National Library of Energy BETA

Sample records for regional geographic information

  1. Geographic Information System At U.S. West Region (Williams ...

    Open Energy Info (EERE)

    U.S. West Region (Williams & Deangelo, 2008) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Geographic Information System At U.S. West Region...

  2. Geographic Information System At Northern Basin & Range Region...

    Open Energy Info (EERE)

    Nash & Johnson, 2003) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Geographic Information System At Northern Basin & Range Region (Nash &...

  3. Geographic Information System At Nw Basin & Range Region (Nash...

    Open Energy Info (EERE)

    Nw Basin & Range Region (Nash & Johnson, 2003) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Geographic Information System At Nw Basin & Range...

  4. Geographic Information System At Northern Basin & Range Region...

    Open Energy Info (EERE)

    conventional and EGS capable geothermal systems by analyzing regional data in a GIS. Digital geothermal data will be made available to industry and researchers on a web site....

  5. Geographic Information System At Nw Basin & Range Region (Laney...

    Open Energy Info (EERE)

    conventional and EGS capable geothermal systems by analyzing regional data in a GIS. Digital geothermal data will be made available to industry and researchers on a web site....

  6. Environmental geographic information system.

    SciTech Connect (OSTI)

    Peek, Dennis; Helfrich, Donald Alan; Gorman, Susan

    2010-08-01

    This document describes how the Environmental Geographic Information System (EGIS) was used, along with externally received data, to create maps for the Site-Wide Environmental Impact Statement (SWEIS) Source Document project. Data quality among the various classes of geographic information system (GIS) data is addressed. A complete listing of map layers used is provided.

  7. Montana Geographic Information Library | Open Energy Information

    Open Energy Info (EERE)

    Montana Geographic Information Library Jump to: navigation, search OpenEI Reference LibraryAdd to library Map: Montana Geographic Information LibraryInfo GraphicMapChart Abstract...

  8. Photovoltaic Geographical Information System | Open Energy Information

    Open Energy Info (EERE)

    Information System Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Photovoltaic Geographical Information System Focus Area: Renewable Energy Topics: Opportunity...

  9. Category:Geographic Information System | Open Energy Information

    Open Energy Info (EERE)

    Geographic Information System Jump to: navigation, search Geothermalpower.jpg Looking for the Geographic Information System page? For detailed information on Geographic Information...

  10. Geographic Information System | Open Energy Information

    Open Energy Info (EERE)

    Exploration, Tracers Data Analysis, And Enhanced Data Distribution, Visualization, And Management Geographic Information System At Brady Hot Springs Area (Laney, 2005) Brady Hot...

  11. Geographic Information System At Walker-Lane Transitional Zone...

    Open Energy Info (EERE)

    Zone Region (Laney, 2005) Exploration Activity Details Location Walker-Lane Transition Zone Geothermal Region Exploration Technique Geographic Information System Activity...

  12. Geographic Information Systems- Tools For Geotherm Exploration...

    Open Energy Info (EERE)

    Information Systems- Tools For Geotherm Exploration, Tracers Data Analysis, And Enhanced Data Distribution, Visualization, And Management Abstract Geographic information...

  13. ARM - SGP Geographic Information By Facility

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Geographic Information By Facility SGP Related Links Virtual Tour Facilities and Instruments Central Facility Boundary Facility Extended Facility Intermediate Facility Radiometric Calibration Facility Geographic Information ES&H Guidance Statement Operations Science Field Campaigns Visiting the Site Summer Training SGP Fact Sheet Images Information for Guest Scientists Contacts SGP Geographic Information By Facility Note: BF = Boundary Facility, EF = Extended Facility, and IF = Intermediate

  14. Geographic Information System At International Geothermal Area...

    Open Energy Info (EERE)

    search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Geographic Information System At International Geothermal Area, Indonesia (Nash, Et Al., 2002) Exploration Activity...

  15. Geographic Information System (Monaster And Coolbaugh, 2007)...

    Open Energy Info (EERE)

    navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Geographic Information System (Monaster And Coolbaugh, 2007) Exploration Activity Details Location...

  16. Geographic Information System (Nash, Et Al., 2002) | Open Energy...

    Open Energy Info (EERE)

    search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Geographic Information System (Nash, Et Al., 2002) Exploration Activity Details Location Unspecified Exploration...

  17. Geographic Information System At Lightning Dock Geothermal Area...

    Open Energy Info (EERE)

    navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Geographic Information System At Lightning Dock Geothermal Area (Getman, 2014) Exploration Activity...

  18. Distributed Object Oriented Geographic Information System

    Energy Science and Technology Software Center (OSTI)

    1997-02-01

    This interactive, object-oriented, distributed Geographic Information System (GIS) uses the World Wibe Web (WWW) as application medium and distribution mechanism. The software provides distributed access to multiple geo-spatial databases and presents them as if they came from a single coherent database. DOOGIS distributed access comes not only in the form of multiple geo-spatial servers but can break down a single logical server into the constituent physical servers actually storing the data. The program provides formore » dynamic protocol resolution and content handling allowing unknown objects from a particular server to download their handling code. Security and access privileges are negotiated dynamically with each server contacted and each access attempt.« less

  19. Object-oriented Geographic Information System Framework

    Energy Science and Technology Software Center (OSTI)

    2003-03-01

    JeoViewer is an intelligent object-oriented geographic information system (GIS) framework written in Java that provides transparent linkage to any object’s data, behaviors, and optimized spatial geometry representation. Tools are provided for typical GIS functionality, data ingestion, data export, and integration with other frameworks. The primary difference between Jeo Viewer and traditional GIS systems is that traditional GIS systems offer static views of geo-spatial data while JeoViewer can be dynamically coupled to models and live datamore » streams which dynamically change the state of the object which can be immediately represented in JeoViewer. Additionally, JeoViewer’s object-oriented paradigm provides a more natural representation of spatial data. A rich layer hierarchy allows arbitrary grouping of objects based on any relationship as well as the traditional GIS vertical ordering of objects. JeoViewer can run as a standalone product, extended with additional analysis functionality, or embedded in another framework.« less

  20. Geographic Information System At Chena Geothermal Area (Holdmann...

    Open Energy Info (EERE)

    Details Location Chena Geothermal Area Exploration Technique Geographic Information System Activity Date 2005 - 2007 Usefulness useful DOE-funding Unknown Exploration Basis...

  1. Geographic Information System At Dixie Valley Geothermal Area...

    Open Energy Info (EERE)

    Nash & D., 1997) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Geographic Information System At Dixie Valley Geothermal Area (Nash & D., 1997)...

  2. Geographic Information System At Fish Lake Valley Area (Deymonaz...

    Open Energy Info (EERE)

    Fish Lake Valley Area (Deymonaz, Et Al., 2008) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Geographic Information System At Fish Lake Valley...

  3. Geographic Information System At Nevada Test And Training Range...

    Open Energy Info (EERE)

    Nevada Test And Training Range Area (Sabin, Et Al., 2004) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Geographic Information System At Nevada...

  4. Plate Tectonics, Geographical Information System, paleogeography

    Energy Science and Technology Software Center (OSTI)

    2002-05-24

    The PaleoX.framwork is a dynamically linked/loaded framework for Cocoa applications. The primary goal of this library is to standardize several elements used for working with paleogeographic data. This includes objects designed to organize information for tectonic plates, including maps, rotation objects, plate names, and designations. In addition, PaleoX provides object-oriented solutions for handling standard paleogeographic file formats from the PALEOMAP Project.

  5. Transportation Routing Analysis Geographic Information System (TRAGIS) User's Manual

    SciTech Connect (OSTI)

    Johnson, PE

    2003-09-18

    The Transportation Routing Analysis Geographic Information System (TRAGIS) model is used to calculate highway, rail, or waterway routes within the United States. TRAGIS is a client-server application with the user interface and map data files residing on the user's personal computer and the routing engine and network data files on a network server. The user's manual provides documentation on installation and the use of the many features of the model.

  6. Applications of Geographic Information Systems technology for environmental planning and management in North Carolina

    SciTech Connect (OSTI)

    Nagy, Z.; Wiele-Evans, C. Van Der )

    1993-01-01

    The State of North Carolina is developing a multipurpose geographic information systems (GIS) database for widespread use. The database currently consists of more than fifty categories of information state wide. In addition to basic planimetric information, the data include many categories of environmental significance. Much of the database has proven useful to planners, managers, and consultants involved with environmental policy-making and protection. The database is being used to augment activities in regulatory programs, research programs and in a variety of siting applications. The North Carolina Center for Geographic Information and Analysis (NCCGIA) has operated the State's GIS since 1977 and is the lead coordinating agency for geographic information in the state. NCCGIA is able to develop and maintain the corporate database through partnerships with other state, federal, regional, and local government agencies and private organizations. Users access the database at NCCGIA for the production of maps and statistics, to spontaneously generate displays of a project area, to acquire data, and to conduct special studies. This paper describes some of the activities associated with environmental planning and management applications at the North Carolina Center for Geographic Information and Analysis. Specifically, it illustrates the following: the conceptual framework for development and maintenance of the corporate database; the contents of the database; several environmental planning documents and applications developed at NCCGIA; and methods of data access.

  7. Table 2: U.S. Geographic Areas and Census Regions | Department of Energy

    Energy Savers [EERE]

    2: U.S. Geographic Areas and Census Regions Table 2: U.S. Geographic Areas and Census Regions PDF icon Table 2: U.S. Geographic Areas and Census Regions More Documents & Publications Memorandum Summarizing Ex Parte Communication An Assessment of Heating Fuels And Electricity Markets During the Winters of 2013-2014 and 2014-2015 Final Report of the Mid-Atlantic Marine Wildlife Surveys, Modeling, and Data

  8. Geographic information system applications in coal transportation analysis

    SciTech Connect (OSTI)

    Elmes, G.

    1996-12-31

    Geographic information systems (GIS) offer great potential to the coal transportation industry for capitalizing on the growing availability of spatially-referenced data. As computer-based systems for the collection, storage, retrieval and analysis of spatial data, generating information products in a variety of formats, GIS have a great capability to improve the efficiency and effectiveness of coal transportation operations, planning, engineering, and facilities management. Currently GIS are used in the transportation industry at large to analyze, and display information about network infrastructure, fleet operations, property ownership, routing and scheduling, and utilities. Current coal transportation applications include consumer service inquiries, train and locomotive scheduling, and evaluation of network usage. The paper describes the significant potential uses of GIS in the coal transportation sector when integrated with optimization and decision support systems, scientific visualization, data forecasting, and strategic system planning approaches. Ultimately consumer demand and the drive for economic efficiency are likely to stimulate the integration and management of spatial information across the entire coal chain.

  9. DEACTIVATION AND DECOMMISSIONING PLANNING AND ANALYSIS WITH GEOGRAPHIC INFORMATION SYSTEMS

    SciTech Connect (OSTI)

    Bollinger, J; William Austin, W; Larry Koffman, L

    2007-09-17

    From the mid-1950's through the 1980's, the U.S. Department of Energy's Savannah River Site produced nuclear materials for the weapons stockpile, for medical and industrial applications, and for space exploration. Although SRS has a continuing defense-related mission, the overall site mission is now oriented toward environmental restoration and management of legacy chemical and nuclear waste. With the change in mission, SRS no longer has a need for much of the infrastructure developed to support the weapons program. This excess infrastructure, which includes over 1000 facilities, will be decommissioned and demolished over the forthcoming years. Dispositioning facilities for decommissioning and deactivation requires significant resources to determine hazards, structure type, and a rough-order-of-magnitude estimate for the decommissioning and demolition cost. Geographic information systems (GIS) technology was used to help manage the process of dispositioning infrastructure and for reporting the future status of impacted facilities.

  10. A Geographic Information System approach to modeling nutrient and sediment transport

    SciTech Connect (OSTI)

    Levine, D.A.; Hunsaker, C.T.; Beauchamp, J.J.; Timmins, S.P.

    1993-02-01

    The objective of this study was to develop a water quality model to quantify nonpoint-source (NPS) pollution that uses a geographic information system (GIS) to link statistical modeling of nutrient and sediment delivery with the spatial arrangement of the parameters that drive the model. The model predicts annual nutrient and sediment loading and was developed, calibrated, and tested on 12 watersheds within the Lake Ray Roberts drainage basin in north Texas. Three physiographic regions are represented by these watersheds, and model success, as measured by the accuracy of load estimates, was compared within and across these regions.

  11. Deactivation and Decommissioning Planning and Analysis with Geographic Information Systems

    SciTech Connect (OSTI)

    Bollinger, James S.; Koffman, Larry D.; Austin, William E.

    2008-01-15

    From the mid-1950's through the 1980's, the U.S. Department of Energy's Savannah River Site produced nuclear materials for the weapons stockpile, for medical and industrial applications, and for space exploration. Although SRS has a continuing defense-related mission, the overall site mission is now oriented toward environmental restoration and management of legacy chemical and nuclear waste. With the change in mission, SRS no longer has a need for much of the infrastructure developed to support the weapons program. This excess infrastructure, which includes over 1000 facilities, will be decommissioned and demolished over the forthcoming years. Dis-positioning facilities for decommissioning and deactivation requires significant resources to determine hazards, structure type, and a rough-order-of-magnitude estimate for the decommissioning and demolition cost. Geographic information systems (GIS) technology was used to help manage the process of dis-positioning infrastructure and for reporting the future status of impacted facilities. Several thousand facilities of various ages and conditions are present at SRS. Many of these facilities, built to support previous defense-related missions, now represent a potential hazard and cost for maintenance and surveillance. To reduce costs and the hazards associated with this excess infrastructure, SRS has developed an ambitious plan to decommission and demolish unneeded facilities in a systematic fashion. GIS technology was used to assist development of this plan by: providing locational information for remote facilities, identifying the location of known waste units adjacent to buildings slated for demolition, and for providing a powerful visual representation of the impact of the overall plan. Several steps were required for the development of the infrastructure GIS model. The first step involved creating an accurate and current GIS representation of the infrastructure data. This data is maintained in a Computer Aided Design (CAD) system and had to be imported into a GIS framework. Since the data is maintained in a different format in CAD, import into GIS involved several spatial processing steps to convert various geometric shapes present in the CAD data to self-closing polygons. The polygons represent facility footprints in plan or map view. Once these were successfully imported and converted, building identifier attributes from the CAD had to be associated with the appropriate polygons in GIS. Attributes are stored as graphical information in a CAD system and are not 'attached' to a building in a relational sense. In GIS, attributes such as building names, building area, hazards, or other descriptive information, must be associated or related to the spatial polygon representing a particular building. This spatial relationship between building polygons and the descriptive attribute information is very similar to relating tables of information in a relational database in which each table record has a unique identifier that can be used to join or relate that table to other tables of information present in the database. The CAD building identifiers were imported into the GIS and several spatial processing steps were used to associate building polygons with the correct identifiers. These spatial steps involved determining the intersection of and nearest identifiers with each building polygon in the GIS. Automating this process in GIS saved a significant amount of time. Once a current and geographically correct representation of the infrastructure data had been created in GIS, field-engineering teams collected information for each facility. This information included the building area, radiological hazards and the associated area, industrial hazards such as asbestos or mercury, structure type (e.g. hardened, industrial, nuclear), annual surveillance and monitoring cost, and other engineering data. The facility engineering data was used in a simple model to determine the rough-order-of-magnitude cost for decontaminating and demolishing each facility. Finally, the engineering and cost data was linked to the GIS model so that this data could be rapidly displayed and analyzed in its geographic context. Once the GIS representing SRS infrastructure and associated descriptive attribute information was developed, detailed maps depicting the future status of all site facilities were created. These maps display the relationship between known waste units and buildings that will be decommissioned and demolished. Cost and hazard information was also depicted illustrating areas and facilities that could present a particular demolition challenge. Although the GIS was quite helpful as an engineering and planning tool, its real power was evident in communicating the impact of the facilities disposition plan to senior management and other stakeholders.

  12. Towards Sustainable Watershed Dvelopment: A Geographic Information Systems based Approach

    SciTech Connect (OSTI)

    Bhaduri, Budhendra L

    2006-01-01

    With an unprecedented projection of population and urban growth in the coming decades, assessment of the long-term hydrologic impacts of land use change is crucial for optimizing management practices to control runoff and non-point source (NPS) pollution associated with sustainable watershed development. Land use change, dominated by an increase in urban/impervious areas, can have a significant impact on water resources. Non-point source (NPS) pollution is the leading cause of degraded water quality in the US and urban areas are an important source of NPS pollution. Most planners, government agencies, and consultants lack access to simple impact-assessment tools despite widespread concern over the environmental impacts of watershed development. Before investing in complex analyses and customized data collection, it is often useful to utilize simple screening analyses using data that are already available. In this paper, we discuss such a technique for long-term hydrologic impact assessment (L-THIA) that makes use of basic land use, soils and long-term rainfall data to compare the hydrologic impacts of past, present and any future land use change. Long-term daily rainfall records are used in combination with soils and land use information to calculate average annual runoff and NPS pollution at a watershed scale. Because of the geospatial nature of land use and soils data, and the increasingly widespread use of GIS by planners, government agencies and consultants, the model is integrated with a Geographic Information System (GIS) that allows convenient generation and management of model input and output data, and provides advanced visualization of the model results. An application of the L-THIA/NPS model on the Little Eagle Creek (LEC) watershed near Indianapolis, Indiana is illustrated in this paper. Three historical land use scenarios for 1973, 1984, and 1991 were analyzed to track land use change in the watershed and to assess the impacts of land use change on annual average runoff and NPS pollution from the watershed and its five sub-basins. Results highlight the effectiveness of the L-THIA approach in assessing the long-term hydrologic impact of urban sprawl. The L-THIA/NPS GIS model is a powerful tool for identifying environmentally sensitive areas in terms of NPS pollution potential and for evaluating alternative land use scenarios to enhance NPS pollution management. Access to the model via the INTERNET enhances the usability and effectiveness of the technique significantly. Recommendations can be made to community decision makers, based on this analysis, concerning how development can be controlled within the watershed to minimize the long-term impacts of increased stormwater runoff and NPS pollution for better management of water resources.

  13. Geographic Information System At Central Nevada Seismic Zone...

    Open Energy Info (EERE)

    conventional and EGS capable geothermal systems by analyzing regional data in a GIS. Digital geothermal data will be made available to industry and researchers on a web site....

  14. Geographic Information System At Northern Basin & Range Region...

    Open Energy Info (EERE)

    DOE-funding Unknown References Mark Coolbaugh, Richard Zehner, Corne Kreemer, David Blackwell, Gary Oppliger (2005) A Map Of Geothermal Potential For The Great Basin,...

  15. Geographic Information System At Nw Basin & Range Region (Coolbaugh...

    Open Energy Info (EERE)

    David Blackwell, Gary Oppliger (2005) A Map Of Geothermal Potential For The Great Basin, Usa- Recognition Of Multiple Geothermal Environments Additional References Retrieved from...

  16. Geographic Information System At Northern Basin & Range Region...

    Open Energy Info (EERE)

    study. References Geoffrey Blewittl, Mark F. Coolbaugh, Don Sawatzky, William Holt, James Davis, Richard A. Bennett (2003) Targeting Of Potential Geothermal Resources In The...

  17. Geographic Information System At Nw Basin & Range Region (Blewitt...

    Open Energy Info (EERE)

    study. References Geoffrey Blewittl, Mark F. Coolbaugh, Don Sawatzky, William Holt, James Davis, Richard A. Bennett (2003) Targeting Of Potential Geothermal Resources In The...

  18. Renewable Energy Assessment of Bureau of Reclamation Land and Facilities Using Geographic Information Systems

    SciTech Connect (OSTI)

    Heimiller, D.; Haase, S.; Melius, J.

    2013-05-01

    This report summarizes results of geographic information system screening for solar and wind potential at select Bureau of Reclamation lands in the western United States. The study included both utility-scale and facility-scale potential. This study supplements information in the report titled Renewable Energy Assessment for the Bureau of Reclamation: Final Report.

  19. National Carbon Sequestration Database and Geographic Information System (NatCarb)

    SciTech Connect (OSTI)

    Kenneth Nelson; Timothy Carr

    2009-03-31

    This annual and final report describes the results of the multi-year project entitled 'NATional CARBon Sequestration Database and Geographic Information System (NatCarb)' (http://www.natcarb.org). The original project assembled a consortium of five states (Indiana, Illinois, Kansas, Kentucky and Ohio) in the midcontinent of the United States (MIDCARB) to construct an online distributed Relational Database Management System (RDBMS) and Geographic Information System (GIS) covering aspects of carbon dioxide (CO{sub 2}) geologic sequestration. The NatCarb system built on the technology developed in the initial MIDCARB effort. The NatCarb project linked the GIS information of the Regional Carbon Sequestration Partnerships (RCSPs) into a coordinated regional database system consisting of datasets useful to industry, regulators and the public. The project includes access to national databases and GIS layers maintained by the NatCarb group (e.g., brine geochemistry) and publicly accessible servers (e.g., USGS, and Geography Network) into a single system where data are maintained and enhanced at the local level, but are accessed and assembled through a single Web portal to facilitate query, assembly, analysis and display. This project improves the flow of data across servers and increases the amount and quality of available digital data. The purpose of NatCarb is to provide a national view of the carbon capture and storage potential in the U.S. and Canada. The digital spatial database allows users to estimate the amount of CO{sub 2} emitted by sources (such as power plants, refineries and other fossil-fuel-consuming industries) in relation to geologic formations that can provide safe, secure storage sites over long periods of time. The NatCarb project worked to provide all stakeholders with improved online tools for the display and analysis of CO{sub 2} carbon capture and storage data through a single website portal (http://www.natcarb.org/). While the external project is ending, NatCarb will continue as an internal US Department of Energy National Energy Technology Laboratory (NETL) project with the continued cooperation of personnel at both West Virginia University and the Kansas Geological Survey. The successor project will continue to organize and enhance the information about CO{sub 2} sources and developing the technology needed to access, query, analyze, display, and distribute natural resource data critical to carbon management. Data are generated, maintained and enhanced locally at the RCSP level, or at the national level in specialized data warehouses, and assembled, accessed, and analyzed in real-time through a single geoportal. To address the broader needs of a spectrum of users form high-end technical queries to the general public, NatCarb will be moving to an improved and simplified display for the general public using readily available web tools such as Google Earth{trademark} and Google Maps{trademark}. The goal is for NatCarb to expand in terms of technology and areal coverage and remain the premier functional demonstration of distributed data-management systems that cross the boundaries between institutions and geographic areas, and forms the foundation of a functioning carbon cyber-infrastructure. NatCarb provides access to first-order information to evaluate the costs, economic potential and societal issues of CO{sub 2} capture and storage, including public perception and regulatory aspects.

  20. Category:Geothermal Regions | Open Energy Information

    Open Energy Info (EERE)

    Geothermal Regions Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Geothermalpower.jpg Looking for the Geothermal Regions page? For detailed information on Geothermal...

  1. Petrophysical Analysis and Geographic Information System for San Juan Basin Tight Gas Reservoirs

    SciTech Connect (OSTI)

    Martha Cather; Robert Lee; Robert Balch; Tom Engler; Roger Ruan; Shaojie Ma

    2008-10-01

    The primary goal of this project is to increase the availability and ease of access to critical data on the Mesaverde and Dakota tight gas reservoirs of the San Juan Basin. Secondary goals include tuning well log interpretations through integration of core, water chemistry and production analysis data to help identify bypassed pay zones; increased knowledge of permeability ratios and how they affect well drainage and thus infill drilling plans; improved time-depth correlations through regional mapping of sonic logs; and improved understanding of the variability of formation waters within the basin through spatial analysis of water chemistry data. The project will collect, integrate, and analyze a variety of petrophysical and well data concerning the Mesaverde and Dakota reservoirs of the San Juan Basin, with particular emphasis on data available in the areas defined as tight gas areas for purpose of FERC. A relational, geo-referenced database (a geographic information system, or GIS) will be created to archive this data. The information will be analyzed using neural networks, kriging, and other statistical interpolation/extrapolation techniques to fine-tune regional well log interpretations, improve pay zone recognition from old logs or cased-hole logs, determine permeability ratios, and also to analyze water chemistries and compatibilities within the study area. This single-phase project will be accomplished through four major tasks: Data Collection, Data Integration, Data Analysis, and User Interface Design. Data will be extracted from existing databases as well as paper records, then cleaned and integrated into a single GIS database. Once the data warehouse is built, several methods of data analysis will be used both to improve pay zone recognition in single wells, and to extrapolate a variety of petrophysical properties on a regional basis. A user interface will provide tools to make the data and results of the study accessible and useful. The final deliverable for this project will be a web-based GIS providing data, interpretations, and user tools that will be accessible to anyone with Internet access. During this project, the following work has been performed: (1) Assimilation of most special core analysis data into a GIS database; (2) Inventorying of additional data, such as log images or LAS files that may exist for this area; (3) Analysis of geographic distribution of that data to pinpoint regional gaps in coverage; (4) Assessment of the data within both public and proprietary data sets to begin tuning of regional well logging analyses and improve payzone recognition; (5) Development of an integrated web and GIS interface for all the information collected in this effort, including data from northwest New Mexico; (6) Acquisition and digitization of logs to create LAS files for a subset of the wells in the special core analysis data set; and (7) Petrophysical analysis of the final set of well logs.

  2. Form:GeothermalRegion | Open Energy Information

    Open Energy Info (EERE)

    of a Geothermal Region below. If the region already exists, you will be able to edit its information. AddEdit a Geothermal Region Retrieved from "http:en.openei.orgw...

  3. Development of a Carbon Management Geographic Information System (GIS) for the United States

    SciTech Connect (OSTI)

    Howard Herzog; Holly Javedan

    2009-12-31

    In this project a Carbon Management Geographical Information System (GIS) for the US was developed. The GIS stored, integrated, and manipulated information relating to the components of carbon management systems. Additionally, the GIS was used to interpret and analyze the effect of developing these systems. This report documents the key deliverables from the project: (1) Carbon Management Geographical Information System (GIS) Documentation; (2) Stationary CO{sub 2} Source Database; (3) Regulatory Data for CCS in United States; (4) CO{sub 2} Capture Cost Estimation; (5) CO{sub 2} Storage Capacity Tools; (6) CO{sub 2} Injection Cost Modeling; (7) CO{sub 2} Pipeline Transport Cost Estimation; (8) CO{sub 2} Source-Sink Matching Algorithm; and (9) CO{sub 2} Pipeline Transport and Cost Model.

  4. Geothermal Regions | Open Energy Information

    Open Energy Info (EERE)

    groundwater flow), and other relevant factors. The 21 regions can be seen outlined in red and overlain on the 2008 USGS Geothermal Favorability Map in Figure 1.1 Add a new...

  5. GEOGRAPHIC INFORMATION SYSTEM APPROACH FOR PLAY PORTFOLIOS TO IMPROVE OIL PRODUCTION IN THE ILLINOIS BASIN

    SciTech Connect (OSTI)

    Beverly Seyler; John Grube

    2004-12-10

    Oil and gas have been commercially produced in Illinois for over 100 years. Existing commercial production is from more than fifty-two named pay horizons in Paleozoic rocks ranging in age from Middle Ordovician to Pennsylvanian. Over 3.2 billion barrels of oil have been produced. Recent calculations indicate that remaining mobile resources in the Illinois Basin may be on the order of several billion barrels. Thus, large quantities of oil, potentially recoverable using current technology, remain in Illinois oil fields despite a century of development. Many opportunities for increased production may have been missed due to complex development histories, multiple stacked pays, and commingled production which makes thorough exploitation of pays and the application of secondary or improved/enhanced recovery strategies difficult. Access to data, and the techniques required to evaluate and manage large amounts of diverse data are major barriers to increased production of critical reserves in the Illinois Basin. These constraints are being alleviated by the development of a database access system using a Geographic Information System (GIS) approach for evaluation and identification of underdeveloped pays. The Illinois State Geological Survey has developed a methodology that is being used by industry to identify underdeveloped areas (UDAs) in and around petroleum reservoirs in Illinois using a GIS approach. This project utilizes a statewide oil and gas Oracle{reg_sign} database to develop a series of Oil and Gas Base Maps with well location symbols that are color-coded by producing horizon. Producing horizons are displayed as layers and can be selected as separate or combined layers that can be turned on and off. Map views can be customized to serve individual needs and page size maps can be printed. A core analysis database with over 168,000 entries has been compiled and assimilated into the ISGS Enterprise Oracle database. Maps of wells with core data have been generated. Data from over 1,700 Illinois waterflood units and waterflood areas have been entered into an Access{reg_sign} database. The waterflood area data has also been assimilated into the ISGS Oracle database for mapping and dissemination on the ArcIMS website. Formation depths for the Beech Creek Limestone, Ste. Genevieve Limestone and New Albany Shale in all of the oil producing region of Illinois have been calculated and entered into a digital database. Digital contoured structure maps have been constructed, edited and added to the ILoil website as map layers. This technology/methodology addresses the long-standing constraints related to information access and data management in Illinois by significantly simplifying the laborious process that industry presently must use to identify underdeveloped pay zones in Illinois.

  6. Determining the Effectiveness of Incorporating Geographic Information Into Vehicle Performance Algorithms

    SciTech Connect (OSTI)

    Sera White

    2012-04-01

    This thesis presents a research study using one year of driving data obtained from plug-in hybrid electric vehicles (PHEV) located in Sacramento and San Francisco, California to determine the effectiveness of incorporating geographic information into vehicle performance algorithms. Sacramento and San Francisco were chosen because of the availability of high resolution (1/9 arc second) digital elevation data. First, I present a method for obtaining instantaneous road slope, given a latitude and longitude, and introduce its use into common driving intensity algorithms. I show that for trips characterized by >40m of net elevation change (from key on to key off), the use of instantaneous road slope significantly changes the results of driving intensity calculations. For trips exhibiting elevation loss, algorithms ignoring road slope overestimated driving intensity by as much as 211 Wh/mile, while for trips exhibiting elevation gain these algorithms underestimated driving intensity by as much as 333 Wh/mile. Second, I describe and test an algorithm that incorporates vehicle route type into computations of city and highway fuel economy. Route type was determined by intersecting trip GPS points with ESRI StreetMap road types and assigning each trip as either city or highway route type according to whichever road type comprised the largest distance traveled. The fuel economy results produced by the geographic classification were compared to the fuel economy results produced by algorithms that assign route type based on average speed or driving style. Most results were within 1 mile per gallon ({approx}3%) of one another; the largest difference was 1.4 miles per gallon for charge depleting highway trips. The methods for acquiring and using geographic data introduced in this thesis will enable other vehicle technology researchers to incorporate geographic data into their research problems.

  7. Geographic Information Systems in Support of Wind Energy Activities at NREL: Preprint

    Wind Powering America (EERE)

    Geographic Information Systems in Support of Wind Energy Activities at NREL Preprint January 2001 * NREL/CP-500-29164 D.M. Heimiller S.R. Haymes To be presented at the 39 th AIAA Aerospace Sciences Meeting Reno, Nevada January 8-11, 2001 National Renewable Energy Laboratory 1617 Cole Boulevard Golden, Colorado 80401-3393 NREL is a U.S. Department of Energy Laboratory Operated by Midwest Research Institute * * * * Battelle * * * * Bechtel Contract No. DE-AC36-99-GO10337 NOTICE The submitted

  8. The use of information systems to transform utilities and regulatory commissions: The application of geographic information systems

    SciTech Connect (OSTI)

    Wirick, D.W.; Montgomery, G.E.; Wagman, D.C.; Spiers, J.

    1995-09-01

    One technology that can assist utilities remain financially viable in competitive markets and help utilities and regulators to better serve the public is information technology. Because geography is an important part of an electric, natural gas, telecommunications, or water utility, computer-based Geographic Information Systems (GIS) and related Automated Mapping/Facilities Management systems are emerging as core technologies for managing an ever-expanding variety of formerly manual or paper-based tasks. This report focuses on GIS as an example of the types of information systems that can be used by utilities and regulatory commissions. Chapter 2 provides general information about information systems and effects of information on organizations; Chapter 3 explores the conversion of an organization to an information-based one; Chapters 4 and 5 set out GIS as an example of the use of information technologies to transform the operations of utilities and commissions; Chapter 6 describes the use of GIS and other information systems for organizational reengineering efforts; and Chapter 7 examines the regulatory treatment of information systems.

  9. Application of geographic information systems to waste minimization efforts at Los Alamos National Laboratory

    SciTech Connect (OSTI)

    Lyttle, T.W.; Smith, D.M.; Burns, M.; Weinrach, J.B.

    1993-01-01

    At Los Alamos National Laboratory (LANL), facility waste streams tend to be small but highly diverse. Initial characterization of such waste streams is often difficult in part due to a lack of tools to assist the generators themselves in completing such assessments. A methodology has been developed at LANL to allow process knowledgeable field personnel to develop baseline waste generation assessments and to evaluate potential waste minimization technology. This Process Waste Assessment (PWA) system is an application constructed within the Process Modeling System and currently being integrated with the InFoCAD Geographic Information System (GIS) . The Process Modeling System (PMS) is an object-oriented, mass balance-based, discrete-event simulation framework written using the Common Lisp Object System (CLOS) . Analytical capabilities supported within the PWA system include: complete mass balance specifications, historical characterization of selected waste streams and generation of facility profiles for materials consumption, resource utilization and worker exposure. Development activities include integration with the LANL facilities management Geographic Information System (GIS) and provisions for a Best Available Technologies (BAT) database. The environments used to develop these assessment tools will be discussed in addition to a review of initial implementation results.

  10. Integration of geographic information systems and logistic multiple regression for aquatic macrophyte modeling

    SciTech Connect (OSTI)

    Narumalani, S.; Jensen, J.R.; Althausen, J.D.; Burkhalter, S.; Mackey, H.E. Jr.

    1994-06-01

    Since aquatic macrophytes have an important influence on the physical and chemical processes of an ecosystem while simultaneously affecting human activity, it is imperative that they be inventoried and managed wisely. However, mapping wetlands can be a major challenge because they are found in diverse geographic areas ranging from small tributary streams, to shrub or scrub and marsh communities, to open water lacustrian environments. In addition, the type and spatial distribution of wetlands can change dramatically from season to season, especially when nonpersistent species are present. This research, focuses on developing a model for predicting the future growth and distribution of aquatic macrophytes. This model will use a geographic information system (GIS) to analyze some of the biophysical variables that affect aquatic macrophyte growth and distribution. The data will provide scientists information on the future spatial growth and distribution of aquatic macrophytes. This study focuses on the Savannah River Site Par Pond (1,000 ha) and L Lake (400 ha) these are two cooling ponds that have received thermal effluent from nuclear reactor operations. Par Pond was constructed in 1958, and natural invasion of wetland has occurred over its 35-year history, with much of the shoreline having developed extensive beds of persistent and non-persistent aquatic macrophytes.

  11. DEVELOPMENT OF A CARBON MANAGEMENT GEOGRAPHIC INFORMATION SYSTEM (GIS) FOR THE UNITED STATES

    SciTech Connect (OSTI)

    Howard J. Herzog

    2004-03-01

    The Lab for Energy and Environment (LFEE) at MIT is developing a Geographic Information System (GIS) for carbon management. The GIS will store, integrate, and manipulate information relating to the components of carbon management systems. Additionally, the GIS can be used to interpret and analyze the effect of developing these systems. In the first year of this three year project, we focused on two tasks: (1) specifying the system design--defining in detail the GIS data requirements, the types of analyses that can be conducted, and the forms of output we will produce, as well as designing the computer architecture of the GIS and (2) creating the ''core'' datasets--identifying data sources and converting them into a form accessible by the GIS.

  12. Geographic information system (G.I.S.) research project at Navajo Community College - Shiprock Campus

    SciTech Connect (OSTI)

    Yazzie, R.; Peter, C.; Aaspas, B.; Isely, D.; Grey, R.

    1995-12-31

    The Navajo and Hopi GIS Project was established to assess the feasibility and impact of implementing GIS techology at Tribal institutions. Los Alamos and Lawrence Livermore National Laboratories funded the Navajo and Hopi Geographic Information System (G.I.S.) Project and assigned a mentor from LANL to help guide the project for three summer months of 1995. The six organizations involved were: LANL, LLNL, Navajo Community College, Navajo Nation Land Office, Northern Arizona University and San Juan College. The Navajo Land Office provided the system software, hardware and training. Northern Arizona University selected two students to work at Hopi Water Resource Department. Navajo Community College provided two students and two faculty members. San Juan College provided one student to work with the N.C.C. group. This made up two project teams which led to two project sites. The project sites are the Water Resource Department on the Hopi reservation and Navajo Community College in Shiprock, New Mexico.

  13. Understanding Carbon Sequestration Options in the United States: Capabilities of a Carbon Management Geographic Information System

    SciTech Connect (OSTI)

    Dahowski, Robert T.; Dooley, James J.; Brown, Daryl R.; Mizoguchi, Akiyoshi; Shiozaki, Mai

    2001-04-03

    While one can discuss various sequestration options at a national or global level, the actual carbon management approach is highly site specific. In response to the need for a better understanding of carbon management options, Battelle in collaboration with Mitsubishi Corporation, has developed a state-of-the-art Geographic Information System (GIS) focused on carbon capture and sequestration opportunities in the United States. The GIS system contains information (e.g., fuel type, location, vintage, ownership, rated capacity) on all fossil-fired generation capacity in the Untied States with a rated capacity of at least 100 MW. There are also data on other CO2 sources (i.e., natural domes, gas processing plants, etc.) and associated pipelines currently serving enhanced oil recovery (EOR) projects. Data on current and prospective CO2 EOR projects include location, operator, reservoir and oil characteristics, production, and CO2 source. The system also contains information on priority deep saline aquifers and coal bed methane basins with potential for sequestering CO2. The GIS application not only enables data storage, flexible map making, and visualization capabilities, but also facilitates the spatial analyses required to solve complex linking of CO2 sources with appropriate and cost-effective sinks. A variety of screening criteria (spatial, geophysical, and economic) can be employed to identify sources and sinks most likely amenable to deployment of carbon capture and sequestration systems. The system is easily updateable, allowing it to stay on the leading edge of capture and sequestration technology as well as the ever-changing business landscape. Our paper and presentation will describe the development of this GIS and demonstrate its uses for carbon management analysis.

  14. Using geographic information systems in the delineation of wellhead protection areas

    SciTech Connect (OSTI)

    Shafer, J.M. . Earth Sciences and Resources Inst.); Horton, C.A. . Dept. of Civil Engineering)

    1994-03-01

    The 1986 amendments to the Safe Drinking Water Act established the nationwide wellhead protection program to be administered by the US Environmental Protection Agency. Although individual states have the responsibility to implement wellhead protection, the US EPA provides technical guidance, and approves each wellhead protection plan prepared by the states. A major aspect of wellhead protection strategies is the delineation of wellhead protection areas. These are zones around municipal water supply wells that receive special land use considerations intended to minimize the threat of contamination of the wells. The US EPA has recommended several technical approaches to delineating wellhead protection areas, ranging in sophistication from simple concentric circles around wells to irregular areas determined from groundwater flow and transport analyses. Regardless of the wellhead protection area delineation technique, the resulting area surrounding the municipal well must be accurately mapped. A geographic information system (GIS) approach to mapping the results of wellhead protection area delineation is demonstrated. Using hypothetical groundwater flow regimes, each EPA recommended approach to wellhead protection area delineation is presented in a GIS format. A visual comparison of delineation techniques in terms of area and configuration of the resulting wellhead protection areas is made. Finally, the advantages of using a GIS for representing wellhead protection areas is provided.

  15. Emerging Technologies in the Built Environment: Geographic Information Science (GIS), 3D Printing, and Additive Manufacturing

    SciTech Connect (OSTI)

    New, Joshua Ryan

    2014-01-01

    Abstract 1: Geographic information systems emerged as a computer application in the late 1960s, led in part by projects at ORNL. The concept of a GIS has shifted through time in response to new applications and new technologies, and is now part of a much larger world of geospatial technology. This presentation discusses the relationship of GIS and estimating hourly and seasonal energy consumption profiles in the building sector at spatial scales down to the individual parcel. The method combines annual building energy simulations for city-specific prototypical buildings and commonly available geospatial data in a GIS framework. Abstract 2: This presentation focuses on 3D printing technologies and how they have rapidly evolved over the past couple of years. At a basic level, 3D printing produces physical models quickly and easily from 3D CAD, BIM (Building Information Models), and other digital data. Many AEC firms have adopted 3D printing as part of commercial building design development and project delivery. This presentation includes an overview of 3D printing, discusses its current use in building design, and talks about its future in relation to the HVAC industry. Abstract 3: This presentation discusses additive manufacturing and how it is revolutionizing the design of commercial and residential facilities. Additive manufacturing utilizes a broad range of direct manufacturing technologies, including electron beam melting, ultrasonic, extrusion, and laser metal deposition for rapid prototyping. While there is some overlap with the 3D printing talk, this presentation focuses on the materials aspect of additive manufacturing and also some of the more advanced technologies involved with rapid prototyping. These technologies include design of carbon fiber composites, lightweight metals processing, transient field processing, and more.

  16. Yellowstone Caldera Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    Region (Finn & Morgan, 2002) Compound and Elemental Analysis At Yellowstone Region (Goff & Janik, 2002) Compound and Elemental Analysis At Yellowstone Region (Hurwitz, Et Al.,...

  17. Mexico Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    Geothermal Region Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Mexico Geothermal Region Details Areas (0) Power Plants (0) Projects (0) Techniques (0) References...

  18. Cascades Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    Cascades Geothermal Region (Redirected from Cascades) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Cascades Geothermal Region Details Areas (2) Power Plants (0)...

  19. Italy Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    Region Larderello Geothermal Area Mount Amiata Geothermal Area Travale-Radicondoli Geothermal Area Energy Generation Facilities within the Italy Geothermal Region Bagnore 3...

  20. Transition Zone Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    Unknown Planned Capacity 1 Geothermal Areas within the Transition Zone Geothermal Region Energy Generation Facilities within the Transition Zone Geothermal Region Geothermal Power...

  1. Germany Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    Germany Geothermal Region Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Germany Geothermal Region Details Areas (1) Power Plants (0) Projects (0) Techniques (0)...

  2. Thailand Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    Thailand Geothermal Region Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Thailand Geothermal Region Details Areas (1) Power Plants (1) Projects (0) Techniques (0)...

  3. Indonesia Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    Indonesia Geothermal Region Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Indonesia Geothermal Region Details Areas (5) Power Plants (4) Projects (0) Techniques (0)...

  4. Philippines Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    Philippines Geothermal Region Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Philippines Geothermal Region Details Areas (1) Power Plants (0) Projects (0) Techniques...

  5. China Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    Geothermal Region Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home China Geothermal Region Details Areas (0) Power Plants (0) Projects (0) Techniques (0) References...

  6. Lake Region State College | Open Energy Information

    Open Energy Info (EERE)

    College Jump to: navigation, search Name Lake Region State College Facility Lake Region State College Sector Wind energy Facility Type Community Wind Facility Status In Service...

  7. Austria Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    GEOTHERMAL ENERGYGeothermal Home Austria Geothermal Region Details Areas (0) Power Plants (0) Projects (0) Techniques (0) References Geothermal Region Data Area USGS Resource...

  8. Australia Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    GEOTHERMAL ENERGYGeothermal Home Australia Geothermal Region Details Areas (0) Power Plants (0) Projects (0) Techniques (0) References Geothermal Region Data Area USGS Resource...

  9. New Zealand Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    GEOTHERMAL ENERGYGeothermal Home New Zealand Geothermal Region Details Areas (2) Power Plants (2) Projects (0) Techniques (0) References Geothermal Region Data Area USGS Resource...

  10. Russia Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    GEOTHERMAL ENERGYGeothermal Home Russia Geothermal Region Details Areas (0) Power Plants (0) Projects (0) Techniques (0) References Geothermal Region Data Area USGS Resource...

  11. Iceland Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    GEOTHERMAL ENERGYGeothermal Home Iceland Geothermal Region Details Areas (0) Power Plants (0) Projects (0) Techniques (0) References Geothermal Region Data Area USGS Resource...

  12. Turkey Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    Geothermal Region Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Turkey Geothermal Region Details Areas (0) Power Plants (0) Projects (0) Techniques (0) References...

  13. Request for Information: Operation of Regional Test Center Test...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Information: Operation of Regional Test Center Test Bed Located at SolarTAC Request for Information: Operation of Regional Test Center Test Bed Located at SolarTAC Solicitation...

  14. ,"Geographic Area",,,"Voltage",,,"Capacity Rating (MVa)","In-Service Date","Electrical Connection Locations",,"Line Information",,,,"Conductor Characteristics",,,"Circuits",,"Company Information"

    U.S. Energy Information Administration (EIA) Indexed Site

    Covering Calendar Year 2005, by North American Electric Reliability Council, 2006 Through 2011" ,"(Various)" ,"Geographic Area",,,"Voltage",,,"Capacity Rating (MVa)","In-Service Date","Electrical Connection Locations",,"Line Information",,,,"Conductor Characteristics",,,"Circuits",,"Company Information" ,"Country - with Total (T) for sub-regions","NERC Region"," NERC

  15. Hawaii Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    Area Mokapu Penninsula Geothermal Area Molokai Geothermal Area Olowalu-Ukumehame Canyon Geothermal Area Energy Generation Facilities within the Hawaii Geothermal Region Puna...

  16. Regional Dynamics Model (REDYN) | Open Energy Information

    Open Energy Info (EERE)

    use the REDYN model to estimate the effects of actions and policies on people and the economy. The REDYN model powers the unique Regional Dynamics Economic Service, an...

  17. Browse By Region | Open Energy Information

    Open Energy Info (EERE)

    (231) States (50) Congressional Districts (437) Counties (3142) Cities (27936) Clean Energy Economy Regions (7) Programs (1157) Tools (1669) Retrieved from "http:...

  18. Southern Rockies Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    ENERGYGeothermal Home Southern Rockies Geothermal Region Details Areas (1) Power Plants (0) Projects (0) Techniques (0) Assessment of Moderate- and High-Temperature...

  19. Northern Rockies Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    ENERGYGeothermal Home Northern Rockies Geothermal Region Details Areas (0) Power Plants (0) Projects (0) Techniques (0) Map: Name Province is situated in northern Idaho...

  20. Sierra Nevada Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    ENERGYGeothermal Home Sierra Nevada Geothermal Region Details Areas (0) Power Plants (0) Projects (0) Techniques (0) Map: Name California's Sierra Nevada is a...

  1. Outside a Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    GEOTHERMAL ENERGYGeothermal Home Outside a Geothermal Region Details Areas (1) Power Plants (1) Projects (0) Techniques (0) This is a category for geothermal areas added that do...

  2. TCEQ Regional Offices | Open Energy Information

    Open Energy Info (EERE)

    Environmental Quality provides a map, list of managers, addresses, and phone numbers of its regional offices. Published NA Year Signed or Took Effect 2014 Legal Citation TCEQ...

  3. Emergence of recombinant forms in geographic regions with co-circulating HIV subtypes in the dynamic HIV-1 epidemic

    SciTech Connect (OSTI)

    Zhang, Ming; Letiner, Thomas K; Korber, Bette T; Foley, Brian

    2009-01-01

    We have reexamined the subtype designations of {approx}10,000 subtype A, B, C, G, and AG, BC, BF recombinant sequences, and compared the results of the new analysis with their published designations. Intersubtype recombinants dominate HIV epidemics in three different geographical regions. The circulating recombinant from (CRF) CRF02-AG, common in West Central Africa, appears to result from a recombination event that occurred early in the divergence between subtypes A and G, although additional more recent recombination events may have contributed to the breakpoint pattern in this recombinant lineage as well. The Chinese recombinant epidemic strains CRF07 and CRF08, in contrast, result from recent recombinations between more contemporary strains. Nevertheless, CRF07 and CRF08 contributed to many subsequent recombination events. The BF recombinant epidemics in two HIV-1 epicenters in South America are not independent and BF epidemics in South America have an unusually high fraction of unique recombinant forms (URFs) that have each been found only once and carry distinctive breakpoints. Taken together, these analyses reveal a complex and dynamic picture of the current HIV-1 epidemic, and suggest a means of grouping and tracking relationships between viruses through preservation of shared breakpints.

  4. Johnstown Regional Energy | Open Energy Information

    Open Energy Info (EERE)

    Johnstown Regional Energy is a US local energy company who owns three landfill gas to natural gas plants in Pennsylvania. Coordinates: 40.32726, -78.918354 Show Map Loading...

  5. Evaluation of Open Geospatial Consortium Standards fur Use In LLNL Geographic Information Systems (GIS)

    SciTech Connect (OSTI)

    Walker, H; Chou, R; Chubb, K; Schek, J

    2005-09-28

    The objective of this project is to evaluate existing and emerging Open Geospatial Consortium (OGC) standards for use in LLNL programs that rely heavily on geographic data. OGC standards are intended to facilitate interoperability between geospatial processing systems to avoid duplication of effort, lower development costs, and encourage competition based on improved capability and performance rather than vendor lock-in. Some of these standards appear to be gaining traction in the geospatial data community, the Federal government, DOE and DHS. A serious evaluation of this technology is appropriate at this time due to increasing interest and mandated compliance in the Federal government in some situations. A subset of OGC standards is identified and reviewed with a focus on applications to LLNL programs. Each standard or recommendation reviewed was evaluated in general terms. In addition, for specific programs such as Gen&SIS and NARAC, a specific evaluation was made of several of the standards and how they could be used most effectively. It is also important to evaluate the acceptance of these standards in the commercial arena. The implementation of OGC standards by the largest GIS vendor (ESRI) was reviewed. At present, OGC standards are primary useful in specific situations. More generally, many of the standards are immature and their impact on the government and commercial sectors is unclear. Consequently, OGC and related developments need to be observed. As specific standards or groups of standards mature and establish their relevance, these can also be incorporated in LLNL programs as requirements dictate, especially if open implementations and commercial products are available.

  6. NATIONAL CARBON SEQUESTRATION DATABASE AND GEOGRAPHIC INFORMATION SYSTEM (NATCARB) FORMER TITLE-MIDCONTINENT INTERACTIVE DIGITAL CARBON ATLAS AND RELATIONAL DATABASE (MIDCARB)

    SciTech Connect (OSTI)

    Timothy R. Carr

    2004-07-16

    This annual report describes progress in the third year of the three-year project entitled ''Midcontinent Interactive Digital Carbon Atlas and Relational Database (MIDCARB)''. The project assembled a consortium of five states (Indiana, Illinois, Kansas, Kentucky and Ohio) to construct an online distributed Relational Database Management System (RDBMS) and Geographic Information System (GIS) covering aspects of carbon dioxide (CO{sub 2}) geologic sequestration (http://www.midcarb.org). The system links the five states in the consortium into a coordinated regional database system consisting of datasets useful to industry, regulators and the public. The project has been extended and expanded as a ''NATional CARBon Sequestration Database and Geographic Information System (NATCARB)'' to provide national coverage across the Regional CO{sub 2} Partnerships, which currently cover 40 states (http://www.natcarb.org). Advanced distributed computing solutions link database servers across the five states and other publicly accessible servers (e.g., USGS) into a single system where data is maintained and enhanced at the local level but is accessed and assembled through a single Web portal and can be queried, assembled, analyzed and displayed. This project has improved the flow of data across servers and increased the amount and quality of available digital data. The online tools used in the project have improved in stability and speed in order to provide real-time display and analysis of CO{sub 2} sequestration data. The move away from direct database access to web access through eXtensible Markup Language (XML) has increased stability and security while decreasing management overhead. The MIDCARB viewer has been simplified to provide improved display and organization of the more than 125 layers and data tables that have been generated as part of the project. The MIDCARB project is a functional demonstration of distributed management of data systems that cross the boundaries between institutions and geographic areas. The MIDCARB system addresses CO{sub 2} sequestration and other natural resource issues from sources, sinks and transportation within a spatial database that can be queried online. Visualization of high quality and current data can assist decision makers by providing access to common sets of high quality data in a consistent manner.

  7. Geographic Information System Tools for Management of US DOE Sites - 13489

    SciTech Connect (OSTI)

    Carpenter, Cliff; Pilz, Elaine; Pawel, Steve

    2013-07-01

    The DOE Office of Legacy Management (LM) uses a variety of GIS tools to support long-term surveillance and maintenance (LTS and M) activities at DOE closure sites. These geo-spatial applications provide access to data both for external public viewing and for internal analysis and decision making. LM uses a custom geo-spatial application called geo-spatial Environmental Mapping System (GEMS) that draws validated information from a database of 4.6 million analytical results and 232,000 water level measurements for 58 LTS and M sites. These data were collected from transferred sites over a period of 40 years. The database is used to capture and store historical environmental information such as analytical chemistry data, groundwater depths and elevations, well logs, well construction data, geo-referenced boundaries, site physical features, and sampling locations from LTS and M sites. Stakeholders, regulators, and project personnel can use this Web-based application and data to display information in several forms, such as a tabular report, a graph, and a geo-spatial display, or the data can be labeled or highlighted in a map view. Institutional controls, with their LTS and M requirements and documentation, have recently been incorporated into a prototype GEMS Web page for the Weldon Spring, Missouri, Site. LM uses multiple internal GIS viewers to help ensure the future protection of human health and the environment. For example, at the Rocky Flats, Colorado, Site, LM uses a GIS application to display real property interests on authoritative maps. Another project is used to facilitate discussions at stakeholder meetings for the Rocky Flats site's Original Landfill. The Uranium Leasing Program uses multiple interactive maps that assist in ongoing monitoring and the oversight of lease-holders' activities. (authors)

  8. Integration of remote sensing and geographic information systems for Great Lakes water quality monitoring

    SciTech Connect (OSTI)

    Lathrop, R.G. Jr.

    1988-01-01

    The utility of three operational satellite remote sensing systems, namely, the Landsat Thematic Mapper (TM), the SPOT High Resolution Visible (HRV) sensors and the NOAA Advanced Very High Resolution Radiometer (AVHRR), were evaluated as a means of estimating water quality and surface temperature. Empirical calibration through linear regression techniques was used to relate near-simultaneously acquired satellite radiance/reflectance data and water quality observations obtained in Green Bay and the nearshore waters of Lake Michigan. Four dates of TM and one date each of SPOT and AVHRR imagery/surface reference data were acquired and analyzed. Highly significant relationships were identified between the TM and SPOT data and secchi disk depth, nephelometric turbidity, chlorophyll a, total suspended solids (TSS), absorbance, and surface temperature (TM only). The AVHRR data were not analyzed independently but were used for comparison with the TM data. Calibrated water quality image maps were input to a PC-based raster GIS package, EPPL7. Pattern interpretation and spatial analysis techniques were used to document the circulation dynamics and model mixing processes in Green Bay. A GIS facilitates the retrieval, query and spatial analysis of mapped information and provides the framework for an integrated operational monitoring system for the Great Lakes.

  9. Web-Based Geographic Information System Tool for Accessing Hanford Site Environmental Data

    SciTech Connect (OSTI)

    Triplett, Mark B.; Seiple, Timothy E.; Watson, David J.; Charboneau, Briant L.; Morse, John G.

    2014-11-15

    Data volume, complexity, and access issues pose severe challenges for analysts, regulators and stakeholders attempting to efficiently use legacy data to support decision making at the U.S. Department of Energys (DOE) Hanford Site. DOE has partnered with the Pacific Northwest National Laboratory (PNNL) on the PHOENIX (PNNL-Hanford Online Environmental Information System) project, which seeks to address data access, transparency, and integration challenges at Hanford to provide effective decision support. PHOENIX is a family of spatially-enabled web applications providing quick access to decades of valuable scientific data and insight through intuitive query, visualization, and analysis tools. PHOENIX realizes broad, public accessibility by relying only on ubiquitous web-browsers, eliminating the need for specialized software. It accommodates a wide range of users with intuitive user interfaces that require little or no training to quickly obtain and visualize data. Currently, PHOENIX is actively hosting three applications focused on groundwater monitoring, groundwater clean-up performance reporting, and in-tank monitoring. PHOENIX-based applications are being used to streamline investigative and analytical processes at Hanford, saving time and money. But more importantly, by integrating previously isolated datasets and developing relevant visualization and analysis tools, PHOENIX applications are enabling DOE to discover new correlations hidden in legacy data, allowing them to more effectively address complex issues at Hanford.

  10. Energy Department Announces New Regional Approach to Wind Energy Information

    Broader source: Energy.gov [DOE]

    In order to provide the highest quality information to support decision-making regarding wind energy, the Energy Department today kicked off the collaborative partnership between its new WINDExchange initiative and six supporting Regional Resource Centers.

  11. Informational Webinar Series for State and Regional Initiatives

    Broader source: Energy.gov [DOE]

    DOE's Fuel Cell Technologies Office and partners co-host a series of informational webinars on various topics to help states and state and regional hydrogen and fuel cell initiative leaders network...

  12. Geographic Information System (GIS) Emergency Support for the May 2000 Cerro Grande Wildfire, Los Alamos, New Mexico, USA

    SciTech Connect (OSTI)

    C.R.Mynard; G.N.Keating; P.M.Rich; D.R. Bleakly

    2003-05-01

    In May 2000 the Cerro Grande wildfire swept through Los Alamos, New Mexico, burning approximately 17,400 ha (43,000 acres) and causing evacuation of Los Alamos National Laboratory (LANL) and the communities of Los Alamos and White Rock. An integral part of emergency response during the fire was the use of geographic information system (GIS) technology, which continues to be used in support of post-fire restoration and environmental monitoring. During the fire Laboratory GIS staff and volunteers from other organizations worked to produce maps and provide support for emergency managers, including at an emergency GIS facility in Santa Fe. Subsequent to the fire, Laboratory GIS teams supported the multiagency Burned Area Emergency Rehabilitation (BAER) team to provide GIS data and maps for planning mitigation efforts. The GIS teams continue to help researchers, operations personnel, and managers deal with the tremendous changes caused by the fire. Much of the work is under the auspices of the Cerro Grande Rehabilitation Project (CGRP) to promote recovery from fire damage, improve information exchange, enhance emergency management, and conduct mitigation activities. GIS efforts during the fire provided important lessons about institutional matters, working relationships, and emergency preparedness. These lessons include the importance of (1) an integrated framework for assessing natural and human hazards in a landscape context; (2) a strong GIS capability for emergency response; (3) coordinated emergency plans for GIS operations; (4) a method for employees to report their whereabouts and receive authoritative information during an evacuation; (5) GIS data that are complete, backed-up, and available during an emergency; (6) adaptation of GIS to the circumstances of the emergency; (7) better coordination in the GIS community; (8) better integration of GIS into LANL operations; and (9) a central data warehouse for data and metadata. These lessons are important for planning future directions of GIS at LANL. Growing maturity of GIS is expected to lead to standardization and a better-integrated, more-coordinated approach to data sharing and emergency management at LANL, and within DOE, in accord with the federal government's increasing focus on electronic communication for its organizational and public interactions.

  13. Toward an ontology framework supporting the integration of geographic information with modeling and simulation for critical infrastructure protection

    SciTech Connect (OSTI)

    Ambrosiano, John J; Bent, Russell W; Linger, Steve P

    2009-01-01

    Protecting the nation's infrastructure from natural disasters, inadvertent failures, or intentional attacks is a major national security concern. Gauging the fragility of infrastructure assets, and understanding how interdependencies across critical infrastructures affect their behavior, is essential to predicting and mitigating cascading failures, as well as to planning for response and recovery. Modeling and simulation (M&S) is an indispensable part of characterizing this complex system of systems and anticipating its response to disruptions. Bringing together the necessary components to perform such analyses produces a wide-ranging and coarse-grained computational workflow that must be integrated with other analysis workflow elements. There are many points in both types of work flows in which geographic information (GI) services are required. The GIS community recognizes the essential contribution of GI in this problem domain as evidenced by past OGC initiatives. Typically such initiatives focus on the broader aspects of GI analysis workflows, leaving concepts crucial to integrating simulations within analysis workflows to that community. Our experience with large-scale modeling of interdependent critical infrastructures, and our recent participation in a DRS initiative concerning interoperability for this M&S domain, has led to high-level ontological concepts that we have begun to assemble into an architecture that spans both computational and 'world' views of the problem, and further recognizes the special requirements of simulations that go beyond common workflow ontologies. In this paper we present these ideas, and offer a high-level ontological framework that includes key geospatial concepts as special cases of a broader view.

  14. Geographic information system for Long Island: An epidemiologic systems approach to identify environmental breast cancer risks on Long Island. Phase 1

    SciTech Connect (OSTI)

    Barancik, J.I.; Kramer, C.F.; Thode, H.C. Jr.

    1995-12-01

    BNL is developing and implementing the project ``Geographic Information System (GIS) for Long Island`` to address the potential relationship of environmental and occupational exposures to breast cancer etiology on Long Island. The project is divided into two major phases: The four month-feasibility project (Phase 1), and the major development and implementation project (Phase 2). This report summarizes the work completed in the four month Phase 1 Project, ``Feasibility of a Geographic Information System for Long Island.`` It provides the baseline information needed to further define and prioritize the scope of work for subsequent tasks. Phase 2 will build upon this foundation to develop an operational GIS for the Long Island Breast Cancer Study Project (LIBCSP).

  15. Cape Cod Regional Transit Authority | Open Energy Information

    Open Energy Info (EERE)

    Cod Regional Transit Authority Jump to: navigation, search Name Cape Cod Regional Transit Authority Facility Cape Cod Regional Transit Authority Sector Wind energy Facility Type...

  16. Snake River Plain Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    Survey At Snake River Plain Region (DOE GTP) Micro-Earthquake At Snake River Plain Geothermal Region (1976) Reflection Survey At Snake River Plain Region (DOE GTP)...

  17. REEEP South Asia Regional Secretariat | Open Energy Information

    Open Energy Info (EERE)

    South Asia Regional Secretariat Jump to: navigation, search Name: REEEP South Asia Regional Secretariat Place: New Delhi, Delhi (NCT), India Zip: 110 003 Product: Regional...

  18. Rio Grande Rift Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    Region Data Acquisition-Manipulation At Rio Grande Rift Region (Morgan, Et Al., 2010) Ground Gravity Survey At Rio Grande Rift Region (Aiken & Ander, 1981) Magnetotellurics At...

  19. LEDSGP/about/regional-platforms | Open Energy Information

    Open Energy Info (EERE)

    Guiding Structure Regional Platforms LEDS GP regional platforms lead regional peer learning, training, and collaboration; engage technical working groups, the LEDS GP...

  20. Northwest Basin and Range Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    Basin and Range Geothermal Region Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Northwest Basin and Range Geothermal Region Details Areas (51) Power Plants (10)...

  1. Solar Atlas (PACA Region - France) | Open Energy Information

    Open Energy Info (EERE)

    Atlas (PACA Region - France) Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Solar Atlas (PACA Region - France) AgencyCompany Organization: MINES ParisTech Sector:...

  2. Regional Waste Systems Biomass Facility | Open Energy Information

    Open Energy Info (EERE)

    Waste Systems Biomass Facility Jump to: navigation, search Name Regional Waste Systems Biomass Facility Facility Regional Waste Systems Sector Biomass Facility Type Municipal Solid...

  3. Papua New Guinea Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    ENERGYGeothermal Home Papua New Guinea Geothermal Region Details Areas (1) Power Plants (1) Projects (0) Techniques (0) References Geothermal Region Data Area USGS Resource...

  4. East African Rift Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    ENERGYGeothermal Home East African Rift Geothermal Region Details Areas (0) Power Plants (0) Projects (0) Techniques (0) References Geothermal Region Data Country(ies)...

  5. Using DRASTIC'' to improve the accuracy of a geographical information system used for solid waste disposal facility siting: A case study

    SciTech Connect (OSTI)

    Padgett, D.A. . Dept. of Geography)

    1993-01-01

    Beginning in 1989, the citizens and commissioners of Alachua County, Florida began to develop a siting plan for a new solid waste disposal facility (SWDF). Through a cooperative effort with a private consulting firm, several evaluative criteria were selected and then translated into parameters for a geographical information system (GIS). Despite efforts to avoid vulnerable hydrogeology, the preferred site selected was in close proximity to the well field supplying Gainesville, Florida, home to approximately 75 percent of the county's population. The results brought forth a wave of protests from local residents claiming that leachate from the proposed SWDF would contaminate their drinking water. In this study, DRASTIC'' was applied in order to improve the accuracy and defensibility of the aquifer protection-based GIS parameters. DRASTIC'', a method for evaluating ground water contamination potential, is an acronym which stands for Depth to Water, Net Recharge, Aquifer Media, Soil Media, Topography, Impact of Vadose Zone Media, and Conductivity (Hydraulic)''.

  6. LAC Regional Platform Workshop General Information | Open Energy...

    Open Energy Info (EERE)

    Visas Participants Presentations Outcomes Report Links Contact Us General Information (English) General information LEDS GP INCAE English-rev FINAL.pdf Informacion General LEDS GP...

  7. Coulee Region Bio Fuels LLC | Open Energy Information

    Open Energy Info (EERE)

    Region Bio Fuels LLC Jump to: navigation, search Name: Coulee Region Bio-Fuels LLC Place: Ettrick, Wisconsin Zip: 54627 Sector: Biofuels Product: LLC created by PrairieFire...

  8. Regional Water Board NPDES Program Manager | Open Energy Information

    Open Energy Info (EERE)

    search OpenEI Reference LibraryAdd to library Legal Document- OtherOther: Regional Water Board NPDES Program ManagerLegal Abstract Regional Water Board NPDES Program Manager,...

  9. Regional Water Quality Control Boards | Open Energy Information

    Open Energy Info (EERE)

    search OpenEI Reference LibraryAdd to library Legal Document- OtherOther: Regional Water Quality Control BoardsLegal Abstract California Regional Water Quality Control Boards,...

  10. Regional Greenhouse Gas Initiative Inc RGGI | Open Energy Information

    Open Energy Info (EERE)

    Greenhouse Gas Initiative Inc RGGI Jump to: navigation, search Name: Regional Greenhouse Gas Initiative, Inc (RGGI) Place: New York Zip: NY 10007 Sector: Services Product: New...

  11. Incubateur Regional Poitou Charentes IRPC | Open Energy Information

    Open Energy Info (EERE)

    Jump to: navigation, search Name: Incubateur Regional Poitou Charentes (IRPC) Place: France Sector: Services Product: General Financial & Legal Services ( Academic Research...

  12. Regional Economic Models, Inc. (REMI) Model | Open Energy Information

    Open Energy Info (EERE)

    TOOL Name: REMI AgencyCompany Organization: Regional Economic Models Inc. Sector: Energy Focus Area: Transportation Resource Type: Softwaremodeling tools User Interface:...

  13. EPA Region 6 NPDES General Permits | Open Energy Information

    Open Energy Info (EERE)

    Permits Abstract Access to NPDES General Permits for EPA Region 6. Author United States Environmental Protection Agency Published EPA, Date Not Provided DOI Not Provided Check...

  14. San Andreas Split Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    ENERGYGeothermal Home San Andreas Split Geothermal Region Details Areas (0) Power Plants (0) Projects (0) Techniques (0) Assessment of Moderate- and High-Temperature...

  15. Southern Colorado Plateau Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    Home Southern Colorado Plateau Geothermal Region Details Areas (0) Power Plants (0) Projects (0) Techniques (0) Map: Name "The Colorado Plateau is a high...

  16. EPA Region 7 Air Program Website | Open Energy Information

    Open Energy Info (EERE)

    Not Provided DOI Not Provided Check for DOI availability: http:crossref.org Online Internet link for EPA Region 7 Air Program Website Citation Environmental Protection Agency....

  17. Bayshore Regional Sewerage Authority (BRSA) | Open Energy Information

    Open Energy Info (EERE)

    References "Bayshore Regional Sewerage Authority to Recycle Wastewater using the Wind" Retrieved from "http:en.openei.orgwindex.php?titleBayshoreRegi...

  18. Category:Clean Energy Economy Regions | Open Energy Information

    Open Energy Info (EERE)

    Economy Regions" The following 7 pages are in this category, out of 7 total. B Bay Area G Greater Boston Area N Northeast - NY NJ CT PA Area P Pacific Northwest Area R Rockies...

  19. U.S. EPA Region 10 | Open Energy Information

    Open Energy Info (EERE)

    Not Provided DOI Not Provided Check for DOI availability: http:crossref.org Online Internet link for U.S. EPA Region 10 Citation United States Environmental Protection Agency....

  20. Geographic coordinates | Open Energy Information

    Open Energy Info (EERE)

    Property:BoundingCoordinatesSW C Property:Coordinates F Property:FirstWellCoordinates G Property:GBIGCalculatedCenter G cont. Property:GBIGSelectedCenter H Property:HPBD...

  1. Request for Information: Operation of Regional Test Center Test Bed Located at SolarTAC

    Broader source: Energy.gov [DOE]

    Solicitation Title:  Request for Information: Operation of Regional Test Center Test Bed Located at SolarTAC

  2. ,"Geographic Area",,,"Voltage",,,"Capacity ","In-Service",,"Electrical Connection Locations",,"Line Information",,,,"Conductor Characteristics",,,"Circuits",,"Company Information",,,,"Project Information"

    U.S. Energy Information Administration (EIA) Indexed Site

    6. Proposed high-voltage transmission line additions filed covering calendar Year 2011, by North American Electric Reliability Corporation, 2012 through 2021" ,"Geographic Area",,,"Voltage",,,"Capacity ","In-Service",,"Electrical Connection Locations",,"Line Information",,,,"Conductor Characteristics",,,"Circuits",,"Company Information",,,,"Project Information" "Data

  3. ,"Geographic Area",,,"Voltage",,,"Capacity Rating (MVa)","In-Service",,"Electrical Connection Locations",,"Line Information",,,,"Conductor Characteristics",,,"Circuits",,"Company Information",,,,"Project Information"

    U.S. Energy Information Administration (EIA) Indexed Site

    6. Existing and Proposed High-voltage Transmission Line Additions Filed Covering Calendar Year 2007, by North American Electric Reliability Corporation, 2009 Through 2019" ,"(Various)" ,"Geographic Area",,,"Voltage",,,"Capacity Rating (MVa)","In-Service",,"Electrical Connection Locations",,"Line Information",,,,"Conductor Characteristics",,,"Circuits",,"Company Information",,,,"Project

  4. Application of Spatial Data Modeling and Geographical Information Systems (GIS) for Identification of Potential Siting Options for Various Electrical Generation Sources

    SciTech Connect (OSTI)

    Mays, Gary T; Belles, Randy; Blevins, Brandon R; Hadley, Stanton W; Harrison, Thomas J; Jochem, Warren C; Neish, Bradley S; Omitaomu, Olufemi A; Rose, Amy N

    2012-05-01

    Oak Ridge National Laboratory (ORNL) initiated an internal National Electric Generation Siting Study, which is an ongoing multiphase study addressing several key questions related to our national electrical energy supply. This effort has led to the development of a tool, OR-SAGE (Oak Ridge Siting Analysis for power Generation Expansion), to support siting evaluations. The objective in developing OR-SAGE was to use industry-accepted approaches and/or develop appropriate criteria for screening sites and employ an array of Geographic Information Systems (GIS) data sources at ORNL to identify candidate areas for a power generation technology application. The initial phase of the study examined nuclear power generation. These early nuclear phase results were shared with staff from the Electric Power Research Institute (EPRI), which formed the genesis and support for an expansion of the work to several other power generation forms, including advanced coal with carbon capture and storage (CCS), solar, and compressed air energy storage (CAES). Wind generation was not included in this scope of work for EPRI. The OR-SAGE tool is essentially a dynamic visualization database. The results shown in this report represent a single static set of results using a specific set of input parameters. In this case, the GIS input parameters were optimized to support an economic study conducted by EPRI. A single set of individual results should not be construed as an ultimate energy solution, since US energy policy is very complex. However, the strength of the OR-SAGE tool is that numerous alternative scenarios can be quickly generated to provide additional insight into electrical generation or other GIS-based applications. The screening process divides the contiguous United States into 100 x 100 m (1-hectare) squares (cells), applying successive power generation-appropriate site selection and evaluation criteria (SSEC) to each cell. There are just under 700 million cells representing the contiguous United States. If a cell meets the requirements of each criterion, the cell is deemed a candidate area for siting a specific power generation form relative to a reference plant for that power type. Some SSEC parameters preclude siting a power plant because of an environmental, regulatory, or land-use constraint. Other SSEC assist in identifying less favorable areas, such as proximity to hazardous operations. All of the selected SSEC tend to recommend against sites. The focus of the ORNL electrical generation source siting study is on identifying candidate areas from which potential sites might be selected, stopping short of performing any detailed site evaluations or comparisons. This approach is designed to quickly screen for and characterize candidate areas. Critical assumptions supporting this work include the supply of cooling water to thermoelectric power generation; a methodology to provide an adequate siting footprint for typical power plant applications; a methodology to estimate thermoelectric plant capacity while accounting for available cooling water; and a methodology to account for future ({approx}2035) siting limitations as population increases and demands on freshwater sources change. OR-SAGE algorithms were built to account for these critical assumptions. Stream flow is the primary thermoelectric plant cooling source evaluated in this study. All cooling was assumed to be provided by a closed-cycle cooling (CCC) system requiring makeup water to account for evaporation and blowdown. Limited evaluations of shoreline cooling and the use of municipal processed water (gray) cooling were performed. Using a representative set of SSEC as input to the OR-SAGE tool and employing the accompanying critical assumptions, independent results for the various power generation sources studied were calculated.

  5. NREL: Dynamic Maps, GIS Data, and Analysis Tools - Geographic...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Geographic Information System Data Background NREL's GIS Team develops technology-specific GIS data maps for a variety of areas, including biomass, geothermal, solar, wind, and...

  6. ,"Geographic Area",,,"Voltage",,,"Capacity Rating (MVa)","In-Service Date","Electrical Connection Locations",,"Line Information",,,,"Conductor Characteristics",,,"Circuits",,"Company Information"

    U.S. Energy Information Administration (EIA) Indexed Site

    6. Existing and Proposed High-voltage Transmission Line Additions Filed Covering Calendar Year 2007, by North American Electric Reliability Corporation, 2008 Through 2018" ,"(Various)" ,"Geographic Area",,,"Voltage",,,"Capacity Rating (MVa)","In-Service Date","Electrical Connection Locations",,"Line Information",,,,"Conductor Characteristics",,,"Circuits",,"Company Information" ,"Country

  7. ,"Geographic Area",,,"Voltage",,,"Capacity Rating (MVa)","In-Service Date","Electrical Connection Locations",,"Line Information",,,,"Conductor Characteristics",,,"Circuits",,"Company Information"

    U.S. Energy Information Administration (EIA) Indexed Site

    " ","Next Update: October 2008" ,"Table 6. Existing and Proposed High-voltage Transmission Line Additions Filed in Calendar Year 2001, by North American Electric Reliability Council, 2002 Through 2011" ,"(Various)" ,"Geographic Area",,,"Voltage",,,"Capacity Rating (MVa)","In-Service Date","Electrical Connection Locations",,"Line Information",,,,"Conductor

  8. ,"Geographic Area",,,"Voltage",,,"Capacity Rating (MVa)","In-Service Date","Electrical Connection Locations",,"Line Information",,,,"Conductor Characteristics",,,"Circuits",,"Company Information"

    U.S. Energy Information Administration (EIA) Indexed Site

    ,,,,,,,,,,,,,,,,,," " ,"Table 6. Existing and Proposed High-voltage Transmission Line Additions Filed in Calendar Year 2002, by North American Electric Reliability Council, 2003 Through 20012" ,"(Various)" ,"Geographic Area",,,"Voltage",,,"Capacity Rating (MVa)","In-Service Date","Electrical Connection Locations",,"Line Information",,,,"Conductor

  9. ,"Geographic Area",,,"Voltage",,,"Capacity Rating (MVa)","In-Service Date","Electrical Connection Locations",,"Line Information",,,,"Conductor Characteristics",,,"Circuits",,"Company Information"

    U.S. Energy Information Administration (EIA) Indexed Site

    ,,," " ,"Next Update: October 2008" ,"Table 6. Existing and Proposed High-voltage Transmission Line Additions Filed in Calendar Year 2003, by North American Electric Reliability Council, 2003 Through 2008" ,"(Various)" ,"Geographic Area",,,"Voltage",,,"Capacity Rating (MVa)","In-Service Date","Electrical Connection Locations",,"Line Information",,,,"Conductor

  10. ,"Geographic Area",,,"Voltage",,,"Capacity Rating (MVa)","In-Service Date","Electrical Connection Locations",,"Line Information",,,,"Conductor Characteristics",,,"Circuits",,"Company Information"

    U.S. Energy Information Administration (EIA) Indexed Site

    ,"Table 6. Existing and Proposed High-voltage Transmission Line Additions Filed For Calendar Year 2004, by North American Electric Reliability Council, 2004 Through 2009" ,"(Various)",,,,,,,,,,,," " ,"Geographic Area",,,"Voltage",,,"Capacity Rating (MVa)","In-Service Date","Electrical Connection Locations",,"Line Information",,,,"Conductor Characteristics",,,"Circuits",,"Company

  11. ,"Geographic Area",,,"Voltage",,,"Capacity Rating (MVa)","In-Service Date","Electrical Connection Locations",,"Line Information",,,,"Conductor Characteristics",,,"Circuits",,"Company Information"

    U.S. Energy Information Administration (EIA) Indexed Site

    07, 2008" ,"Next Update: October 2008" ,"Table 6. Existing and Proposed High-voltage Transmission Line Additions Filed Covering Calendar Year 2006, by North American Electric Reliability Corporation, 2007 Through 2012" ,"(Various)" ,"Geographic Area",,,"Voltage",,,"Capacity Rating (MVa)","In-Service Date","Electrical Connection Locations",,"Line Information",,,,"Conductor

  12. Geographic Setting M

    Office of Legacy Management (LM)

    Geographic Setting M . I , . Merritt Sandia Laboratories, Albuquerque, New Mexico Amchitka Island lies at latitude 51.5ON and longi- tude 17g0E. I t is one of the Rat Island Group of the Aleutian Islands, Alaska, which comprise the emergent part of a long submarine ridge connecting North America and Asia and separating the Bering Sea fro111 the North Pacific Ocean (Fig. 1). Am- chitka is allnost the souther~llnost Aleutian Island, only nearby Amatignak being farther south. I t is thus almost the

  13. Database for Regional Geology, Phase 1: A Tool for Informing Regional Evaluations of Alternative Geologic Media and Decision Making

    SciTech Connect (OSTI)

    Perry, Frank Vinton; Kelley, Richard E.; Birdsell, Suzanne M.; Lugo, Alexander Bryan; Dobson, Patrick; Houseworth, James

    2014-11-12

    Reported is progress in the following areas: Phase 1 and 2 websites for the regional geology GIS database; terrane maps of crystalline basement rocks; inventory of shale formations in the US; and rock properties and in-situ conditions for shale estimated from sonic velocity measurements.

  14. Property:GeographicScope | Open Energy Information

    Open Energy Info (EERE)

    Review of World Energy + Earth + C Coal Power Plant Database + United States + E ENERGY STAR Labeled Buildings and Plants + United States + N NSRDB 1961-1990 + United...

  15. How Do I Use Renewable Energy in My Region?

    SciTech Connect (OSTI)

    Not Available

    2005-11-01

    NREL can asses renewable energy resource information and integrate it with data using geographic information systems (GIS) and interface the data with key analytical models. Planners and energy developers use these integrated resource assessments to make decisions about the feasibility, cost-effectiveness, and risks of developing projects in specific locations and for regional planning.

  16. Geographic Perspective on the Current Biomass Resource Availability in the United States

    SciTech Connect (OSTI)

    Milbrandt, A.

    2005-12-01

    The objective of this report is to estimate the biomass resources available in the United States and map the results using geographic information systems (GIS).

  17. Geographic Information System (Laney, 2005) | Open Energy Information

    Open Energy Info (EERE)

    sets, and merging of data that would not be possible using any other technology. While CAD is preferred by some in geothermal exploration, it lacks a multitude of the functions...

  18. BioEarth: Envisioning and developing a new regional earth system model to inform natural and agricultural resource management

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Adam, Jennifer C.; Stephens, Jennie C.; Chung, Serena H.; Brady, Michael P.; Evans, R. David; Kruger, Chad E.; Lamb, Brian K.; Liu, Mingliang; Stöckle, Claudio O.; Vaughan, Joseph K.; et al

    2014-04-24

    Uncertainties in global change impacts, the complexities associated with the interconnected cycling of nitrogen, carbon, and water present daunting management challenges. Existing models provide detailed information on specific sub-systems (e.g., land, air, water, and economics). An increasing awareness of the unintended consequences of management decisions resulting from interconnectedness of these sub-systems, however, necessitates coupled regional earth system models (EaSMs). Decision makers’ needs and priorities can be integrated into the model design and development processes to enhance decision-making relevance and “usability” of EaSMs. BioEarth is a research initiative currently under development with a focus on the U.S. Pacific Northwest region thatmore » explores the coupling of multiple stand-alone EaSMs to generate usable information for resource decision-making. Direct engagement between model developers and non-academic stakeholders involved in resource and environmental management decisions throughout the model development process is a critical component of this effort. BioEarth utilizes a bottom-up approach for its land surface model that preserves fine spatial-scale sensitivities and lateral hydrologic connectivity, which makes it unique among many regional EaSMs. Here, we describe the BioEarth initiative and highlights opportunities and challenges associated with coupling multiple stand-alone models to generate usable information for agricultural and natural resource decision-making.« less

  19. BioEarth: Envisioning and developing a new regional earth system model to inform natural and agricultural resource management

    SciTech Connect (OSTI)

    Adam, J. C.; Stephens, J. C.; Chung, Serena; Brady, M. P.; Evans, R. D.; Kruger, C. E.; Lamb, Brian K.; Liu, M. L.; Stockle, Claudio O.; Vaughan, Joseph K.; Rajagopalan, K.; Harrison, John; Tague, C. L.; Kalyanaraman, Anantharaman; Chen, Yong; Guenther, Alex B.; Leung, F. Y.; Leung, Lai-Yung R.; Perleberg, A. B.; Yoder, J.; Allen, Elizabeth; Anderson, S.; Chandrasekharan, B.; Malek, K.; Mullis, T.; Miller, C.; Nergui, T.; Poinsatte, J.; Reyes, J.; Zhu, J.; Choate, J. S.; Jiang, X.; Nelson, R.; Yoon, Jin-Ho; Yorgey, G. G.; Johnson, Kristen; Chinnayakanhalli, K. J.; Hamlet, A. F.; Nijssen, B.; Walden, Von

    2015-04-01

    As managers of agricultural and natural resources are confronted with uncertainties in global change impacts, the complexities associated with the interconnected cycling of nitrogen, carbon, and water present daunting management challenges. Existing models provide detailed information on specific sub-systems (land, air, water, economics, etc). An increasing awareness of the unintended consequences of management decisions resulting from interconnectedness of these sub-systems, however, necessitates coupled regional earth system models (EaSMs). Decision makers needs and priorities can be integrated into the model design and development processes to enhance decision-making relevance and "usability" of EaSMs. BioEarth is a current research initiative with a focus on the U.S. Pacific Northwest region that explores the coupling of multiple stand-alone EaSMs to generate usable information for resource decision-making. Direct engagement between model developers and non-academic stakeholders involved in resource and environmental management decisions throughout the model development process is a critical component of this effort. BioEarth utilizes a "bottom-up" approach, upscaling a catchment-scale model to basin and regional scales, as opposed to the "top-down" approach of downscaling global models utilized by most other EaSM efforts. This paper describes the BioEarth initiative and highlights opportunities and challenges associated with coupling multiple stand-alone models to generate usable information for agricultural and natural resource decision-making.

  20. Geographic Resource Map of Frozen Pipe Probabilities

    Broader source: Energy.gov [DOE]

    Presentation slide details a resource map showing the probability of frozen pipes in the geographic United States.

  1. Southeast Regional Carbon Sequestration Partnership (SECARB)

    SciTech Connect (OSTI)

    Kathryn A. Baskin

    2004-03-31

    Work during the first six months of the project mainly concentrated on contracts execution and collection of data to characterize the region and input of that data into the geographical information system (GIS) system. Data was collected for source characterization, transportation options and terrestrial options. In addition, discussions were held to determine the extent of the geologic information that would be needed for the project. In addition, activities associated with the regulatory, permitting and safety issues were completed. Outreach activities are in the formative stages.

  2. Application of Spatial Data Modeling Systems, Geographical Information Systems (GIS), and Transportation Routing Optimization Methods for Evaluating Integrated Deployment of Interim Spent Fuel Storage Installations and Advanced Nuclear Plants

    SciTech Connect (OSTI)

    Mays, Gary T; Belles, Randy; Cetiner, Sacit M; Howard, Rob L; Liu, Cheng; Mueller, Don; Omitaomu, Olufemi A; Peterson, Steven K; Scaglione, John M

    2012-06-01

    The objective of this siting study work is to support DOE in evaluating integrated advanced nuclear plant and ISFSI deployment options in the future. This study looks at several nuclear power plant growth scenarios that consider the locations of existing and planned commercial nuclear power plants integrated with the establishment of consolidated interim spent fuel storage installations (ISFSIs). This research project is aimed at providing methodologies, information, and insights that inform the process for determining and optimizing candidate areas for new advanced nuclear power generation plants and consolidated ISFSIs to meet projected US electric power demands for the future.

  3. Geographically Based Hydrogen Demand and Infrastructure Rollout...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Rollout Scenario Analysis Geographically Based Hydrogen Demand and Infrastructure Rollout Scenario Analysis Presentation by Margo Melendez at the 2010-2025 Scenario Analysis for ...

  4. Geographical Applications of Remote Sensing (Journal Article...

    Office of Scientific and Technical Information (OSTI)

    SciTech Connect Search Results Journal Article: Geographical Applications of Remote ... DOE Contract Number: AC05-76RL01830 Resource Type: Journal Article Resource Relation: ...

  5. Comprehensive Monitoring for Heterogeneous Geographically Distributed...

    Office of Scientific and Technical Information (OSTI)

    Comprehensive Monitoring for Heterogeneous Geographically Distributed Storage Citation ... Sponsoring Org: USDOE Office of Science (SC), High Energy Physics (HEP) (SC-25) Country of ...

  6. Geographically Based Hydrogen Consumer Demand and Infrastructure...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Geographically Based Hydrogen Consumer Demand and Infrastructure Analysis Final Report M. Melendez and A. Milbrandt Technical Report NRELTP-540-40373 October 2006 NREL is operated...

  7. Hydrothermal System | Open Energy Information

    Open Energy Info (EERE)

    of the underlying resource.1 Occurrence Models "To search efficiently for blind geothermal systems, general geographic regions must first be identified based upon...

  8. Geographically distributed environmental sensor system

    DOE Patents [OSTI]

    French, Patrick; Veatch, Brad; O'Connor, Mike

    2006-10-03

    The present invention is directed to a sensor network that includes a number of sensor units and a base unit. The base station operates in a network discovery mode (in which network topology information is collected) in a data polling mode (in which sensed information is collected from selected sensory units). Each of the sensor units can include a number of features, including an anemometer, a rain gauge, a compass, a GPS receiver, a barometric pressure sensor, an air temperature sensor, a humidity sensor, a level, and a radiant temperature sensor.

  9. Geospatial Toolkit | Open Energy Information

    Open Energy Info (EERE)

    Laboratory (NREL). It integrates resource data and geographic information systems (GIS) - for integrated resource assessment. The Geospatial Toolkit (GsT) is a map-based...

  10. Next Update: November 2016 Geographic Area Capacity In-Service

    U.S. Energy Information Administration (EIA) Indexed Site

    Geographic Area Capacity In-Service Data Year NERC Region Type Operating (kV) Design (kV) Rating (MVa) Month/Year From Terminal To Terminal Length (Miles) Type Company Code Company Name Organizational Type Ownership (Percent) Project Name Level of Certainty Primary Driver 1 Primary Driver 2 2014 FRCC AC 200-299 115 460 1/2016 SUB 4 230.00 SUB 7 230.00 3.8 OH 18445 of Tallahassee M 100% 0.00 - SUB 7 230.00 Under Constructio Reliability 2014 FRCC AC 100-120 115 232 12/2016 Sub 14 115 Sub 7 115 6.0

  11. Property:File/GeographicExtent | Open Energy Information

    Open Energy Info (EERE)

    (previous 25) (next 25) A Australia-Solar-Map.png + National + Awstwspd100onoff3-1.jpg + National + B BOEMRE OCS.oil.gas.2007-12.map.pdf + Continental US plus Alaska + BOEMRE...

  12. Geographic Information System At Central Nevada Seismic Zone...

    Open Energy Info (EERE)

    DOE-funding Unknown References Mark Coolbaugh, Richard Zehner, Corne Kreemer, David Blackwell, Gary Oppliger (2005) A Map Of Geothermal Potential For The Great Basin,...

  13. Geographic Information System At Cove Fort Area - Vapor (Nash...

    Open Energy Info (EERE)

    Unknown Notes An example, shown in Figure 1, shows results from the classification of big sagebrush (Artimesia tridentata) spectra, acquired over the Cove Fort-Sulphurdale,...

  14. Geographic Information System At Cove Fort Area (Nash, Et Al...

    Open Energy Info (EERE)

    Unknown Notes An example, shown in Figure 1, shows results from the classification of big sagebrush (Artimesia tridentata) spectra, acquired over the Cove Fort-Sulphurdale,...

  15. Geographic Information System At Brady Hot Springs Area (Laney...

    Open Energy Info (EERE)

    United States by developing basic measurements and interpretations that will assist reservoir management and expansion at Bradys, Desert Peak and the Desert Peak EGS study...

  16. Geographic Information System At Dixie Valley Geothermal Area...

    Open Energy Info (EERE)

    Unknown Exploration Basis This project is being conducted to develop exploration methodology for EGS development. Dixie Valley is being used as a calibration site for the EGS...

  17. Geographic Information System for Visualization of PHEV Fleet Data

    Broader source: Energy.gov [DOE]

    2010 DOE Vehicle Technologies and Hydrogen Programs Annual Merit Review and Peer Evaluation Meeting, June 7-11, 2010 -- Washington D.C.

  18. OpenEI:Projects/Geographic Pages | Open Energy Information

    Open Energy Info (EERE)

    and per square foot: Total Electricity Use Total heating fuel use (or broken down by gasoil) Total building square footage HeatingCooling degree-days - This would allow us to...

  19. Geographic Information System At Walker-Lane Transitional Zone...

    Open Energy Info (EERE)

    David Blackwell, Gary Oppliger (2005) A Map Of Geothermal Potential For The Great Basin, Usa- Recognition Of Multiple Geothermal Environments Additional References Retrieved from...

  20. Geographic Information System At Walker-Lane Transitional Zone...

    Open Energy Info (EERE)

    generic Basin and Range systems based on Dixie Valley data that help to understand the nature of large scale constraints on the location and characteristics of the geothermal...

  1. Geographic Information System At Central Nevada Seismic Zone...

    Open Energy Info (EERE)

    Unknown References Geoffrey Blewittl, Mark F. Coolbaugh, Don Sawatzky, William Holt, James Davis, Richard A. Bennett (2003) Targeting Of Potential Geothermal Resources In The...

  2. Geographic resolution issues in RAM transportation risk analysis

    SciTech Connect (OSTI)

    MILLS,G. SCOTT; NEUHAUSER,SIEGLINDE

    2000-04-12

    Over the years that radioactive material (RAM) transportation risk estimates have been calculated using the RADTRAN code, demand for improved geographic resolution of route characteristics, especially density of population neighboring route segments, has led to code improvements that provide more specific route definition. With the advent of geographic information systems (GISs), the achievable resolution of route characteristics is theoretically very high. The authors have compiled population-density data in 1-kilometer increments for routes extending over hundreds of kilometers without impractical expenditures of time. Achievable resolution of analysis is limited, however, by the resolution of available data. U.S. Census data typically have 1-km or better resolution within densely-populated portions of metropolitan areas but census blocks are much larger in rural areas. Geographic resolution of accident-rate data, especially for heavy/combination trucks, are typically tabulated on a statewide basis. These practical realities cause one to ask what level(s) of resolution may be necessary for meaningful risk analysis of transportation actions on a state or interstate scale.

  3. Thermally Activated Cooling: A Regional Approach for EstimatingBuilding Adoption

    SciTech Connect (OSTI)

    Edwards, Jennifer L.; Marnay, Chris

    2005-06-01

    This paper examines the economic potential for thermally-activated cooling (TAC) technologies as a component of distributed energy resource (DER) systems in California. A geographic information system (GIS) is used to assess the regional variation of TAC potential and to visualize the geographic pattern of potential adoption. The economic potential and feasibility of DER systems in general, and especially TAC, is highly dependent on regional factors such as retail electricity rates, building cooling loads, and building heating loads. Each of these factors varies with location, and their geographic overlap at different sites is an important determinant in a market assessment of DER and TAC. This analysis uses system payback period as the metric to show the regional variation of TAC potential in California office buildings. The DER system payback with and without TAC is calculated for different regions in California using localized values of retail electricity rates and the weather-dependent variation in building cooling and heating loads. This GIS-based method has numerous applications in building efficiency studies where geographically dependent variables, such as space cooling and heating energy use, play an important role.

  4. Category:Data Techniques | Open Energy Information

    Open Energy Info (EERE)

    1 pages G Geographic Information System 1 pages Geothermal Literature Review 1 pages Pages in category "Data Techniques" The following 4 pages are in...

  5. SOUTHEAST REGIONAL CARBON SEQUESTRATION PARTNERSHIP (SECARB)

    SciTech Connect (OSTI)

    Kenneth J. Nemeth

    2004-09-01

    The Southeast Regional Carbon Sequestration Partnership (SECARB) is on schedule and within budget projections for the work completed during the first year of its two year program. Work during the semiannual period (third and fourth quarter) of the project (April 1--September 30, 2004) was conducted within a ''Task Responsibility Matrix.'' Under Task 1.0 Define Geographic Boundaries of the Region, Texas and Virginia were added during the second quarter of the project and no geographical changes occurred during the third or fourth quarter of the project. Under Task 2.0 Characterize the Region, general mapping and screening of sources and sinks has been completed, with integration and Geographical Information System (GIS) mapping ongoing. The first step focused on the macro level characterization of the region. Subsequent characterization will focus on smaller areas having high sequestration potential. Under Task 3.0 Identify and Address Issues for Technology Deployment, SECARB has completed a preliminary assessment of safety, regulatory, permitting, and accounting frameworks within the region to allow for wide-scale deployment of promising terrestrial and geologic sequestration approaches. Under Task 4.0 Develop Public Involvement and Education Mechanisms, SECARB has conducted a survey and focus group meeting to gain insight into approaches that will be taken to educate and involve the public. Task 5.0 and 6.0 will be implemented beginning October 1, 2004. Under Task 5.0 Identify the Most Promising Capture, Sequestration, and Transport Options, SECARB will evaluate findings from work performed during the first year and shift the focus of the project team from region-wide mapping and characterization to a more detailed screening approach designed to identify the most promising opportunities. Under Task 6.0 Prepare Action Plans for Implementation and Technology Validation Activity, the SECARB team will develop an integrated approach to implementing and setting up measurement, monitoring and verification (MMV) programs for the most promising opportunities. During this semiannual period special attention was provided to Texas and Virginia, which were added to the SECARB region, to ensure a smooth integration of activities with the other 9 states. Milestones completed and submitted during the third and fourth quarter included: Q3-FY04--Complete initial development of plans for GIS; and Q4-FYO4--Complete preliminary action plan and assessment for overcoming public perception issues.

  6. SOUTHEAST REGIONAL CARBON SEQUESTRATION PARTNERSHP (SECARB)

    SciTech Connect (OSTI)

    Kenneth J. Nemeth

    2005-04-01

    The Southeast Regional Carbon Sequestration Partnership (SECARB) is on schedule and within budget projections for the work completed during the first 18-months of its two year program. Work during the semiannual period (fifth and sixth project quarters) of the project (October 1, 2004-March 31, 2005) was conducted within a ''Task Responsibility Matrix.'' Under Task 1.0 Define Geographic Boundaries of the Region, no changes occurred during the fifth or sixth quarters of the project. Under Task 2.0 Characterize the Region, refinements have been made to the general mapping and screening of sources and sinks. Integration and geographical information systems (GIS) mapping is ongoing. Characterization during this period was focused on smaller areas having high sequestration potential. Under Task 3.0 Identify and Address Issues for Technology Deployment, SECARB continues to expand upon its assessment of safety, regulatory, permitting, and accounting frameworks within the region to allow for wide-scale deployment of promising terrestrial and geologic sequestration approaches. Under Task 4.0 Develop Public Involvement and Education Mechanisms, SECARB has used results of a survey and focus group meeting to refine approaches that are being taken to educate and involve the public. Under Task 5.0 Identify the Most Promising Capture, Sequestration, and Transport Options, SECARB has evaluated findings from work performed during the first 18-months. The focus of the project team has shifted from region-wide mapping and characterization to a more detailed screening approach designed to identify the most promising opportunities. Under Task 6.0 Prepare Action Plans for Implementation and Technology Validation Activity, the SECARB team is developing an integrated approach to implementing the most promising opportunities and in setting up measurement, monitoring and verification (MMV) programs for the most promising opportunities. Milestones completed during the fifth and sixth project quarters included: (1) Q1-FY05--Assess safety, regulatory and permitting issues; and (2) Q2-FY05--Finalize inventory of major sources/sinks and refine GIS algorithms.

  7. Comprehensive Monitoring for Heterogeneous Geographically Distributed Storage

    SciTech Connect (OSTI)

    Ratnikova, N.; Karavakis, E.; Lammel, S.; Wildish, T.

    2015-12-23

    Storage capacity at CMS Tier-1 and Tier-2 sites reached over 100 Petabytes in 2014, and will be substantially increased during Run 2 data taking. The allocation of storage for the individual users analysis data, which is not accounted as a centrally managed storage space, will be increased to up to 40%. For comprehensive tracking and monitoring of the storage utilization across all participating sites, CMS developed a space monitoring system, which provides a central view of the geographically dispersed heterogeneous storage systems. The first prototype was deployed at pilot sites in summer 2014, and has been substantially reworked since then. In this paper we discuss the functionality and our experience of system deployment and operation on the full CMS scale.

  8. Geographic Visualization of Power-Grid Dynamics

    SciTech Connect (OSTI)

    Sukumar, Sreenivas R.

    2015-06-18

    The visualization enables the simulation analyst to see changes in the frequency through time and space. With this technology, the analyst has a bird's eye view of the frequency at loads and generators as the simulated power system responds to the loss of a generator, spikes in load, and other contingencies. The significance of a contingency to the operation of an electrical power system depends critically on how the resulting tansients evolve in time and space. Consequently, these dynamic events can only be understood when seen in their proper geographic context. this understanding is indispensable to engineers working on the next generation of distributed sensing and control systems for the smart grid. By making possible a natural and intuitive presentation of dynamic behavior, our new visualization technology is a situational-awareness tool for power-system engineers.

  9. Geographic Visualization of Power-Grid Dynamics

    Energy Science and Technology Software Center (OSTI)

    2015-06-18

    The visualization enables the simulation analyst to see changes in the frequency through time and space. With this technology, the analyst has a bird's eye view of the frequency at loads and generators as the simulated power system responds to the loss of a generator, spikes in load, and other contingencies. The significance of a contingency to the operation of an electrical power system depends critically on how the resulting tansients evolve in time andmore » space. Consequently, these dynamic events can only be understood when seen in their proper geographic context. this understanding is indispensable to engineers working on the next generation of distributed sensing and control systems for the smart grid. By making possible a natural and intuitive presentation of dynamic behavior, our new visualization technology is a situational-awareness tool for power-system engineers.« less

  10. Renewable Resources: a national catalog of model projects. Volume 1. Northeast Solar Energy Center Region

    SciTech Connect (OSTI)

    1980-07-01

    This compilation of diverse conservation and renewable energy projects across the United States was prepared through the enthusiastic participation of solar and alternate energy groups from every state and region. Compiled and edited by the Center for Renewable Resources, these projects reflect many levels of innovation and technical expertise. In many cases, a critique analysis is presented of how projects performed and of the institutional conditions associated with their success or failure. Some 2000 projects are included in this compilation; most have worked, some have not. Information about all is presented to aid learning from these experiences. The four volumes in this set are arranged in state sections by geographic region, coinciding with the four Regional Solar Energy Centers. The table of contents is organized by project category so that maximum cross-referencing may be obtained. This volume includes information on the Northeast Solar Energy Center Region. (WHK).

  11. Renewable Resources: a national catalog of model projects. Volume 4. Western Solar Utilization Network Region

    SciTech Connect (OSTI)

    1980-07-01

    This compilation of diverse conservation and renewable energy projects across the United States was prepared through the enthusiastic participation of solar and alternate energy groups from every state and region. Compiled and edited by the Center for Renewable Resources, these projects reflect many levels of innovation and technical expertise. In many cases, a critique analysis is presented of how projects performed and of the institutional conditions associated with their success or failure. Some 2000 projects are included in this compilation; most have worked, some have not. Information about all is presented to aid learning from these experiences. The four volumes in this set are arranged in state sections by geographic region, coinciding with the four Regional Solar Energy Centers. The table of contents is organized by project category so that maximum cross-referencing may be obtained. This volume includes information on the Western Solar Utilization Network Region. (WHK)

  12. Renewable Resources: a national catalog of model projects. Volume 3. Southern Solar Energy Center Region

    SciTech Connect (OSTI)

    1980-07-01

    This compilation of diverse conservation and renewable energy projects across the United States was prepared through the enthusiastic participation of solar and alternate energy groups from every state and region. Compiled and edited by the Center for Renewable Resources, these projects reflect many levels of innovation and technical expertise. In many cases, a critique analysis is presented of how projects performed and of the institutional conditions associated with their success or failure. Some 2000 projects are included in this compilation; most have worked, some have not. Information about all is presented to aid learning from these experiences. The four volumes in this set are arranged in state sections by geographic region, coinciding with the four Regional Solar Energy Centers. The table of contents is organized by project category so that maximum cross-referencing may be obtained. This volume includes information on the Southern Solar Energy Center Region. (WHK)

  13. Optimizing Geographic Allotment of Photovoltaic Capacity in a...

    Office of Scientific and Technical Information (OSTI)

    ... Program Country of Publication: United States Language: English Subject: 14 SOLAR ENERGY; 24 POWER TRANSMISSION AND DISTRIBUTION DISTRIBUTED GENERATION; OPTIMIZATION; GEOGRAPHIC ...

  14. Geographic Area Month Aviation Gasoline Kerosene-Type Jet Fuel

    U.S. Energy Information Administration (EIA) Indexed Site

    District and State (Cents per Gallon Excluding Taxes) - Continued Geographic Area Month Aviation Gasoline Kerosene-Type Jet Fuel Kerosene Sales to End Users Sales for Resale...

  15. The East Asia geographic map series

    SciTech Connect (OSTI)

    Terman, M.J.; Bell, E.P. )

    1990-06-01

    During the last 15 years, the Circum-Pacific Map Project Northwest Quadrant Panel (NWQP) has created a map inventory of geoscience data at a scale of 1:10,000,000. Now, for East Asia, a second set of thematic maps is being initiated cooperatively by the Circum-Pacific Council for Energy and Mineral Resources and the Committee for Coordination of Joint Prospecting for Mineral Resources in Asian Offshore Areas (CCOP). These new maps will constitute the East Asia Map Project, and they will present geoscience parameters at a scale of 1:2,000,000 that can be used to evaluate the potential for undiscovered resources with the application of new deposit modeling methodologies. The following map series are being compiled or are under consideration: geography, geotectonics, geophysics, mineral resources, energy resources, and hazards. The U.S, Geological Survey (USGS) is compiling the East Asia Geographic Map Series. Shorelines, rivers, and international boundaries have been computer plotted by the National Mapping Division from the most detailed version of the World Data Bank II (WDB II). This publicly available bank was hand digitized from a 1:3,000,000-scale global map compiled from a variety of sources. The East Asia series is composed of eight overlapping sheets with Lambert Azimuthal Equal-Area Projection having a common point of origin at 120{degree}E and 15{degree}N; neatlines for each sheet are 39{degree} {times} 54.4{degree}. Titles reflect each map's coverage: Sheet 1, Japan/Korea/Northeast China; Sheet 2, Southeast China; Sheet 3, Southeast Asia; Sheet 4, Philippines; Sheet 5, Malaysia/ West Indonesia; Sheet 6, East Indonesia; Sheet 7, Papua New Guinea/ Solomon Islands; and Sheet 8, Western Pacific Islands. Contours have been scribed by the USGS's Office of International Geology.

  16. Property:ExpActivityDateEnd | Open Energy Information

    Open Energy Info (EERE)

    C Conceptual Model At Dixie Valley Geothermal Area (Iovenitti, Et Al., 2012) G Geographic Information System At Dixie Valley Geothermal Area (Iovenitti, Et Al., 2012)...

  17. Afghanistan-NREL Resource Maps and Toolkits | Open Energy Information

    Open Energy Info (EERE)

    partnered with Afghanistan to develop high-resolution wind and solar resource maps and data products for Afghanistan. The data were output in Geographic Information Systems (GIS)...

  18. Geographic Variation in Potential of Rooftop Residential Photovoltaic Electric Power Production in the United States

    Broader source: Energy.gov [DOE]

    This paper describes a geographic evaluation of Zero Energy Home (ZEH) potential, specifically an assessment of residential roof-top solar electric photovoltaic (PV) performance around the United States and how energy produced would match up with very-efficient and super-efficient home designs. We performed annual simulations for 236 TMY2 data locations throughout the United States on two highly-efficient one-story 3-bedroom homes with a generic grid-tied solar electric 2kW PV system. These annual simulations show how potential annual solar electric power generation (kWh) and potential energy savings from PV power vary geographically around the U.S. giving the user in a specific region an indication of their expected PV system performance.

  19. An integrated computer modeling environment for regional land use, air quality, and transportation planning

    SciTech Connect (OSTI)

    Hanley, C.J.; Marshall, N.L.

    1997-04-01

    The Land Use, Air Quality, and Transportation Integrated Modeling Environment (LATIME) represents an integrated approach to computer modeling and simulation of land use allocation, travel demand, and mobile source emissions for the Albuquerque, New Mexico, area. This environment provides predictive capability combined with a graphical and geographical interface. The graphical interface shows the causal relationships between data and policy scenarios and supports alternative model formulations. Scenarios are launched from within a Geographic Information System (GIS), and data produced by each model component at each time step within a simulation is stored in the GIS. A menu-driven query system is utilized to review link-based results and regional and area-wide results. These results can also be compared across time or between alternative land use scenarios. Using this environment, policies can be developed and implemented based on comparative analysis, rather than on single-step future projections. 16 refs., 3 figs., 2 tabs.

  20. Renewable Resources: a national catalog of model projects. Volume 2. Mid-American Solar Energy Complex Region

    SciTech Connect (OSTI)

    1980-07-01

    This compilation of diverse conservation and renewable energy projects across the United States was prepared through the enthusiastic participation of solar and alternate energy groups from every state and region. Compiled and edited by the Center for Renewable Resources, these projects reflect many levels of innovation and technical expertise. In many cases, a critique analysis is presented of how projects performed and of the institutional conditions associated with their success or failure. Some 2000 projects are included in this compilation; most have worked, some have not. Information about all is presented to aid learning from these experiences. The four volumes in this set are arranged in state sections by geographic region, coinciding with the four Regional Solar Energy Centers. The table of contents is organized by project category so that maximum cross-referencing may be obtained. This volume includes information on the Mid-American Solar Energy Complex Region. (WHK)

  1. WEST COAST REGIONAL CARBON SEQUESTRATION PARTNERSHIP

    SciTech Connect (OSTI)

    Larry Myer; Terry Surles; Kelly Birkinshaw

    2004-01-01

    The West Coast Regional Carbon Sequestration Partnership is one of seven partnerships which have been established by the US Department of Energy (DOE) to evaluate carbon dioxide capture, transport and sequestration (CT&S) technologies best suited for different regions of the country. The West Coast Region comprises Arizona, California, Nevada, Oregon, Washington, and the North Slope of Alaska. Led by the California Energy Commission, the West Coast Partnership is a consortium of over thirty five organizations, including state natural resource and environmental protection agencies; national labs and universities; private companies working on CO{sub 2} capture, transportation, and storage technologies; utilities; oil and gas companies; nonprofit organizations; and policy/governance coordinating organizations. In an eighteen month Phase I project, the Partnership will evaluate both terrestrial and geologic sequestration options. Work will focus on five major objectives: (1) Collect data to characterize major CO{sub 2} point sources, the transportation options, and the terrestrial and geologic sinks in the region, and compile and organize this data via a geographic information system (GIS) database; (2) Address key issues affecting deployment of CT&S technologies, including storage site permitting and monitoring, injection regulations, and health and environmental risks (3) Conduct public outreach and maintain an open dialogue with stakeholders in CT&S technologies through public meetings, joint research, and education work (4) Integrate and analyze data and information from the above tasks in order to develop supply curves and cost effective, environmentally acceptable sequestration options, both near- and long-term (5) Identify appropriate terrestrial and geologic demonstration projects consistent with the options defined above, and create action plans for their safe and effective implementation A kickoff meeting for the West Coast Partnership was held on Sept 30-Oct.1. Contracts were then put into place with twelve organizations which will carry out the technical work required to meet Partnership objectives.

  2. Southeast Regional Carbon Sequestration Partnership (SECARB)

    SciTech Connect (OSTI)

    Kenneth J. Nemeth

    2005-09-30

    The Southeast Regional Carbon Sequestration Partnership (SECARB) is a diverse partnership covering eleven states involving the Southern States Energy Board (SSEB) an interstate compact; regulatory agencies and/or geological surveys from member states; the Electric Power Research Institute (EPRI); academic institutions; a Native American enterprise; and multiple entities from the private sector. Figure 1 shows the team structure for the partnership. In addition to the Technical Team, the Technology Coalition, an alliance of auxiliary participants, in the project lends yet more strength and support to the project. The Technology Coalition, with its diverse representation of various sectors, is integral to the technical information transfer, outreach, and public perception activities of the partnership. The Technology Coalition members, shown in Figure 2, also provide a breadth of knowledge and capabilities in the multiplicity of technologies needed to assure a successful outcome to the project and serve as an extremely important asset to the partnership. The eleven states comprising the multi-state region are: Alabama; Arkansas; Florida; Georgia; Louisiana; Mississippi; North Carolina; South Carolina; Tennessee; Texas; and Virginia. The states making up the SECARB area are illustrated in Figure 3. The primary objectives of the SECARB project include: (1) Supporting the U.S. Department of Energy (DOE) Carbon Sequestration Program by promoting the development of a framework and infrastructure necessary for the validation and deployment of carbon sequestration technologies. This requires the development of relevant data to reduce the uncertainties and risks that are barriers to sequestration, especially for geologic storage in the SECARB region. Information and knowledge are the keys to establishing a regional carbon dioxide (CO{sub 2}) storage industry with public acceptance. (2) Supporting the President's Global Climate Change Initiative with the goal of reducing greenhouse gas intensity by 18 percent by 2012. A corollary to the first objective, this objective requires the development of a broad awareness across government, industry, and the general public of sequestration issues and establishment of the technological and legal frameworks necessary to achieve the President's goal. The information developed by the SECARB team will play a vital role in achieving the President's goal for the southeastern region of the United States. (3) Evaluating options and potential opportunities for regional CO{sub 2} sequestration. This requires characterization of the region regarding the presence and location of sources of greenhouse gases (GHGs), primarily CO{sub 2}, the presence and location of potential carbon sinks and geological parameters, geographical features and environmental concerns, demographics, state and interstate regulations, and existing infrastructure.

  3. EIA - Natural Gas Pipeline Network - Region To Region System Capacity

    U.S. Energy Information Administration (EIA) Indexed Site

    Levels Interregional Capacity About U.S. Natural Gas Pipelines - Transporting Natural Gas based on data through 2007/2008 with selected updates Interregional Natural Gas Transmission Pipeline Capacity, Close of 2008 (Million cubic feet per day) Map of Interregional Natural Gas Transmission Pipeline Capacity in 2008 The EIA has determined that the informational map displays here do not raise security concerns, based on the application of the Federal Geographic Data Committee's Guidelines for

  4. Regional Standards Enforcement

    Broader source: Energy.gov [DOE]

    Central air conditioners are now subject to a base national standard in the North and different, regional standards in the Southeast and Southwest. This page provides information about those standards and how DOE enforces them.

  5. Working With Tribal Nations - A Geographic, Legal, and Economic

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Imperative | Department of Energy With Tribal Nations - A Geographic, Legal, and Economic Imperative Working With Tribal Nations - A Geographic, Legal, and Economic Imperative June 1, 2012 - 4:59pm Addthis Our Nation’s tribal communities are neighbors to the Energy Department’s National Laboratories and sites. In some cases there are tribes who retain treaty rights to land under the control of the Department. Our Nation's tribal communities are neighbors to the Energy Department's

  6. Regional Purchasing

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Regional Partnerships Regional Partnerships DOE's Regional Carbon Sequestration Partnerships Program DOE has created a network of seven Regional Carbon Sequestration Partnerships (RCSPs) to help develop the technology, infrastructure, and regulations to implement large-scale CO2 storage (also called carbon sequestration) in different regions and geologic formations within the Nation. Collectively, the seven RCSPs represent regions encompassing: 97 percent of coal-fired CO2 emissions; 97 percent

  7. Fuel Cell Backup Power Geographical Visualization Map (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2012-12-01

    This NREL Hydrogen and Fuel Cell Technical Highlight describes a time-lapse geographical visualization map of early market use of fuel cells for telecommunications backup power. The map synthesizes data being analyzed by NREL's Technology Validation team for the U.S. Department of Energy (DOE) Fuel Cell Technologies Program with DOE's publicly available annual summaries of electric disturbance events.

  8. U.S. Regional Demand Forecasts Using NEMS and GIS

    SciTech Connect (OSTI)

    Cohen, Jesse A.; Edwards, Jennifer L.; Marnay, Chris

    2005-07-01

    The National Energy Modeling System (NEMS) is a multi-sector, integrated model of the U.S. energy system put out by the Department of Energy's Energy Information Administration. NEMS is used to produce the annual 20-year forecast of U.S. energy use aggregated to the nine-region census division level. The research objective was to disaggregate this regional energy forecast to the county level for select forecast years, for use in a more detailed and accurate regional analysis of energy usage across the U.S. The process of disaggregation using a geographic information system (GIS) was researched and a model was created utilizing available population forecasts and climate zone data. The model's primary purpose was to generate an energy demand forecast with greater spatial resolution than what is currently produced by NEMS, and to produce a flexible model that can be used repeatedly as an add-on to NEMS in which detailed analysis can be executed exogenously with results fed back into the NEMS data flow. The methods developed were then applied to the study data to obtain residential and commercial electricity demand forecasts. The model was subjected to comparative and statistical testing to assess predictive accuracy. Forecasts using this model were robust and accurate in slow-growing, temperate regions such as the Midwest and Mountain regions. Interestingly, however, the model performed with less accuracy in the Pacific and Northwest regions of the country where population growth was more active. In the future more refined methods will be necessary to improve the accuracy of these forecasts. The disaggregation method was written into a flexible tool within the ArcGIS environment which enables the user to output the results in five year intervals over the period 2000-2025. In addition, the outputs of this tool were used to develop a time-series simulation showing the temporal changes in electricity forecasts in terms of absolute, per capita, and density of demand.

  9. CAPITAL REGION

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    t 092007 15:28 FAX 301 903 4656 CAPITAL REGION 0 j002 SDOE F 1325.8 (8-89) EFG (0790) ... 092007 15:29 FAX 301 903 4656 CAPITAL REGION 003 * Implemented a more robust ...

  10. Geographical features of global water cycle during warm geological epochs

    SciTech Connect (OSTI)

    Georgiadi, A.G.

    1996-12-31

    The impact of global warming on the water cycle can be extremely complex and diverse. The goal of the investigation was to estimate the geographic features of the mean annual water budget of the world during climatic optimums of the Holocene and the Eemian interglacial periods. These geological epochs could be used as analogs of climatic warming on 1 degree, centigrade and 2 degrees, centigrade. The author used the results of climatic reconstructions based on a simplified version of a GCM.

  11. Geographic smoothing of solar PV: Results from Gujarat

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Klima, Kelly; Apt, Jay

    2015-09-24

    We examine the potential for geographic smoothing of solar photovoltaic (PV) electricity generation using 13 months of observed power production from utility-scale plants in Gujarat, India. To our knowledge, this is the first published analysis of geographic smoothing of solar PV using actual generation data at high time resolution from utility-scale solar PV plants. We use geographic correlation and Fourier transform estimates of the power spectral density (PSD) to characterize the observed variability of operating solar PV plants as a function of time scale. Most plants show a spectrum that is linear in the log–log domain at high frequencies f,more » ranging from f-1.23 to f-1.56 (slopes of -1.23 and -1.56), thus exhibiting more relative variability at high frequencies than exhibited by wind plants. PSDs for large PV plants have a steeper slope than those for small plants, hence more smoothing at short time scales. Interconnecting 20 Gujarat plants yields a f-1.66 spectrum, reducing fluctuations at frequencies corresponding to 6 h and 1 h by 23% and 45%, respectively. Half of this smoothing can be obtained through connecting 4-5 plants; reaching marginal improvement of 1% per added plant occurs at 12-14 plants. The largest plant (322 MW) showed an f-1.76 spectrum. Furthermore, this suggests that in Gujarat the potential for smoothing is limited to that obtained by one large plant.« less

  12. State & Regional Resources | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... & Workforce Development Financial Opportunities Information Resources Publications Multimedia Databases Analytical Tools Glossary State & Regional Resources State Biomass ...

  13. Utah Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. Utah Region Middle School Regional Utah Nevada Regional Middle School Science...

  14. Alaska Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the High School Coach page. Alaska Region High School Regional Alaska Alaska High School Regional Science...

  15. Louisiana Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. Louisiana Region Middle School Regional Louisiana Arkansas Regional Middle...

  16. Alabama Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the High School Coach page. Alabama Region High School Regional Alabama Alabama High School Regional Science...

  17. Louisiana Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the High School Coach page. Louisiana Region High School Regional Louisiana Louisiana Regional High School...

  18. Georgia Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. Georgia Region Middle School Regional Georgia Georgia Regional Middle School...

  19. Wyoming Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. Wyoming Region Middle School Regional Wyoming Wyoming Regional Middle School...

  20. Colorado Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. Colorado Region Middle School Regional Colorado Colorado Regional Middle School...

  1. Hawaii Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the High School Coach page. Hawaii Region High School Regional Hawaii Hawaii Regional High School Science...

  2. Massachusetts Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. Massachusetts Region Middle School Regional Massachusetts Massachusetts Regional...

  3. Maine Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. Maine Region Middle School Regional Maine Massachusetts Regional Middle School...

  4. Vermont Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. Vermont Region Middle School Regional Vermont Massachusetts Regional Middle...

  5. Maryland Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. Maryland Region Middle School Regional Maryland Maryland Regional Middle School...

  6. Maine Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the High School Coach page. Maine Region High School Regional Maine Maine Regional High School Science Bowl...

  7. Delaware Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. Delaware Region Middle School Regional Delaware New Jersey Regional Middle...

  8. Florida Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. Florida Region Middle School Regional Florida Florida Regional Middle School...

  9. Tennessee Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. Tennessee Region Middle School Regional Tennessee Tennessee Regional Middle...

  10. Michigan Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. Michigan Region Middle School Regional Michigan Indiana Regional Middle School...

  11. Connecticut Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. Connecticut Region Middle School Regional Connecticut Connecticut Regional...

  12. Kansas Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. Kansas Region Middle School Regional Kansas Missouri Regional Middle School...

  13. Indiana Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the High School Coach page. Indiana Region High School Regional Indiana Indiana Regional High School Science...

  14. Delaware Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the High School Coach page. Delaware Region High School Regional Delaware New Jersey Regional High School...

  15. Utah Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    for your school's state, county, city, or district. For more information, please visit the High School Coach page. Utah Region High School Regional Utah Nevada Regional High School...

  16. Kentucky Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. Kentucky Region Middle School Regional Kentucky West Kentucky Regional Middle...

  17. Ohio Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. Ohio Region Middle School Regional Ohio Indiana Regional Middle School Science...

  18. Information Technology Specialist

    Broader source: Energy.gov [DOE]

    (See Frequently Asked Questions for more information). Where would I be working? Western Area Power Administration, Upper Great Plains Region, Power Systems Operations, Operations Computer Support ...

  19. BETR North America: A regionally segmented multimedia contaminant fate model for North America

    SciTech Connect (OSTI)

    MacLeod, M.; Woodfine, D.G.; Mackay, D.; McKone, T.E.; Bennett, D.H.; Maddalena, R.L.

    2001-03-01

    We present the Berkeley-Trent North American contaminant fate model (BETR North America), a regionally segmented multimedia contaminant fate model based on the fugacity concept. The model is built on a framework that links contaminant fate models of individual regions, and is generally applicable to large, spatially heterogeneous areas. The North American environment is modeled as 24 ecological regions, within each region contaminant fate is described using a 7 compartment multimedia fugacity model including a vertically segmented atmosphere, freshwater, freshwater sediment, soil, coastal water and vegetation compartments. Inter-regional transport of contaminants in the atmosphere, freshwater and coastal water is described using a database of hydrological and meteorological data compiled with Geographical Information Systems (GIS) techniques. Steady-state and dynamic solutions to the 168 mass balance equations that make up the linked model for North America are discussed, and an illustrative case study of toxaphene transport from the southern United States to the Great Lakes Basin is presented. Regionally segmented models such as BETR North America can provide a critical link between evaluative models of long-range transport potential and contaminant concentrations observed in remote regions. The continent-scale mass balance calculated by the model provides a sound basis for evaluating long-range transport potential of organic pollutants, and formulation of continent scale management and regulatory strategies for chemicals.

  20. Hydrogeologic evaluation and numerical simulation of the Death Valley regional ground-water flow system, Nevada and California

    SciTech Connect (OSTI)

    D`Agnese, F.A.; Faunt, C.C.; Turner, A.K.; Hill, M.C.

    1997-12-31

    Yucca Mountain is being studied as a potential site for a high-level radioactive waste repository. In cooperation with the U.S. Department of Energy, the U.S. Geological Survey is evaluating the geologic and hydrologic characteristics of the ground-water system. The study area covers approximately 100,000 square kilometers between lat 35{degrees}N., long 115{degrees}W and lat 38{degrees}N., long 118{degrees}W and encompasses the Death Valley regional ground-water flow system. Hydrology in the region is a result of both the and climatic conditions and the complex described as dominated by interbasinal flow and may be conceptualized as having two main components: a series of relatively shallow and localized flow paths that are superimposed on deeper regional flow paths. A significant component of the regional ground-water flow is through a thick Paleozoic carbonate rock sequence. Throughout the regional flow system, ground-water flow is probably controlled by extensive and prevalent structural features that result from regional faulting and fracturing. Hydrogeologic investigations over a large and hydrogeologically complex area impose severe demands on data management. This study utilized geographic information systems and geoscientific information systems to develop, store, manipulate, and analyze regional hydrogeologic data sets describing various components of the ground-water flow system.

  1. Geographic smoothing of solar PV: Results from Gujarat

    SciTech Connect (OSTI)

    Klima, Kelly; Apt, Jay

    2015-09-24

    We examine the potential for geographic smoothing of solar photovoltaic (PV) electricity generation using 13 months of observed power production from utility-scale plants in Gujarat, India. To our knowledge, this is the first published analysis of geographic smoothing of solar PV using actual generation data at high time resolution from utility-scale solar PV plants. We use geographic correlation and Fourier transform estimates of the power spectral density (PSD) to characterize the observed variability of operating solar PV plants as a function of time scale. Most plants show a spectrum that is linear in the log–log domain at high frequencies f, ranging from f-1.23 to f-1.56 (slopes of -1.23 and -1.56), thus exhibiting more relative variability at high frequencies than exhibited by wind plants. PSDs for large PV plants have a steeper slope than those for small plants, hence more smoothing at short time scales. Interconnecting 20 Gujarat plants yields a f-1.66 spectrum, reducing fluctuations at frequencies corresponding to 6 h and 1 h by 23% and 45%, respectively. Half of this smoothing can be obtained through connecting 4-5 plants; reaching marginal improvement of 1% per added plant occurs at 12-14 plants. The largest plant (322 MW) showed an f-1.76 spectrum. Furthermore, this suggests that in Gujarat the potential for smoothing is limited to that obtained by one large plant.

  2. National Geographic Society Kids Network: Report on 1994 teacher participants

    SciTech Connect (OSTI)

    1995-03-01

    In 1994, National Geographic Society Kids Network, a computer/telecommunications-based science curriculum, was presented to elementary and middle school teachers through summer programs sponsored by NGS and US DOE. The network program assists teachers in understanding the process of doing science; understanding the role of computers and telecommunications in the study of science, math, and engineering; and utilizing computers and telecommunications appropriately in the classroom. The program enables teacher to integrate science, math, and technology with other subjects with the ultimate goal of encouraging students of all abilities to pursue careers in science/math/engineering. This report assesses the impact of the network program on participating teachers.

  3. Bayesian Integration of Isotope Ratio for Geographic Sourcing of Castor Beans

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Webb-Robertson, Bobbie-Jo; Kreuzer, Helen; Hart, Garret; Ehleringer, James; West, Jason; Gill, Gary; Duckworth, Douglas

    2012-01-01

    Recenmore » t years have seen an increase in the forensic interest associated with the poison ricin, which is extracted from the seeds of the Ricinus communis plant. Both light element (C, N, O, and H) and strontium (Sr) isotope ratios have previously been used to associate organic material with geographic regions of origin. We present a Bayesian integration methodology that can more accurately predict the region of origin for a castor bean than individual models developed independently for light element stable isotopes or Sr isotope ratios. Our results demonstrate a clear improvement in the ability to correctly classify regions based on the integrated model with a class accuracy of 60.9 ± 2.1 % versus 55.9 ± 2.1 % and 40.2 ± 1.8 % for the light element and strontium (Sr) isotope ratios, respectively. In addition, we show graphically the strengths and weaknesses of each dataset in respect to class prediction and how the integration of these datasets strengthens the overall model.« less

  4. A Web Based Geographic Information Platform to Support Urban Adaptation to Climate Change

    SciTech Connect (OSTI)

    Nugent, Philip J; Omitaomu, Olufemi A; Parish, Esther S; Mei, Rui; Ernst, Kathleen M; Absar, Mariya

    2015-01-01

    The urban climate is changing rapidly. Therefore, climate change and its projected impacts on environmental conditions must be considered in assessing and comparing urban planning alternatives. In this paper, we present an integrated framework for urban climate adaptation tool (Urban-CAT) that will help cities to plan for, rather than react to, possible risks. Urban-CAT will be developed as a scenario planning tool that is locally relevant to existing urban decision-making processes.

  5. Property:Region | Open Energy Information

    Open Energy Info (EERE)

    @Ventures (California) + Bay Area + @Ventures (Massachusetts) + Greater Boston Area + A A1 Sun, Inc. + Bay Area + A10 Power + Bay Area + A123 Systems + Greater Boston Area + A2BE...

  6. Alaska Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    Springs Geothermal Area Sitka Hot Spring Geothermal Area South Geothermal Area Tolovana Geothermal Area ... further results Energy Generation Facilities within the Alaska...

  7. Gainesville Regional Utilities | Open Energy Information

    Open Energy Info (EERE)

    www.gru.com Outage Hotline: 352-334-2871 Outage Map: m.gru.comemergencyelectric.j References: EIA Form EIA-861 Final Data File for 2010 - File1a1 EIA Form 861 Data...

  8. Template:GeothermalRegion | Open Energy Information

    Open Energy Info (EERE)

    area is located, in km. IdentifiedHydrothermalPotential - The identified hydrothermal electricity generation potential in megawatts, from the USGS resource estimate....

  9. Property:GeothermalRegion | Open Energy Information

    Open Energy Info (EERE)

    Power Plant + Upper Austrian Molasse Basin + Alum Geothermal Area + Walker-Lane Transition Zone + Alum Geothermal Project + Walker-Lane Transition Zone + Aluto-Langano...

  10. Cascades Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    years) thick mafic lava flows, primarily of andesitic composition are associated with ash flows, tuffs, and silicic intrusive bodies and stocks that decrease in age eastward to...

  11. Redesigned CCS Website Offers Wealth of Information on Worldwide Technology, Projects

    Broader source: Energy.gov [DOE]

    A wealth of information about worldwide carbon capture and storage technologies and projects is available on the newly launched, updated and redesigned National Carbon Sequestration Database and Geographic Information System (NATCARB) website.

  12. Aquaculture information package

    SciTech Connect (OSTI)

    Boyd, T.; Rafferty, K.

    1998-08-01

    This package of information is intended to provide background information to developers of geothermal aquaculture projects. The material is divided into eight sections and includes information on market and price information for typical species, aquaculture water quality issues, typical species culture information, pond heat loss calculations, an aquaculture glossary, regional and university aquaculture offices and state aquaculture permit requirements. A bibliography containing 68 references is also included.

  13. Implications of Wide-Area Geographic Diversity for Short- Term Variability of Solar Power

    SciTech Connect (OSTI)

    Mills, Andrew; Wiser, Ryan

    2010-08-23

    Worldwide interest in the deployment of photovoltaic generation (PV) is rapidly increasing. Operating experience with large PV plants, however, demonstrates that large, rapid changes in the output of PV plants are possible. Early studies of PV grid impacts suggested that short-term variability could be a potential limiting factor in deploying PV. Many of these early studies, however, lacked high-quality data from multiple sites to assess the costs and impacts of increasing PV penetration. As is well known for wind, accounting for the potential for geographic diversity can significantly reduce the magnitude of extreme changes in aggregated PV output, the resources required to accommodate that variability, and the potential costs of managing variability. We use measured 1-min solar insolation for 23 time-synchronized sites in the Southern Great Plains network of the Atmospheric Radiation Measurement program and wind speed data from 10 sites in the same network to characterize the variability of PV with different degrees of geographic diversity and to compare the variability of PV to the variability of similarly sited wind. The relative aggregate variability of PV plants sited in a dense 10 x 10 array with 20 km spacing is six times less than the variability of a single site for variability on time scales less than 15-min. We find in our analysis of wind and PV plants similarly sited in a 5 x 5 grid with 50 km spacing that the variability of PV is only slightly more than the variability of wind on time scales of 5-15 min. Over shorter and longer time scales the level of variability is nearly identical. Finally, we use a simple approximation method to estimate the cost of carrying additional reserves to manage sub-hourly variability. We conclude that the costs of managing the short-term variability of PV are dramatically reduced by geographic diversity and are not substantially different from the costs for managing the short-term variability of similarly sited wind in this region.

  14. Southeast Regional Carbon Sequestration Partnership

    SciTech Connect (OSTI)

    Kenneth J. Nemeth

    2006-08-30

    The Southeast Regional Carbon Sequestration Partnership's (SECARB) Phase I program focused on promoting the development of a framework and infrastructure necessary for the validation and commercial deployment of carbon sequestration technologies. The SECARB program, and its subsequent phases, directly support the Global Climate Change Initiative's goal of reducing greenhouse gas intensity by 18 percent by the year 2012. Work during the project's two-year period was conducted within a ''Task Responsibility Matrix''. The SECARB team was successful in accomplishing its tasks to define the geographic boundaries of the region; characterize the region; identify and address issues for technology deployment; develop public involvement and education mechanisms; identify the most promising capture, sequestration, and transport options; and prepare action plans for implementation and technology validation activity. Milestones accomplished during Phase I of the project are listed below: (1) Completed preliminary identification of geographic boundaries for the study (FY04, Quarter 1); (2) Completed initial inventory of major sources and sinks for the region (FY04, Quarter 2); (3) Completed initial development of plans for GIS (FY04, Quarter 3); (4) Completed preliminary action plan and assessment for overcoming public perception issues (FY04, Quarter 4); (5) Assessed safety, regulatory and permitting issues (FY05, Quarter 1); (6) Finalized inventory of major sources/sinks and refined GIS algorithms (FY05, Quarter 2); (7) Refined public involvement and education mechanisms in support of technology development options (FY05, Quarter 3); and (8) Identified the most promising capture, sequestration and transport options and prepared action plans (FY05, Quarter 4).

  15. On the mixing time of geographical threshold graphs

    SciTech Connect (OSTI)

    Bradonjic, Milan

    2009-01-01

    In this paper, we study the mixing time of random graphs generated by the geographical threshold graph (GTG) model, a generalization of random geometric graphs (RGG). In a GTG, nodes are distributed in a Euclidean space, and edges are assigned according to a threshold function involving the distance between nodes as well as randomly chosen node weights. The motivation for analyzing this model is that many real networks (e.g., wireless networks, the Internet, etc.) need to be studied by using a 'richer' stochastic model (which in this case includes both a distance between nodes and weights on the nodes). We specifically study the mixing times of random walks on 2-dimensional GTGs near the connectivity threshold. We provide a set of criteria on the distribution of vertex weights that guarantees that the mixing time is {Theta}(n log n).

  16. The Australian Geographic Team Marsupial solar-powered car

    SciTech Connect (OSTI)

    Allen, G.R.; Storey, J.W.V.

    1988-01-01

    As in all vehicles of this type, low weight and aerodynamic drag must be achieved without compromising safety, and in an extremely rugged structure. This has been done by using a chrome-molybdenum steel space-frame, surrounded by a Kevlar/foam sandwich body shell. The solar panel wing, which uses a laminar flow section to obtain low drag, does not tilt except when the vehicle is stationary. A high degree of redundancy is built into the vehicle; for example there are two motors and transmissions, the solar array is divided into seven parallel sub-arrays, and the power electronics is multiply redundant. Built entirely in the garage of a suburban house, the Australian Geographic Team Marsupial car cost less than US$50,000 to construct.

  17. BETR-world: A geographically explicit model of chemical fate: Application to transport of a-HCH to the arctic

    SciTech Connect (OSTI)

    Toose, Liisa; Woodfine, David G.; MacLeod, Matthew; Mackay, Don; Gouin, Jenn

    2003-12-01

    The Berkeley Trent (BETR)-World model, a 25 compartment, geographically explicit fugacity-based model is described and applied to evaluate the transport of chemicals from temperate source regions to receptor regions (such as the Arctic). The model was parameterized using GIS and an array of digital data on weather, oceans, freshwater, vegetation and geo-political boundaries. This version of the BETR model framework includes modification of atmospheric degradation rates by seasonally variable hydroxyl radical concentrations and temperature. Degradation rates in all other compartments vary with seasonally changing temperature. Deposition to the deep ocean has been included as a loss mechanism. A case study was undertaken for a-HCH. Dynamic emission scenarios were estimated for each of the 25 regions. Predicted environmental concentrations showed good agreement with measured values for the northern regions in air , and fresh and oceanic water and with the results from a previous model of global chemical fate. Potential for long-range transport and deposition to the Arctic region was assessed using a Transfer Efficiency combined with estimated emissions. European regions and the Orient including China have a high potential to contribute a-HCH contamination in the Arctic due to high rates of emission in these regions despite low Transfer Efficiencies. Sensitivity analyses reveal that the performance and reliability of the model is strongly in sequenced by parameters controlling degradation rates.

  18. Geographic Area Month Sales to End Users Sales

    U.S. Energy Information Administration (EIA) Indexed Site

    Prices by Sales Type and PAD District Energy Information Administration Petroleum Marketing Annual 1997 221 Table 38. Propane (Consumer Grade) Prices by Sales Type and PAD...

  19. Geographic Area Month Sales to End Users Sales

    U.S. Energy Information Administration (EIA) Indexed Site

    Prices by Sales Type and PAD District Energy Information Administration Petroleum Marketing Annual 1996 221 Table 38. Propane (Consumer Grade) Prices by Sales Type and PAD...

  20. International Energy Initiative | Open Energy Information

    Open Energy Info (EERE)

    to as INTAAACT, which means integrating information, training, analysis, advocacy, and action into projects. The Asian Regional Energy Initiative under a regional Director, was...

  1. General Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    General Information JLF Contacts Request a Tour

  2. Colorado Regional Faults

    SciTech Connect (OSTI)

    Hussein, Khalid

    2012-02-01

    Citation Information: Originator: Earth Science &Observation Center (ESOC), CIRES, University of Colorado at Boulder Originator: Colorado Geological Survey (CGS) Publication Date: 2012 Title: Regional Faults Edition: First Publication Information: Publication Place: Earth Science & Observation Center, Cooperative Institute for Research in Environmental Science, University of Colorado, Boulder Publisher: Earth Science &Observation Center (ESOC), CIRES, University of Colorado at Boulder Description: This layer contains the regional faults of Colorado Spatial Domain: Extent: Top: 4543192.100000 m Left: 144385.020000 m Right: 754585.020000 m Bottom: 4094592.100000 m Contact Information: Contact Organization: Earth Science &Observation Center (ESOC), CIRES, University of Colorado at Boulder Contact Person: Khalid Hussein Address: CIRES, Ekeley Building Earth Science & Observation Center (ESOC) 216 UCB City: Boulder State: CO Postal Code: 80309-0216 Country: USA Contact Telephone: 303-492-6782 Spatial Reference Information: Coordinate System: Universal Transverse Mercator (UTM) WGS’1984 Zone 13N False Easting: 500000.00000000 False Northing: 0.00000000 Central Meridian: -105.00000000 Scale Factor: 0.99960000 Latitude of Origin: 0.00000000 Linear Unit: Meter Datum: World Geodetic System 1984 (WGS ’984) Prime Meridian: Greenwich Angular Unit: Degree Digital Form: Format Name: Shape file

  3. Value of Geographic Diversity of Wind and Solar: Stochastic Geometry Approach; Preprint

    SciTech Connect (OSTI)

    Diakov, V.

    2012-08-01

    Based on the available geographically dispersed data for the continental U.S. (excluding Alaska), we analyze to what extent the geographic diversity of these resources can offset their variability. A geometric model provides a convenient measure for resource variability, shows the synergy between wind and solar resources.

  4. Incorporating Stakeholder Decision Support Needs into an Integrated Regional Earth System Model

    SciTech Connect (OSTI)

    Rice, Jennie S.; Moss, Richard H.; Runci, Paul J.; Anderson, K. L.; Malone, Elizabeth L.

    2012-03-21

    A new modeling effort exploring the opportunities, constraints, and interactions between mitigation and adaptation at regional scale is utilizing stakeholder engagement in an innovative approach to guide model development and demonstration, including uncertainty characterization, to effectively inform regional decision making. This project, the integrated Regional Earth System Model (iRESM), employs structured stakeholder interactions and literature reviews to identify the most relevant adaptation and mitigation alternatives and decision criteria for each regional application of the framework. The information is used to identify important model capabilities and to provide a focus for numerical experiments. This paper presents the stakeholder research results from the first iRESM pilot region. The pilot region includes the Great Lakes Basin in the Midwest portion of the United States as well as other contiguous states. This geographic area (14 states in total) permits cohesive modeling of hydrologic systems while also providing gradients in climate, demography, land cover/land use, and energy supply and demand. The results from the stakeholder research indicate that iRESM should prioritize addressing adaptation alternatives in the water resources, urban infrastructure, and agriculture sectors, such as water conservation, expanded water quality monitoring, altered reservoir releases, lowered water intakes, urban infrastructure upgrades, increased electric power reserves in urban areas, and land use management/crop selection changes. Regarding mitigation alternatives, the stakeholder research shows a need for iRESM to focus on policies affecting the penetration of renewable energy technologies, and the costs and effectiveness of energy efficiency, bioenergy production, wind energy, and carbon capture and sequestration.

  5. Wind energy resources atlas. Volume 1. Northwest region

    SciTech Connect (OSTI)

    Elliott, D.L.; Barchet, W.R.

    1980-04-01

    Information is presented concering regional wind energy resource assessment; regional features; and state features for Idaho, Montana, Oregon, Washington, and Wyoming.

  6. Iowa Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    that is designated for your school's state, county, city, or district. For more information, please visit the Middle School Coach page. Iowa Region Middle School Regional Iowa Iowa...

  7. Connecticut Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    for your school's state, county, city, or district. For more information, please visit the High School Coach page. Connecticut Region High School Regional Connecticut Connecticut...

  8. Montana Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    is designated for your school's state, county, city, or district. For more information, please visit the High School Coach page. Montana Region High School Regional Montana Montana...

  9. Montana Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    for your school's state, county, city, or district. For more information, please visit the Middle School Coach page. Montana Region Middle School Regional Montana Montana...

  10. Indiana Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    for your school's state, county, city, or district. For more information, please visit the Middle School Coach page. Indiana Region Middle School Regional Indiana Indiana...

  11. Massachusetts Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    for your school's state, county, city, or district. For more information, please visit the High School Coach page. Massachusetts Region High School Regional Massachusetts Northeast...

  12. Arizona Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    is designated for your school's state, county, city, or district. For more information, please visit the High School Coach page. Arizona Region High School Regional Arizona Arizona...

  13. Vermont Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    designated for your school's state, county, city, or district. For more information, please visit the High School Coach page. Vermont Region High School Regional Vermont Northeast...

  14. Kansas Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    is designated for your school's state, county, city, or district. For more information, please visit the High School Coach page. Kansas Region High School Regional Kansas Kansas...

  15. Alabama Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    for your school's state, county, city, or district. For more information, please visit the Middle School Coach page. Alabama Regions Middle School Regional Alabama Alabama...

  16. Missouri Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    designated for your school's state, county, city, or district. For more information, please visit the High School Coach page. Missouri Region High School Regional Missouri Missouri...

  17. Virginia Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    designated for your school's state, county, city, or district. For more information, please visit the High School Coach page. Virginia Region High School Regional Virginia Virginia...

  18. Wyoming Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    designated for your school's state, county, city, or district. For more information, please visit the High School Coach page. Wyoming Regions High School Regional Wyoming Wyoming...

  19. Tennessee Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    for your school's state, county, city, or district. For more information, please visit the High School Coach page. Tennessee Region High School Regional Tennessee Tennessee...

  20. Virginia Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    for your school's state, county, city, or district. For more information, please visit the Middle School Coach page. Virginia Region Middle School Regional Virginia Virginia...

  1. Nevada Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    is designated for your school's state, county, city, or district. For more information, please visit the High School Coach page. Nevada Region High School Regional Nevada Nevada...

  2. Arkansas Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    for your school's state, county, city, or district. For more information, please visit the Middle School Coach page. Arkansas Region Middle School Regional Arkansas Arkansas...

  3. Missouri Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    for your school's state, county, city, or district. For more information, please visit the Middle School Coach page. Missouri Region Middle School Regional Missouri Missouri...

  4. Mississippi Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    your school's state, county, city, or district. For more information, please visit the Middle School Coach page. Mississippi Region Middle School Regional Mississippi Mississippi...

  5. Colorado Region | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    designated for your school's state, county, city, or district. For more information, please visit the High School Coach page. Colorado Region High School Regional Colorado Colorado...

  6. Arkansas Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    designated for your school's state, county, city, or district. For more information, please visit the High School Coach page. Arkansas Region High School Regional Arkansas Arkansas...

  7. Arizona Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    for your school's state, county, city, or district. For more information, please visit the Middle School Coach page. Arizona Region Middle School Regional Arizona Arizona...

  8. Wisconsin Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. Wisconsin Region Middle School Regional Wisconsin Wisconsin Middle School...

  9. Maryland Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    designated for your school's state, county, city, or district. For more information, please visit the High School Coach page. Maryland Region High School Regional Maryland Maryland...

  10. Oregon Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    is designated for your school's state, county, city, or district. For more information, please visit the Middle School Coach page. Oregon Region Middle School Regional Oregon BPA...

  11. Nebraska Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    for your school's state, county, city, or district. For more information, please visit the Middle School Coach page. Nebraska Region Middle School Regional Nebraska Nebraska...

  12. Nevada Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    designated for your school's state, county, city, or district. For more information, please visit the Middle School Coach page. Nevada Region Middle School Regional Nevada Nevada...

  13. Wisconsin Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    for your school's state, county, city, or district. For more information, please visit the High School Coach page. Wisconsin Regions High School Regional Wisconsin Wisconsin...

  14. Michigan Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    designated for your school's state, county, city, or district. For more information, please visit the High School Coach page. Michigan Region High School Regional Michigan Michigan...

  15. Iowa Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    that is designated for your school's state, county, city, or district. For more information, please visit the High School Coach page. Iowa Region High School Regional Iowa Iowa...

  16. Geographic Area Month Sales to End Users Sales

    U.S. Energy Information Administration (EIA) Indexed Site

    100.7 34.6 See footnotes at end of table. Energy Information AdministrationPetroleum Marketing Annual 1998 179 Table 38. Propane (Consumer Grade) Prices by Sales Type and PAD...

  17. Geographic Area Month Sales to End Users Sales

    U.S. Energy Information Administration (EIA) Indexed Site

    100.8 40.5 See footnotes at end of table. Energy Information Administration Petroleum Marketing Annual 1995 221 Table 38. Propane (Consumer Grade) Prices by Sales Type and PAD...

  18. Geographic Area Month Sales to End Users Sales

    U.S. Energy Information Administration (EIA) Indexed Site

    102.4 39.7 See footnotes at end of table. Energy Information AdministrationPetroleum Marketing Annual 1999 179 Table 38. Propane (Consumer Grade) Prices by Sales Type and PAD...

  19. Kawerau Geothermal Power Station | Open Energy Information

    Open Energy Info (EERE)

    Station General Information Name Kawerau Geothermal Power Station Sector Geothermal energy Location Information Location Bay of Plenty Region, New Zealand Coordinates...

  20. Nagqu Geothermal Power Plant | Open Energy Information

    Open Energy Info (EERE)

    Name Nagqu Geothermal Power Plant Facility Geothermal Power Plant Sector Geothermal energy Location Information Geothermal Resource Area Geothermal Region Plant Information...

  1. Information Technology and Community Restoration Studies/Task 1: Information Technology

    SciTech Connect (OSTI)

    Upton, Jaki F.; Lesperance, Ann M.; Stein, Steven L.

    2009-11-19

    Executive Summary The Interagency Biological Restoration Demonstration—a program jointly funded by the Department of Defense's Defense Threat Reduction Agency and the Department of Homeland Security's (DHS's) Science and Technology Directorate—is developing policies, methods, plans, and applied technologies to restore large urban areas, critical infrastructures, and Department of Defense installations following the intentional release of a biological agent (anthrax) by terrorists. There is a perception that there should be a common system that can share information both vertically and horizontally amongst participating organizations as well as support analyses. A key question is: "How far away from this are we?" As part of this program, Pacific Northwest National Laboratory conducted research to identify the current information technology tools that would be used by organizations in the greater Seattle urban area in such a scenario, to define criteria for use in evaluating information technology tools, and to identify current gaps. Researchers interviewed 28 individuals representing 25 agencies in civilian and military organizations to identify the tools they currently use to capture data needed to support operations and decision making. The organizations can be grouped into five broad categories: defense (Department of Defense), environmental/ecological (Environmental Protection Agency/Ecology), public health and medical services, emergency management, and critical infrastructure. The types of information that would be communicated in a biological terrorism incident include critical infrastructure and resource status, safety and protection information, laboratory test results, and general emergency information. The most commonly used tools are WebEOC (web-enabled crisis information management systems with real-time information sharing), mass notification software, resource tracking software, and NW WARN (web-based information to protect critical infrastructure systems). It appears that the current information management tools are used primarily for information gathering and sharing—not decision making. Respondents identified the following criteria for a future software system. It is easy to learn, updates information in real time, works with all agencies, is secure, uses a visualization or geographic information system feature, enables varying permission levels, flows information from one stage to another, works with other databases, feeds decision support tools, is compliant with appropriate standards, and is reasonably priced. Current tools have security issues, lack visual/mapping functions and critical infrastructure status, and do not integrate with other tools. It is clear that there is a need for an integrated, common operating system. The system would need to be accessible by all the organizations that would have a role in managing an anthrax incident to enable regional decision making. The most useful tool would feature a GIS visualization that would allow for a common operating picture that is updated in real time. To capitalize on information gained from the interviews, the following activities are recommended: • Rate emergency management decision tools against the criteria specified by the interviewees. • Identify and analyze other current activities focused on information sharing in the greater Seattle urban area. • Identify and analyze information sharing systems/tools used in other regions.

  2. Water Sampling | Open Energy Information

    Open Energy Info (EERE)

    Water Sampling Details Activities (63) Areas (51) Regions (5) NEPA(2) Exploration Technique Information Exploration Group: Field Techniques Exploration Sub Group: Field Sampling...

  3. Geographically Based Hydrogen Consumer Demand and Infrastructure Analysis: Final Report

    SciTech Connect (OSTI)

    Melendez, M.; Milbrandt, A.

    2006-10-01

    In FY 2004 and 2005, NREL developed a proposed minimal infrastructure to support nationwide deployment of hydrogen vehicles by offering infrastructure scenarios that facilitated interstate travel. This report identifies key metropolitan areas and regions on which to focus infrastructure efforts during the early hydrogen transition.

  4. WINDExchange: Wind Energy Regional Resource Centers

    Wind Powering America (EERE)

    Deployment Activities Printable Version Bookmark and Share Regional Resource Centers About Economic Development Siting Wind Energy Regional Resource Centers The U.S. Department of Energy's Regional Resource Centers provide unbiased wind energy information to communities and decision makers to help them evaluate wind energy potential and learn about wind power's benefits and impacts in their regions. During their first year of operations, the Regional Resource Centers impacted more than 12,000

  5. National Geographic Hosts the Energy Department's STEM Mentoring Café for

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Students | Department of Energy Geographic Hosts the Energy Department's STEM Mentoring Café for Students National Geographic Hosts the Energy Department's STEM Mentoring Café for Students February 24, 2016 - 4:20pm Addthis Hands on learning in science and technology gave 90 school kids and their teachers from Maryland, Virginia, and Washington, D.C. a first-hand look at STEM careers in February. Here, Carrie Seltzer, a research scientist and program manager at the National Geographic

  6. New Jersey Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. New Jersey Region Middle School Regional New Jersey New Jersey Regional Middle...

  7. New Hampshire Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. New Hampshire Region Middle School Regional New Hampshire Massachusetts Regional...

  8. West Virginia Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. West Virginia Region Middle School Regional West Virginia West Virginia Regional...

  9. Rhode Island Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. Rhode Island Region Middle School Regional Rhode Island Massachusetts Regional...

  10. West Virginia Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the High School Coach page. West Virginia Regions High School Regional West Virginia West Virginia Regional...

  11. Geographical Distribution of Biomass Carbon in Tropical Southeast Asian Forests: A Database

    SciTech Connect (OSTI)

    Brown, S

    2001-05-22

    A database was generated of estimates of geographically referenced carbon densities of forest vegetation in tropical Southeast Asia for 1980. A geographic information system (GIS) was used to incorporate spatial databases of climatic, edaphic, and geomorphological indices and vegetation to estimate potential (i.e., in the absence of human intervention and natural disturbance) carbon densities of forests. The resulting map was then modified to estimate actual 1980 carbon density as a function of population density and climatic zone. The database covers the following 13 countries: Bangladesh, Brunei, Cambodia (Campuchea), India, Indonesia, Laos, Malaysia, Myanmar (Burma), Nepal, the Philippines, Sri Lanka, Thailand, and Vietnam. The data sets within this database are provided in three file formats: ARC/INFOTM exported integer grids, ASCII (American Standard Code for Information Interchange) files formatted for raster-based GIS software packages, and generic ASCII files with x, y coordinates for use with non-GIS software packages. This database includes ten ARC/INFO exported integer grid files (five with the pixel size 3.75 km x 3.75 km and five with the pixel size 0.25 degree longitude x 0.25 degree latitude) and 27 ASCII files. The first ASCII file contains the documentation associated with this database. Twenty-four of the ASCII files were generated by means of the ARC/INFO GRIDASCII command and can be used by most raster-based GIS software packages. The 24 files can be subdivided into two groups of 12 files each. These files contain real data values representing actual carbon and potential carbon density in Mg C/ha (1 megagram = 10{sup 6} grams) and integer-coded values for country name, Weck's Climatic Index, ecofloristic zone, elevation, forest or non-forest designation, population density, mean annual precipitation, slope, soil texture, and vegetation classification. One set of 12 files contains these data at a spatial resolution of 3.75 km, whereas the other set of 12 files has a spatial resolution of 0.25 degree. The remaining two ASCII data files combine all of the data from the 24 ASCII data files into 2 single generic data files. The first file has a spatial resolution of 3.75 km, and the second has a resolution of 0.25 degree. Both files also provide a grid-cell identification number and the longitude and latitude of the center-point of each grid cell. The 3.75-km data in this numeric data package yield an actual total carbon estimate of 42.1 Pg (1 petagram = 10{sup 15} grams) and a potential carbon estimate of 73.6 Pg; whereas the 0.25-degree data produced an actual total carbon estimate of 41.8 Pg and a total potential carbon estimate of 73.9 Pg. Fortran and SAS{trademark} access codes are provided to read the ASCII data files, and ARC/INFO and ARCVIEW command syntax are provided to import the ARC/INFO exported integer grid files. The data files and this documentation are available without charge on a variety of media and via the Internet from the Carbon Dioxide Information Analysis Center (CDIAC).

  12. Geographical Distribution of Biomass Carbon in Tropical Southeast Asian Forests: A Database

    SciTech Connect (OSTI)

    Brown, S.

    2002-02-07

    A database was generated of estimates of geographically referenced carbon densities of forest vegetation in tropical Southeast Asia for 1980. A geographic information system (GIS) was used to incorporate spatial databases of climatic, edaphic, and geomorphological indices and vegetation to estimate potential (i.e., in the absence of human intervention and natural disturbance) carbon densities of forests. The resulting map was then modified to estimate actual 1980 carbon density as a function of population density and climatic zone. The database covers the following 13 countries: Bangladesh, Brunei, Cambodia (Campuchea), India, Indonesia, Laos, Malaysia, Myanmar (Burma), Nepal, the Philippines, Sri Lanka, Thailand, and Vietnam. The data sets within this database are provided in three file formats: ARC/INFO{trademark} exported integer grids, ASCII (American Standard Code for Information Interchange) files formatted for raster-based GIS software packages, and generic ASCII files with x, y coordinates for use with non-GIS software packages. This database includes ten ARC/INFO exported integer grid files (five with the pixel size 3.75 km x 3.75 km and five with the pixel size 0.25 degree longitude x 0.25 degree latitude) and 27 ASCII files. The first ASCII file contains the documentation associated with this database. Twenty-four of the ASCII files were generated by means of the ARC/INFO GRIDASCII command and can be used by most raster-based GIS software packages. The 24 files can be subdivided into two groups of 12 files each. These files contain real data values representing actual carbon and potential carbon density in Mg C/ha (1 megagram = 10{sup 6} grams) and integer- coded values for country name, Weck's Climatic Index, ecofloristic zone, elevation, forest or non-forest designation, population density, mean annual precipitation, slope, soil texture, and vegetation classification. One set of 12 files contains these data at a spatial resolution of 3.75 km, whereas the other set of 12 files has a spatial resolution of 0.25 degree. The remaining two ASCII data files combine all of the data from the 24 ASCII data files into 2 single generic data files. The first file has a spatial resolution of 3.75 km, and the second has a resolution of 0.25 degree. Both files also provide a grid-cell identification number and the longitude and latitude of the centerpoint of each grid cell. The 3.75-km data in this numeric data package yield an actual total carbon estimate of 42.1 Pg (1 petagram = 10{sup 15} grams) and a potential carbon estimate of 73.6 Pg; whereas the 0.25-degree data produced an actual total carbon estimate of 41.8 Pg and a total potential carbon estimate of 73.9 Pg. Fortran and SASTM access codes are provided to read the ASCII data files, and ARC/INFO and ARCVIEW command syntax are provided to import the ARC/INFO exported integer grid files. The data files and this documentation are available without charge on a variety of media and via the Internet from the Carbon Dioxide Information Analysis Center (CDIAC).

  13. Cyber Graph Queries for Geographically Distributed Data Centers

    SciTech Connect (OSTI)

    Berry, Jonathan W.; Collins, Michael; Kearns, Aaron; Phillips, Cynthia A.; Saia, Jared

    2015-05-01

    We present new algorithms for a distributed model for graph computations motivated by limited information sharing we first discussed in [20]. Two or more independent entities have collected large social graphs. They wish to compute the result of running graph algorithms on the entire set of relationships. Because the information is sensitive or economically valuable, they do not wish to simply combine the information in a single location. We consider two models for computing the solution to graph algorithms in this setting: 1) limited-sharing: the two entities can share only a polylogarithmic size subgraph; 2) low-trust: the entities must not reveal any information beyond the query answer, assuming they are all honest but curious. We believe this model captures realistic constraints on cooperating autonomous data centers. We have algorithms in both setting for s - t connectivity in both models. We also give an algorithm in the low-communication model for finding a planted clique. This is an anomaly- detection problem, finding a subgraph that is larger and denser than expected. For both the low- communication algorithms, we exploit structural properties of social networks to prove perfor- mance bounds better than what is possible for general graphs. For s - t connectivity, we use known properties. For planted clique, we propose a new property: bounded number of triangles per node. This property is based upon evidence from the social science literature. We found that classic examples of social networks do not have the bounded-triangles property. This is because many social networks contain elements that are non-human, such as accounts for a business, or other automated accounts. We describe some initial attempts to distinguish human nodes from automated nodes in social networks based only on topological properties.

  14. Appropriate Technology Management Information System

    SciTech Connect (OSTI)

    Not Available

    1984-02-01

    From 1978 to 1981, the Department of Energy (DOE) awarded more than 2200 small grants worth more than $25 million to individuals, organizations and small businesses across the nation for the purposes of researching, developing and demonstrating appropriate technologies. Grants were given in the full range of technology areas, including conservation, solar, biomass, wind, geothermal, and hydro power. The final report from each DOE grantee was reviewed in an effort to extract information about new ideas and proven concepts that could be of value to the public. To manage the growing wealth of information from the grant reports, and to monitor the report review process, the Appropriate Technology Management Information System (ATMIS), a computer data base, was developed. The ATMIS can classify data into numerous categories (technology area, geographic location, project status, etc.). This manual was generated directly from the data base.

  15. CHP REGIONAL APPLICATION CENTERS: ACTIVITIES AND SELECTED RESULTS

    SciTech Connect (OSTI)

    Schweitzer, Martin

    2010-08-01

    Between 2001 and 2005, the U.S. Department of Energy (DOE) created a set of eight Regional Application Centers (RACs) to facilitate the development and deployment of Combined Heat and Power (CHP) technologies. By utilizing the thermal energy that is normally wasted when electricity is produced at central generating stations, Combined Heat and Power installations can save substantial amounts of energy compared to more traditional technologies. In addition, the location of CHP facilities at or near the point of consumption greatly reduces or eliminates electric transmission and distribution losses. The regional nature of the RACs allows each one to design and provide services that are most relevant to the specific economic and market conditions in its particular geographic area. Between them, the eight RACs provide services to all 50 states and the District of Columbia. Through the end of the federal 2009 fiscal year (FY 2009), the primary focus of the RACs was on providing CHP-related information to targeted markets, encouraging the creation and adoption of public policies and incentives favorable to CHP, and providing CHP users and prospective users with technical assistance and support on specific projects. Beginning with the 2010 fiscal year, the focus of the regional centers broadened to include district energy and waste heat recovery and these entities became formally known as Clean Energy Application Centers, as required by the Energy Independence and Security Act (EISA) of 2007. In 2007, ORNL led a cooperative effort to establish metrics to quantify the RACs accomplishments. That effort began with the development of a detailed logic model describing RAC operations and outcomes, which provided a basis for identifying important activities and accomplishments to track. A data collection spreadsheet soliciting information on those activities for FY 2008 and all previous years of RAC operations was developed and sent to the RACs in the summer of 2008. This represents the first systematic attempt at RAC program measurement in a manner consistent with approaches used for other efforts funded by DOE's Industrial Technologies Program (ITP). In addition, data on CHP installations and associated effects were collected for the same years from a state-by-state database maintained for DOE by ICF international. A report documenting the findings of that study was produced in September, 2009. The purpose of the current report is to present the findings from a new study of RAC activities and accomplishments which examined what the Centers did in FY 2009, the last year in which they concentrated exclusively on CHP technologies. This study focused on identifying and describing RAC activities and was not designed to measure how those efforts influenced CHP installations or other outcomes.

  16. Contact Information | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Information Contact Information

  17. Rate Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    links Financial Information Financial Public Processes Asset Management Cost Verification Process Rate Cases Rate Information Current Power Rates Current Transmission Rates...

  18. Ordering Information

    Gasoline and Diesel Fuel Update (EIA)

    coal industry Natural gas trade (Table 4.3) Ordering Information This publication and other Energy Information Administration (EIA) publications may be purchased from the...

  19. Applicant Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Applicant Information General Information for Applicants Bringing together top, space science students with internationally recognized researchers at Los Alamos in an educational...

  20. Hotel Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Rockville Pike, Rockville, Maryland, 20852. The hotel is about 27 miles from Dulles Airport. Hotel Information Home Page Maps and Transportation Area Information Sleeping Room...

  1. Fire Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Resources Emergency Communication Fire Information Fire Information Focusing on fire prevention and protection. Contact Fire Management Officer Manuel J. L'Esperance...

  2. Regional partnerships lead US carbon sequestration efforts

    SciTech Connect (OSTI)

    NONE

    2007-07-01

    During the sixth annual conference on carbon capture and sequestration, 7-10 May 2007, a snapshot was given of progress on characterization efforts and field validation tests being carried out through the Carbon Sequestration Regional Partnership Initiative. The initiative is built on the recognition that geographical differences in fossil fuel/energy use and CO{sub 2} storage sinks across North America will dictate approaches to carbon sequestration. The first characterization phase (2003-2005) identified regional opportunities and developed frameworks to validate and deploy technologies. The validation phase (2005-2009) includes 10 enhanced oil recovery/enhanced gas recovery field tests in progress in Alberta and six US states and is applying lessons learned from these operations to sequestration in unmineable coal seams. Storage in saline formations are the focus of 10 field tests, and terrestrial sequestration will be studied in 11 other projects. 1 tab., 3 photos.

  3. Environmental remediation and waste management information systems

    SciTech Connect (OSTI)

    Harrington, M.W.; Harlan, C.P.

    1993-12-31

    The purpose of this paper is to document a few of the many environmental information systems that currently exist worldwide. The paper is not meant to be a comprehensive list; merely a discussion of a few of the more technical environmental database systems that are available. Regulatory databases such as US Environmental Protection Agency`s (EPA`s) RODS (Records of Decision System) database [EPA, 1993] and cost databases such as EPA`s CORA (Cost of Remedial Action) database [EPA, 1993] are not included in this paper. Section 2 describes several US Department of Energy (DOE) Environmental Restoration and Waste Management (EM) information systems and databases. Section 3 discusses several US EPA information systems on waste sites and technologies. Section 4 summarizes a few of the European Community environmental information systems, networks, and clearinghouses. And finally, Section 5 provides a brief overview of Geographical Information Systems. Section 6 contains the references, and the Appendices contain supporting information.

  4. File:EIA-shaleusa5.pdf | Open Energy Information

    Open Energy Info (EERE)

    Play, Appalachian Basin Sources Energy Information Administration Related Technologies Natural Gas Creation Date 2010-03-17 Extent Regional Countries United States UN Region...

  5. File:EIA-shaleusa4.pdf | Open Energy Information

    Open Energy Info (EERE)

    Salt Basin Sources Energy Information Administration Related Technologies Natural Gas Creation Date 2010-11-09 Extent Regional Countries United States UN Region...

  6. File:EIA-shaleusa8.pdf | Open Energy Information

    Open Energy Info (EERE)

    Oklahoma and Texas Sources Energy Information Administration Related Technologies Natural Gas Creation Date 2010-03-30 Extent Regional Countries United States UN Region...

  7. File:EIA-shaleusa6.pdf | Open Energy Information

    Open Energy Info (EERE)

    Arkoma Basin, Oklahoma Sources Energy Information Administration Related Technologies Natural Gas Creation Date 2010-03-30 Extent Regional Countries United States UN Region...

  8. File:EIA-shaleusa9.pdf | Open Energy Information

    Open Energy Info (EERE)

    Gulf Basin, South Texas Sources Energy Information Administration Related Technologies Natural Gas Creation Date 2010-10-06 Extent Regional Countries United States UN Region...

  9. File:EIA-shaleusa7.pdf | Open Energy Information

    Open Energy Info (EERE)

    Oklahoma and Texas Sources Energy Information Administration Related Technologies Natural Gas Creation Date 2010-03-30 Extent Regional Countries United States UN Region...

  10. File:EIA-shaleusa10.pdf | Open Energy Information

    Open Energy Info (EERE)

    Texas and Oklahoma Sources Energy Information Administration Related Technologies Natural Gas Creation Date 2010-11-09 Extent Regional Countries United States UN Region...

  11. Regional Education Partners

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Regional Education Partners Regional Education Partners One of the Laboratory's STEM education objectives is centered on strengthening the future workforce of Northern New Mexico...

  12. General Information

    National Nuclear Security Administration (NNSA)

    Site Waste Profile Sheet - Revision 0 - February 27, 2012 (Log No. 2012-048) A. Generator Information 1. Company name: ...

  13. USE OF THE AERIAL MEASUREMENT SYSTEM HELICOPTER EMERGENCY RESPONSE ACQUISITION SYSTEMS WITH GEOGRAPHIC INFORMATION SYSTEM FOR RADIOACTIVE SOIL REMEDIATION - [11504

    SciTech Connect (OSTI)

    BROCK CT

    2011-02-15

    The Aerial Measurement System (AMS) Helicopter Emergency Response Acquisition System provides a thorough and economical means to identify and characterize the contaminants for large area radiological surveys. The helicopter system can provide a 100-percent survey of an area that qualifies as a scoping survey under the Multi-Agency Radiation Survey and Site Investigation Manual (MARSSIM) methodology. If the sensitivity is adequate when compared to the clean up values, it may also be used for the characterization survey. The data from the helicopter survey can be displayed and manipulated to provide invaluable data during remediation activities.

  14. NBP RFI: Communications Requirements- Comments of Lake Region Electric

    Energy Savers [EERE]

    Cooperative- Minnesota | Department of Energy Lake Region Electric Cooperative- Minnesota NBP RFI: Communications Requirements- Comments of Lake Region Electric Cooperative- Minnesota Comments of Lake Region Electric Cooperative- Minnesota on Implementing the National Broadband Plan by Studying the Communications Requirements of Electric Utilities to Inform Federal Smart Grid Policy PDF icon NBP RFI: Communications Requirements- Comments of Lake Region Electric Cooperative- Minnesota More

  15. Darajat Geothermal Power Plant | Open Energy Information

    Open Energy Info (EERE)

    n":"","group":"","inlineLabel":"","visitedicon":"" Hide Map Geothermal Resource Area Java - Darajat Geothermal Area Geothermal Region Sunda Volcanic Arc Plant Information Owner...

  16. Cibuni Geothermal Power Plant | Open Energy Information

    Open Energy Info (EERE)

    Hide Map Geothermal Resource Area Pengalengan Geothermal Area Geothermal Region West Java Plant Information Owner PLN Commercial Online Date 2014 Power Plant Data Type of Plant...

  17. Takigami Geothermal Power Plant | Open Energy Information

    Open Energy Info (EERE)

    Hide Map Geothermal Resource Area Oita Geothermal Area Geothermal Region Ryuku Arc Plant Information Facility Type Single Flash Owner Idemitsu Oita Geothermal CoKyushu...

  18. Bacman 1 GEPP | Open Energy Information

    Open Energy Info (EERE)

    "","group":"","inlineLabel":"","visitedicon":"" Hide Map Geothermal Resource Area Bac-Man Laguna Geothermal Area Geothermal Region Philippine Island Arc Plant Information...

  19. Bacman 2 GEPP | Open Energy Information

    Open Energy Info (EERE)

    "","group":"","inlineLabel":"","visitedicon":"" Hide Map Geothermal Resource Area Bac-Man Laguna Geothermal Area Geothermal Region Philippine Island Arc Plant Information...

  20. Ormesa I Geothermal Facility | Open Energy Information

    Open Energy Info (EERE)

    Hide Map Geothermal Resource Area East Mesa Geothermal Area Geothermal Region Gulf of California Rift Zone Plant Information Facility Type Binary Owner Ormat Number of...

  1. Palinpinon 2 GEPP | Open Energy Information

    Open Energy Info (EERE)

    Region Philippine Island Arc Plant Information Facility Type Single Flash Owner Energy Development Corporation Number of Units 4 1 Commercial Online Date 1993 Power...

  2. Mahanagdong A GEPP | Open Energy Information

    Open Energy Info (EERE)

    Region Philippine Island Arc Plant Information Facility Type Single Flash Owner Energy Development Corporation Number of Units 2 1 Commercial Online Date 1997 Power...

  3. Ngawha Geothermal Power Station | Open Energy Information

    Open Energy Info (EERE)

    Geothermal Region Plant Information Facility Type Binary Cycle Power Plant Owner Top Energy Number of Units 3 1 Commercial Online Date 1998 Power Plant Data Type of Plant...

  4. Palinpinon 1 GEPP | Open Energy Information

    Open Energy Info (EERE)

    Region Philippine Island Arc Plant Information Facility Type Single Flash Owner Energy Development Corporation Number of Units 3 1 Commercial Online Date 1983 Power...

  5. Surface Water Sampling | Open Energy Information

    Open Energy Info (EERE)

    Surface Water Sampling Details Activities (3) Areas (2) Regions (0) NEPA(0) Exploration Technique Information Exploration Group: Field Techniques Exploration Sub Group: Field...

  6. Background information on RSO Test Deeming Guidance

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    information on RSO Test Deeming Guidance BPA has now had over two years of experience implementing Slice under the Regional Dialogue contract. Slice product customers are required...

  7. Energy Department Announces New Regional Approach to Wind Energy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Regional Resource Centers. The new WINDExchange initiative and website will serve as a digital portal providing fact-based informational resources about the costs and benefits...

  8. ,"Midwest Region Natural Gas Underground Storage Volume (MMcf...

    U.S. Energy Information Administration (EIA) Indexed Site

    Region Natural Gas Underground Storage Volume (MMcf)" ,"Click worksheet name or tab at ...dnavnghistn5030852m.htm" ,"Source:","Energy Information Administration" ,"For Help, ...

  9. ,"Pacific Region Natural Gas Underground Storage Volume (MMcf...

    U.S. Energy Information Administration (EIA) Indexed Site

    Pacific Region Natural Gas Underground Storage Volume (MMcf)" ,"Click worksheet name or ...dnavnghistn5030912m.htm" ,"Source:","Energy Information Administration" ,"For Help, ...

  10. ,"Mountain Region Natural Gas Underground Storage Volume (MMcf...

    U.S. Energy Information Administration (EIA) Indexed Site

    Mountain Region Natural Gas Underground Storage Volume (MMcf)" ,"Click worksheet name or ...dnavnghistn5030862m.htm" ,"Source:","Energy Information Administration" ,"For Help, ...

  11. May 29 Tribal Renewable Energy Webinar to Highlight Regional...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    present the next Tribal Renewable Energy Series webinar, "Regional Transmission ... Helpful background information on the electricity grid can be found by viewing the free ...

  12. Oregon Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Oregon Regions National Science Bowl (NSB) NSB Home About High School High School ... WDTS Home Contact Information National Science Bowl U.S. Department of Energy SC-27 ...

  13. California Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    California Regions National Science Bowl (NSB) NSB Home About High School Middle School ... WDTS Home Contact Information National Science Bowl U.S. Department of Energy SC-27 ...

  14. Idaho Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Idaho Regions National Science Bowl (NSB) NSB Home About High School High School ... WDTS Home Contact Information National Science Bowl U.S. Department of Energy SC-27 ...

  15. California Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    California Regions National Science Bowl (NSB) NSB Home About High School High School ... WDTS Home Contact Information National Science Bowl U.S. Department of Energy SC-27 ...

  16. Pennsylvania Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Pennsylvania Regions National Science Bowl (NSB) NSB Home About High School Middle ... WDTS Home Contact Information National Science Bowl U.S. Department of Energy SC-27 ...

  17. Idaho Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Idaho Regions National Science Bowl (NSB) NSB Home About High School Middle School ... WDTS Home Contact Information National Science Bowl U.S. Department of Energy SC-27 ...

  18. Washington Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Regions National Science Bowl (NSB) NSB Home About High School Middle School Middle ... WDTS Home Contact Information National Science Bowl U.S. Department of Energy SC-27 ...

  19. Pennsylvania Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Pennsylvania Regions National Science Bowl (NSB) NSB Home About High School High School ... WDTS Home Contact Information National Science Bowl U.S. Department of Energy SC-27 ...

  20. Florida Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Florida Regions National Science Bowl (NSB) NSB Home About High School High School ... WDTS Home Contact Information National Science Bowl U.S. Department of Energy SC-27 ...

  1. Nebraska Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Nebraska Regions National Science Bowl (NSB) NSB Home About High School High School ... WDTS Home Contact Information National Science Bowl U.S. Department of Energy SC-27 ...

  2. Illinois Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Illinois Regions National Science Bowl (NSB) NSB Home About High School High School ... WDTS Home Contact Information National Science Bowl U.S. Department of Energy SC-27 ...

  3. Illinois Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Illinois Regions National Science Bowl (NSB) NSB Home About High School Middle School ... WDTS Home Contact Information National Science Bowl U.S. Department of Energy SC-27 ...

  4. Appendix C: Map of NEMS Electricity Market Module Regions

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    U.S. Energy Information Administration | Analysis of Impacts of a Clean Energy Standard as requested by Chairman Bingaman Appendix C: Map of NEMS Electricity Market Module Regions...

  5. Water Energy Resources of the United States with Emphasis on Low Head/Low Power Resources: Appendix A - Assessment Results by Hydrologic Region

    SciTech Connect (OSTI)

    Hall, Douglas

    2004-04-01

    Analytical assessments of the water energy resources in the 20 hydrologic regions of the United States were performed using state-of-the-art digital elevation models and geographic information system tools. The principal focus of the study was on low head (less than 30 ft)/low power (less than 1 MW) resources in each region. The assessments were made by estimating the power potential of all the stream segments in a region, which averaged 2 miles in length. These calculations were performed using hydrography and hydraulic heads that were obtained from the U.S. Geological Survey’s Elevation Derivatives for National Applications dataset and stream flow predictions from a regression equation or equations developed specifically for the region. Stream segments excluded from development and developed hydropower were accounted for to produce an estimate of total available power potential. The total available power potential was subdivided into high power (1 MW or more), high head (30 ft or more)/low power, and low head/low power total potentials. The low head/low power potential was further divided to obtain the fractions of this potential corresponding to the operating envelopes of three classes of hydropower technologies: conventional turbines, unconventional systems, and microhydro (less than 100 kW). Summing information for all the regions provided total power potential in various power classes for the entire United States. Distribution maps show the location and concentrations of the various classes of low power potential. No aspect of the feasibility of developing these potential resources was evaluated. Results for each of the 20 hydrologic regions are presented in Appendix A

  6. South Carolina Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    school's state, county, city, or district. For more information, please visit the High School Coach page. South Carolina Region High School Regional South Carolina Savannah River

  7. Arkansas Regional Middle School Science Bowl | U.S. DOE Office...

    Office of Science (SC) Website

    Competition Location Math and Science Building University of Arkansas - Fort Smith 5120 Grand Avenue Fort Smith, Arkansas 72913 Regional Contact Information Regional Coordinator: ...

  8. Rhode Island Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    for your school's state, county, city, or district. For more information, please visit the High School Coach page. Rhode Island Region High School Regional Rhode Island Northeast...

  9. Washington DC Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    for your school's state, county, city, or district. For more information, please visit the Middle School Coach page. Washington, DC Region Middle School Regional Washington, DC DC...

  10. Washington DC Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    school's state, county, city, or district. For more information, please visit the High School Coach page. Washington, DC Region High School Regional Washington, DC Washington, DC...

  11. New Hampshire Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    for your school's state, county, city, or district. For more information, please visit the High School Coach page. New Hampshire Region High School Regional New Hampshire Northeast...

  12. Puerto Rico Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. Puerto Rico Region Middle School Regional Puerto Rico Puerto Rico Middle School...

  13. South Carolina Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. South Carolina Region Middle School Regional South Carolina Carolina Middle...

  14. North Carolina Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    state, county, city, or district. For more information, please visit the Middle School Coach page. North Carolina Region Middle School Regional North Carolina Carolina Middle...

  15. South Daktoa Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    your school's state, county, city, or district. For more information, please visit the High School Coach page. South Daktoa Region High School Regional South Daktoa South Dakota...

  16. Puerto Rico Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    for your school's state, county, city, or district. For more information, please visit the High School Coach page. Puerto Rico Region High School Regional Puerto Rico Puerto Rico...

  17. New Jersey Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    for your school's state, county, city, or district. For more information, please visit the High School Coach page. New Jersey Region High School Regional New Jersey New Jersey...

  18. North Dakota Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    for your school's state, county, city, or district. For more information, please visit the High School Coach page. New Dakota Region High School Regional North Dakota North Dakota...

  19. North Carolina Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    school's state, county, city, or district. For more information, please visit the High School Coach page. New carolina Region High School Regional North Carolina North Carolina...

  20. Hotel Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Logistics Hotel Information Location The workshop was held at the Hilton Washington DC/Rockville Executive Meeting Center. Address is 1750 Rockville Pike, Rockville, Maryland, 20852. The hotel is about 27 miles from Dulles Airport. Hotel Information Home Page Maps and Transportation Area Information Sleeping Room Block A block of rooms at the federal per diem rate of $226++ per night (single or double) has been reserved for the nights of September 10 & 11, 2012. As a courtesy, this rate will

  1. Hotel Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Logistics Hotel Information Location The review was held at the Hilton Washington DC/Rockville Executive Meeting Center. Address is 1750 Rockville Pike, Rockville, Maryland, 20852. Hotel Information Home Page Maps and Transportation Area Information Sleeping Room Block A block of rooms at $183 + 15% tax per night (single or double) has been reserved for the nights of November 26 & 27, 2012. Making Your Reservation To reserve your room, please call 1-800-HILTONS (445-8667) and refer to the

  2. Local Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Local Information Local Information Bringing together top space science students with internationally recognized researchers at Los Alamos in an educational and collaborative atmosphere. Contacts Director Misa Cowee Email Administrative Assistant Mary Wubbena Email Request more information Email Housing, transportation Every year several hundred students come to Los Alamos to work and live here. Housing can get quite scarce, and options will be more expensive and less attractive than you expect

  3. Technical information

    Gasoline and Diesel Fuel Update (EIA)

    Home> Commercial Buildings Home> Technical Information > Estimation of Standard Errors Estimation of Standard Errors Sampling error is the difference between the survey estimate...

  4. Information Science

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Information Science and Technology (ASIS&T) American Society for Indexing (ASI) Digital Library Federation (DLF) National Archives and Records Administration (NARA) Special...

  5. Information Repository

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Information Repository Index Permit Renewal Application (Parts A and B) Submissions, September 2009, Department of Energy CBFOWashington TRU Solutions Administrative Completeness...

  6. Hotel Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the Hilton Washington DCRockville Executive Meeting Center. Address is 1750 Rockville Pike, Rockville, Maryland, 20852. Hotel Information Home Page Maps and Transportation Area...

  7. Improving image segmentation by learning region affinities

    SciTech Connect (OSTI)

    Prasad, Lakshman; Yang, Xingwei; Latecki, Longin J

    2010-11-03

    We utilize the context information of other regions in hierarchical image segmentation to learn new regions affinities. It is well known that a single choice of quantization of an image space is highly unlikely to be a common optimal quantization level for all categories. Each level of quantization has its own benefits. Therefore, we utilize the hierarchical information among different quantizations as well as spatial proximity of their regions. The proposed affinity learning takes into account higher order relations among image regions, both local and long range relations, making it robust to instabilities and errors of the original, pairwise region affinities. Once the learnt affinities are obtained, we use a standard image segmentation algorithm to get the final segmentation. Moreover, the learnt affinities can be naturally unutilized in interactive segmentation. Experimental results on Berkeley Segmentation Dataset and MSRC Object Recognition Dataset are comparable and in some aspects better than the state-of-art methods.

  8. User Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    User Information User Information Print ALSHub User Portal User Guide A step-by-step guide for users about how to apply and prepare for beam time at the ALS. Experiment Safety Upon receiving beam time, complete an Experiment Safety Sheet Prospective Users Users from Industry Contacts for Users User Policy Data Management Users' Executive Committee (UEC) User Meeting

  9. Dynamic Information Architecture System

    Energy Science and Technology Software Center (OSTI)

    1997-02-12

    The Dynamic Information System (DIAS) is a flexible object-based software framework for concurrent, multidiscplinary modeling of arbitrary (but related) processes. These processes are modeled as interrelated actions caused by and affecting the collection of diverse real-world objects represented in a simulation. The DIAS architecture allows independent process models to work together harmoniously in the same frame of reference and provides a wide range of data ingestion and output capabilities, including Geographic Information System (GIS) typemore » map-based displays and photorealistic visualization of simulations in progress. In the DIAS implementation of the object-based approach, software objects carry within them not only the data which describe their static characteristics, but also the methods, or functions, which describe their dynamic behaviors. There are two categories of objects: (1) Entity objects which have real-world counterparts and are the actors in a simulation, and (2) Software infrastructure objects which make it possible to carry out the simulations. The Entity objects contain lists of Aspect objects, each of which addresses a single aspect of the Entity''s behavior. For example, a DIAS Stream Entity representing a section of a river can have many aspects correspondimg to its behavior in terms of hydrology (as a drainage system component), navigation (as a link in a waterborne transportation system), meteorology (in terms of moisture, heat, and momentum exchange with the atmospheric boundary layer), and visualization (for photorealistic visualization or map type displays), etc. This makes it possible for each real-world object to exhibit any or all of its unique behaviors within the context of a single simulation.« less

  10. NASEO Midwest Regional Meeting

    Broader source: Energy.gov [DOE]

    The National Association of State Energy Officials (NASEO) is hosting its Midwest Regional Meeting in Des Moines, Iowa.

  11. Regional Education Partners

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Regional Education Partners Regional Education Partners One of the Laboratory's STEM education objectives is centered on strengthening the future workforce of Northern New Mexico and LANL through effective partnerships with regional secondary and higher education organizations, businesses and industry. Contact Executive Office Director Kathy Keith Community Relations & Partnerships (505) 665-4400 Email Regional Partners Charlie McMillan talking with Rick Ulibarri and Dr. Fries, President of

  12. Visitor Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Information Visitor Information The Museum is open to the public every day except Thanksgiving, Christmas, and New Year's. Contact Us thumbnail of Bradbury Science Museum 505 667-4444 Email Museum Hours Open every day except Thanksgiving, Christmas, and New Year's. Tuesday-Saturday: 10 am-5 pm Sunday & Monday: 1-5 pm FREE ADMISSION Download our brochure for more information (pdf) Weather conditions Call ahead during snow storms: (505) 667-6622 or (877) 723-4101. We follow Los Alamos National

  13. Regional assessment of aquifers for thermal-energy storage. Volume 2. Regions 7 through 12

    SciTech Connect (OSTI)

    Not Available

    1981-06-01

    This volume contains information on the geologic and hydrologic framework, major aquifers, aquifers which are suitable and unsuitable for annual thermal energy storage (ATES) and the ATES potential of the following regions of the US: Unglaciated Central Region; Glaciated Appalachians, Unglaciated Appalachians; Coastal Plain; Hawaii; and Alaska. (LCL)

  14. Visitor Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Visitor Info Visitor Information NERSC is located in Shyh Wang Hall-also known as the computational research and theory (CRT) building (Bldg. 59)-on the campus of Lawrence Berkeley National Laboratory in Berkeley, California. You can find information about visiting the lab, including an interactive campus map, transportation and lodging suggestions at http://www.lbl.gov/visit/. Your host must arrange site access prior to your visit. Last edited: 2016-01-06 16:48:46

  15. Information Sciences

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 Information Sciences Uncovering actionable knowledge and generating insight into exascale datasets from heterogeneous sources in real time Leadership Group Leader Patrick M. Kelly Email Deputy Group Leader Amy Larson Email Contact Us Administrator Yvonne McKelvey Email Conceptual illustration of futuristic data stream processing. Developing methods and tools for understanding complex interactions and extracting actionable information from massive data streams. Basic and applied research

  16. Information Security

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2011-06-20

    The protection and control of classified information is critical to our nations security. This Order establishes requirements and responsibilities for Department of Energy (DOE) Departmental Elements, including the National Nuclear Security Administration (NNSA), to protect and control classified information as required by statutes, regulation, Executive Orders, government-wide policy directives and guidelines, and DOE policy and directives. Cancels DOE M 470.4-4A Chg except for Section D.

  17. Information Request

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 25, 2008 TO: Sue Tierney, Phil Niedzielski-Eichner, Skila Harris FROM: Chris Kouts SUBJECT: Information Request As requested, enclosed is the additional information you requested yesterday. 1. Testimony: * September 24, 2008 before the Senate Committee on Commerce, Science and Transportation, * July 15, 2008 before the House Committee on Energy and Commerce * October 4, 2007 before the House Committee on the Budget and Chairman Spratt 2. Proposed Legislation "Nuclear Fuel

  18. Project Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Project Information Slider award map The REE Program funds projects focused on developing economically feasible and environmentally benign technologies for recovering REEs from coal and/or coal by-products. Project Information The listed projects represent the current REE program portfolio. Agreement Number Project Title Performer Name FWP-RIC REE FY2016-2020 Rare Earth Elements (REE) from Coal and Coal By-Products National Energy Technology Laboratory FE0027167 High Yield and Economical

  19. Computing Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Information From here you can find information relating to: Obtaining the right computer accounts. Using NIC terminals. Using BooNE's Computing Resources, including: Choosing your desktop. Kerberos. AFS. Printing. Recommended applications for various common tasks. Running CPU- or IO-intensive programs (batch jobs) Commonly encountered problems Computing support within BooNE Bringing a computer to FNAL, or purchasing a new one. Laptops. The Computer Security Program Plan for MiniBooNE The

  20. Regional-Scale Climate Change: Observations and Model Simulations

    SciTech Connect (OSTI)

    Raymond S. Bradley; Henry F. Diaz

    2010-12-14

    This collaborative proposal addressed key issues in understanding the Earth??s climate system, as highlighted by the U.S. Climate Science Program. The research focused on documenting past climatic changes and on assessing future climatic changes based on suites of global and regional climate models. Geographically, our emphasis was on the mountainous regions of the world, with a particular focus on the Neotropics of Central America and the Hawaiian Islands. Mountain regions are zones where large variations in ecosystems occur due to the strong climate zonation forced by the topography. These areas are particularly susceptible to changes in critical ecological thresholds, and we conducted studies of changes in phonological indicators based on various climatic thresholds.

  1. State and Regional Energy Risk Assessment Initiative

    Broader source: Energy.gov [DOE]

    OE is leading a State and Regional Energy Risk Assessment Initiative to help States better understand risks to their energy infrastructure so they can be better prepared to make informed decisions about their investments, resilience and hardening strategies, and asset management. As part of this Initiative, OE has developed a series of State and Regional Energy Risk Profiles that examine the relative magnitude of the risks that each State's energy infrastructure routinely encounters in comparison with the probable impacts.

  2. Rio Grande Rift Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    less than 100 km2. The three major basins (from northernmost to southernmost) are the San Luis, Espanola, and Albuquerque basins. Further south, a network of smaller basins run...

  3. Southern Basin and Range Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    faults form the western edge of the Sierra Madre Occidental plateau in northeastern Sonora. These faults and associated half-grabens extend over a distance of more than 300 km...

  4. LAC Regional Platform Workshop Links | Open Energy Information

    Open Energy Info (EERE)

    Announcement Agenda Participant Package Accommodations Location & Transportation Insurance & Visas Participants Presentations Outcomes Report Links Contact Us One Page Event...

  5. Informational Webinar Series for State and Regional Initiatives

    Broader source: Energy.gov [DOE]

    Here you'll find student resources on competitions that promote awareness about energy technologies and issues.

  6. LAC Regional Platform Workshop Agenda | Open Energy Information

    Open Energy Info (EERE)

    world Home About Resources & Tools Expert Assistance News & Events Publications Join Contact LAC Workshop Announcement Agenda Participant Package Accommodations Location &...

  7. LAC Regional Platform Workshop Report | Open Energy Information

    Open Energy Info (EERE)

    world Home About Resources & Tools Expert Assistance News & Events Publications Join Contact LAC Workshop Announcement Agenda Participant Package Accommodations Location &...

  8. Category:Latin America Region | Open Energy Information

    Open Energy Info (EERE)

    Guatemala Guyana H Haiti Honduras J Jamaica M Martinique Mexico N Nicaragua P Panama Paraguay Peru S Saint Barthlemy Saint Kitts and Nevis Saint Lucia Saint Vincent and the...

  9. Cuyahoga Regional Landfill Biomass Facility | Open Energy Information

    Open Energy Info (EERE)

    3,600,000 W 3,600,000,000 mW 0.0036 GW Commercial Online Date 1999 Heat Rate (BTUkWh) 10374.2 References EPA Web Site1 Loading map... "minzoom":false,"mappingservice":"googlem...

  10. Lake Region Electric Coop, Inc | Open Energy Information

    Open Energy Info (EERE)

    Website: lrecok.coop Outage Hotline: 800-364-5732 Outage Map: ebill.lrecok.coopomsoutageMa References: EIA Form EIA-861 Final Data File for 2010 - File1a1 EIA Form...

  11. Regional Energy Deployment System (ReEDS) | Open Energy Information

    Open Energy Info (EERE)

    NREL Sector: Energy Topics: Pathways analysis, Resource assessment Resource Type: Softwaremodeling tools User Interface: Desktop Application Website: www.nrel.gov...

  12. U.S. EPA Region 9 | Open Energy Information

    Open Energy Info (EERE)

    Retrieved from "http:en.openei.orgwindex.php?titleU.S.EPARegion9&oldid767258" Categories: Organizations Policy Organizations Stubs Articles with outstanding TODO tasks...

  13. MENA-GTZ EERE Regional Center | Open Energy Information

    Open Energy Info (EERE)

    Center AgencyCompany Organization GTZ Partner Ministry of electricity and energy of Egypt, New and Renewable Energy Authority (NREA) Sector Energy Focus Area Energy Efficiency,...

  14. Property:TransportToolkit/Regions | Open Energy Information

    Open Energy Info (EERE)

    America + B Bike-Sharing:History, Impacts, Models of Provision, and Future + Global + Biodiesel Handling and Use Guide + Global +, Australia & North America + Bus Rapid Transit...

  15. NREL/OAS-Regional EERE Training Workshop | Open Energy Information

    Open Energy Info (EERE)

    Organization of American States (OAS) Sector: Energy Focus Area: Non-renewable Energy, Buildings, Buildings - Commercial, Renewable Energy Resource Type: Presentation,...

  16. Database for Regional Geology, Phase 1- A Tool for informing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    and 3) rock properties and in-situ conditions for shale estimated from sonic velocity measurements, and 4) other aspects important to potential future site evaluation exercises. ...

  17. Northern Basin and Range Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    Hot Springs Geothermal Area Raft River Geothermal Area Railroad Valley Geothermal Area Red River Hot Springs Geothermal Area Roosevelt Hot Springs Geothermal Area Sharkey Hot...

  18. Snake River Plain Geothermal Region | Open Energy Information

    Open Energy Info (EERE)

    rhyolite ignimbrite eruptions, with single eruptions producing up to 2500 cubic km of ash. Island Park Caldera, measuring 18 miles (29 km) by 23 miles (37 km), may be the...

  19. File:LongValley Regional.pdf | Open Energy Information

    Open Energy Info (EERE)

    geothermics.2011.03.001 Date and time of digitizing 21:56, 2 March 2014 Software used Elsevier File change date and time 08:00, 2 March 2014 Date metadata was last modified 08:00,...

  20. Regional Energy Deployment System (ReEDS) | Open Energy Information

    Open Energy Info (EERE)

    as well as electricity storage. The principal issues addressed include access to and cost of transmission, access to and quality of renewable resources, the variability of...

  1. Southern Nevada Regional Planning Coalition | Open Energy Information

    Open Energy Info (EERE)

    guided by a ten member Board, is to focus and capitalize on strategies that create a sustainable and balanced environment where economic and fiscal vibrancy, social equity,...

  2. Regional Economic Development

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Regional Economic Development Regional Economic Development Supporting companies in every stage of development through access to technology, technical assistance or investment Questions Richard P. Feynman Center for Innovation Regional Programs (505) 665-9090 New Mexico Small Business Assistance Email Venture Acceleration Fund Email DisrupTECH Email SBIR/STTR Email FCI facilitates commercialization in New Mexico to accelerate and enhance our efforts to convert federal and state research

  3. Western Regional Partnership Overview

    Energy Savers [EERE]

    Regional Partnership Overview June 2013 Briefing Overview  WRP Background  Importance of Region  WRP Tribal Relations Committee  WRP Energy Committee WRP Region's Uniqueness  5 states stretching from the Great Plains to the Pacific Ocean  Diverse terrain ranging from desert valleys to forested mountains  Significant State Trust Landholdings  Approximately 188 Federally recognized Tribes  Significant amounts of Federally managed land  According to GSA 2004 study, WRP

  4. Coal-Producing Region

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    . Coal Production by State (thousand short tons) Year to Date Coal-Producing Region and State October - December 2015 July - September 2015 October - December 2014 2015 2014 ...

  5. CEMI Western Regional Summit

    Broader source: Energy.gov [DOE]

    Please Join Assistant Secretary of Energy Dr. David Danielson for the Clean Energy Manufacturing Initiative's Western Regional Summit. Register now for this free event.

  6. ERHIC INTERACTION REGION DESIGN.

    SciTech Connect (OSTI)

    MONTAG,C.PARKER,B.PTITSYN,V.TEPIKIAN,S.WANG,D.WANG,F.

    2003-10-13

    This paper presents the current interaction region design status of the ring-ring version of the electron-ion collider eRHIC (release 2.0).

  7. Hotel Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Hotel Information Hotel Information Los Alamos National Laboratory is situated on a mesatop on the eastern side of the Jemez Mountains, an impressive series of ancient volcanoes with extensive views of the Sangre de Cristo Mountains in the east, where sunsets turn the western slopes a vibrant red. We hope you enjoy your stay in the Land of Enchantment. Contacts Mike Rogers (505) 665-2513 Email Chandra Savage Marsden (505) 664-0183 Email Lodging A block of rooms has been reserved under the name

  8. Information Security

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2011-06-20

    The protection and control of classified information is critical to our nations security. This Order establishes requirements and responsibilities for Department of Energy (DOE) Departmental Elements, including the National Nuclear Security Administration (NNSA), to protect and control classified information as required by statutes, regulation, Executive Orders, government-wide policy directives and guidelines, and DOE policy and directives. Cancels DOE M 470.4-4A Chg except for Section D. Admin Chg 1, dated 11-23-2012, cancels DOE O 471.6. Canceled by Admin Chg 2 dated 5-15-15.

  9. Assistance Focus: Asia/Pacific Region (Brochure)

    SciTech Connect (OSTI)

    Not Available

    2015-01-01

    The Clean Energy Solutions Center Ask an Expert service connects governments seeking policy information and advice with one of more than 30 global policy experts who can provide reliable and unbiased quick-response advice and information. The service is available at no cost to government agency representatives from any country and the technical institutes assisting them. This publication presents summaries of assistance provided to governments in the Asia/Pacific region, including the benefits of that assistance.

  10. The NO{sub x} Budget trading program: a collaborative, innovative approach to solving a regional air pollution problem

    SciTech Connect (OSTI)

    Napolitano, Sam; Stevens, Gabrielle; Schreifels, Jeremy; Culligan, Kevin

    2007-11-15

    The NO{sub x} Budget Trading Program showed that regional cap-and-trade programs are adaptable to more than one pollutant, time period, and geographic scale, and can achieve compliance results similar to the Acid Rain Program. Here are 11 specific lessons that have emerged from the experience. (author)

  11. Regional Analysis Briefs

    Reports and Publications (EIA)

    2028-01-01

    Regional Analysis Briefs (RABs) provide an overview of specific regions that play an important role in world energy markets, either directly or indirectly. These briefs cover areas that are currently major producers (Caspian Sea), have geopolitical importance (South China Sea), or may have future potential as producers or transit areas (East Africa, Eastern Mediterranean).

  12. WIPP Stakeholder Information Page

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    WIPP Stakeholder Information Index 2016 WIPP Stakeholder Information Documents 2015 WIPP Stakeholder Information Documents 2014 WIPP Stakeholder Information Documents 2013 WIPP Stakeholder Information Documents 2012 WIPP Stakeholder Information Documents 2011 WIPP Stakeholder Information Documents 2010 WIPP Stakeholder Information Documents 2009 WIPP Stakeholder Information Documents 2008 WIPP Stakeholder Information Documents 2007 WIPP Stakeholder Information Documents 2006 WIPP Stakeholder

  13. Information Security

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2011-06-29

    This Order establishes requirements and responsibilities for Department of Energy (DOE) Departmental Elements, including the National Nuclear Security Administration (NNSA), to protect and control classified information as required by statutes, regulation, Executive Orders, government-wide policy directives and guidelines, and DOE policy and directives. (The original DOE O 471.6 canceled DOE M 470.4-4A, except for Section D). Admin Chg 2, dated 5-15-15, supersedes Admin Chg 1. Certified 5-21-2015.

  14. Visitor Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Visitor Information Visiting the Transportation Research and Analysis Computing Center For guests who wish to visit and meet with the technical staff, please contact the TRACC service desk or the Technical Point of Contact assigned to you for registration, scheduling, and confirmation, including Foreign Visits and Assignments. Registration with your host is required for entry into the TRACC facilities. A photo I.D., such as a driver's license or passport, is also required for facility access. If

  15. Information Repository

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 Information Repository Documents WIPP Annual Waste Minimization Report Transmittal of the Waste Isolation Pilot Plant Annual Waste Minimization Report, dated November 19, 2012 Class 1 Permit Modifications and NMED Responses Administrative Completeness and Final Determination, Class 1 Permit Modification Request, Contingency Plan Update, JE Kieling NMED dated December 17, 2012 Class 1 Permit Modification Request, Contingency Plan Update, Jose R. Franco, CBFO and M. F. Sharif, NWP, dated

  16. Information Repository

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    3 Information Repository Documents WIPP Annual Waste Minimization Report Transmittal of the Waste Isolation Pilot Plant Annual Waste Minimization Report, dated November 14, 2013 Class 1 Permit Modifications and NMED Responses Class 1 Modification, August 29, 2013 WIPP Hazardous Waste Facility Permit EPA I.D. Number NM4890139088. (1. revise a course outline; 2. revise table and panel figures to include Panel 7; 3. update description related to Type B Packages; and 4. update TRUPACT-II and

  17. User information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    User Information: Project Proposal Form Beamtime Request Form Emergency procedure policy Experimental Hall Policy Publications Lodging New Users First, please fill out the Project Proposal Form and submit to Craig Stevens. Next a beamtime request form should be completed and submitted to Lisa Bovenkamp along with any questions or requests for special accommodations. Before your first visit to CAMD, everyone must take and pass the CAMD Radiation Safety Test which may be taken online prior to your

  18. Regional Workforce Study - SRSCRO

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Regional Workforce Study Regional employers will need to fill more than 30,000 job openings over the next five years in the five-county region of South Carolina and Georgia represented by the SRS Community Reuse Organization (SRSCRO). That is a key finding of a new study released on April 22, 2015. TIP Strategies, an Austin, Texas-based economic consulting firm, performed the study for the SRSCRO by examining workforce trends in the five counties the SRSCRO represents - Aiken, Allendale and

  19. Regional Science Bowl

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    January » Regional Science Bowl Regional Science Bowl WHEN: Jan 23, 2016 8:00 AM - 5:00 PM WHERE: Highland High School 4700 Coal SE, Albuquerque, NM CONTACT: Janelle Vigil-Maestas (505) 665-4329 CATEGORY: Community INTERNAL: Calendar Login Event Description Five teams from Northern New Mexico area schools are among 16 participating in the middle school Regional Science Bowl competition. Northern area teams participating are from Los Alamos, Española, Cuba and Santa Fe. The winning team at this

  20. Database for Regional Geology, Phase 1- A Tool for informing Regional

    Energy Savers [EERE]

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  1. Information storage medium and method of recording and retrieving information thereon

    DOE Patents [OSTI]

    Marchant, D. D.; Begej, Stefan

    1986-01-01

    Information storage medium comprising a semiconductor doped with first and second impurities or dopants. Preferably, one of the impurities is introduced by ion implantation. Conductive electrodes are photolithographically formed on the surface of the medium. Information is recorded on the medium by selectively applying a focused laser beam to discrete regions of the medium surface so as to anneal discrete regions of the medium containing lattice defects introduced by the ion-implanted impurity. Information is retrieved from the storage medium by applying a focused laser beam to annealed and non-annealed regions so as to produce a photovoltaic signal at each region.

  2. State action in regional transmission groups

    SciTech Connect (OSTI)

    Rokach, J.Z.

    1994-12-01

    States should participate in coordinated transmission planning through regional transmission groups, while reserving their right to pass upon transmission planning. This would smooth an otherwise difficult transition, as FERC and state regulators seek to facilitate a competitive bulk power market that ignores arbitrary jurisdiction lines. Since the Federal Energy Regulatory Commission issued its Policy Statement on Regional Transmission Groups, two RTG`s, the Western Regional Transmission Association and the Southwest Regional Transmission Association, have gained conditional approval from FERC. A third, the Northwest Regional Transmission Association, files its governing agreement with the Commission, seeking FERC`s approval. Price setting within RTGs and information exchanges involved in planning the grid raise questions of the legality of these collective actions under the antitrust laws. All three agreements allow for exchanges of commercial and planning information, but, conspicuously, do not set transmission prices. For the moment, therefore, antitrust liability for RTGs would arise out of the information exchanges involved in planning the grid. In addition, with FERC pushing for `restructuring` at the wholesale level through open access and the states becoming aggressive in trying to institute competition at the consumer level through retail wheeling, issues of federal-state jurisdiction in transmission have come to the fore.

  3. Delineating coal market regions

    SciTech Connect (OSTI)

    Solomon, B.D.; Pyrdol, J.J.

    1986-04-01

    This study addresses the delineation of US coal market regions and their evolution since the 1973 Arab oil embargo. Dichotomizing into compliance (low sulfur) and high sulfur coal deliveries, market regions are generated for 1973, 1977, and 1983. Focus is restricted to steam coal shipments to electric utilities, which currently account for over 80% of the total domestic market. A two-stage method is used. First, cluster analyses are performed on the origin-destination shipments data to generate baseline regions. This is followed by multiple regression analyses on CIF delivered price data for 1983. Sensitivity analysis on the configuration of the regions is also conducted, and some thoughts on the behavior of coal markets conclude the paper. 37 references, 6 figures, 2 tables.

  4. Regional Carbon Sequestration Partnerships

    Broader source: Energy.gov [DOE]

    DOE has created a network of seven Regional Carbon Sequestration Partnerships (RCSPs) to help develop the technology, infrastructure, and regulations to implement large-scale CO2 storage (also...

  5. Regional companies eye growth

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Regional companies eye growth Regional companies eye growth Adaptive Radio Technologies, Los Alamos Visualization Associates, Mesa Tech International Inc., and ThermaSun Inc. were awarded from the Venture Acceleration Fund. August 21, 2009 Los Alamos National Laboratory sits on top of a once-remote mesa in northern New Mexico with the Jemez mountains as a backdrop to research and innovation covering multi-disciplines from bioscience, sustainable energy sources, to plasma physics and new

  6. Information Security

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2007-06-29

    Establishes security requirements for the protection and control of information and matter required to be classified or controlled by statutes, regulations, or Department of Energy directives. Section E, Technical Surveillance Countermeasures Program, is Official Use Only. Please contact the DOE Office of Health, Safety and Security at 301-903-0292 if your official duties require you to have access to this part of the directive. Cancels: DOE M 471.2-1B, DOE M 471.2-1C, DOE M 471.2-4, and DOE O 471.2A

  7. Information Security

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2005-08-26

    This Manual establishes security requirements for the protection and control of information and matter required to be classified or controlled by statutes, regulations, or Department of Energy directives. Attachment E, Technical Surveillance Countermeasures Program, is for Official Use Only. Contact the Office of Security and Safety Performance Assurance at 301-903-3653 if your official duties require you to have access to this part of the directive. Cancels: DOE M 471.2-1B, DOE M 471.2-1C, DOE M 471.2-4, and DOE O 471.2A.

  8. Header Information

    National Nuclear Security Administration (NNSA)

    NRC 741 Crosswalk to SAMS 741 Field Number 741 Field Name SAMS 8.0 Field Header Information 1 Shipper's RIS ShipperRIS 2 Receiver's RIS ReceiverRIS 3 Transaction No. TransferNumber 4 Correction No. CorrectionNumber 5a Processing Code - Shipper * not entered 5b Processing Code - Receiver * not entered 6a Action Code - Shipper ActionCode 6b Action Code - Receiver ActionCode 8a Name and Address of Shipper * not entered 9a Name and Address of Receiver * not entered 10 No. of Data Lines NumberofLines

  9. Geneial Information

    Office of Legacy Management (LM)

    --- _____ ii3 ' 6 f Geneial Information su-u+./ I The Commission maintains a residue storage area known as the Airport Site at Robertson, l Missouri. This site is located immediately north of the St. Louis Municipal Airport and east of the McIknnell Aircraft Corporation Plant on Rr~wn Road in St. Louis County. Consent to use and occupy the 21.7 acre tract was obtalned by the Manhattan Dlstrlot on Marsh 2, 19&6. T!ltle uas auqubed to the property on Janwry 3, 1947 by condemnation proceeding8

  10. Air Risk Information Support Center

    SciTech Connect (OSTI)

    Shoaf, C.R.; Guth, D.J.

    1990-12-31

    The Air Risk Information Support Center (Air RISC) was initiated in early 1988 by the US Environmental Protection Agency`s (EPA) Office of Health and Environmental Assessment (OHEA) and the Office of Air Quality Planning and Standards (OAQPS) as a technology transfer effort that would focus on providing information to state and local environmental agencies and to EPA Regional Offices in the areas of health, risk, and exposure assessment for toxic air pollutants. Technical information is fostered and disseminated by Air RISCs three primary activities: (1) a {open_quotes}hotline{close_quotes}, (2) quick turn-around technical assistance projects, and (3) general technical guidance projects. 1 ref., 2 figs.

  11. Sampling designs for geochemical baseline studies in the Colorado oil shale region: a manual for practical application

    SciTech Connect (OSTI)

    Klusman, R. W.; Ringrose, C. D.; Candito, R. J.; Zuccaro, B.; Rutherford, D. W.; Dean, W. E.

    1980-06-01

    This manual presents a rationale for sampling designs, and results of geochemical baseline studies in the Colorado portion of the oil-shale region. The program consists of a systematic trace element study of soils, stream sediments, and plants carried out in a way to be conservative of human and financial resources and yield maximum information. Extension of this approach to other parameters, other locations, and to environmental baseline studies in general is a primary objective. A baseline for any geochemical parameter can be defined as the concentration of that parameter in a given medium such as soil, the range of its concentration, and the geographic scale of variability. In air quality studies, and to a lesser extent for plants, the temporal scale of variability must also be considered. In studies of soil, the temporal variablility does not become a factor until such time that a study is deemed necessary to evaluate whether or not there have been changes in baseline levels as a result of development. The manual is divided into five major parts. The first is a suggested sampling protocol which is presented in an outline form for guiding baseline studies in this area. The second section is background information on the physical features of the area of study, trace elements of significance occurring in oil shale, and the sample media used in these studies. The third section is concerned primarily with sampling design and its application to the geochemical studies of the oil shale region. The last sections, in the form of appendices, provide actual data and illustrate in a systematic manner, the calculations performed to obtain the various summary data. The last segment of the appendices is a more academic discussion of the geochemistry of trace elements and the parameters of importance influencing their behavior in natural systems.

  12. DOE Collaboration with National Geographic's JASON Project Yields Three CODiE Awards

    Broader source: Energy.gov [DOE]

    The JASON Project's multimedia energy curriculum has earned three CODiE Awards from the Software & Information Industry Association.

  13. DOE Hydrogen and Fuel Cell Overview: 2010 State and Regional Initiatives

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Informational Call and Meeting Series Relaunch | Department of Energy 2010 State and Regional Initiatives Informational Call and Meeting Series Relaunch DOE Hydrogen and Fuel Cell Overview: 2010 State and Regional Initiatives Informational Call and Meeting Series Relaunch Presented at the State and Regional Initiatives Informational Call and Meeting Series Relaunch Introduction on December 14, 2010. PDF icon DOE Hydrogen and Fuel Cell Overview More Documents & Publications U.S. DOE

  14. Northeast Regional Biomass Program

    SciTech Connect (OSTI)

    Lusk, P.D.

    1992-12-01

    The Northeast Regional Biomass Program has been in operation for a period of nine years. During this time, state managed programs and technical programs have been conducted covering a wide range of activities primarily aim at the use and applications of wood as a fuel. These activities include: assessments of available biomass resources; surveys to determine what industries, businesses, institutions, and utility companies use wood and wood waste for fuel; and workshops, seminars, and demonstrations to provide technical assistance. In the Northeast, an estimated 6.2 million tons of wood are used in the commercial and industrial sector, where 12.5 million cords are used for residential heating annually. Of this useage, 1504.7 mw of power has been generated from biomass. The use of wood energy products has had substantial employment and income benefits in the region. Although wood and woodwaste have received primary emphasis in the regional program, the use of municipal solid waste has received increased emphasis as an energy source. The energy contribution of biomass will increase as potentia users become more familiar with existing feedstocks, technologies, and applications. The Northeast Regional Biomass Program is designed to support region-specific to overcome near-term barriers to biomass energy use.

  15. Supplemental Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Supplemental Information All documents by title A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 00-Table of Contents 1-11-11 10 CFR 34.27 10 CFR Part 20 29 CFR 1910.120 29 CFR 1910.134 29 CFR 1910.1200 30 CFR Part 48 30 CFR Part 49 30 CFR part 57 40 CFR 191.13 40 CFR 302 40 CFR 355 40 CFR Part 136 49 CFR Documents 56 CFR 55167 61 CFR Volume 109 A Back to top abstract ACC_ERMS239636 acknowledgments Ahrens and Hansen 1995 Ahrens and Onofrei 1996 Ahrens et. al 1996 Anderson 1978 Anderson et

  16. NV PFA Regional Data

    SciTech Connect (OSTI)

    James Faulds

    2015-10-28

    This project focused on defining geothermal play fairways and development of a detailed geothermal potential map of a large transect across the Great Basin region (96,000 km2), with the primary objective of facilitating discovery of commercial-grade, blind geothermal fields (i.e. systems with no surface hot springs or fumaroles) and thereby accelerating geothermal development in this promising region. Data included in this submission consists of: structural settings (target areas, recency of faulting, slip and dilation potential, slip rates, quality), regional-scale strain rates, earthquake density and magnitude, gravity data, temperature at 3 km depth, permeability models, favorability models, degree of exploration and exploration opportunities, data from springs and wells, transmission lines and wilderness areas, and published maps and theses for the Nevada Play Fairway area.

  17. Regional seismic discrimination research at LLNL

    SciTech Connect (OSTI)

    Walter, W.R.; Mayeda, K.M.; Goldstein, P.; Patton, H.J.; Jarpe, S.; Glenn, L.

    1995-10-01

    The ability to verify a Comprehensive Test Ban Treaty (CTBT) depends in part on the ability to seismically detect and discriminate between potential clandestine underground nuclear tests and other seismic sources, including earthquakes and mining activities. Regional techniques are necessary to push detection and discrimination levels down to small magnitudes, but existing methods of event discrimination are mainly empirical and show much variability from region to region. The goals of Lawrence Livermore National Laboratory`s (LLNL`s) regional discriminant research are to evaluate the most promising discriminants, improve the understanding of their physical basis and use this information to develop new and more effective discriminants that can be transported to new regions of high monitoring interest. In this report the authors discuss preliminary efforts to geophysically characterize the Middle East and North Africa. They show that the remarkable stability of coda allows one to develop physically based, stable single station magnitude scales in new regions. They then discuss progress to date on evaluating and improving physical understanding and ability to model regional discriminants, focusing on the comprehensive NTS dataset. The authors apply this modeling ability to develop improved discriminants including slopes of P to S ratios. They find combining disparate discriminant techniques is particularly effective in identifying consistent outliers such as shallow earthquakes and mine seismicity. Finally they discuss development and use of new coda and waveform modeling tools to investigate special events.

  18. Washington Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Regions National Science Bowl (NSB) NSB Home About High School High School Students High ... WDTS Home Contact Information National Science Bowl U.S. Department of Energy SC-27 ...

  19. Ohio Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Ohio Regions National Science Bowl (NSB) NSB Home About High School High School Students ... WDTS Home Contact Information National Science Bowl U.S. Department of Energy SC-27 ...

  20. File:EIA-shale-gas.pdf | Open Energy Information

    Open Energy Info (EERE)

    Lower 48 States Sources Energy Information Administration Related Technologies Natural Gas Creation Date 2010-03-10 Extent National Countries United States UN Region Northern...

  1. File:EIA-shalenamerica1.pdf | Open Energy Information

    Open Energy Info (EERE)

    of December 2010 Sources Energy Information Administration Related Technologies Natural Gas Creation Date 2010-12-15 Extent National Countries United States UN Region Northern...

  2. File:EIA-tight-gas.pdf | Open Energy Information

    Open Energy Info (EERE)

    48 States Sources U.S. Energy Information Administration Related Technologies Natural Gas Creation Date 2010-06-06 Extent National Countries United States UN Region Northern...

  3. UC Center for Information Technology Research in the Interest...

    Open Energy Info (EERE)

    Center for Information Technology Research in the Interest of Society (CITRIS) Place: Berkeley, California Zip: 94720 Region: Bay Area Website: www.citris-uc.org Coordinates:...

  4. Request for Information: Assistance in Target Setting and Strategic...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Assistance in Target Setting and Strategic Planning for Renewable Energy Deployment at the State and Regional Level Request for Information: Assistance in Target Setting and ...

  5. Del Ranch (Hoch) Geothermal Facility | Open Energy Information

    Open Energy Info (EERE)

    Hide Map Geothermal Resource Area Salton Sea Geothermal Area Geothermal Region Gulf of California Rift Zone Plant Information Facility Type Double Flash Owner CalEnergy...

  6. Soda Lake II Geothermal Facility | Open Energy Information

    Open Energy Info (EERE)

    and Range Geothermal Region Plant Information Facility Type Binary Owner Constellation Energy, Harbert Power Number of Units 6.0 Commercial Online Date 1990 Power Plant Data...

  7. Don A. Cambell Geothermal Power Plant | Open Energy Information

    Open Energy Info (EERE)

    Geothermal Region Plant Information Facility Type Binary Owner Ormat Developer Ormat Energy Purchaser Ormat Commercial Online Date 2013 Power Plant Data Type of Plant Number...

  8. Las Tres Virgenes Geothermal Plant | Open Energy Information

    Open Energy Info (EERE)

    Region Baja Peninsula Plant Information Facility Type Single Flash Developer Alstom Energy Purchaser Comisin Federal de Electricidad Number of Units 2 Commercial Online...

  9. The Midwest Regional Carbon Sequestration Partnership (MRCSP)

    SciTech Connect (OSTI)

    James J. Dooley; Robert Dahowski; Casie Davidson

    2005-12-01

    This final report summarizes the Phase I research conducted by the Midwest regional Carbon Sequestration Partnership (MRCSP). The Phase I effort began in October 2003 and the project period ended on September 31, 2005. The MRCSP is a public/private partnership led by Battelle with the mission of identifying the technical, economic, and social issues associated with implementation of carbon sequestration technologies in its seven state geographic region (Indiana, Kentucky, Maryland, Michigan, Ohio, Pennsylvania, and West Virginia) and identifying viable pathways for their deployment. It is one of seven partnerships that together span most of the U.S. and parts of Canada that comprise the U.S. Department of Energy's (DOE's) Regional Carbon Sequestration Program led by DOE's national Energy Technology Laboratory (NETL). The MRCSP Phase I research was carried out under DOE Cooperative Agreement No. DE-FC26-03NT41981. The total value of Phase I was $3,513,513 of which the DOE share was $2,410,967 or 68.62%. The remainder of the cost share was provided in varying amounts by the rest of the 38 members of MRCSP's Phase I project. The next largest cost sharing participant to DOE in Phase I was the Ohio Coal Development Office within the Ohio Air Quality Development Authority (OCDO). OCDO's contribution was $100,000 and was contributed under Grant Agreement No. CDO/D-02-17. In this report, the MRCSP's research shows that the seven state MRCSP region is a major contributor to the U. S. economy and also to total emissions of CO2, the most significant of the greenhouse gases thought to contribute to global climate change. But, the research has also shown that the region has substantial resources for sequestering carbon, both in deep geological reservoirs (geological sequestration) and through improved agricultural and land management practices (terrestrial sequestration). Geological reservoirs, especially deep saline reservoirs, offer the potential to permanently store CO2 for literally 100s of years even if all the CO2 emissions from the region's large point sources were stored there, an unlikely scenario under any set of national carbon emission mitigation strategies. The terrestrial sequestration opportunities in the region have the biophysical potential to sequester up to 20% of annual emissions from the region's large point sources of CO2. This report describes the assumptions made and methods employed to arrive at the results leading to these conclusions. It also describes the results of analyses of regulatory issues in the region affecting the potential for deployment of sequestration technologies. Finally, it describes the public outreach and education efforts carried out in Phase I including the creation of a web site dedicated to the MRCSP at www.mrcsp.org.

  10. U.S. Energy Information Administration (EIA)

    Gasoline and Diesel Fuel Update (EIA)

    Figure 3. Electric power sector consumption of coal by census region, 2010 (million short tons and percent change from 2009) U.S. total: 975.6 million short tons (4.5%) Figure 3. Electric Power Sector Consumption of Coal by Census Region, 2010 Source: U.S. Energy Information Administration, Form EIA-

  11. Final Scientific and Technical Report State and Regional Biomass Partnerships

    SciTech Connect (OSTI)

    Handley, Rick; Stubbs, Anne D.

    2008-12-29

    The Northeast Regional Biomass Program successfully employed a three pronged approach to build the regional capacity, networks, and reliable information needed to advance biomass and bioenergy technologies and markets. The approach included support for state-based, multi-agency biomass working groups; direct technical assistance to states and private developers; and extensive networking and partnership-building activities to share objective information and best practices.

  12. DOE New Jersey Regional Middle School Science Bowl | Princeton Plasma

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Physics Lab 0, 2015, 9:00am to 3:00pm Science Education Lab-wide DOE New Jersey Regional Middle School Science Bowl Contact Information Website: New Jersey Regional Science Bowl Coordinator(s): Deedee Ortiz-Arias, Science Education Department Program Administraor dortiz@pppl.gov PPPL Entrance Procedures Visitor Information, Directions, Security at PPPL As a federal facility, the Princeton Plasma Physics Laboratory is operating under heightened security measures because of the events of

  13. U.S. Energy Information Administration (EIA)

    Gasoline and Diesel Fuel Update (EIA)

    Figure 1. Coal production by coal-producing region, 2010 (million short tons and percent change from 2009) U.S. total: 1,085.3 million short tons (-1.0%) Figure 1. Coal Production by Coal-Producing Region, 2010 Source: U.S. Energy Information Administration, Quarterly Coal Report, October-December 2010, DOE/EIA-0121(2010/Q4) (Washington, DC, April 2011). Regional totals do not include refuse recovery.

  14. U.S. Energy Information Administration (EIA)

    Gasoline and Diesel Fuel Update (EIA)

    Figure 2. Coal production by region, 2000-2010 (million short tons) Figure 2. Coal Production by Region, 2000-2010 Sources: U.S. Energy Information Administration, Quarterly Coal Report, October-December 2010, DOE/EIA-0121(2010/Q4) (Washington, DC, April 2011); Coal Industry Annual, DOE/EIA-0584, various issues; Annual Coal Report, DOE/EIA-0584, various issues. Regional totals do not include refuse recovery

  15. Regional Climate Modeling: Progress, Challenges, and Prospects

    SciTech Connect (OSTI)

    Wang, Yuqing; Leung, Lai R.; McGregor, John L.; Lee, Dong-Kyou; Wang, Wei-Chyung; Ding, Yihui; Kimura, Fujio

    2004-12-01

    Regional climate modeling with regional climate models (RCMs) has matured over the past decade and allows for meaningful utilization in a broad spectrum of applications. In this paper, latest progresses in regional climate modeling studies are reviewed, including RCM development, applications of RCMs to dynamical downscaling for climate change assessment, seasonal climate predictions and climate process studies, and the study of regional climate predictability. Challenges and potential directions of future research in this important area are discussed, with the focus on those to which less attention has been given previously, such as the importance of ensemble simulations, further development and improvement of regional climate modeling approach, modeling extreme climate events and sub-daily variation of clouds and precipitation, model evaluation and diagnostics, applications of RCMs to climate process studies and seasonal predictions, and development of regional earth system models. It is believed that with both the demonstrated credibility of RCMs capability in reproducing not only monthly to seasonal mean climate and interannual variability but also the extreme climate events when driven by good quality reanalysis and the continuous improvements in the skill of global general circulation models (GCMs) in simulating large-scale atmospheric circulation, regional climate modeling will remain an important dynamical downscaling tool for providing the needed information for assessing climate change impacts and seasonal climate predictions, and a powerful tool for improving our understanding of regional climate processes. An internationally coordinated effort can be developed with different focuses by different groups to advance regional climate modeling studies. It is also recognized that since the final quality of the results from nested RCMs depends in part on the realism of the large-scale forcing provided by GCMs, the reduction of errors and improvement in physics parameterizations in both GCMs and RCMs remain a priority for climate modeling community.

  16. Resource Planning Model: An Integrated Resource Planning and Dispatch Tool for Regional Electric Systems

    SciTech Connect (OSTI)

    Mai, T.; Drury, E.; Eurek, K.; Bodington, N.; Lopez, A.; Perry, A.

    2013-01-01

    This report introduces a new capacity expansion model, the Resource Planning Model (RPM), with high spatial and temporal resolution that can be used for mid- and long-term scenario planning of regional power systems. Although RPM can be adapted to any geographic region, the report describes an initial version of the model adapted for the power system in Colorado. It presents examples of scenario results from the first version of the model, including an example of a 30%-by-2020 renewable electricity penetration scenario.

  17. Reliability and Geographic Trends of 50,000 Photovoltaic Systems in the USA: Preprint

    SciTech Connect (OSTI)

    Jordan, D. C.; Kurtz, S. R.

    2014-09-01

    This paper presents performance and reliability data from nearly 50,000 photovoltaic (PV) systems totaling 1.7 gigawatts installed capacity in the USA from 2009 to 2012 and their geographic trends. About 90% of the normal systems and about 85% of all systems, including systems with known issues, performed to within 10% or better of expected performance. Although considerable uncertainty may exist due to the nature of the data, hotter climates appear to exhibit some degradation not seen in the more moderate climates. Special causes of underperformance and their impacts are delineated by reliability category. Hardware-related issues are dominated by inverter problems (totaling less than 0.5%) and underperforming modules (totaling less than 0.1%). Furthermore, many reliability categories show a significant decrease in occurrence from year 1 to subsequent years, emphasizing the need for higher-quality installations but also the need for improved standards development. The probability of PV system damage because of hail is below 0.05%. Singular weather events can have a significant impact such as a single lightning strike to a transformer or the impact of a hurricane. However, grid outages are more likely to have a significant impact than PV system damage when extreme weather events occur.

  18. Information Technology Specialist (Information Security) | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Information Technology Specialist (Information Security) Information Technology Specialist (Information Security) Submitted by admin on Tue, 2016-05-10 18:01 Job Summary Organization Name Department Of Energy Agency SubElement Department of Energy Locations Oak Ridge, Tennessee Announcement Number DOE-SE-16-ST-00003-DHA Job Summary A successful candidate in this position will serve as an Information Technology Specialist (INFOSEC) responsible for the protection of the information and

  19. Regions for Select Spot Prices

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    are used to represent the following regions: Region Gas Point Used Power Point Used New England Algonquin Citygate Massachusetts Hub (ISONE) New York City Transco Zone 6-NY...

  20. Introduction: Regional Dialogue Contract Templates

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Introduction: Regional Dialogue Contract Templates October 17, 2007 1. Summary * BPA invites comments on the first draft of the Regional Dialogue Master Template by Friday,...

  1. Regional Shelter Analysis Methodology

    SciTech Connect (OSTI)

    Dillon, Michael B.; Dennison, Deborah; Kane, Jave; Walker, Hoyt; Miller, Paul

    2015-08-01

    The fallout from a nuclear explosion has the potential to injure or kill 100,000 or more people through exposure to external gamma (fallout) radiation. Existing buildings can reduce radiation exposure by placing material between fallout particles and exposed people. Lawrence Livermore National Laboratory was tasked with developing an operationally feasible methodology that could improve fallout casualty estimates. The methodology, called a Regional Shelter Analysis, combines the fallout protection that existing buildings provide civilian populations with the distribution of people in various locations. The Regional Shelter Analysis method allows the consideration of (a) multiple building types and locations within buildings, (b) country specific estimates, (c) population posture (e.g., unwarned vs. minimally warned), and (d) the time of day (e.g., night vs. day). The protection estimates can be combined with fallout predictions (or measurements) to (a) provide a more accurate assessment of exposure and injury and (b) evaluate the effectiveness of various casualty mitigation strategies. This report describes the Regional Shelter Analysis methodology, highlights key operational aspects (including demonstrating that the methodology is compatible with current tools), illustrates how to implement the methodology, and provides suggestions for future work.

  2. Energy Information Project. Final report

    SciTech Connect (OSTI)

    Not Available

    1985-01-01

    The AFL-CIO Great Lakes Regional Council (GLRC) proposed the Energy Information Project to bridge the organizational gap in the six-state region between state and local labor groups on the one hand, and federal agencies on the other, concerning energy-related matters. The project was designed to establish a productive relationship between the US DOE and AFL-CIO affiliates in the GLRC area around aspects of energy policies and programs of interest to organized labor. This report covers the activities during the grant period from July 20, 1979 to August 15, 1980.

  3. Information Technology - DOE Directives, Delegations, and Requirements

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Information Technology

  4. West Kentucky Regional High School Science Bowl | U.S. DOE Office...

    Office of Science (SC) Website

    Regional Contact Information Regional Coordinator: Don Dihel Email: Don.Dihel@lex.doe.gov Phone: 270-441-6824 Co-Coordinator: Robert "Buz" Smith Email: Robert.Smith@lex.doe.gov ...

  5. West Kentucky Regional Middle School Science Bowl | U.S. DOE...

    Office of Science (SC) Website

    Regional Contact Information Regional Coordinator: Don Dihel Email: Don.Dihel@lex.doe.gov Phone: 270-441-6824 Co-Coordinator: Robert "Buz" Smith Email: Robert.Smith@lex.doe.gov ...

  6. JPL Regional High School Science Bowl | U.S. DOE Office of Science...

    Office of Science (SC) Website

    4800 Oak Grove Drive, MS 186-115 Pasadena, California 91109 Regional Contact Information Regional Coordinator: Kimberly Lievense Email: Klievense@jpl.nasa.gov Phone: 818-354-0112

  7. FY08 LDRD Final Report Regional Climate

    SciTech Connect (OSTI)

    Bader, D C; Chin, H; Caldwell, P M

    2009-05-19

    An integrated, multi-model capability for regional climate change simulation is needed to perform original analyses to understand and prepare for the impacts of climate change on the time and space scales that are critical to California's future environmental quality and economic prosperity. Our intent was to develop a very high resolution regional simulation capability to address consequences of climate change in California to complement the global modeling capability that is supported by DOE at LLNL and other institutions to inform national and international energy policies. The California state government, through the California Energy Commission (CEC), institutionalized the State's climate change assessment process through its biennial climate change reports. The bases for these reports, however, are global climate change simulations for future scenarios designed to inform international policy negotiations, and are primarily focused on the global to continental scale impacts of increasing emissions of greenhouse gases. These simulations do not meet the needs of California public and private officials who will make major decisions in the next decade that require an understanding of climate change in California for the next thirty to fifty years and its effects on energy use, water utilization, air quality, agriculture and natural ecosystems. With the additional development of regional dynamical climate modeling capability, LLNL will be able to design and execute global simulations specifically for scenarios important to the state, then use those results to drive regional simulations of the impacts of the simulated climate change for regions as small as individual cities or watersheds. Through this project, we systematically studied the strengths and weaknesses of downscaling global model results with a regional mesoscale model to guide others, particularly university researchers, who are using the technique based on models with less complete parameterizations or coarser spatial resolution. Further, LLNL has now built a capability in state-of-the-science mesoscale climate modeling that complements that which it has in global climate simulation, providing potential sponsors with an end-to-end simulation and analysis program.

  8. U.S. Geographic Analysis of the Cost of Hydrogen from Electrolysis

    SciTech Connect (OSTI)

    Saur, G.; Ainscough, C.

    2011-12-01

    This report summarizes U.S. geographic analysis of the cost of hydrogen from electrolysis. Wind-based water electrolysis represents a viable path to renewably-produced hydrogen production. It might be used for hydrogen-based transportation fuels, energy storage to augment electricity grid services, or as a supplement for other industrial hydrogen uses. This analysis focuses on the levelized production, costs of producing green hydrogen, rather than market prices which would require more extensive knowledge of an hourly or daily hydrogen market. However, the costs of hydrogen presented here do include a small profit from an internal rate of return on the system. The cost of renewable wind-based hydrogen production is very sensitive to the cost of the wind electricity. Using differently priced grid electricity to supplement the system had only a small effect on the cost of hydrogen; because wind electricity was always used either directly or indirectly to fully generate the hydrogen. Wind classes 3-6 across the U.S. were examined and the costs of hydrogen ranged from $3.74kg to $5.86/kg. These costs do not quite meet the 2015 DOE targets for central or distributed hydrogen production ($3.10/kg and $3.70/kg, respectively), so more work is needed on reducing the cost of wind electricity and the electrolyzers. If the PTC and ITC are claimed, however, many of the sites will meet both targets. For a subset of distributed refueling stations where there is also inexpensive, open space nearby this could be an alternative to central hydrogen production and distribution.

  9. Large-Scale Information Systems

    SciTech Connect (OSTI)

    D. M. Nicol; H. R. Ammerlahn; M. E. Goldsby; M. M. Johnson; D. E. Rhodes; A. S. Yoshimura

    2000-12-01

    Large enterprises are ever more dependent on their Large-Scale Information Systems (LSLS), computer systems that are distinguished architecturally by distributed components--data sources, networks, computing engines, simulations, human-in-the-loop control and remote access stations. These systems provide such capabilities as workflow, data fusion and distributed database access. The Nuclear Weapons Complex (NWC) contains many examples of LSIS components, a fact that motivates this research. However, most LSIS in use grew up from collections of separate subsystems that were not designed to be components of an integrated system. For this reason, they are often difficult to analyze and control. The problem is made more difficult by the size of a typical system, its diversity of information sources, and the institutional complexities associated with its geographic distribution across the enterprise. Moreover, there is no integrated approach for analyzing or managing such systems. Indeed, integrated development of LSIS is an active area of academic research. This work developed such an approach by simulating the various components of the LSIS and allowing the simulated components to interact with real LSIS subsystems. This research demonstrated two benefits. First, applying it to a particular LSIS provided a thorough understanding of the interfaces between the system's components. Second, it demonstrated how more rapid and detailed answers could be obtained to questions significant to the enterprise by interacting with the relevant LSIS subsystems through simulated components designed with those questions in mind. In a final, added phase of the project, investigations were made on extending this research to wireless communication networks in support of telemetry applications.

  10. New Mexico Regions | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Mexico Regions National Science Bowl (NSB) NSB Home About High School High School ... WDTS Home Contact Information National Science Bowl U.S. Department of Energy SC-27 ...

  11. AEO2011: World Total Coal Flows By Importing Regions and Exporting...

    Open Energy Info (EERE)

    Coal Flows By Importing Regions and Exporting Countries This dataset comes from the Energy Information Administration (EIA), and is part of the 2011 Annual Energy Outlook Report...

  12. Montana Rivers Information System : Edit/Entry Program User's Manual.

    SciTech Connect (OSTI)

    United States. Bonneville Power Administration; Montana Department of Fish, Wildlife and Parks

    1992-07-01

    The Montana Rivers Information System (MRIS) was initiated to assess the state`s fish, wildlife, and recreation value; and natural cultural, and geologic features. The MRIS is now a set of data bases containing part of the information in the Natural Heritage Program natural features and threatened and endangered species data bases and comprises of the Montana Interagency Stream Fisheries Database; the MDFWP Recreation Database; and the MDFWP Wildlife Geographic Information System. The purpose of this User`s Manual is to describe to the user how to maintain the MRIS database of their choice by updating, changing, deleting, and adding records using the edit/entry programs; and to provide to the user all information and instructions necessary to complete data entry into the MRIS databases.

  13. WIPP Recovery Information

    Broader source: Energy.gov [DOE]

    At the March 26, 2014 Board meeting J. R. Stroble CBFO, Provided Information on Locations to Access WIPP Recovery Information.

  14. ARM - Public Information Materials

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    govPublicationsPublic Information Materials Publications Journal Articles Conference Documents Program Documents Technical Reports Publications Database Public Information...

  15. Contractor Past Performance Information

    Broader source: Energy.gov (indexed) [DOE]

    management controls and the compliance assessments of contractor performance information. Section IV has best practices to address contractor performance information....

  16. Special Undergraduate Informations

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Special Undergraduate Information Special Undergraduate Information for SAGE A National Science Foundation Research Experiences for Undergraduates program Contacts Institute...

  17. A Hierarchical Evaluation of Regional Climate Simulations

    SciTech Connect (OSTI)

    Leung, Lai-Yung R.; Ringler, Todd; Collins, William D.; Taylor, Mark; Ashfaq, Moetasim

    2013-08-20

    Global climate models (GCMs) are the primary tools for predicting the evolution of the climate system. Through decades of development, GCMs have demonstrated useful skill in simulating climate at continental to global scales. However, large uncertainties remain in projecting climate change at regional scales, which limit our ability to inform decisions on climate change adaptation and mitigation. To bridge this gap, different modeling approaches including nested regional climate models (RCMs), global stretch-grid models, and global high-resolution atmospheric models have been used to provide regional climate simulations (Leung et al. 2003). In previous efforts to evaluate these approaches, isolating their relative merits was not possible because factors such as dynamical frameworks, physics parameterizations, and model resolutions were not systematically constrained. With advances in high performance computing, it is now feasible to run coupled atmosphere-ocean GCMs at horizontal resolution comparable to what RCMs use today. Global models with local refinement using unstructured grids have become available for modeling regional climate (e.g., Rauscher et al. 2012; Ringler et al. 2013). While they offer opportunities to improve climate simulations, significant efforts are needed to test their veracity for regional-scale climate simulations.

  18. Strengthening regional safeguards

    SciTech Connect (OSTI)

    Palhares, L.; Almeida, G.; Mafra, O.

    1996-08-01

    Nuclear cooperation between Argentina and Brazil has been growing since the early 1980`s and as it grew, so did cooperation with the US Department of Energy (DOE). The Brazilian-Argentine Agency for Accounting and Control of Nuclear Materials (ABACC) was formed in December 1991 to operate the Common System of Accounting and Control of Nuclear Materials (SCCC). In April 1994, ABACC and the DOE signed an Agreement of Cooperation in nuclear material safeguards. This cooperation has included training safeguards inspectors, exchanging nuclear material measurement and containment and surveillance technology, characterizing reference materials, and studying enrichment plant safeguards. The goal of the collaboration is to exchange technology, evaluate new technology in Latin American nuclear facilities, and strengthen regional safeguards. This paper describes the history of the cooperation, its recent activities, and future projects. The cooperation is strongly supported by all three governments: the Republics of Argentina and Brazil and the United States.

  19. SOUTHWEST REGIONAL PARTNERSHIP FOR CARBON SEQUESTRATION

    SciTech Connect (OSTI)

    Brian McPherson

    2004-04-01

    The Southwest Partnership Region includes five states (Arizona, Colorado, New Mexico, Oklahoma, Utah) and contiguous areas from three adjacent states (west Texas, south Wyoming, and west Kansas). This energy-rich region exhibits some of the largest growth rates in the nation, and it contains two major CO{sub 2} pipeline networks that presently tap natural subsurface CO{sub 2} reservoirs for enhanced oil recovery at a rate of 30 million tons per year. The ten largest coal-fired power plants in the region produce 50% (140 million tons CO{sub 2}/y) of the total CO{sub 2} from power-plant fossil fuel combustion, with power plant emissions close to half the total CO{sub 2} emissions. The Southwest Regional Partnership comprises a large, diverse group of expert organizations and individuals specializing in carbon sequestration science and engineering, as well as public policy and outreach. These partners include 21 state government agencies and universities, the five major electric utility industries, seven oil, gas and coal companies, three federal agencies, the Navajo Nation, several NGOs including the Western Governors Association, and data sharing agreements with four other surrounding states. The Partnership is developing action plans for possible Phase II carbon sequestration pilot tests in the region, as well as the non-technical aspects necessary for developing and carrying out these pilot tests. The establishment of a website network to facilitate data storage and information sharing, decision-making, and future management of carbon sequestration in the region is a priority. The Southwest Partnership's approach includes (1) dissemination of existing regulatory/permitting requirements, (2) assessing and initiating public acceptance of possible sequestration approaches, and (3) evaluation and ranking of the most appropriate sequestration technologies for capture and storage of CO{sub 2} in the Southwest Region. The Partnership will also identify potential gaps in monitoring and verification approaches needed to validate long-term storage efforts.

  20. REGIONAL PARTNERSHIPSThe Pioneer Regional Partnerships are early-stage

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    REGIONAL PARTNERSHIPSThe Pioneer Regional Partnerships are early-stage public/private collaborative projects that address specific near-term grid modernization issues important to the identified region and its stakeholders. The Grid Modernization Laboratory Consortium (GMLC) has initiated 11 proposed partnerships to accomplish the following:Address a key state/regional grid modernization challenge that is visible and important to local industry and government stakeholders.Engage collaboration

  1. To: Regional Managers

    Energy Savers [EERE]

    N O R T H A M E R I C A N E L E C T R I C R E L I A B I L I T Y C O U N C I L P r i n c e t o n F o r r e s t a l V i l l a g e , 1 1 6 - 3 9 0 V i l l a g e B o u l e v a r d , P r i n c e t o n , N e w J e r s e y 0 8 5 4 0 - 5 7 3 1 Phone 609-452-8060 Fax 609-452-9550 URL www.nerc.com FOR IMMEDIATE RELEASE Contact: Ellen P. Vancko evancko@nerc.com Preliminary Disturbance Report August 14, 2003 Sequence of Events The following information represents a partial sequence of events based upon

  2. Regional analysis of ground and above-ground climate

    SciTech Connect (OSTI)

    Not Available

    1981-12-01

    The regional suitability of underground construction as a climate control technique is discussed with reference to (1) a bioclimatic analysis of long-term weather data for 29 locations in the United States to determine appropriate above ground climate control techniques, (2) a data base of synthesized ground temperatures for the coterminous United States, and (3) monthly dew point ground temperature comparisons for identifying the relative likelihood of condensation from one region to another. It is concluded that the suitability of earth tempering as a practice and of specific earth-sheltered design stereotypes varies geographically; while the subsurface almost always provides a thermal advantage on its own terms when compared to above ground climatic data, it can, nonetheless, compromise the effectiveness of other, regionally more important climate control techniques. Also contained in the report are reviews of above and below ground climate mapping schemes related to human comfort and architectural design, and detailed description of a theoretical model of ground temperature, heat flow, and heat storage in the ground. Strategies of passive climate control are presented in a discussion of the building bioclimatic analysis procedure which has been applied in a computer analysis of 30 years of weather data for each of 29 locations in the United States.

  3. Mid-Atlantic Regional Wind Energy Institute

    SciTech Connect (OSTI)

    Courtney Lane

    2011-12-20

    As the Department of Energy stated in its 20% Wind Energy by 2030 report, there will need to be enhanced outreach efforts on a national, state, regional, and local level to communicate wind development opportunities, benefits and challenges to a diverse set of stakeholders. To help address this need, PennFuture was awarded funding to create the Mid-Atlantic Regional Wind Energy Institute to provide general education and outreach on wind energy development across Maryland, Virginia, Delaware, Pennsylvania and West Virginia. Over the course of the two-year grant period, PennFuture used its expertise on wind energy policy and development in Pennsylvania and expanded it to other states in the Mid-Atlantic region. PennFuture accomplished this through reaching out and establishing connections with policy makers, local environmental groups, health and economic development organizations, and educational institutions and wind energy developers throughout the Mid-Atlantic region. PennFuture conducted two regional wind educational forums that brought together wind industry representatives and public interest organizations from across the region to discuss and address wind development in the Mid-Atlantic region. PennFuture developed the agenda and speakers in collaboration with experts on the ground in each state to help determine the critical issue to wind energy in each location. The sessions focused on topics ranging from the basics of wind development; model ordinance and tax issues; anti-wind arguments and counter points; wildlife issues and coalition building. In addition to in-person events, PennFuture held three webinars on (1) Generating Jobs with Wind Energy; (2) Reviving American Manufacturing with Wind Power; and (3) Wind and Transmission. PennFuture also created a web page for the institute (http://www.midatlanticwind.org) that contains an online database of fact sheets, research reports, sample advocacy letters, top anti-wind claims and information on how to address them, wind and wildlife materials and sample model ordinances. Video and presentations from each in-person meeting and webinar recordings are also available on the site. At the end of the two-year period, PennFuture has accomplished its goal of giving a unified voice and presence to wind energy advocates in the Mid-Atlantic region. We educated a broad range of stakeholders on the benefits of wind energy and gave them the tools to help make a difference in their states. We grew a database of over 500 contacts and hope to continue the discussion and work around the importance of wind energy in the region.

  4. Energy information sheets

    SciTech Connect (OSTI)

    1995-07-01

    The National Energy Information Center (NEIC), as part of its mission, provides energy information and referral assistance to Federal, State, and local governments, the academic community, business and industrial organizations, and the public. The Energy Information Sheets was developed to provide general information on various aspects of fuel production, prices, consumption, and capability. Additional information on related subject matter can be found in other Energy Information Administration (EIA) publications as referenced at the end of each sheet.

  5. Information Technology Specialist (Security)

    Broader source: Energy.gov [DOE]

    A successful candidate in this position will serve as an Information Technology Specialist (Security) responsible for providing technical support in the information security environment which...

  6. Background Information on CBECS

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Information on CBECS The following topics provide detailed information on survey methodology, the kinds of errors associated with sample surveys, estimation of standard errors,...

  7. Utilities | Open Energy Information

    Open Energy Info (EERE)

    historic, in human and machine readable formats. See also the NREL System Advisor Model (SAM) and NREL's BEOpt. Utility Outage Information dataset - Information and resources...

  8. Takigami | Open Energy Information

    Open Energy Info (EERE)

    ENERGYGeothermal Home Takigami General Information Name Takigami Sector Geothermal energy Location Information Address 2862-12 Kokonoe, Kusu District, Oita Prefecture 879-4802...

  9. ARM - People Contact Information

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    govPeople DirectoryReports ARM People Database Reports Email List Owner Information Email List Membership Information (password required) CategoryProgram List Membership...

  10. Characterization of seven United States coal regions. The development of optimal terrace pit coal mining systems

    SciTech Connect (OSTI)

    Wimer, R.L.; Adams, M.A.; Jurich, D.M.

    1981-02-01

    This report characterizes seven United State coal regions in the Northern Great Plains, Rocky Mountain, Interior, and Gulf Coast coal provinces. Descriptions include those of the Fort Union, Powder River, Green River, Four Corners, Lower Missouri, Illinois Basin, and Texas Gulf coal resource regions. The resource characterizations describe geologic, geographic, hydrologic, environmental and climatological conditions of each region, coal ranks and qualities, extent of reserves, reclamation requirements, and current mining activities. The report was compiled as a basis for the development of hypothetical coal mining situations for comparison of conventional and terrace pit surface mining methods, under contract to the Department of Energy, Contract No. DE-AC01-79ET10023, entitled The Development of Optimal Terrace Pit Coal Mining Systems.

  11. Alaska - CPCN General Information | Open Energy Information

    Open Energy Info (EERE)

    CPCN General Information Jump to: navigation, search OpenEI Reference LibraryAdd to library PermittingRegulatory Guidance - Instructions: Alaska - CPCN General...

  12. Nevada Transmission Siting Information | Open Energy Information

    Open Energy Info (EERE)

    search OpenEI Reference LibraryAdd to library PermittingRegulatory Guidance - GuideHandbook: Nevada Transmission Siting InformationPermittingRegulatory GuidanceGuide...

  13. AUDIT REPORT The Energy Information Administration's Information...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Technology Program" BACKGROUND The Energy Information Administration (EIA) is a statistical and analytical agency within the Department of Energy responsible for a wide range ...

  14. Method of Evaluating, Expanding, and Collapsing Connectivity Regions Within

    Office of Scientific and Technical Information (OSTI)

    Dynamic Systems (Patent Application) | SciTech Connect Patent Application: Method of Evaluating, Expanding, and Collapsing Connectivity Regions Within Dynamic Systems Citation Details In-Document Search Title: Method of Evaluating, Expanding, and Collapsing Connectivity Regions Within Dynamic Systems × You are accessing a document from the Department of Energy's (DOE) SciTech Connect. This site is a product of DOE's Office of Scientific and Technical Information (OSTI) and is provided as a

  15. Method of evaluating, expanding, and collapsing connectivity regions within

    Office of Scientific and Technical Information (OSTI)

    dynamic systems (Patent) | SciTech Connect Patent: Method of evaluating, expanding, and collapsing connectivity regions within dynamic systems Citation Details In-Document Search Title: Method of evaluating, expanding, and collapsing connectivity regions within dynamic systems × You are accessing a document from the Department of Energy's (DOE) SciTech Connect. This site is a product of DOE's Office of Scientific and Technical Information (OSTI) and is provided as a public service. Visit

  16. Air Conditioner Regional Standards Brochure | Department of Energy

    Energy Savers [EERE]

    Air Conditioner Regional Standards Brochure Air Conditioner Regional Standards Brochure November 9, 2015 DOE has adopted energy conservation standards for split-system air conditioners that vary depending on when and where a unit is installed. This brochure provides information about the new standards to distributors, contractors (installers), and consumers. PDF icon Central Air Conditioner Standards Brochure More Documents & Publications 2015-11-12 Proposed Rulemaking Regarding Enforcement

  17. Rapidity divergences and deep inelastic scattering in the endpoint region

    Office of Scientific and Technical Information (OSTI)

    (Journal Article) | SciTech Connect Rapidity divergences and deep inelastic scattering in the endpoint region Citation Details In-Document Search Title: Rapidity divergences and deep inelastic scattering in the endpoint region Authors: Fleming, Sean ; Labun, Ou Z. Publication Date: 2015-05-12 OSTI Identifier: 1179737 Grant/Contract Number: FG02-06ER41449; FG02-04ER41338 Type: Publisher's Accepted Manuscript Journal Name: Physical Review D Additional Journal Information: Journal Volume: 91;

  18. Students from Aurora Triumph in Denver Regional Science Bowl

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Denver Regional Science Bowl For more information contact: e:mail: Public Affairs Golden, Colo., Feb. 27, 1999 — Students from Aurora's Smoky Hill High School won top honors at the 1999 Denver Regional Science Bowl today at the Colorado School of Mines in Golden. In the final round of rapid-fire questions about physics, math, biology, astronomy, chemistry, computers and the earth sciences, students from Smoky Hill High School were victorious over Highlands Ranch High School. Twenty-one student

  19. I UNITED STATES NUCLEAR REGU.LATORYCOMMISS& REGION I

    Office of Legacy Management (LM)

    ' \*-'- I UNITED STATES NUCLEAR REGU.LATORYCOMMISS& REGION I 63, PARK AVENUE KING OF PRUSSIA. PENNSY LVANIA 19406 I..*. :+ 2 6 JUN 1979 2.lr.b The Commonwealth of Massachusetts Department of Public Health Division of Health Care Standards 8 Regulation ATTN: Mr. Gerald S. Parker, Director Radiation Control Programs 80 Boylston Street, Room 835 Boston, Massachusetts 02116 Dear Mr. Parker: Enclosed for your information and retention is a copy of the NRC, Region I Investigation Report No.

  20. Ohio-Kentucky-Indiana Regional Council of Governments Go Solar Ready – Solar Map

    Broader source: Energy.gov [DOE]

    The Ohio-Kentucky-Indiana Regional Council of Governments Go Solar Ready Map provides general information about the estimated annual solar energy potential on building rooftops in the OKI region. The intention of this tool is to provide the user a general understanding of the solar energy available on rooftops in the OKI tristate region.