap to 0.6 .Ap in a blowout regime. This paper suggests a feasibility of TeV/m scale acceleration with a hollow crystalline structure (e.g. nanotubes) of high electron plasma density.« less

  12. Z-petawatt driven ion beam radiography development.

    SciTech Connect (OSTI)

    Schollmeier, Marius; Geissel, Matthias; Rambo, Patrick K.; Schwarz, Jens; Sefkow, Adam B.

    2013-09-01

    Laser-driven proton radiography provides electromagnetic field mapping with high spatiotemporal resolution, and has been applied to many laser-driven High Energy Density Physics (HEDP) experiments. Our report addresses key questions about the feasibility of ion radiography at the Z-Accelerator (%E2%80%9CZ%E2%80%9D), concerning laser configuration, hardware, and radiation background. Charged particle tracking revealed that radiography at Z requires GeV scale protons, which is out of reach for existing and near-future laser systems. However, it might be possible to perform proton deflectometry to detect magnetic flux compression in the fringe field region of a magnetized liner inertial fusion experiment. Experiments with the Z-Petawatt laser to enhance proton yield and energy showed an unexpected scaling with target thickness. Full-scale, 3D radiation-hydrodynamics simulations, coupled to fully explicit and kinetic 2D particle-in-cell simulations running for over 10 ps, explain the scaling by a complex interplay of laser prepulse, preplasma, and ps-scale temporal rising edge of the laser.

  13. Filamentation instability of nonextensive current-driven plasma in the ion acoustic frequency range

    SciTech Connect (OSTI)

    Khorashadizadeh, S. M. Rastbood, E.; Niknam, A. R.

    2014-12-15

    The filamentation and ion acoustic instabilities of nonextensive current-driven plasma in the ion acoustic frequency range have been studied using the Lorentz transformation formulas. Based on the kinetic theory, the possibility of filamentation instability and its growth rate as well as the ion acoustic instability have been investigated. The results of the research show that the possibility and growth rate of these instabilities are significantly dependent on the electron nonextensive parameter and drift velocity. Besides, the increase of electrons nonextensive parameter and drift velocity lead to the increase of the growth rates of both instabilities. In addition, the wavelength region in which the filamentation instability occurs is more stretched in the presence of higher values of drift velocity and nonextensive parameter. Finally, the results of filamentation and ion acoustic instabilities have been compared and the conditions for filamentation instability to be dominant mode of instability have been presented.

  14. Nonlinear dynamics of three-magnon process driven by ferromagnetic resonance in yttrium iron garnet

    SciTech Connect (OSTI)

    Cunha, R. O.; Holanda, J.; Azevedo, A.; Rezende, S. M.; Vilela-Leo, L. H.; Rodrguez-Surez, R. L.

    2015-05-11

    We report an investigation of the dynamics of the three-magnon splitting process associated with the ferromagnetic resonance (FMR) in films of the insulating ferrimagnet yttrium iron garnet (YIG). The experiments are performed with a 6??m thick YIG film close to a microstrip line fed by a microwave generator operating in the 26?GHz range. The magnetization precession is driven by the microwave rf magnetic field perpendicular to the static magnetic field, and its dynamics is observed by monitoring the amplitude of the FMR absorption peak. The time evolution of the amplitude reveals that if the frequency is lowered below a critical value of 3.3?GHz, the FMR mode pumps two magnons with opposite wave vectors that react back on the FMR, resulting in a nonlinear dynamics of the magnetization. The results are explained by a model with coupled nonlinear equations describing the time evolution of the magnon modes.

  15. 1st Mile | Open Energy Information

    Open Energy Info (EERE)

    research and screening for venture capitalists. Website: www.1stmile.dk Coordinates: 56.866669, 8.31667 Show Map Loading map... "minzoom":false,"mappingservice":"googlemap...

  16. 1999 User Survey Results

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    helpful. At times they went beyond the scope of my request which resulted in making my job easier." "Provides reliable machines, which are well-maintained and have scheduling...

  17. Testbed: Published Results

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Testbed Results Network R&D Software-Defined Networking (SDN) Experimental Network Testbeds 100G SDN Testbed Dark Fiber Testbed Test Circuit Service Testbed Results Current Testbed Research Previous Testbed Research Performance (perfSONAR) Software & Tools Development Data for Researchers Partnerships Publications Workshops Contact Us Technical Assistance: 1 800-33-ESnet (Inside US) 1 800-333-7638 (Inside US) 1 510-486-7600 (Globally) 1 510-486-7607 (Globally) Report Network Problems:

  18. WIND-DRIVEN ACCRETION IN PROTOPLANETARY DISKS. II. RADIAL DEPENDENCE AND GLOBAL PICTURE

    SciTech Connect (OSTI)

    Bai Xuening, E-mail: xbai@cfa.harvard.edu [Institute for Theory and Computation, Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, MS-51, Cambridge, MA 02138 (United States)

    2013-08-01

    Non-ideal magnetohydrodynamical effects play a crucial role in determining the mechanism and efficiency of angular momentum transport as well as the level of turbulence in protoplanetary disks (PPDs), which are the key to understanding PPD evolution and planet formation. It was shown in our previous work that at 1 AU, the magnetorotational instability (MRI) is completely suppressed when both ohmic resistivity and ambipolar diffusion (AD) are taken into account, resulting in a laminar flow with accretion driven by magnetocentrifugal wind. In this work, we study the radial dependence of the laminar wind solution using local shearing-box simulations. The scaling relation on the angular momentum transport for the laminar wind is obtained, and we find that the wind-driven accretion rate can be approximated as M-dot approx. 0.91 x 10{sup -8}R{sub AU}{sup 1.21}(B{sub p}/10 mG){sup 0.93} M{sub Sun} yr{sup -1}, where B{sub p} is the strength of the large-scale poloidal magnetic field threading the disk. The result is independent of disk surface density. Four criteria are outlined for the existence of the laminar wind solution: (1) ohmic resistivity dominated the midplane region, (2) the AD-dominated disk upper layer, (3) the presence of a (not too weak) net vertical magnetic flux, and (4) sufficiently well-ionized gas beyond the disk surface. All these criteria are likely to be met in the inner region of the disk from {approx}0.3 AU to about 5-10 AU for typical PPD accretion rates. Beyond this radius, the angular momentum transport is likely to proceed due to a combination of the MRI and disk wind, and eventually completely dominated by the MRI (in the presence of strong AD) in the outer disk. Our simulation results provide key ingredients for a new paradigm on the accretion processes in PPDs.

  19. Experimental study on the thorium-loaded accelerator-driven system at the

    Office of Scientific and Technical Information (OSTI)

    Kyoto Univ. critical assembly (Conference) | SciTech Connect Experimental study on the thorium-loaded accelerator-driven system at the Kyoto Univ. critical assembly Citation Details In-Document Search Title: Experimental study on the thorium-loaded accelerator-driven system at the Kyoto Univ. critical assembly The experimental study on the thorium-loaded accelerator-driven system (ADS) is conducted in the Kyoto Univ. Critical Assembly (KUCA). The experiments are carried out in both the

  20. Accelerator driven sub-critical core (Patent) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Patent: Accelerator driven sub-critical core Citation Details In-Document Search Title: Accelerator driven sub-critical core Systems and methods for operating an accelerator driven sub-critical core. In one embodiment, a fission power generator includes a sub-critical core and a plurality of proton beam generators. Each of the proton beam generators is configured to concurrently provide a proton beam into a different area of the sub-critical core. Each proton beam scatters neutrons within the

  1. Accelerator-driven subcritical fission in molten salt core: Closing the

    Office of Scientific and Technical Information (OSTI)

    nuclear fuel cycle for green nuclear energy (Journal Article) | SciTech Connect Accelerator-driven subcritical fission in molten salt core: Closing the nuclear fuel cycle for green nuclear energy Citation Details In-Document Search Title: Accelerator-driven subcritical fission in molten salt core: Closing the nuclear fuel cycle for green nuclear energy A technology for accelerator-driven subcritical fission in a molten salt core (ADSMS) is being developed as a basis for the destruction of

  2. Bioenergy Demand in a Market Driven Forest Economy (U.S. South) |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Demand in a Market Driven Forest Economy (U.S. South) Bioenergy Demand in a Market Driven Forest Economy (U.S. South) Breakout Session 1A: Biomass Feedstocks for the Bioeconomy Bioenergy Demand in a Market Driven Forest Economy (U.S. South) Robert C. Abt, Professor of Natural Resource Economics and Management, North Carolina State University PDF icon abt_bioenergy_2015.pdf More Documents & Publications Biomass Program Peer Review Sustainability Platform Biomass as

  3. Spin-driven multiferroics in BaYFeO{sub 4} (Journal Article) | SciTech

    Office of Scientific and Technical Information (OSTI)

    Connect Spin-driven multiferroics in BaYFeO{sub 4} Citation Details In-Document Search Title: Spin-driven multiferroics in BaYFeO{sub 4} We report on the spin-driven multiferroic property and magnetoelectric effect in the lately synthesized compound BaYFeO{sub 4}. Due to its peculiar crystal structure, the system exhibits complex magnetic phases with multiple transitions. The dielectric and pyroelectric measurements evidence a spin-driven multiferroic state raised by the cycloidal spin

  4. Systems Modeling for a Laser-Driven IFE Power Plant using Direct...

    Office of Scientific and Technical Information (OSTI)

    IFE Power Plant using Direct Conversion Citation Details In-Document Search Title: Systems Modeling for a Laser-Driven IFE Power Plant using Direct Conversion You ...

  5. Buoyancy-Driven Ventilation of Hydrogen from Buildings: Laboratory Test and Model Validation

    SciTech Connect (OSTI)

    Barley, C. D.; Gawlik, K.

    2009-05-01

    Passive, buoyancy-driven ventilation is one approach to limiting hydrogen concentration. We explored the relationship between leak rate, ventilation design, and hydrogen concentrations.

  6. Radiation Transport and Energetics of Laser-driven Half-hohlraums...

    Office of Scientific and Technical Information (OSTI)

    Radiation Transport and Energetics of Laser-driven Half-hohlraums at the National Ignition Facility Citation Details In-Document Search Title: Radiation Transport and Energetics of ...

  7. Hawaiis EVolution: Hawaii Powered. Technology Driven. ...

    Broader source: Energy.gov (indexed) [DOE]

    Powered. Technology Driven. Table of Contents Charting the Course Toward a Clean Energy Future 4 Forging a New Path for Island Transportation 5 Embracing New Alternatives 6...

  8. Recent results from MAC

    SciTech Connect (OSTI)

    MAC Collaboration

    1982-05-01

    Some preliminary results from the MAC detector at PEP are presented. These include measurements of the angular distribution of ..gamma gamma.., ..mu mu.. and tau tau final states, a determination of the tau lifetime, a measurement of R, and a presentation of the inclusive muon p/sub perpendicular/ distribution for hadronic events.

  9. Plans, Implementation, and Results

    Broader source: Energy.gov [DOE]

    The Bioenergy Technologies Office carries out technology research, development, and deployment through an ongoing process of planning and analysis, implementation, and review. This Web page includes links to documents that support and document the program management process, and the results and public benefits that derive from it.

  10. Light and phospholipid driven structural transitions in nematic microdroplets

    SciTech Connect (OSTI)

    Dubtsov, A. V., E-mail: alexanderdubtsov@gmail.com; Pasechnik, S. V.; Shmeliova, D. V. [Moscow State University of Instrument Engineering and Computer Science, Stromynka 20, Moscow 107996 (Russian Federation); Kralj, Samo [Condensed Matter Physics Department, Joef Stefan Institute, Jamova 39, 1000 Ljubljana (Slovenia); FNM, University of Maribor, Koroska 160, 2000 Maribor (Slovenia)

    2014-10-13

    We studied the UV-irradiation and phospholipid driven bipolar-radial structural transitions within azoxybenzene nematic liquid crystal (LC) droplets dispersed in water. It was found that the UV-irradiation induced trans-cis isomerisation of LC molecules could enable structural transitions into radial-type configurations at a critical UV-irradiation time t{sub c}. In particular, we show that under appropriate conditions, a value of t{sub c} could sensitively fingerprint the concentration of phospholipid molecules present in LC-water dispersions. This demonstrated proof-of-principle mechanism could be exploited for development of sensitive detectors for specific nanoparticles (NPs), where value of t{sub c} reveals concentration of NPs.

  11. Laser-driven Sisyphus cooling in an optical dipole trap

    SciTech Connect (OSTI)

    Ivanov, Vladyslav V.; Gupta, Subhadeep

    2011-12-15

    We propose a laser-driven Sisyphus-cooling scheme for atoms confined in a far-off resonance optical dipole trap. Utilizing the differential trap-induced ac Stark shift, two electronic levels of the atom are resonantly coupled by a cooling laser preferentially near the trap bottom. After absorption of a cooling photon, the atom loses energy by climbing the steeper potential, and then spontaneously decays preferentially away from the trap bottom. The proposed method is particularly suited to cooling alkaline-earth-metal-like atoms where two-level systems with narrow electronic transitions are present. Numerical simulations for the cases of {sup 88}Sr and {sup 174}Yb demonstrate the expected recoil and Doppler temperature limits. The method requires a relatively small number of scattered photons and can potentially lead to phase-space densities approaching quantum degeneracy in subsecond time scales.

  12. Electron heating during discharges driven by thermionic emission

    SciTech Connect (OSTI)

    Levko, D.; Krasik, Ya. E.

    2014-11-15

    The heating of plasma electrons during discharges driven by thermionic emission is studied using one-dimensional particle-in-cell Monte Carlo collisions modeling that self-consistently takes the dependence of the thermionic current on the plasma parameters into account. It is found that at a gas pressure of 10{sup 2?}Pa the electron two-stream instability is excited. As a consequence, the electrostatic plasma wave propagates from the cathode to the anode. The trapping of electrons by this wave contributes noticeably to the heating of the plasma. At a larger gas pressure, this instability is not excited. As a consequence, plasma electrons are heated only because of the generation of energetic electrons in ionization events and the scattering of emitted electrons.

  13. Instability-driven electromagnetic fields in coronal plasmas

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Manuel, M. J.-E.; Li, C. K.; Seguin, F. H.; Sinenian, N.; Frenje, J. A.; Casey, D. T.; Petrasso, R. D.; Hager, J. D.; Betti, R.; Hu, S. X.; et al

    2013-04-15

    Filamentary electromagnetic fields previously observed in the coronae of laser-driven spherical targets [F. H. S#2;eguin et al., Phys. Plasma. 19, 012701 (2012)] have been further investigated in laser irradiated plastic foils. Face-on proton-radiography provides an axial view of these filaments and shows coherent cellular structure regardless of initial foil-surface conditions. The observed cellular fields are shown to have an approximately constant scale size of #2;210 lm throughout the plasma evolution. A discussion of possible field-generation mechanisms is provided and it is demonstrated that the likely source of the cellular field structure is the magnetothermal instability. Using predicted temperature and densitymore » profiles, the fastest growing modes of this instability were found to be slowly varying in time and consistent with the observed cellular size.« less

  14. Dynamically Driven Phase Transformations in Damaged Composite Materials

    SciTech Connect (OSTI)

    Plohr, JeeYeon N.; Clements, Brad E.; Addessio, Frank L

    2006-07-28

    A model developed for composite materials undergoing dynamicaly driven phase transitions in its constituents has been extended to allow for complex material micro-structure and evolution of damage. In this work, damage is described by interfacial debonding and micro-crack growth. We have applied the analysis to silicon carbide-titanium (SiC-Ti) unidirectional metal matrix composites. In these composites, Ti can undergo a low pressure and temperature solid-solid phase transition. With these extensions we have carried out simulations to study the complex interplay between loading rates, micro-structure, damage, and the thermo-mechanical response of the system as it undergoes a solid-solid phase transitions.

  15. Instability-driven electromagnetic fields in coronal plasmas

    SciTech Connect (OSTI)

    Manuel, M. J.-E.; Li, C. K.; Sguin, F. H.; Sinenian, N.; Frenje, J. A.; Casey, D. T.; Petrasso, R. D.; Hager, J. D.; Betti, R.; Hu, S. X.; Delettrez, J.; Meyerhofer, D. D.

    2013-05-15

    Filamentary electromagnetic fields previously observed in the coronae of laser-driven spherical targets [F. H. Sguin et al., Phys. Plasma. 19, 012701 (2012)] have been further investigated in laser-irradiated plastic foils. Face-on proton-radiography provides an axial view of these filaments and shows coherent cellular structure regardless of initial foil-surface conditions. The observed cellular fields are shown to have an approximately constant scale size of ?210 ?m throughout the plasma evolution. A discussion of possible field-generation mechanisms is provided and it is demonstrated that the likely source of the cellular field structure is the magnetothermal instability. Using predicted temperature and density profiles, the fastest growing modes of this instability were found to be slowly varying in time and consistent with the observed cellular size.

  16. Instability-driven electromagnetic fields in coronal plasmas

    SciTech Connect (OSTI)

    Manuel, M. J.-E.; Li, C. K.; Seguin, F. H.; Sinenian, N.; Frenje, J. A.; Casey, D. T.; Petrasso, R. D.; Hager, J. D.; Betti, R.; Hu, S. X.; Delettrez, J.; Meyerhofer, D. D.

    2013-04-15

    Filamentary electromagnetic fields previously observed in the coronae of laser-driven spherical targets [F. H. S#2;eguin et al., Phys. Plasma. 19, 012701 (2012)] have been further investigated in laser irradiated plastic foils. Face-on proton-radiography provides an axial view of these filaments and shows coherent cellular structure regardless of initial foil-surface conditions. The observed cellular fields are shown to have an approximately constant scale size of #2;210 lm throughout the plasma evolution. A discussion of possible field-generation mechanisms is provided and it is demonstrated that the likely source of the cellular field structure is the magnetothermal instability. Using predicted temperature and density profiles, the fastest growing modes of this instability were found to be slowly varying in time and consistent with the observed cellular size.

  17. Heat-driven spin transport in a ferromagnetic metal

    SciTech Connect (OSTI)

    Xu, Yadong; Yang, Bowen; Tang, Chi; Jiang, Zilong; Shi, Jing; Schneider, Michael; Whig, Renu

    2014-12-15

    As a non-magnetic heavy metal is attached to a ferromagnet, a vertically flowing heat-driven spin current is converted to a transverse electric voltage, which is known as the longitudinal spin Seebeck effect (SSE). If the ferromagnet is a metal, this voltage is also accompanied by voltages from two other sources, i.e., the anomalous Nernst effect in both the ferromagnet and the proximity-induced ferromagnetic boundary layer. By properly identifying and carefully separating those different effects, we find that in this pure spin current circuit the additional spin current drawn by the heavy metal generates another significant voltage by the ferromagnetic metal itself which should be present in all relevant experiments.

  18. Sandia National Laboratories: Search Results

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Search Results Search Results Search Loading

  19. Hugoniot and spall data from the laser-driven miniflyer

    SciTech Connect (OSTI)

    Warnes, R.H.; Paisley, D.L.; Tonks, D.L.

    1996-05-01

    The laser-driven miniflyer has been developed as a small-sized complement to the propellant- or gas-driven gun with which to make material property measurements. Flyer velocities typically range from 0.5 to 1.5 km/s, depending on the energy of the launching laser and the flyer dimensions. The 10{endash}50 {mu}m-thick flyers, 1{endash}3 mm in diameter, and comparably small targets require very little material and are easy to recover for post-experiment analysis. To measure and improve the precision of our measurements, we are conducting an extensive series of experiments impacting well-characterized Cu, Al, and Au on several transparent, calibrated, windows (PMMA, LiF, and sapphire). Measurement of the impact and interface velocities with a high-time-resolution velocity interferometer (VISAR) gives us a point on the Hugoniot of the flyer material. These are then compared to published Hugoniot data taken with conventional techniques. In the spall experiments, a flyer strikes a somewhat thicker target of the same material and creates a spall in the target. Measuring the free-surface velocity of the target gives information on the compressive elastic-plastic response of the target to the impact, the tensile spall strength, and the strain rate at which the spall occurred. Volumetric strain rates at spall in these experiments are frequently in the 10{sup 6}{endash}10{sup 8}s{sup {minus}1} range, considerably higher than the 10{sup 3}{endash}10{sup 4}s{sup {minus}1} range obtainable from gas gun experiments. {copyright} {ital 1996 American Institute of Physics.}

  20. Hugoniot and spall data from the laser-driven miniflyer

    SciTech Connect (OSTI)

    Warnes, R.H.; Paisley, D.L.; Tonks, D.L.

    1995-09-01

    The laser-driven miniflyer has been developed as a small-sized complement to the propellant or gas-driven gun with which to make material property measurements. Flyer velocities typically range from 0.5 to 1.5 km/s, depending on the energy of the launching laser and the flyer dimensions. The 10--50 {micro}m-thick flyers, 1--3 mm in diameter, and comparably small targets require very little material and are easy to recover for post-experiment analysis. To measure and improve the precision of the measurements, the authors are conducting an extensive series of experiments impacting well-characterized Cu, Al, and Au on several transparent, calibrated, windows (PMMA, LiF, and sapphire). Measurement of the impact and interface velocities with a high-time-resolution velocity interferometer (VISAR) gives them a point on the Hugoniot of the flyer material. These are then compared to published Hugoniot data taken with conventional techniques. In the spall experiments, a flyer strikes a somewhat thicker target of the same material and creates a spall in the target. Measuring the free-surface velocity of the target gives information on the compressive elastic-plastic response of the target to the impact, the tensile spall strength, and the strain rate at which the spall occurred. Volumetric strain rates at spall in these experiments are frequently in the 10{sup 6}--10{sup 8} s{sup {minus}1} range, considerably higher than the 10{sup 3}--10{sup 4} s{sup {minus}1} range obtainable from gas gun experiments.

  1. Relativistic MHD simulations of poynting flux-driven jets

    SciTech Connect (OSTI)

    Guan, Xiaoyue; Li, Hui; Li, Shengtai

    2014-01-20

    Relativistic, magnetized jets are observed to propagate to very large distances in many active galactic nuclei (AGNs). We use three-dimensional relativistic MHD simulations to study the propagation of Poynting flux-driven jets in AGNs. These jets are already assumed to be being launched from the vicinity (?10{sup 3} gravitational radii) of supermassive black holes. Jet injections are characterized by a model described in Li et al., and we follow the propagation of these jets to ?parsec scales. We find that these current-carrying jets are always collimated and mildly relativistic. When ?, the ratio of toroidal-to-poloidal magnetic flux injection, is large the jet is subject to nonaxisymmetric current-driven instabilities (CDI) which lead to substantial dissipation and reduced jet speed. However, even with the presence of instabilities, the jet is not disrupted and will continue to propagate to large distances. We suggest that the relatively weak impact by the instability is due to the nature of the instability being convective and the fact that the jet magnetic fields are rapidly evolving on Alfvnic time scales. We present the detailed jet properties and show that far from the jet launching region, a substantial amount of magnetic energy has been transformed into kinetic energy and thermal energy, producing a jet magnetization number ? < 1. In addition, we have also studied the effects of a gas pressure supported 'disk' surrounding the injection region, and qualitatively similar global jet behaviors were observed. We stress that jet collimation, CDIs, and the subsequent energy transitions are intrinsic features of current-carrying jets.

  2. Efficient quasi-monoenergetic ion beams from laser-driven relativistic plasmas

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Palaniyappan, Sasi; Huang, Chengkun; Gautier, Donald C.; Hamilton, Christopher E.; Santiago, Miguel A.; Kreuzer, Christian; Sefkow, Adam B.; Shah, Rahul C.; Fernández, Juan C.

    2015-12-11

    Table-top laser–plasma ion accelerators have many exciting applications, many of which require ion beams with simultaneous narrow energy spread and high conversion efficiency. However, achieving these requirements has been elusive. We report the experimental demonstration of laser-driven ion beams with narrow energy spread and energies up to 18 MeV per nucleon and ~5% conversion efficiency (that is 4 J out of 80-J laser). Using computer simulations we identify a self-organizing scheme that reduces the ion energy spread after the laser exits the plasma through persisting self-generated plasma electric (~1012 V m-1) and magnetic (~104 T) fields. Furthermore, these results contributemore » to the development of next generation compact accelerators suitable for many applications such as isochoric heating for ion-fast ignition and producing warm dense matter for basic science.« less

  3. A magnetically coupled Stirling engine driven heat pump: Design optimization and operating cost analysis

    SciTech Connect (OSTI)

    Vincent, R.J.; Waldron, W.D.

    1990-01-01

    A preliminary design for a 2nd generation, gas-fired free-piston Stirling engine driven heat pump has been developed which incorporates a linear magnetic coupling to drive the refrigerant compressor piston. The Mark 2 machine is intended for the residential heat pump market and has 3 Ton cooling capacity. The new heat pump is an evolutionary design based on the Mark 1 free-piston machine which was successfully developed and independently tested by a major heat pump/air conditioning manufacturer. This paper briefly describes test results that were obtained with the Mark 1 machine and then presents the design and operating cost analysis for the Mark 2 heat pump. Operating costs by month are given for both Chicago and Atlanta. A summary of the manufacturing cost estimates obtained from Pioneer Engineering and Manufacturing Company (PEM) are also given. 9 figs., 3 tabs.

  4. Merits of Stirling-driven vapor-compression systems and their advanced technologies

    SciTech Connect (OSTI)

    Kagawa, Noboru

    1997-12-31

    Stirling engines have unique advantages including a high thermal efficiency, preferable exhaust gas characteristics, multi-fuel usage, and low noise and vibration. On the other hand, heat pump systems are very attractive because of their potential to save energy and to get applicability for space heating and industrial usage. This paper introduced the recognized merits of efficient and environmental-friendly Stirling-driven vapor-compression (SDVC) systems. The differences between SDVC systems and conventional systems were discussed from the aspects of the performance and operating cost. The results show SDVC systems have many advantages. This paper also mentioned about the future R and D which will be required to realize more attractive SDVC system including the initial cost issues and several advance technologies for SDVC. The Lorenz cycle and flash gas removal technologies for heat pump cycle were introduced as the advanced SDVC technologies.

  5. Efficient quasi-monoenergetic ion beams from laser-driven relativistic plasmas

    SciTech Connect (OSTI)

    Palaniyappan, Sasi; Huang, Chengkun; Gautier, Donald C.; Hamilton, Christopher E.; Santiago, Miguel A.; Kreuzer, Christian; Sefkow, Adam B.; Shah, Rahul C.; Fernández, Juan C.

    2015-12-11

    Table-top laser–plasma ion accelerators have many exciting applications, many of which require ion beams with simultaneous narrow energy spread and high conversion efficiency. However, achieving these requirements has been elusive. We report the experimental demonstration of laser-driven ion beams with narrow energy spread and energies up to 18 MeV per nucleon and ~5% conversion efficiency (that is 4 J out of 80-J laser). Using computer simulations we identify a self-organizing scheme that reduces the ion energy spread after the laser exits the plasma through persisting self-generated plasma electric (~1012 V m-1) and magnetic (~104 T) fields. Furthermore, these results contribute to the development of next generation compact accelerators suitable for many applications such as isochoric heating for ion-fast ignition and producing warm dense matter for basic science.

  6. Quantum interference and sub-Poissonian statistics for time-modulated driven dissipative nonlinear oscillators

    SciTech Connect (OSTI)

    Gevorgyan, T. V. [Institute for Physical Research, National Academy of Sciences, Ashtarak-2, 0203 Ashtarak (Armenia); Shahinyan, A. R. [Yerevan State University, A. Manoogian 1, 0025 Yerevan (Armenia); Kryuchkyan, G. Yu. [Institute for Physical Research, National Academy of Sciences, Ashtarak-2, 0203 Ashtarak (Armenia); Yerevan State University, A. Manoogian 1, 0025 Yerevan (Armenia)

    2009-05-15

    We show that quantum-interference phenomena can be realized for the dissipative nonlinear systems exhibiting hysteresis-cycle behavior and quantum chaos. Such results are obtained for a driven dissipative nonlinear oscillator with time-dependent parameters and take place for the regimes of long time intervals exceeding dissipation time and for macroscopic levels of oscillatory excitation numbers. Two schemas of time modulation, (i) periodic variation in the strength of the {chi}(3) nonlinearity; (ii) periodic modulation of the amplitude of the driving force, are considered. These effects are obtained within the framework of phase-space quantum distributions. It is demonstrated that the Wigner functions of oscillatory mode in both bistable and chaotic regimes acquire negative values and interference patterns in parts of phase-space due to appropriately time modulation of the oscillatory nonlinear dynamics. It is also shown that the time modulation of the oscillatory parameters essentially improves the degree of sub-Poissonian statistics of excitation numbers.

  7. Enhanced Component Performance Study: Turbine-Driven Pumps 1998–2012

    SciTech Connect (OSTI)

    T. E. Wierman

    2013-10-01

    This report presents an enhanced performance evaluation of turbine-driven pumps (TDPs) at U.S. commercial nuclear power plants. The data used in this study are based on the operating experience failure reports from fiscal year 1998 through 2012 for the component reliability as reported in the Equipment Performance and Information Exchange (EPIX). The TDP failure modes considered are failure to start, failure to run less than or equal to 1 hour, failure to run more than 1 hour, and (for normally running systems) failure to run. The component reliability estimates and the reliability data are trended for the most recent 10-year period while yearly estimates for reliability are provided for the entire active period. No statistically significant increasing trends were identified in the TDP results. Statistically significant decreasing trends were identified for TDP run hours per reactor critical year and start demands.

  8. Feasibility of an XUV FEL Oscillator Driven by a SCRF Linear Accelerator

    SciTech Connect (OSTI)

    Lumpkin, A. H.; Freund, H. P.; Reinsch, M.

    2014-01-01

    The Advanced Superconducting Test Accelerator (ASTA) facility is currently under construction at Fermi National Accelerator Laboratory. Using a1-ms-long macropulse composed of up to 3000 micropulses, and with beam energies projected from 45 to 800 MeV, the possibility for an extreme ultraviolet (XUV) free-electron laser oscillator (FELO) with the higher energy is evaluated. We have used both GINGER with an oscillator module and the MEDUSA/OPC code to assess FELO saturation prospects at 120 nm, 40 nm, and 13.4 nm. The results support saturation at all of these wavelengths which are also shorter than the demonstrated shortest wavelength record of 176 nm from a storage-ring-based FELO. This indicates linac-driven FELOs can be extended into this XUV wavelength regime previously only reached with single-pass FEL configurations.

  9. Seating Arrangement, Group Composition and Competition-driven Interaction: Effects on Students' Performance in Physics

    SciTech Connect (OSTI)

    Roxas, R. M.; Monterola, C.; Carreon-Monterola, S. L.

    2010-07-28

    We probe the effect of seating arrangement, group composition and group-based competition on students' performance in Physics using a teaching technique adopted from Mazur's peer instruction method. Ninety eight lectures, involving 2339 students, were conducted across nine learning institutions from February 2006 to June 2009. All the lectures were interspersed with student interaction opportunities (SIO), in which students work in groups to discuss and answer concept tests. Two individual assessments were administered before and after the SIO. The ratio of the post-assessment score to the pre-assessment score and the Hake factor were calculated to establish the improvement in student performance. Using actual assessment results and neural network (NN) modeling, an optimal seating arrangement for a class was determined based on student seating location. The NN model also provided a quantifiable method for sectioning students. Lastly, the study revealed that competition-driven interactions increase within-group cooperation and lead to higher improvement on the students' performance.

  10. Final environmental impact statement for the construction and operation of an independent spent fuel storage installation to store the Three Mile Island Unit 2 spent fuel at the Idaho National Engineering and Environmental Laboratory. Docket Number 72-20

    SciTech Connect (OSTI)

    1998-03-01

    This Final Environmental Impact Statement (FEIS) contains an assessment of the potential environmental impacts of the construction and operation of an Independent Spent Fuel Storage Installation (ISFSI) for the Three Mile Island Unit 2 (TMI-2) fuel debris at the Idaho National Engineering and Environmental laboratory (INEEL). US Department of Energy-Idaho Operations Office (DOE-ID) is proposing to design, construct, and operate at the Idaho Chemical Processing Plant (ICPP). The TMI-2 fuel debris would be removed from wet storage, transported to the ISFSI, and placed in storage modules on a concrete basemat. As part of its overall spent nuclear fuel (SNF) management program, the US DOE has prepared a final programmatic environmental impact statement (EIS) that provides an overview of the spent fuel management proposed for INEEL, including the construction and operation of the TMI-2 ISFSI. In addition, DOE-ID has prepared an environmental assessment (EA) to describe the environmental impacts associated with the stabilization of the storage pool and the construction/operation of the ISFSI at the ICPP. As provided in NRC`s NEPA procedures, a FEIS of another Federal agency may be adopted in whole or in part in accordance with the procedures outlined in 40 CFR 1506.3 of the regulations of the Council on Environmental Quality (CEQ). Under 40 CFR 1506.3(b), if the actions covered by the original EIS and the proposed action are substantially the same, the agency adopting another agency`s statement is not required to recirculate it except as a final statement. The NRC has determined that its proposed action is substantially the same as actions considered in DOE`s environmental documents referenced above and, therefore, has elected to adopt the DOE documents as the NRC FEIS.

  11. SPEAR results, 1981

    SciTech Connect (OSTI)

    Scharre, D.L.

    1981-09-01

    New results from SPEAR on the inclusive photon spectrum at the psi' and on J/psi radiative transitions are presented. Evidence for an eta/sub c/' candidate is observed in the psi' inclusive photon spectrum at a mass M = 3592 +- 5 MeV. A new resonance, the theta(1640) which is observed to decay into eta eta, has been seen in radiative transitions from the J/psi. The spin-parity of the l(1440), previously observed in J/psi radiative transitions and originally identified as the E(1420), has been determined to be 0/sup -/.

  12. Recent BABAR Results

    SciTech Connect (OSTI)

    Eigen, Gerald

    2015-04-29

    We present herein the most recent BABAR results on direct CP asymmetry measurements in B → Xsγ, on partial branching fraction and CP asymmetry measurements in B → Xs+-, on a search for B → π/ηℓ+- decays, on a search for lepton number violation in B+ → X-+ℓ'+ modes and a study of B0 →ωω and B0 → ωφ decays.

  13. Organic Separation Test Results

    SciTech Connect (OSTI)

    Russell, Renee L.; Rinehart, Donald E.; Peterson, Reid A.

    2014-09-22

    Separable organics have been defined as “those organic compounds of very limited solubility in the bulk waste and that can form a separate liquid phase or layer” (Smalley and Nguyen 2013), and result from three main solvent extraction processes: U Plant Uranium Recovery Process, B Plant Waste Fractionation Process, and Plutonium Uranium Extraction (PUREX) Process. The primary organic solvents associated with tank solids are TBP, D2EHPA, and NPH. There is concern that, while this organic material is bound to the sludge particles as it is stored in the tanks, waste feed delivery activities, specifically transfer pump and mixer pump operations, could cause the organics to form a separated layer in the tank farms feed tank. Therefore, Washington River Protection Solutions (WRPS) is experimentally evaluating the potential of organic solvents separating from the tank solids (sludge) during waste feed delivery activities, specifically the waste mixing and transfer processes. Given the Hanford Tank Waste Treatment and Immobilization Plant (WTP) waste acceptance criteria per the Waste Feed Acceptance Criteria document (24590-WTP-RPT-MGT-11-014) that there is to be “no visible layer” of separable organics in the waste feed, this would result in the batch being unacceptable to transfer to WTP. This study is of particular importance to WRPS because of these WTP requirements.

  14. Revisiting impacts of nuclear burning for reviving weak shocks in neutrino-driven supernovae

    SciTech Connect (OSTI)

    Nakamura, Ko; Kotake, Kei; Takiwaki, Tomoya; Nishimura, Nobuya

    2014-02-20

    We revisit potential impacts of nuclear burning on the onset of the neutrino-driven explosions of core-collapse supernovae. By changing the neutrino luminosity and its decay time to obtain parametric explosions in one- and two-dimensional (1D and 2D, respectively) models with or without a 13 isotope ? network, we study how the inclusion of nuclear burning could affect the postbounce dynamics for 4 progenitor models; 3 for 15.0 M {sub ?} stars and 1 for an 11.2 M {sub ?} star. We find that the energy supply due to the nuclear burning of infalling material behind the shock can energize the shock expansion, especially for models that produce only marginal explosions in the absence of nuclear burning. These models are energized by nuclear energy deposition when the shock front passes through the silicon-rich layer and/or later as it touches the oxygen-rich layer. Depending on the neutrino luminosity and its decay time, the diagnostic energy of the explosion increases up to a few times 10{sup 50} erg for models with nuclear burning compared to the corresponding models without. We point out that these features are most remarkable for the Limongi-Chieffi progenitor in both 1D and 2D because the progenitor model possesses a massive oxygen layer, with an inner-edge radius that is smallest among the employed progenitors, which means that the shock can touch the rich fuel on a shorter timescale after bounce. The energy difference is generally smaller (?0.1-0.2 10{sup 51} erg) in 2D than in 1D (at most ?0.6 10{sup 51} erg). This is because neutrino-driven convection and the shock instability in 2D models enhance the neutrino heating efficiency, which makes the contribution of nuclear burning relatively smaller compared to 1D models. Considering uncertainties in progenitor models, our results indicate that nuclear burning should remain one of the important ingredients to foster the onset of neutrino-driven explosions.

  15. Electro-osmotically driven liquid delivery method and apparatus

    DOE Patents [OSTI]

    Rakestraw, David J.; Anex, Deon S.; Yan, Chao; Dadoo, Rajeev; Zare, Richard N.

    1999-01-01

    Method and apparatus for controlling precisely the composition and delivery of liquid at sub-.mu.L/min flow rate. One embodiment of such a delivery system is an electro-osmotically driven gradient flow delivery system that generates dynamic gradient flows with sub-.mu.L/min flow rates by merging a plurality of electro-osmotic flows. These flows are delivered by a plurality of delivery arms attached to a mixing connector, where they mix and then flow into a receiving means, preferably a column. Each inlet of the plurality of delivery arms is placed in a corresponding solution reservoir. A plurality of independent programmable high-voltage power supplies is used to apply a voltage program to each of the plurality of solution reservoirs to regulate the electro-osmotic flow in each delivery arm. The electro-osmotic flow rates in the delivery arms are changed with time according to each voltage program to deliver the required gradient profile to the column.

  16. Electro-osmotically driven liquid delivery method and apparatus

    DOE Patents [OSTI]

    Rakestraw, D.J.; Anex, D.S.; Yan, C.; Dadoo, R.; Zare, R.N.

    1999-08-24

    Method and apparatus are disclosed for controlling precisely the composition and delivery of liquid at sub-{micro}L/min flow rate. One embodiment of such a delivery system is an electro-osmotically driven gradient flow delivery system that generates dynamic gradient flows with sub-{micro}L/min flow rates by merging a plurality of electro-osmotic flows. These flows are delivered by a plurality of delivery arms attached to a mixing connector, where they mix and then flow into a receiving means, preferably a column. Each inlet of the plurality of delivery arms is placed in a corresponding solution reservoir. A plurality of independent programmable high-voltage power supplies is used to apply a voltage program to each of the plurality of solution reservoirs to regulate the electro-osmotic flow in each delivery arm. The electro-osmotic flow rates in the delivery arms are changed with time according to each voltage program to deliver the required gradient profile to the column. 4 figs.

  17. Feasibility Study of Accelerator Driven System Proposed by JAEA

    SciTech Connect (OSTI)

    Sugawara, Takanori; Nishihara, Kenji; Tsujimoto, Kazufumi; Iwanaga, Kohei; Kurata, Yuji; Sasa, Toshinobu; Oigawa, Hiroyuki

    2007-07-01

    Accelerator Driven System (ADS) has been studied to transmute minor actinides (MA) discharged from spent fuel of commercial nuclear power plants. In Japan Atomic Energy Agency (JAEA), various R and D for an 800 MWt, lead bismuth eutectic (LBE) cooled ADS have been performed. The feasibility for the ADS is discussed in the present study in terms of the neutronics design, the safety analysis and the design of the beam window. In the neutronics design, the maximum temperature at the surface of the fuel pin was decreased from 578 deg. C to 498 deg. C by the adjustment of the ZrN inert matrix ratio for four zones. In the safety analysis, it was confirmed that there was very little possibility of core disruptive accidents at unprotected accidents in the ADS proposed by JAEA. For the design of the beam window, the parametric survey for the buckling failure was performed to discuss the methods to increase the margin for the buckling pressure. (authors)

  18. Valving for controlling a fluid-driven reciprocating apparatus

    DOE Patents [OSTI]

    Whitehead, John C.

    1995-01-01

    A pair of control valve assemblies for alternately actuating a pair of fluid-driven free-piston devices by using fluid pressure communication therebetween. Each control valve assembly is switched by a pressure signal depending on the state of its counterpart's piston. The communication logic is arranged to provide overlap of the forward strokes of the pistons, so that at least one of the pair will always be pressurized. Thus, uninterrupted pumping of liquid is made possible from a pair of free-piston pumps. In addition, the speed and frequency of piston stroking is entirely dependent on the mechanical power load applied. In the case of a pair of pumps, this enables liquid delivery at a substantially constant pressure over the full range of flow rates, from zero to maximum flow. Each of the valve assemblies uses an intake-exhaust valve and a signal valve with the signal valve of one pump being connected to be pressure responsive to the piston of the opposite cylinder or pump.

  19. Valving for controlling a fluid-driven reciprocating apparatus

    DOE Patents [OSTI]

    Whitehead, J.C.

    1995-06-27

    A pair of control valve assemblies is described for alternately actuating a pair of fluid-driven free-piston devices by using fluid pressure communication therebetween. Each control valve assembly is switched by a pressure signal depending on the state of its counterpart`s piston. The communication logic is arranged to provide overlap of the forward strokes of the pistons, so that at least one of the pair will always be pressurized. Thus, uninterrupted pumping of liquid is made possible from a pair of free-piston pumps. In addition, the speed and frequency of piston stroking is entirely dependent on the mechanical power load applied. In the case of a pair of pumps, this enables liquid delivery at a substantially constant pressure over the full range of flow rates, from zero to maximum flow. Each of the valve assemblies uses an intake-exhaust valve and a signal valve with the signal valve of one pump being connected to be pressure responsive to the piston of the opposite cylinder or pump. 15 figs.

  20. Two-dimensional state in driven magnetohydrodynamic turbulence

    SciTech Connect (OSTI)

    Bigot, Barbara; Galtier, Sebastien

    2011-02-15

    The dynamics of the two-dimensional (2D) state in driven three-dimensional (3D) incompressible magnetohydrodynamic turbulence is investigated through high-resolution direct numerical simulations and in the presence of an external magnetic field at various intensities. For such a flow the 2D state (or slow mode) and the 3D modes correspond, respectively, to spectral fluctuations in the plane k{sub ||}=0 and in the area k{sub ||}>0. It is shown that if initially the 2D state is set to zero it becomes nonnegligible in few turnover times, particularly when the external magnetic field is strong. The maintenance of a large-scale driving leads to a break for the energy spectra of 3D modes; when the driving is stopped, the previous break is removed and a decay phase emerges with Alfvenic fluctuations. For a strong external magnetic field the energy at large perpendicular scales lies mainly in the 2D state, and in all situations a pinning effect is observed at small scales.

  1. Laser-driven ion acceleration with hollow laser beams

    SciTech Connect (OSTI)

    Brabetz, C. Kester, O.; Busold, S.; Bagnoud, V.; Cowan, T.; Deppert, O.; Jahn, D.; Roth, M.; Schumacher, D.

    2015-01-15

    The laser-driven acceleration of protons from thin foils irradiated by hollow high-intensity laser beams in the regime of target normal sheath acceleration (TNSA) is reported for the first time. The use of hollow beams aims at reducing the initial emission solid angle of the TNSA source, due to a flattening of the electron sheath at the target rear side. The experiments were conducted at the PHELIX laser facility at the GSI Helmholtzzentrum für Schwerionenforschung GmbH with laser intensities in the range from 10{sup 18} W cm{sup −2} to 10{sup 20} W cm{sup −2}. We observed an average reduction of the half opening angle by (3.07±0.42)° or (13.2±2.0)% when the targets have a thickness between 12 μm and 14 μm. In addition, the highest proton energies were achieved with the hollow laser beam in comparison to the typical Gaussian focal spot.

  2. Heat-driven acoustic cooling engine having no moving parts

    DOE Patents [OSTI]

    Wheatley, John C.; Swift, Gregory W.; Migliori, Albert; Hofler, Thomas J.

    1989-01-01

    A heat-driven acoustic cooling engine having no moving parts receives heat from a heat source. The acoustic cooling engine comprises an elongated resonant pressure vessel having first and second ends. A compressible fluid having a substantial thermal expansion coefficient and capable of supporting an acoustic standing wave is contained in the resonant pressure vessel. The heat source supplies heat to the first end of the vessel. A first heat exchanger in the vessel is spaced-apart from the first end and receives heat from the first end. A first thermodynamic element is adjacent to the first heat exchanger and converts some of the heat transmitted by the first heat exchanger into acoustic power. A second thermodynamic element has a first end located spaced-apart from the first thermodynamic element and a second end farther away from the first thermodynamic element than is its first end. The first end of the second thermodynamic element heats while its second end cools as a consequence of the acoustic power. A second heat exchanger is adjacent to and between the first and second thermodynamic elements. A heat sink outside of the vessel is thermally coupled to and receives heat from the second heat exchanger. The resonant pressure vessel can include a housing less than one-fourth wavelength in length coupled to a reservoir. The housing can include a reduced diameter portion communicating with the reservoir.

  3. Effects of the radial dependence of the fast electron diffusion coefficient on the current driven by lower-hybrid waves in tokamak

    SciTech Connect (OSTI)

    Zhang Xianmei; Wang Yanhui; Yu Limin; Shen Xin; Wang Jianbin

    2012-07-15

    The lower hybrid current drive (LHCD) is one of the promising methods not only for driving the non-inductive current required for steady-state tokamak operation, but also for controlling the plasma current profile to improve confinement in tokamak experiments. A direct consequence of experimental imperfection is difficult to obtain reliable estimate of the radial diffusion coefficient (D{sub st}) of the lower hybrid driven current. In this paper, the radial profile of D{sub st} is estimated to investigate its effect on the current driven by lower hybrid wave (LHW) in Experimental Advanced Superconducting Tokamak. Compared with the case of the constant radial diffusion coefficient, the efficiency of LHW driven current with the radial dependent diffusion coefficient D{sub st} ({rho}) becomes either higher or lower with respect to the plasma parameters, such as the density and the magnetic fluctuation. It is also found that the profiles of the LHW driven current are different. Therefore, it is necessary to consider the radial dependence of D{sub st} in order to get an accurate and reliable result in the numerical simulation of LHCD.

  4. Diversity waves in collapse-driven population dynamics

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Maslov, Sergei; Sneppen, Kim

    2015-09-14

    Populations of species in ecosystems are often constrained by availability of resources within their environment. In effect this means that a growth of one population, needs to be balanced by comparable reduction in populations of others. In neutral models of biodiversity all populations are assumed to change incrementally due to stochastic births and deaths of individuals. Here we propose and model another redistribution mechanism driven by abrupt and severe collapses of the entire population of a single species freeing up resources for the remaining ones. This mechanism may be relevant e.g. for communities of bacteria, with strain-specific collapses caused e.g.more » by invading bacteriophages, or for other ecosystems where infectious diseases play an important role. The emergent dynamics of our system is cyclic ‘‘diversity waves’’ triggered by collapses of globally dominating populations. The population diversity peaks at the beginning of each wave and exponentially decreases afterwards. Species abundances are characterized by a bimodal time-aggregated distribution with the lower peak formed by populations of recently collapsed or newly introduced species while the upper peak - species that has not yet collapsed in the current wave. In most waves both upper and lower peaks are composed of several smaller peaks. This self-organized hierarchical peak structure has a long-term memory transmitted across several waves. It gives rise to a scale-free tail of the time-aggregated population distribution with a universal exponent of 1.7. We show that diversity wave dynamics is robust with respect to variations in the rules of our model such as diffusion between multiple environments, species-specific growth and extinction rates, and bet-hedging strategies.« less

  5. Betatron Radiation from a Beam Driven Plasma Source (Conference) | SciTech

    Office of Scientific and Technical Information (OSTI)

    Connect Conference: Betatron Radiation from a Beam Driven Plasma Source Citation Details In-Document Search Title: Betatron Radiation from a Beam Driven Plasma Source Photons produced by the betatron oscillation of electrons in a beam-driven plasma wake provide a uniquely intense and high-energy source of hard X-rays and gamma rays. This betatron radiation is interesting not only for its high intensity and spectral characteristics, but also because it can be used as a diagnostic for beam

  6. 9 GeV energy gain in a beam-driven plasma wakefield accelerator (Journal

    Office of Scientific and Technical Information (OSTI)

    Article) | SciTech Connect 9 GeV energy gain in a beam-driven plasma wakefield accelerator Citation Details In-Document Search Title: 9 GeV energy gain in a beam-driven plasma wakefield accelerator An electron beam has gained a maximum energy of 9 GeV per particle in a 1.3 m-long electron beam-driven plasma wakefield accelerator. The amount of charge accelerated in the spectral peak was 28.3 pC, and the root-mean-square energy spread was 5.0%. The mean accelerated charge and energy gain per

  7. Report on the 1. Techno Rally of small model cars driven by Stirling

    Office of Scientific and Technical Information (OSTI)

    engines (Conference) | SciTech Connect Report on the 1. Techno Rally of small model cars driven by Stirling engines Citation Details In-Document Search Title: Report on the 1. Techno Rally of small model cars driven by Stirling engines The first speed contest of model cars driven by hand made Stirling engines was held in summer of 1997 in Tokyo under the name of The First Stirling Techno Rally sponsored by JSME and others. The body of cars were smaller than 60 cm in length and 30 cm in width

  8. MODIL cryocooler producibility demonstration project results

    SciTech Connect (OSTI)

    Cruz, G.E.; Franks, R.M.

    1993-04-07

    The production of large quantities of spacecraft needed by SDIO will require a cultural change in design and production practices. Low rates production and the need for exceedingly high reliability has driven the industry to custom designed, hand crafted, and exhaustively tested satellites. These factors have mitigated against employing design and manufacturing cost reduction methods commonly used in tactical missile production. Additional challenges to achieving production efficiencies are presented by the SDI spacecraft mission requirement. IR sensor systems, for example, are comprised of subassemblies and components that require the design, manufacture, and maintenance of ultra precision tolerances over challenging operational lifetimes. These IR sensors demand the use of reliable, closed loop, cryogenic refrigerators or active cryocoolers to meet stringent system acquisition and pointing requirements. The authors summarize some spacecraft cryocooler requirements and discuss observations regarding Industry`s current production capabilities of cryocoolers. The results of the Lawrence Livermore National Laboratory (LLNL) Spacecraft Fabrication and Test (SF and T) MODIL`s Phase I producibility demonstration project is presented.

  9. MODIL cryocooler producibility demonstration project results

    SciTech Connect (OSTI)

    Cruz, G.E.; Franks, R.M.

    1993-06-24

    The production of large quantities of spacecraft needed by SDIO will require a cultural change in design and production practices. Low rates production and the need for exceedingly high reliability has driven the industry to custom designed, hand crafted, and exhaustingly tested satellites. These factors have mitigated against employing design and manufacturing cost reduction methods commonly used in tactical missile production. Additional challenges to achieving production efficiencies are presented by the SDI spacecraft mission requirement. IR sensor systems, for example, are comprised of subassemblies and components that require the design, manufacture, and maintenance of ultra precision tolerances over challenging operational lifetimes. These IR sensors demand the use of reliable, closed loop, cryogenic refrigerators or active cryocoolers to meet stringent system acquisition and pointing requirements. The authors summarize some spacecraft cryocooler requirements and discuss their observations regarding Industry`s current production capabilities of cryocoolers. The results of the Lawrence Livermore National Laboratory (LLNL) Spacecraft Fabrication and Test (SF and T) MODIL`s Phase I producibility demonstration project are presented. The current project that involves LLNL and industrial participants is discussed.

  10. A data-driven approach for retrieving temperatures and abundances in brown dwarf atmospheres

    SciTech Connect (OSTI)

    Line, Michael R.; Fortney, Jonathan J.; Marley, Mark S.; Sorahana, Satoko

    2014-09-20

    Brown dwarf spectra contain a wealth of information about their molecular abundances, temperature structure, and gravity. We present a new data driven retrieval approach, previously used in planetary atmosphere studies, to extract the molecular abundances and temperature structure from brown dwarf spectra. The approach makes few a priori physical assumptions about the state of the atmosphere. The feasibility of the approach is first demonstrated on a synthetic brown dwarf spectrum. Given typical spectral resolutions, wavelength coverage, and noise, property precisions of tens of percent can be obtained for the molecular abundances and tens to hundreds of K on the temperature profile. The technique is then applied to the well-studied brown dwarf, Gl 570D. From this spectral retrieval, the spectroscopic radius is constrained to be 0.75-0.83 R {sub J}, log (g) to be 5.13-5.46, and T {sub eff} to be between 804 and 849 K. Estimates for the range of abundances and allowed temperature profiles are also derived. The results from our retrieval approach are in agreement with the self-consistent grid modeling results of Saumon et al. This new approach will allow us to address issues of compositional differences between brown dwarfs and possibly their formation environments, disequilibrium chemistry, and missing physics in current grid modeling approaches as well as a many other issues.

  11. 9 GeV energy gain in a beam-driven plasma wakefield accelerator

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Litos, M.; Adli, E.; Allen, J. M.; An, W.; Clarke, C. I.; Corde, S.; Clayton, C. E.; Frederico, J.; Gessner, S. J.; Green, S. Z.; et al

    2016-02-15

    An electron beam has gained a maximum energy of 9 GeV per particle in a 1.3 m-long electron beam-driven plasma wakefield accelerator. The amount of charge accelerated in the spectral peak was 28.3 pC, and the root-mean-square energy spread was 5.0%. The mean accelerated charge and energy gain per particle of the 215 shot data set was 115 pC and 5.3 GeV, respectively, corresponding to an acceleration gradient of 4.0 GeV m-1 at the spectral peak. Moreover, the mean energy spread of the data set was 5.1%. Our results are consistent with the extrapolation of the previously reported energy gainmore » results using a shorter, 36 cm-long plasma source to within 10%, evincing a non-evolving wake structure that can propagate distances of over a meter in length. Wake-loading effects were evident in the data through strong dependencies observed between various spectral properties and the amount of accelerated charge.« less

  12. Drainage capture and discharge variations driven by glaciation in the Southern Alps, New Zealand

    SciTech Connect (OSTI)

    Ann V. Rowan; Mitchell A. Plummer; Simon H. Brocklehurst; Merren A. Jones; David M. Schultz

    2013-02-01

    Sediment flux in proglacial fluvial settings is primarily controlled by discharge, which usually varies predictably over a glacial–interglacial cycle. However, glaciers can flow against the topographic gradient to cross drainage divides, reshaping fluvial drainage networks and dramatically altering discharge. In turn, these variations in discharge will be recorded by proglacial stratigraphy. Glacial-drainage capture often occurs in alpine environments where ice caps straddle range divides, and more subtly where shallow drainage divides cross valley floors. We investigate discharge variations resulting from glacial-drainage capture over the past 40 k.y. for the adjacent Ashburton, Rangitata, and Rakaia basins in the Southern Alps, New Zealand. Although glacial-drainage capture has previously been inferred in the range, our numerical glacier model provides the first quantitative demonstration that this process drives larger variations in discharge for a longer duration than those that occur due to climate change alone. During the Last Glacial Maximum, the effective drainage area of the Ashburton catchment increased to 160% of the interglacial value with drainage capture, driving an increase in discharge exceeding that resulting from glacier recession. Glacial-drainage capture is distinct from traditional (base level–driven) drainage capture and is often unrecognized in proglacial deposits, complicating interpretation of the sedimentary record of climate change.

  13. INSTABILITIES DRIVEN BY THE DRIFT AND TEMPERATURE ANISOTROPY OF ALPHA PARTICLES IN THE SOLAR WIND

    SciTech Connect (OSTI)

    Verscharen, Daniel; Bourouaine, Sofiane; Chandran, Benjamin D. G. E-mail: s.bourouaine@unh.edu

    2013-08-20

    We investigate the conditions under which parallel-propagating Alfven/ion-cyclotron (A/IC) waves and fast-magnetosonic/whistler (FM/W) waves are driven unstable by the differential flow and temperature anisotropy of alpha particles in the solar wind. We focus on the limit in which w{sub Parallel-To {alpha}} {approx}> 0.25v{sub A}, where w{sub Parallel-To {alpha}} is the parallel alpha-particle thermal speed and v{sub A} is the Alfven speed. We derive analytic expressions for the instability thresholds of these waves, which show, e.g., how the minimum unstable alpha-particle beam speed depends upon w{sub Parallel-To {alpha}}/v{sub A}, the degree of alpha-particle temperature anisotropy, and the alpha-to-proton temperature ratio. We validate our analytical results using numerical solutions to the full hot-plasma dispersion relation. Consistent with previous work, we find that temperature anisotropy allows A/IC waves and FM/W waves to become unstable at significantly lower values of the alpha-particle beam speed U{sub {alpha}} than in the isotropic-temperature case. Likewise, differential flow lowers the minimum temperature anisotropy needed to excite A/IC or FM/W waves relative to the case in which U{sub {alpha}} = 0. We discuss the relevance of our results to alpha particles in the solar wind near 1 AU.

  14. A Beam Driven Plasma-Wakefield Linear Collider: From Higgs Factory...

    Office of Scientific and Technical Information (OSTI)

    A Beam Driven Plasma-Wakefield Linear Collider: From Higgs Factory to Multi-TeV Summarized for CSS2013 E. Adli, J.P.Delahaye, S.J.Gessner, M.J. Hogan, T. Raubenheimer (SLAC) W.An,...

  15. Energy Department Co-Hosts Workshops to Develop an Industry-Driven...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Department Co-Hosts Workshops to Develop an Industry-Driven Vision of the Nation's ... in the Office of Electricity Delivery and Energy Reliability The U.S. electric grid ...

  16. Picture of the Week: Laser-driven neutron source for research...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Laser-driven neutron source for research and global security At Los Alamos's Trident facility, scientists are using an ultra-high intensity laser beam to produce high intensity ...

  17. Sub-100 ps laser-driven dynamic compression of solid deuterium...

    Office of Scientific and Technical Information (OSTI)

    a 40 J laser pulse Citation Details In-Document Search Title: Sub-100 ps laser-driven dynamic compression of solid deuterium with a 40 J laser pulse You are ...

  18. Coulomb-driven organization and enhancement of spin-orbit fields...

    Office of Scientific and Technical Information (OSTI)

    Title: Coulomb-driven organization and enhancement of spin-orbit fields in collective spin excitations Authors: Baboux, F. ; Perez, F. ; Ullrich, C. A. ; D'Amico, I. ; Karczewski, ...

  19. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  20. Ultrasonic Concentration in a Line-Driven Cylindrical Tube

    SciTech Connect (OSTI)

    G.R. Goddard

    2004-12-15

    The fractionation of particles from their suspending fluid or noninvasive micromanipulation of particles in suspension has many applications ranging from the recovery of valuable reagents from process flows to the fabrication of microelectromechanical devices. Techniques based on size, density, solubility, or electromagnetic properties exist for fulfilling these needs, but many particles have traits that preclude their use such as small size, neutral buoyancy, or uniform electromagnetic characteristics. While separation by those techniques may not be possible, often compressibility differences exist between the particle and fluid that would allow fractionation by acoustic forces. The potential of acoustic separation is known, but due to inherent difficulties in achieving and maintaining accurate alignment of the transduction system, it is rarely utilized. The objective of this project is to investigate the use of structural excitation as a potentially efficient concentration/fractionation method for particles in suspension. It is demonstrated that structural excitation of a cylindrically symmetric cavity, such as a tube, allows non-invasive, fast, and low power concentration of particles suspended in a fluid. The inherent symmetry of the system eliminates the need for careful alignment inherent in current acoustic concentration devices. Structural excitation distributes the acoustic field throughout the volume of the cavity, which also significantly reduces temperature gradients and acoustic streaming in the fluid; cavitation is no longer an issue. The lowest-order coupled modes of a long cylindrical glass tube and fluid-filled cavity, driven by a line contact, are tuned, via material properties and aspect ratio, to achieve a coupled dipolar vibration of the system, shown to generate efficient concentration of particles to the central axis of the tube. A two dimensional elastodynamic model of the system was developed and subsequently utilized to optimize particle concentration within the system. The effects of tubing, fluid, and particle material properties, tube geometry, fluid flow, and tube length on the structural excitation and consequently power requirements and concentration quality within the tube were investigated theoretically and experimentally. Limitations of the method are discussed, as well as ways to minimize or compensate for deleterious effects. Finally a preliminary demonstration of the efficacy of acoustic concentration is presented.

  1. Evidence for a Bubble-Competition Regime in Indirectly Driven Ablative

    Office of Scientific and Technical Information (OSTI)

    Rayleigh-Taylor Instability Experiments on the NIF (Journal Article) | SciTech Connect Journal Article: Evidence for a Bubble-Competition Regime in Indirectly Driven Ablative Rayleigh-Taylor Instability Experiments on the NIF Citation Details In-Document Search This content will become publicly available on May 28, 2016 Title: Evidence for a Bubble-Competition Regime in Indirectly Driven Ablative Rayleigh-Taylor Instability Experiments on the NIF Authors: Martinez, D. A. ; Smalyuk, V. A. ;

  2. I. AN INTRODUCTION TO THE PROPELLANT-DRIVEN MAGNETIC FLUX COMPRESSION GENERATOR

    Office of Scientific and Technical Information (OSTI)

    I. AN INTRODUCTION TO THE PROPELLANT-DRIVEN MAGNETIC FLUX COMPRESSION GENERATOR Pharis E . Williams Abstract An introduction to the concept of a propellant-driven magnetic flux compression generator is presented, together with the theory of its operation. The principles of operation of the propellant flux compression generator combine generator principles, derived from lumped parameter circuit theory, and interior ballistic principles, INTRODUCTION Explosive magnetic flux compression generators

  3. Identification of a jet-driven supernova remnant in the Small Magellanic

    Office of Scientific and Technical Information (OSTI)

    Cloud: Possible evidence for the enhancement of bipolar explosions at low metallicity (Journal Article) | SciTech Connect Identification of a jet-driven supernova remnant in the Small Magellanic Cloud: Possible evidence for the enhancement of bipolar explosions at low metallicity Citation Details In-Document Search Title: Identification of a jet-driven supernova remnant in the Small Magellanic Cloud: Possible evidence for the enhancement of bipolar explosions at low metallicity Recent

  4. Hawai'i's Evolution: Hawai'i Powered. Technology Driven. | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Hawai'i's Evolution: Hawai'i Powered. Technology Driven. Hawai'i's Evolution: Hawai'i Powered. Technology Driven. Outlines Hawaii's energy and transportation goals and the implementation of electric vehicles (EV) and electric vehicle infrastructure since HCEI began in 2008. Includes information about Hawaii's role in leading the nation in available EV charging infrastructure per capita; challenges for continuing to implement EV technology; features on various successful EV users and

  5. A hybrid Rayleigh-Taylor-current-driven coupled instability in a

    Office of Scientific and Technical Information (OSTI)

    magnetohydrodynamically collimated cylindrical plasma with lateral gravity (Journal Article) | DOE PAGES A hybrid Rayleigh-Taylor-current-driven coupled instability in a magnetohydrodynamically collimated cylindrical plasma with lateral gravity This content will become publicly available on March 22, 2017 Title: A hybrid Rayleigh-Taylor-current-driven coupled instability in a magnetohydrodynamically collimated cylindrical plasma with lateral gravity Authors: Zhai, Xiang [1] ; Bellan, Paul M.

  6. Are GRACE-era Terrestrial Water Trends Driven by Anthropogenic Climate

    Office of Scientific and Technical Information (OSTI)

    Change? (Journal Article) | SciTech Connect Are GRACE-era Terrestrial Water Trends Driven by Anthropogenic Climate Change? Citation Details In-Document Search Title: Are GRACE-era Terrestrial Water Trends Driven by Anthropogenic Climate Change? To provide context for observed trends in terrestrial water storage (TWS) during GRACE (2003-2014), trends and variability in the CESM1-CAM5 Large Ensemble (LE) are examined. Motivated in part by the anomalous nature of climate variability during

  7. Filamentation instability of current-driven dust ion-acoustic waves in a collisional dusty plasma

    SciTech Connect (OSTI)

    Niknam, A. R. [Laser and Plasma Research Institute, Shahid Beheshti University, G.C., Tehran 19839-63113 (Iran, Islamic Republic of); Haghtalab, T.; Khorashadizadeh, S. M. [Physics Department, Birjand University, Birjand 97179-63384 (Iran, Islamic Republic of)

    2011-11-15

    A theoretical investigation has been made of the dust ion-acoustic filamentation instability in an unmagnetized current-driven dusty plasma by using the Lorentz transformation formulas. The effect of collision between the charged particles with neutrals and their thermal motion on this instability is considered. Developing the filamentation instability of the current-driven dust ion-acoustic wave allows us to determine the period and the establishment time of the filamentation structure and threshold for instability development.

  8. New Homogeneous Chromophore/Catalyst Concepts for the Solar-Driven

    Office of Scientific and Technical Information (OSTI)

    Reduction of Carbon Dioxide (Technical Report) | SciTech Connect New Homogeneous Chromophore/Catalyst Concepts for the Solar-Driven Reduction of Carbon Dioxide Citation Details In-Document Search Title: New Homogeneous Chromophore/Catalyst Concepts for the Solar-Driven Reduction of Carbon Dioxide One of the major scientific and technical challenges of this century is to develop chemical means to store solar energy in the form of fuels. This can be accomplished by developing light-absorbing

  9. Operon Formation is Driven by Co-Regulation and Not by Horizontal Gene

    Office of Scientific and Technical Information (OSTI)

    Transfer (Journal Article) | SciTech Connect Operon Formation is Driven by Co-Regulation and Not by Horizontal Gene Transfer Citation Details In-Document Search Title: Operon Formation is Driven by Co-Regulation and Not by Horizontal Gene Transfer Although operons are often subject to horizontal gene transfer (HGT), non-HGT genes are particularly likely to be in operons. To resolve this apparent discrepancy and to determine whether HGT is involved in operon formation, we examined the

  10. Prospects for Higgs coupling measurements in SUSY with radiatively-driven

    Office of Scientific and Technical Information (OSTI)

    naturalness (Journal Article) | SciTech Connect Prospects for Higgs coupling measurements in SUSY with radiatively-driven naturalness Citation Details In-Document Search This content will become publicly available on August 13, 2016 Title: Prospects for Higgs coupling measurements in SUSY with radiatively-driven naturalness Authors: Bae, Kyu Jung ; Baer, Howard ; Nagata, Natsumi ; Serce, Hasan Publication Date: 2015-08-14 OSTI Identifier: 1210124 Type: Publisher's Accepted Manuscript Journal

  11. Radiation Transport and Energetics of Laser-driven Half-hohlraums at the

    Office of Scientific and Technical Information (OSTI)

    National Ignition Facility (Journal Article) | SciTech Connect Radiation Transport and Energetics of Laser-driven Half-hohlraums at the National Ignition Facility Citation Details In-Document Search Title: Radiation Transport and Energetics of Laser-driven Half-hohlraums at the National Ignition Facility Authors: Moore, A ; Cooper, A ; Schneider, M ; MacLaren, S ; Graham, P ; Lu, K ; Seugling, R ; Satcher, J ; Klingmann, J ; et al. Publication Date: 2014-06-05 OSTI Identifier: 1229309 Report

  12. Large spin-wave bullet in a ferrimagnetic insulator driven by spin Hall

    Office of Scientific and Technical Information (OSTI)

    effect. (Journal Article) | SciTech Connect Large spin-wave bullet in a ferrimagnetic insulator driven by spin Hall effect. Citation Details In-Document Search Title: Large spin-wave bullet in a ferrimagnetic insulator driven by spin Hall effect. Due to its transverse nature, spin Hall effects (SHE) provide the possibility to excite and detect spin currents and magnetization dynamics even in magnetic insulators. Magnetic insulators are outstanding materials for the investigation of nonlinear

  13. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  14. Coulomb-driven organization and enhancement of spin-orbit fields in

    Office of Scientific and Technical Information (OSTI)

    collective spin excitations (Journal Article) | SciTech Connect Coulomb-driven organization and enhancement of spin-orbit fields in collective spin excitations Citation Details In-Document Search Title: Coulomb-driven organization and enhancement of spin-orbit fields in collective spin excitations Authors: Baboux, F. ; Perez, F. ; Ullrich, C. A. ; D'Amico, I. ; Karczewski, G. ; Wojtowicz, T. Publication Date: 2013-03-21 OSTI Identifier: 1103944 Type: Publisher's Accepted Manuscript Journal

  15. Design and optimization of a bi-axial vibration-driven electromagnetic

    Office of Scientific and Technical Information (OSTI)

    generator (Journal Article) | SciTech Connect Design and optimization of a bi-axial vibration-driven electromagnetic generator Citation Details In-Document Search Title: Design and optimization of a bi-axial vibration-driven electromagnetic generator To scavenge energy from ambient vibrations with arbitrary in-plane motion directions and over a wide frequency range, a novel electromagnetic vibration energy harvester is designed and optimized. In the harvester, a circular cross-section

  16. Engine Driven Combined Heat and Power: Arrow Linen Supply, December 2008 |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Engine Driven Combined Heat and Power: Arrow Linen Supply, December 2008 Engine Driven Combined Heat and Power: Arrow Linen Supply, December 2008 This paper describes the Arrow Linen CHP demonstration, including the original installation supported by NYSERDA and the data monitoring and analysis supported by DOE. The team consisted of Oak Ridge National Lab, Energy Solutions Center, and ICF International. PDF icon arrow_linen_hedman.pdf More Documents & Publications

  17. Systems Modeling for a Laser-Driven IFE Power Plant using Direct Conversion

    Office of Scientific and Technical Information (OSTI)

    (Journal Article) | SciTech Connect a Laser-Driven IFE Power Plant using Direct Conversion Citation Details In-Document Search Title: Systems Modeling for a Laser-Driven IFE Power Plant using Direct Conversion A variety of systems analyses have been conducted for laser driver IFE power plants being developed as part of the High Average Power Laser (HAPL) program. A key factor determining the economics attractiveness of the power plant is the net power conversion efficiency which increases

  18. THE DOMINANCE OF NEUTRINO-DRIVEN CONVECTION IN CORE-COLLAPSE SUPERNOVAE

    Office of Scientific and Technical Information (OSTI)

    (Journal Article) | SciTech Connect THE DOMINANCE OF NEUTRINO-DRIVEN CONVECTION IN CORE-COLLAPSE SUPERNOVAE Citation Details In-Document Search Title: THE DOMINANCE OF NEUTRINO-DRIVEN CONVECTION IN CORE-COLLAPSE SUPERNOVAE Multi-dimensional instabilities have become an important ingredient in core-collapse supernova (CCSN) theory. Therefore, it is necessary to understand the driving mechanism of the dominant instability. We compare our parameterized three-dimensional CCSN simulations with

  19. Temperature-driven phase transformation in Y3Co: Neutron scattering and

    Office of Scientific and Technical Information (OSTI)

    first-principles studies (Journal Article) | SciTech Connect Temperature-driven phase transformation in Y3Co: Neutron scattering and first-principles studies Citation Details In-Document Search Title: Temperature-driven phase transformation in Y3Co: Neutron scattering and first-principles studies Authors: Podlesnyak, A. ; Ehlers, G. ; Cao, H. ; Matsuda, M. ; Frontzek, M. ; Zaharko, O. ; Kazantsev, V. A. ; Gubkin, A. F. ; Baranov, N. V. Publication Date: 2013-07-26 OSTI Identifier: 1104316

  20. The ADAPT concept - an accelerator driven system for the rapid and

    Office of Scientific and Technical Information (OSTI)

    efficient disposal of plutonium (Journal Article) | SciTech Connect The ADAPT concept - an accelerator driven system for the rapid and efficient disposal of plutonium Citation Details In-Document Search Title: The ADAPT concept - an accelerator driven system for the rapid and efficient disposal of plutonium A new concept; termed ADAPT; for the rapid and virtually complete burning of plutonium is described. ADAPT employs a high current CW linear accelerator (linac) to generate neutrons in a

  1. Analysis of Buoyancy-Driven Ventilation of Hydrogen from Buildings (Presentation)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Buoyancy-Driven Ventilation of Hydrogen from Buildings C. Dennis Barley, Keith Gawlik, Jim Ohi, Russell Hewett National Renewable Laboratory U.S. DOE Hydrogen Safety, Codes & Standards Program Presented at 2 nd ICHS, San Sebastián, Spain September 11, 2007 NREL/PR-550-42289 Scope of Work * Safe building design * Vehicle leak in residential garage * Continual slow leak * Passive, buoyancy-driven ventilation (vs. mechanical) * Steady-state concentration of H 2 vs. vent size Prior Work *

  2. Analysis of Improved Reference Design for a Nuclear-Driven High Temperature Electrolysis Hydrogen Production Plant

    SciTech Connect (OSTI)

    Edwin A. Harvego; James E. O'Brien; Michael G. McKellar

    2010-06-01

    The use of High Temperature Electrolysis (HTE) for the efficient production of hydrogen without the greenhouse gas emissions associated with conventional fossil-fuel hydrogen production techniques has been under investigation at the Idaho National Engineering Laboratory (INL) for the last several years. The activities at the INL have included the development, testing and analysis of large numbers of solid oxide electrolysis cells, and the analyses of potential plant designs for large scale production of hydrogen using an advanced Very-High Temperature Reactor (VHTR) to provide the process heat and electricity to drive the electrolysis process. The results of these system analyses, using the UniSim process analysis software, have shown that the HTE process, when coupled to a VHTR capable of operating at reactor outlet temperatures of 800 C to 950 C, has the potential to produce the large quantities of hydrogen needed to meet future energy and transportation needs with hydrogen production efficiencies in excess of 50%. In addition, economic analyses performed on the INL reference plant design, optimized to maximize the hydrogen production rate for a 600 MWt VHTR, have shown that a large nuclear-driven HTE hydrogen production plant can to be economically competitive with conventional hydrogen production processes, particularly when the penalties associated with greenhouse gas emissions are considered. The results of this research led to the selection in 2009 of HTE as the preferred concept in the U.S. Department of Energy (DOE) hydrogen technology down-selection process. However, the down-selection process, along with continued technical assessments at the INL, has resulted in a number of proposed modifications and refinements to improve the original INL reference HTE design. These modifications include changes in plant configuration, operating conditions and individual component designs. This paper describes the resulting new INL reference design and presents results of system analyses performed to optimize the design and to determine required plant performance and operating conditions.

  3. Sulfide-Driven Arsenic Mobilization from Arsenopyrite and Black Shale Pyrite

    SciTech Connect (OSTI)

    Zhu, W.; Young, L; Yee, N; Serfes, M; Rhine, E; Reinfelder, J

    2008-01-01

    We examined the hypothesis that sulfide drives arsenic mobilization from pyritic black shale by a sulfide-arsenide exchange and oxidation reaction in which sulfide replaces arsenic in arsenopyrite forming pyrite, and arsenide (As-1) is concurrently oxidized to soluble arsenite (As+3). This hypothesis was tested in a series of sulfide-arsenide exchange experiments with arsenopyrite (FeAsS), homogenized black shale from the Newark Basin (Lockatong formation), and pyrite isolated from Newark Basin black shale incubated under oxic (21% O2), hypoxic (2% O2, 98% N2), and anoxic (5% H2, 95% N2) conditions. The oxidation state of arsenic in Newark Basin black shale pyrite was determined using X-ray absorption-near edge structure spectroscopy (XANES). Incubation results show that sulfide (1 mM initial concentration) increases arsenic mobilization to the dissolved phase from all three solids under oxic and hypoxic, but not anoxic conditions. Indeed under oxic and hypoxic conditions, the presence of sulfide resulted in the mobilization in 48 h of 13-16 times more arsenic from arsenopyrite and 6-11 times more arsenic from isolated black shale pyrite than in sulfide-free controls. XANES results show that arsenic in Newark Basin black shale pyrite has the same oxidation state as that in FeAsS (-1) and thus extend the sulfide-arsenide exchange mechanism of arsenic mobilization to sedimentary rock, black shale pyrite. Biologically active incubations of whole black shale and its resident microorganisms under sulfate reducing conditions resulted in sevenfold higher mobilization of soluble arsenic than sterile controls. Taken together, our results indicate that sulfide-driven arsenic mobilization would be most important under conditions of redox disequilibrium, such as when sulfate-reducing bacteria release sulfide into oxic groundwater, and that microbial sulfide production is expected to enhance arsenic mobilization in sedimentary rock aquifers with major pyrite-bearing, black shale formations.

  4. Geophysical monitoring and reactive transport modeling of ureolytically-driven calcium carbonate precipitation

    SciTech Connect (OSTI)

    Wu, Y.; Ajo-Franklin, J.B.; Spycher, N.; Hubbard, S.S.; Zhang, G.; Williams, K.H.; Taylor, J.; Fujita, Y.; Smith, R.

    2011-07-15

    Ureolytically-driven calcium carbonate precipitation is the basis for a promising in-situ remediation method for sequestration of divalent radionuclide and trace metal ions. It has also been proposed for use in geotechnical engineering for soil strengthening applications. Monitoring the occurrence, spatial distribution, and temporal evolution of calcium carbonate precipitation in the subsurface is critical for evaluating the performance of this technology and for developing the predictive models needed for engineering application. In this study, we conducted laboratory column experiments using natural sediment and groundwater to evaluate the utility of geophysical (complex resistivity and seismic) sensing methods, dynamic synchrotron x-ray computed tomography (micro-CT), and reactive transport modeling for tracking ureolytically-driven calcium carbonate precipitation processes under site relevant conditions. Reactive transport modeling with TOUGHREACT successfully simulated the changes of the major chemical components during urea hydrolysis. Even at the relatively low level of urea hydrolysis observed in the experiments, the simulations predicted an enhanced calcium carbonate precipitation rate that was 3-4 times greater than the baseline level. Reactive transport modeling results, geophysical monitoring data and micro-CT imaging correlated well with reaction processes validated by geochemical data. In particular, increases in ionic strength of the pore fluid during urea hydrolysis predicted by geochemical modeling were successfully captured by electrical conductivity measurements and confirmed by geochemical data. The low level of urea hydrolysis and calcium carbonate precipitation suggested by the model and geochemical data was corroborated by minor changes in seismic P-wave velocity measurements and micro-CT imaging; the latter provided direct evidence of sparsely distributed calcium carbonate precipitation. Ion exchange processes promoted through NH{sub 4}{sup +} production during urea hydrolysis were incorporated in the model and captured critical changes in the major metal species. The electrical phase increases were potentially due to ion exchange processes that modified charge structure at mineral/water interfaces. Our study revealed the potential of geophysical monitoring for geochemical changes during urea hydrolysis and the advantages of combining multiple approaches to understand complex biogeochemical processes in the subsurface.

  5. Geophysical Monitoring and Reactive Transport Modeling of Ureolytically-Driven Calcium Carbonate Precipitation

    SciTech Connect (OSTI)

    Yuxin Wu; Jonathan B. Ajo-Franklin; Nicolas Spycher; Susan S. Hubbard; Guoxiang Zhang; Kenneth H. Williams; Joanna Taylor; Yoshiko Fujita; Robert Smith

    2011-09-01

    Ureolytically-driven calcium carbonate precipitation is the basis for a promising in-situ remediation method for sequestration of divalent radionuclide and trace metal ions. It has also been proposed for use in geotechnical engineering for soil strengthening applications. Monitoring the occurrence, spatial distribution, and temporal evolution of calcium carbonate precipitation in the subsurface is critical for evaluating the performance of this technology and for developing the predictive models needed for engineering application. In this study, we conducted laboratory column experiments using natural sediment and groundwater to evaluate the utility of geophysical (complex resistivity and seismic) sensing methods, dynamic synchrotron x-ray computed tomography (micro-CT), and reactive transport modeling for tracking ureolytically-driven calcium carbonate precipitation processes under site relevant conditions. Reactive transport modeling with TOUGHREACT successfully simulated the changes of the major chemical components during urea hydrolysis. Even at the relatively low level of urea hydrolysis observed in the experiments, the simulations predicted an enhanced calcium carbonate precipitation rate that was 3-4 times greater than the baseline level. Reactive transport modeling results, geophysical monitoring data and micro-CT imaging correlated well with reaction processes validated by geochemical data. In particular, increases in ionic strength of the pore fluid during urea hydrolysis predicted by geochemical modeling were successfully captured by electrical conductivity measurements and confirmed by geochemical data. The low level of urea hydrolysis and calcium carbonate precipitation suggested by the model and geochemical data was corroborated by minor changes in seismic P-wave velocity measurements and micro-CT imaging; the latter provided direct evidence of sparsely distributed calcium carbonate precipitation. Ion exchange processes promoted through NH4+ production during urea hydrolysis were incorporated in the model and captured critical changes in the major metal species. The electrical phase increases were potentially due to ion exchange processes that modified charge structure at mineral/water interfaces. Our study revealed the potential of geophysical monitoring for geochemical changes during urea hydrolysis and the advantages of combining multiple approaches to understand complex biogeochemical processes in the subsurface.

  6. Example-Based Automatic Music-Driven Conventional Dance Motion Synthesis

    SciTech Connect (OSTI)

    Xu, Songhua; Fan, Rukun; Geng, Weidong

    2012-01-01

    We introduce a novel method for synthesizing dance motions that follow the emotions and contents of a piece of music. Our method employs a learning-based approach to model the music to motion mapping relationship embodied in example dance motions along with those motions' accompanying background music. A key step in our method is to train a music to motion matching quality rating function through learning the music to motion mapping relationship exhibited in synchronized music and dance motion data, which were captured from professional human dance performance. To generate an optimal sequence of dance motion segments to match with a piece of music, we introduce a constraint-based dynamic programming procedure. This procedure considers both music to motion matching quality and visual smoothness of a resultant dance motion sequence. We also introduce a two-way evaluation strategy, coupled with a GPU-based implementation, through which we can execute the dynamic programming process in parallel, resulting in significant speedup. To evaluate the effectiveness of our method, we quantitatively compare the dance motions synthesized by our method with motion synthesis results by several peer methods using the motions captured from professional human dancers' performance as the gold standard. We also conducted several medium-scale user studies to explore how perceptually our dance motion synthesis method can outperform existing methods in synthesizing dance motions to match with a piece of music. These user studies produced very positive results on our music-driven dance motion synthesis experiments for several Asian dance genres, confirming the advantages of our method.

  7. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Education & Training Search results Search results Enter terms Search Showing 1 - 5 of 5 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to...

  8. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Education Search results Search results Enter terms Search Showing 1 - 10 of 12 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to the...

  9. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Education & Training Search results Search results Enter terms Search Showing 11 - 20 of 13 results. Download Energy Management Students will review energy basics and what they...

  10. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Education Search results Search results Enter terms Search Showing 1 - 10 of 20 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to the...

  11. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Education & Training Download Search results Search results Enter terms Search Showing 1 - 10 of 13 results. Download Energy Literacy Video Analysis Guide A guide for...

  12. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Education Search results Search results Enter terms Search Showing 1 - 9 of 9 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to the...

  13. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Education Search results Search results Enter terms Search Showing 1 - 10 of 10 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to the...

  14. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Education & Training Search results Search results Enter terms Search Showing 1 - 8 of 8 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to...

  15. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Education & Training Search results Search results Enter terms Search Showing 1 - 7 of 7 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to...

  16. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Education Search results Search results Enter terms Search Showing 1 - 7 of 7 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to the...

  17. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Education & Training Search results Search results Enter terms Search Showing 1 - 3 of 3 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to...

  18. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Science Education Search results Search results Enter terms Search Showing 1 - 10 of 10 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to...

  19. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Education Search results Search results Enter terms Search Showing 1 - 4 of 4 results. Download Alternative Fuels Used in Transportation (5 Activities) Gasoline is the most...

  20. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Science Education Search results Search results Enter terms Search Showing 1 - 5 of 5 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to...

  1. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Education & Training Search results Search results Enter terms Search Showing 1 - 6 of 6 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to...

  2. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Education Search results Search results Enter terms Search Showing 1 - 10 of 12 results. Article Energy Literacy in Action: Nevada Teachers Helping Students Learn About Energy...

  3. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Education & Training Search results Search results Enter terms Search Showing 1 - 4 of 4 results. Download Energy Literacy Videos New video series, Energy Literacy highlights...

  4. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Education & Training Search results Search results Enter terms Search Showing 1 - 10 of 10 results. Download Energy Literacy Video Analysis Guide A guide for discussion related...

  5. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Science Education Search results Search results Enter terms Search Showing 1 - 10 of 17 results. Download Build a Pizza Box Solar Oven Check out this staightforward lesson, that...

  6. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Science Education Search results Search results Enter terms Search Showing 1 - 10 of 16 results. Article Energy Literacy in Action: Nevada Teachers Helping Students Learn About...

  7. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Education Search results Search results Enter terms Search Showing 21 - 30 of 43 results. Download What Makes A Home 'Energy Efficient'? As energy demands increase and the...

  8. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Education Search results Search results Enter terms Search Showing 41 - 50 of 43 results. Download Ocean Power (4 Activities) Areas of the country that have an available...

  9. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Education Search results Search results Enter terms Search Showing 1 - 8 of 8 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to the...

  10. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Education Search results Search results Enter terms Search Showing 1 - 10 of 15 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to the...

  11. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Education Search results Search results Enter terms Search Showing 1 - 6 of 6 results. Download Alternative Fuels Used in Transportation (5 Activities) Gasoline is the most...

  12. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Science Education Search results Search results Enter terms Search Showing 1 - 10 of 28 results. Download Build a Pizza Box Solar Oven Check out this staightforward lesson, that...

  13. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Education Search results Search results Enter terms Search Showing 11 - 20 of 42 results. Download Alternative Fuels Used in Transportation (5 Activities) Gasoline is the most...

  14. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Science Education Search results Search results Enter terms Search Showing 1 - 10 of 26 results. Download Build a Pizza Box Solar Oven Check out this staightforward lesson, that...

  15. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Science Education Search results Search results Enter terms Search Showing 1 - 10 of 15 results. Download Energy Literacy Videos New video series, Energy Literacy highlights the...

  16. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Climate Change Energy Literacy Principle 6 Search results Search results Enter terms Search Showing 1 - 1 of 1 result. Download Energy Awareness Quiz Students will identify...

  17. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Climate Change Elementary (K-5) Teachers Search results Search results Enter terms Search Showing 1 - 1 of 1 result. Download Protect Your Climate Curriculum and Training...

  18. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Climate Change Middle School (6-8) Teachers Search results Search results Enter terms Search Showing 1 - 1 of 1 result. Download Protect Your Climate Curriculum and Training...

  19. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Emergency Response & Procedures Search results Search results Enter terms Search Showing 1 - 1 of 1 result. Video Re-Building Greensburg Civic leaders and entrepreneurs helped...

  20. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Geothermal Search results Search results Enter terms Search Showing 1 - 5 of 5 results. Video Energy 101: Geothermal Energy See how we can generate clean, renewable energy from...

  1. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Sources Search results Search results Enter terms Search Showing 1 - 10 of 81 results. Video Energy 101: Geothermal Energy See how we can generate clean, renewable energy...

  2. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Students Search results Search results Enter terms Search Showing 1 - 8 of 8 results. Page Analytical Tools The Bioenergy Technologies Office and its national lab partners...

  3. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7 Search results Search results Enter terms Search Showing 1 - 3 of 3 results. Video Bioenergy: America's Energy Future Bioenergy: America's Energy Future is a short documentary...

  4. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Homes Search results Search results Enter terms Search Showing 1 - 3 of 3 results. Download Monitoring and Mentoring These activities explore energy use and conservation using...

  5. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Parents Search results Search results Enter terms Search Showing 1 - 6 of 6 results. Article Energy Literacy in Action: Nevada Teachers Helping Students Learn About Energy...

  6. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Solar Search results Search results Enter terms Search Showing 1 - 1 of 1 result. Video Re-Building Greensburg Civic leaders and entrepreneurs helped rebuild Greensburg, Kansas...

  7. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Download Search results Search results Enter terms Search Showing 11 - 20 of 124 results. Download Energy Literacy Videos New video series, Energy Literacy highlights the 7...

  8. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Parents Search results Search results Enter terms Search Showing 1 - 1 of 1 result. Article Energy Literacy in Action: Nevada Teachers Helping Students Learn About Energy Energy...

  9. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Educators Search results Search results Enter terms Search Showing 1 - 1 of 1 result. Article Energy Literacy in Action: Nevada Teachers Helping Students Learn About Energy...

  10. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Bioenergy Search results Search results Enter terms Search Showing 1 - 10 of 14 results. Download Alternative Fuels Used in Transportation (5 Activities) Gasoline is the most...

  11. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Educators Search results Search results Enter terms Search Showing 1 - 10 of 16 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to the...

  12. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Building Design Search results Search results Enter terms Search Showing 1 - 5 of 5 results. Download Learning and Conserving (10 activities) These activities explore energy use...

  13. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Economy Search results Search results Enter terms Search Showing 1 - 10 of 16 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to the...

  14. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Renewables Search results Search results Enter terms Search Showing 61 - 70 of 74 results. Download Cell Wall Recipe: A Lesson on Biofuels Students will investigate how changes...

  15. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Water Search results Search results Enter terms Search Showing 1 - 7 of 7 results. Download Energy Production Students will compare and contrast renewable and nonrenewable...

  16. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Education & Training Search results Search results Enter terms Search Showing 1 - 10 of 13 results. Download Energy Literacy Video Analysis Guide A guide for discussion related...

  17. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Sources Search results Search results Enter terms Search Showing 1 - 10 of 59 results. Download Build a Pizza Box Solar Oven Check out this staightforward lesson, that...

  18. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Search results Search results Enter terms Search Showing 51 - 60 of 189 results. Download Making Energy Personal Students will work with an interactive website in oder to determine...

  19. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7 Search results Search results Enter terms Search Showing 1 - 1 of 1 result. Article Energy Literacy in Action: Nevada Teachers Helping Students Learn About Energy Energy...

  20. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Storage Search results Search results Enter terms Search Showing 1 - 1 of 1 result. Download Electrolysis of Water Students observe the electrolysis of water using either...

  1. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Video Search results Search results Enter terms Search Showing 11 - 20 of 24 results. Video Energy 101: Home Energy Checkup A home energy checkup helps owners determine where...

  2. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Solar Search results Search results Enter terms Search Showing 1 - 1 of 1 result. Article Solar Energy Technology Basics Solar energy technologies produce electricity from the...

  3. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    & Innovation Search results Search results Enter terms Search Showing 1 - 1 of 1 result. Article Energy Literacy in Action: Nevada Teachers Helping Students Learn About Energy...

  4. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Renewables Search results Search results Enter terms Search Showing 1 - 4 of 4 results. Article Solar Energy Technology Basics Solar energy technologies produce electricity from...

  5. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Page Search results Search results Enter terms Search Showing 1 - 8 of 8 results. Page Analytical Tools The Bioenergy Technologies Office and its national lab partners provide a...

  6. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fuel Economy Search results Search results Enter terms Search Showing 1 - 2 of 2 results. Download Alternative Fuels Used in Transportation (5 Activities) Gasoline is the most...

  7. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Students Search results Search results Enter terms Search Showing 1 - 1 of 1 result. Article Energy Literacy in Action: Nevada Teachers Helping Students Learn About Energy...

  8. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Government Search results Search results Enter terms Search Showing 1 - 1 of 1 result. Page Advantages and Challenges of Wind Energy Wind energy offers many advantages, which...

  9. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Education Search results Search results Enter terms Search Showing 1 - 1 of 1 result. Article Energy Literacy in Action: Nevada Teachers Helping Students Learn About Energy...

  10. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Usage Search results Search results Enter terms Search Showing 1 - 10 of 23 results. Download Reducing Energy Loss Students will learn about the Law of Conservation of...

  11. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2 Search results Search results Enter terms Search Showing 1 - 10 of 36 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to the information...

  12. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4 Search results Search results Enter terms Search Showing 1 - 3 of 3 results. Video Bioenergy: America's Energy Future Bioenergy: America's Energy Future is a short documentary...

  13. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Download Search results Search results Enter terms Search Showing 21 - 30 of 124 results. Download Reducing Energy Loss Students will learn about the Law of Conservation of...

  14. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Climate Change Search results Search results Enter terms Search Showing 1 - 3 of 3 results. Download Protect Your Climate Curriculum and Training Request projects here. Upon...

  15. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Download Search results Search results Enter terms Search Showing 41 - 50 of 124 results. Download Great Energy Debate Students evaluate the advantages and disadvantages of the...

  16. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Technology Search results Search results Enter terms Search Showing 1 - 10 of 10 results. Download Exploring Hydroelectricity (9 activities) Integrated and inquiry-based...

  17. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Homes Search results Search results Enter terms Search Showing 1 - 4 of 4 results. Download Monitoring and Mentoring These activities explore energy use and conservation using...

  18. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Video Search results Search results Enter terms Search Showing 21 - 30 of 24 results. Video Energy 101: Lighting Choices In this edition of Energy 101, we discuss lighting...

  19. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5 Search results Search results Enter terms Search Showing 1 - 10 of 12 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to the information...

  20. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Water Search results Search results Enter terms Search Showing 1 - 1 of 1 result. Article Hydropower Technology Basics Hydropower, or hydroelectric power, is the most common and...

  1. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Search results Search results Enter terms Search Showing 1 - 1 of 1 result. Download Electrolysis of Water Students observe the electrolysis of water using either photovoltaics...

  2. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Parents Search results Search results Enter terms Search Showing 1 - 1 of 1 result. Download Energy Literacy Videos New video series, Energy Literacy highlights the 7 Essential...

  3. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Innovation Search results Search results Enter terms Search Showing 1 - 10 of 53 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to the...

  4. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    6 Search results Search results Enter terms Search Showing 1 - 10 of 41 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to the information...

  5. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Building Design Search results Search results Enter terms Search Showing 1 - 6 of 6 results. Download Learning and Conserving (10 activities) These activities explore energy use...

  6. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Innovation Search results Search results Enter terms Search Showing 1 - 1 of 1 result. Video A New Biofuels Technology Blooms in Iowa Cellulosic biofuels made from agricultural...

  7. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Water Search results Search results Enter terms Search Showing 1 - 10 of 11 results. Video Energy 101: Hydroelectric Power Learn how hydropower captures the kinetic energy of...

  8. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3 Search results Search results Enter terms Search Showing 1 - 10 of 24 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to the information...

  9. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Hydrogen Search results Search results Enter terms Search Showing 1 - 5 of 5 results. Download Alternative Fuels Used in Transportation (5 Activities) Gasoline is the most...

  10. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Page Search results Search results Enter terms Search Showing 1 - 5 of 5 results. Page Analytical Tools The Bioenergy Technologies Office and its national lab partners provide a...

  11. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Clean Cities Search results Search results Enter terms Search Showing 1 - 1 of 1 result. Download Transportation Fuels: The Future is Today (6 Activities) This teacher guide...

  12. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Wind Search results Search results Enter terms Search Showing 1 - 10 of 23 results. Video Energy 101: Wind Turbines- 2014 Update The video highlights the basic principles at...

  13. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5 Search results Search results Enter terms Search Showing 1 - 1 of 1 result. Video Re-Building Greensburg Civic leaders and entrepreneurs helped rebuild Greensburg, Kansas into...

  14. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Download Search results Search results Enter terms Search Showing 81 - 90 of 124 results. Download What's Cooking Students in small groups conduct an investigation into the...

  15. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Renewables Search results Search results Enter terms Search Showing 1 - 7 of 7 results. Video Energy 101: Geothermal Energy See how we can generate clean, renewable energy from...

  16. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Sources Search results Search results Enter terms Search Showing 71 - 80 of 81 results. Page Advantages and Challenges of Wind Energy Wind energy offers many advantages,...

  17. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Science Education Search results Search results Enter terms Search Showing 1 - 10 of 43 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to...

  18. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Efficiency Search results Search results Enter terms Search Showing 1 - 10 of 40 results. Download Alternative Fuels Used in Transportation (5 Activities) Gasoline is the...

  19. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Search results Search results Enter terms Search Showing 61 - 70 of 189 results. Download Wonders of Wind (10 Activities) Hands-on investigation that introduce scientific concepts...

  20. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Undergraduate Students Search results Search results Enter terms Search Showing 1 - 1 of 1 result. Article Energy Literacy in Action: Nevada Teachers Helping Students Learn...

  1. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Students Search results Search results Enter terms Search Showing 1 - 5 of 5 results. Download Energy Literacy Videos New video series, Energy Literacy highlights the 7...

  2. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Hydrogen Search results Search results Enter terms Search Showing 1 - 1 of 1 result. Video Energy 101: Fuel Cell Technology This video illustrates the fundamentals of fuel cell...

  3. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Consumers Search results Search results Enter terms Search Showing 1 - 1 of 1 result. Download Energy Literacy Videos New video series, Energy Literacy highlights the 7...

  4. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Biofuels Search results Search results Enter terms Search Showing 1 - 4 of 4 results. Video A New Biofuels Technology Blooms in Iowa Cellulosic biofuels made from agricultural...

  5. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Environmental Science Search results Search results Enter terms Search Showing 1 - 1 of 1 result. Download Wind Turbine Blade Design Blade engineering and design is one of the...

  6. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7 Search results Search results Enter terms Search Showing 1 - 10 of 17 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to the information...

  7. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3 Search results Search results Enter terms Search Showing 1 - 5 of 5 results. Download Energy Literacy Videos New video series, Energy Literacy highlights the 7 Essential...

  8. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Sources Search results Search results Enter terms Search Showing 1 - 4 of 4 results. Article Solar Energy Technology Basics Solar energy technologies produce electricity...

  9. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Search results Search results Enter terms Search Showing 21 - 30 of 189 results. Video Energy 101: Lighting Choices In this edition of Energy 101, we discuss lighting choices....

  10. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Biofuels Search results Search results Enter terms Search Showing 1 - 2 of 2 results. Download Alternative Fuels Used in Transportation (5 Activities) Gasoline is the most...

  11. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Efficiency Search results Search results Enter terms Search Showing 1 - 3 of 3 results. Video Energy 101: Heavy Duty Vehicle Efficiency Although Class 8 Trucks only make...

  12. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Innovation Search results Search results Enter terms Search Showing 1 - 10 of 55 results. Video A New Biofuels Technology Blooms in Iowa Cellulosic biofuels made from...

  13. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Students Search results Search results Enter terms Search Showing 1 - 10 of 11 results. Article Energy Literacy in Action: Nevada Teachers Helping Students Learn About Energy...

  14. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4 Search results Search results Enter terms Search Showing 1 - 10 of 50 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to the information...

  15. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Bioenergy Search results Search results Enter terms Search Showing 1 - 2 of 2 results. Video A New Biofuels Technology Blooms in Iowa Cellulosic biofuels made from agricultural...

  16. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Educators Search results Search results Enter terms Search Showing 1 - 9 of 9 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to the...

  17. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3 Search results Search results Enter terms Search Showing 1 - 10 of 19 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to the information...

  18. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Sources Search results Search results Enter terms Search Showing 1 - 8 of 8 results. Video Energy 101: Geothermal Energy See how we can generate clean, renewable energy...

  19. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Download Search results Search results Enter terms Search Showing 1 - 10 of 124 results. Download Energy Literacy Video Analysis Guide A guide for discussion related to the...

  20. Search results | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Technology Search results Search results Enter terms Search Showing 1 - 10 of 11 results. Video A New Biofuels Technology Blooms in Iowa Cellulosic biofuels made from...