Sample records for reek leic est

  1. LEIC - A Polarized Low Energy Electron-ion Collider at Jefferson Lab

    SciTech Connect (OSTI)

    Derbenev, Yaroslav S. [Thomas Jefferson National Accelerator Facility, Newport News, VA (United States); Hutton, Andrew M. [Thomas Jefferson National Accelerator Facility, Newport News, VA (United States); Krafft, Geoffrey A. [Thomas Jefferson National Accelerator Facility, Newport News, VA (United States); Li, Rui [Thomas Jefferson National Accelerator Facility, Newport News, VA (United States); Lin, Fanglei [Thomas Jefferson National Accelerator Facility, Newport News, VA (United States); Morozov, Vasiliy [Thomas Jefferson National Accelerator Facility, Newport News, VA (United States); Nissen, Edward W. [Thomas Jefferson National Accelerator Facility, Newport News, VA (United States); Yunn, Byung C. [Thomas Jefferson National Accelerator Facility, Newport News, VA (United States); Zhang, He [Thomas Jefferson National Accelerator Facility, Newport News, VA (United States); Sullivan, Michael K. [SLAC National Accelerator Laboratory, Menlo Park, CA (United States); Zhang, Yuhong [Thomas Jefferson National Accelerator Facility, Newport News, VA (United States)

    2013-06-01T23:59:59.000Z

    A polarized electron-ion collider is envisioned as the future nuclear science program at JLab beyond the 12 GeV CEBAF. Presently, a medium energy collider (MEIC) is set as an immediate goal with options for a future energy upgrade. A comprehensive design report for MEIC has been released recently. The MEIC facility could also accommodate electron and proton/ion collisions in a low CM energy range, covering proton energies from 10 to 25 GeV and ion energies with a similar magnetic rigidity, for additional science reach. In this paper, we present a conceptual design of this low energy collider, LEIC, showing its luminosity can reach above 10{sup 33} cm{sup -2}s{sup -1}. The design specifies that the large booster of the MEIC is converted to a low energy ion collider ring with an interaction region and an electron cooler integrated into it. The design provides options for either sharing the detector with the MEIC or a dedicated low energy detector in a third collision point, with advantages of either a minimum cost or extra detection parallel to the MEIC operation, respectively. The LEIC could be positioned as the first and low cost phase of a multi-stage approach to realize the full MEIC.

  2. Regras de Avaliac~ao de CDI-II (Leic-A, 1o s 2010/2011)

    E-Print Network [OSTI]

    Baia, Margarida

    lista bi-semanal de exerc´icios propostos. Estes exerc´icios devem ser resolvidos pelos alunos antes das prepara¸c~ao pr´evia dos exerc´icios de cada ficha, e sobre o desempenho em deter- minados exerc´icios finalizar a resolu¸c~ao dos exerc´icios, recorrendo ao docente para esclarecer eventuais d´uvidas. Em cada

  3. G. Brian Estes | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    site. Prior to joining Westinghouse, Mr. Estes completed 30 years in the Navy Civil Engineer Corps, achieving the rank of Rear Admiral. Admiral Estes served as Commander, Pacific...

  4. EIS-0483: Estes to Flatiron Substation Transmission Lines Rebuild...

    Broader source: Energy.gov (indexed) [DOE]

    EIS-0483: Estes to Flatiron Substation Transmission Lines Rebuild Project, Larimer County, Colorado EIS-0483: Estes to Flatiron Substation Transmission Lines Rebuild Project,...

  5. atendidos por este: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Madagascar Computer Technologies and Information Sciences Websites Summary: Transfert de gestion et conservation de la biodiversit de Makira, Nord-Est de Madagascar Avec sa...

  6. New Mexico's Flagship University est.1889 2011 Legislative

    E-Print Network [OSTI]

    Maccabe, Barney

    New Mexico's Flagship University est.1889 2011 Legislative Initiatives THE UNIVERSITY of NEW MEXICO #12;Priorities for Reductions & Reallocations he University of New Mexico system has absorbed over $47 pursuing the Early Retiree Reinsurance Program component of Health Care Reform to leverage a potential $2

  7. valseur absolue, quand l'intensit elle-mme est faible, que Iors-qu'elle est plus grande.

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    PELTIER; PAR M. E. BOUTY. Dans deux Mémoires antérieurs (1) j'ai établi : i° que les dépôts galvaniques de Peltier se produit à la surface de contact d'une électrode et d'un électrolyte. De nouvelles hauteur du liquide dans le vase est peu supérieure à celle du thermomè tre, de telle sorte que le cou

  8. PECO: une croissance expose En 2007, la croissance est reste dynamique en Europe de l'Est, dpassant

    E-Print Network [OSTI]

    Boyer, Edmond

    plupart des Nouveaux pays membres (NPM), les perspec- tives de croissance restent favorables pour 2008 et * : ralentissement en douceur Dans la plupart des NPM, la croissance s'est maintenue à un très haut niveau en 2007, a fait renaître un risque inflationniste dans l'ensemble des NPM. Les pays baltes présentent ainsi d

  9. Un diagnostic vitalLe paludisme peut provoquer la mort, mais il est possible

    E-Print Network [OSTI]

    vomissements, de toux et parfois de diarrhées chez les nourrissons. Le malade est généralement très fatigué

  10. TQuEST: Threshold Query Execution for Large Sets of Time Series

    E-Print Network [OSTI]

    Kriegel, Hans-Peter

    TQuEST: Threshold Query Execution for Large Sets of Time Series Johannes AÃ?falg, Hans-Peter Kriegel TQuEST, a powerful query processor for time series databases. TQuEST supports a novel but very useful times. 1 Introduction In this paper, we present TQuEST, a powerful analysis tool for time series

  11. Estes Park, Colorado: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand JumpConceptual Model,DOEHazelPennsylvania: Energy Resources JumpVermont: Energy ResourcesEstes Park,

  12. Property:EstReservoirVol | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSppEnvReviewLeasingEstReservoirVol Jump to:

  13. Property:Geothermal/DOEJobsCreationEst | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to:Ezfeedflag Jump to: navigation, search PropertyCalculatedCenterGeofluidTempDOEJobsCreationEst

  14. Unipersonal y Siemsa Este SA | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directedAnnualProperty Edit withTianlin BaxinUmwelt Management AG UMaAG Jump to:Unipersonal y Siemsa Este SA

  15. CONOMIE ET STATISTIQUE N 457-458, 201298 L'automobile est parfois perue comme

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    #12;�CONOMIE ET STATISTIQUE N° 457-458, 201298 L'automobile est parfois perçue comme emblématique d'équipement et aux consommations matérielles (Gartman, 1991). Il est ainsi parfois avancé que l'automobile ne- nismes socio-économiques. L'automobile est de ce fait souvent prise comme exemple d'un bien dont les

  16. Estes Park Light and Power Department- Commercial and Industrial Energy Efficiency Rebate Program

    Broader source: Energy.gov [DOE]

    Estes Park Power & Light, in conjunction with the Platte River Power Authority provides businesses incentives for new construction projects and existing building retrofits. The Electric...

  17. Approximations. -Il est bon d'indiquer quelles approximations nous avons fuites : toutes d'ailleurs

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    'est-à-dire du même ordre de grandeur que (HHo)2, par rapport à d2udt etd2vdt et par conséquent négli- geables

  18. Guidelines for Participation in the ETV ESTE Verification Test of Lead Paint Test Kits

    E-Print Network [OSTI]

    Guidelines for Participation in the ETV ESTE Verification Test of Lead Paint Test Kits Revised 09/24/2009 The following guidelines have been set to establish the eligibility of individual test kits for participation in the ETV ESTE verification test of lead paint test kits. Test kits must conform to the following guidelines

  19. Rsum--La pile combustible est une technologie alternative pour la propulsion des vhicules lectriques.

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    Résumé-- La pile à combustible est une technologie alternative pour la propulsion des véhicules...) pour assurer l'alimentation et la gestion de l'hydrogène et de l'air. Un modèle du générateur à pile à standard utilisé dans les applications transport. I. INTRODUCTION La pile à combustible (PAC) est un

  20. enero-marzo2007Cinvestav44 El espectro electromagntico (EEM) est constituido

    E-Print Network [OSTI]

    enero-marzo2007·Cinvestav44 El espectro electromagnético (EEM) está constituido por un conjunto de-marzo2007·Cinvestav45 El EEM visible está presente en nuestro entorno diario, es decir, todo lo que nos

  1. Facult des sciences infirmires Le Baccalaurat en sciences infirmires est offert selon divers par-

    E-Print Network [OSTI]

    Montréal, Université de

    titulaires d'un DEC en soins infirmiers, première composante du DEC- Baccalauréat intégré et à l'intention des infirmières et infirmiers en exercice. Le programme est offert selon deux modalités : temps plein destiné aux infirmières et infirmiers en exercice. Le parcours est constitué de trois étapes, les Mineures

  2. Logiciel de Gestion de Version Qu'est-ce qu'un Version Control System (VCS) ?

    E-Print Network [OSTI]

    Tichit, Laurent

    Logiciel de Gestion de Version Git Qu'est-ce qu'un Version Control System (VCS) ? Appelé également Logiciel de Gestion de Révision (RCS), un VCS est un outil qui permet de : · de suivre l'évolution d revenir en arrière en cas de problème ; · de retenir qui a effectué chaque modification de chaque fichier

  3. L'hlium est donc beaucoup plus difficile liqufier que l'hydro-gne dont le point critique est d'environ -

    E-Print Network [OSTI]

    Boyer, Edmond

    372 L'hélium est donc beaucoup plus difficile à liquéfier que l'hydro- gène dont le point critique près. L'auteur en conclut que le thermomètre à hydro- gène peut servir à déterminer les basses résistance servent à la détermination des températures, est enfermé dans le réservoir du thermomètre à hydro

  4. Evolution and comparative genomics of subcellular specializations: EST sequencing of Torpedo electric organ

    E-Print Network [OSTI]

    Vertes, Akos

    Evolution and comparative genomics of subcellular specializations: EST sequencing of Torpedo discovery Open reading frame (ORF) Uncharacterized open reading frames (ORFs) in human genomic sequence Elsevier B.V. All rights reserved. 1. Introduction The availability of complete genomic sequences

  5. Space and Time Efficient Parallel Algorithms and Software for EST Clustering

    E-Print Network [OSTI]

    Brendel, Volker

    Space and Time Efficient Parallel Algorithms and Software for EST Clustering Anantharaman. The novel features of our approach include 1) design of space-efficient algorithms to limit the space

  6. ans cette puissance rgio-qu'est l'Iran, les don-

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    EDITORIAL ans cette puissance régio- nale1 qu'est l'Iran, les don- nées démographiques met- tent en diversité ethnique et religieuse d'un pays qui passe souvent pour homogène. En effet, les périphéries de l'Iran majorité perse. � l'extrême sud-est, le peuplement de l'Iran comprend des baloutches (Province du Sistan

  7. Est. 6/09, Revised 6/13 Page 1 Processing Research Participant Costs

    E-Print Network [OSTI]

    Firestone, Jeremy

    Est. 6/09, Revised 6/13 Page 1 Processing Research Participant Costs Support, Patient Care. Participant Support Participant support costs are payments provided to a study participant or to a workshop. These costs are expressed as non-salary expenses and carry no facilities and administrative costs on the grant

  8. Blind identification of MISO-FIR channels Carlos Est^ev~ao R. Fernandes

    E-Print Network [OSTI]

    Boyer, Edmond

    Blind identification of MISO-FIR channels Carlos Est^ev~ao R. Fernandes , Pierre Comon , G, vol.90 Abstract In this paper, we address the problem of determining the order of MISO channels to false alarm. Afterwards, we introduce the concept of MISO channel nested detectors based on a deflation

  9. Un nouvel lment : le Radiothorium dont l'manation est identique celle du Thorium 1

    E-Print Network [OSTI]

    Boyer, Edmond

    Un nouvel élément : le Radiothorium dont l'émanation est identique à celle du Thorium 1 Deuxième principalement par un mélange de terres rares, dont le thorium était la plus abondante. M. Dunstan, qui avait ii (pie la radioactivité des parties les plus solubles était identique il celle du thorium. Il fallait

  10. Que pas este? Narrativas sobre o Brasil criadas por brasileiros residentes no exterior

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    Que país é este? Narrativas sobre o Brasil criadas por brasileiros residentes no exterior Luis utilizados no Brasil, como o Orkut, existem mais de sessenta comunidades com o título "Brasileiros-representação e a imagem do Brasil e dos brasileiros no exterior ou sobre a percepção da terra de chegada. O

  11. denomino CASA CON-CIENCIA. Este proyecto naci gracias a la inquietud de la Asociacin Gilberto

    E-Print Network [OSTI]

    una propuesta constructiva que permita crear y re-crear el entorno de las familias en el medio rural del Gobierno del Estado de Querétaro, la Secretaría de Desarrollo Urbano y Obras Públicas del Estado (SDUOP). El propósito de este proyecto fue la edificación de 10 casas rurales de entre 56 y 59 m2 en

  12. Quelle est l'attitude actuelle des PMI franaises l'gard

    E-Print Network [OSTI]

    Boyer, Edmond

    Quelle est l'attitude actuelle des PMI françaises à l'égard des pratiques de planification? Cette cadre d'analyse pertinent susceptible de faciliter l'observation des pratiques dans les PMI. À partir d'article débouche sur un essai de classification typologique des PMI en fonction de leurs attitudes et de leurs

  13. La Charte dveloppement durable des tablissements publics et entreprises publiques est l'expression

    E-Print Network [OSTI]

    Jeanjean, Louis

    organismes s'engagent à intégrer ces principes dans leur propre stratégie, leur management et leurs relations Centre des monuments nationaux Centre hospitalier universitaire de Brest Chambre de commerce et d les systèmes de management et d'évaluation des performances. Il est régulièrement évoqué au Conseil d

  14. Transfert de gestion et conservation de la biodiversit de Makira, Nord-Est de Madagascar

    E-Print Network [OSTI]

    Boyer, Edmond

    Transfert de gestion et conservation de la biodiversité de Makira, Nord-Est de Madagascar gestion rationnelle mise en place ces dernières années à Makira montre un certain niveau de contribution à communautés, système de suivi 1 Introduction Le transfert de gestion, reconnu comme outil dans le programme

  15. New Mexico's Flagship University est.1889 THE UNIVERSITY of NEW MEXICO

    E-Print Network [OSTI]

    New Mexico, University of

    New Mexico's Flagship University est.1889 THE UNIVERSITY of NEW MEXICO 2013 LegisLative initiatives INSPIRE BE INSPIRED #12;Greetings. As a native son of New Mexico, I am honored to serve as the University of New Mexico's 21st President. I grew up in Las Cruces and earned a swimming scholarship to UNM, where I

  16. Copias electrnicas de este folleto estn a disposicin en la Internet (http://www.niehs.nih.gov/emfrapid).

    E-Print Network [OSTI]

    Bezrukov, Sergey M.

    @niehs.nih.gov). Traducción el español por M. Eta Trabing Este folleto fue imprimido originalmente en 1995, como parte del

  17. EIS-0483: Estes to Flatiron Substation Transmission Lines Rebuild Project, Larimer County, Colorado

    Broader source: Energy.gov [DOE]

    Western Area Power Administration (Western) – with USDA Forest Service, Arapaho and Roosevelt National Forest, as a cooperating agency – is preparing an EIS that analyzes the potential environmental impacts of a proposal to rebuild and upgrade two 115-kilovolt single-circuit transmission lines between the Flatiron Substation and the intersection of Mall Road and U.S. Highway 36 in Estes Park, Larimer County, Colorado. Additional information is available on Western’s project website.

  18. La pollution marine est gnralement provoque par les eaux uses, d'origines

    E-Print Network [OSTI]

    La pollution marine est généralement provoquée par les eaux usées, d'origines domestiques long des bassins-versants qui débouchent sur la mer. Pollution marine 16 Métaux Ils présentent trois indique généralement l'existence d'autres sources de pollution. © Ssuaphoto / Dreamstime.com © Uatp1

  19. M. Arnaboldi EST Science from UKIDSS, Garching, Dec 17, 2007 -1 The Public Surveys at ESO (PS@ESO)

    E-Print Network [OSTI]

    Crowther, Paul

    M. Arnaboldi ­ EST Science from UKIDSS, Garching, Dec 17, 2007 - 1 The Public Surveys at ESO (PS from UKIDSS, Garching, Dec 17, 2007 - 2 PS@ESO: Outline · Survey telescopes at ESO : VISTA and VST. Arnaboldi ­ EST Science from UKIDSS, Garching, Dec 17, 2007 - 3 Survey telescopes: VISTA & VST More than 75

  20. THESE DE DOCTORAT DE L'UNIVERSITE PARIS-EST l'ICMPE EQUIPE SPC (Systmes Polymres Complexes)

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    THESE DE DOCTORAT DE L'UNIVERSITE PARIS-EST Préparée à l'ICMPE ­ EQUIPE SPC (Systèmes Polymères'est déroulé dans la meilleure ambiance qui soit, et ceci grâce aux thésards, post docs et stagiaires du SPC

  1. Master 2 Atiam : Traitement du Signal Audionumerique. Duree : 2h. Aucun document n'est autorise.

    E-Print Network [OSTI]

    Badeau, Roland

    (z) = nZ x(n)z-n ­ Fonction d'autocovariance d'un processus X(n) stationnaire au sens large (SSL) r´e spectrale de puissance (DSP) d'un processus X(n) SSL : SX(e2i ) = kZ RX(k)e-2ik ­ Filtrage des processus SSL transfert H(z), d'un processus SSL X(n). Alors Y (n) est un processus SSL : ­ de moyenne mY = H(1) mX (o`u H

  2. Une histoire volutive La premire espce de cafier est ne il

    E-Print Network [OSTI]

    Une histoire évolutive La première espèce de caféier est née il y a moins de 400 000 ans dans une luxuriante en plaine et en altitude. Les caféiers sont largement répandus. 1 3 Quand le climat redevient plus clément, la végétation colonise à nouveau les plaines et les espèces se diversifient. La notion d

  3. Les oasis du Tafilalet Dans les oasis du Tafilalet, province situe l'est du Maroc, il faut aller

    E-Print Network [OSTI]

    Les oasis du Tafilalet Dans les oasis du Tafilalet, province située à l'est du Maroc, il faut aller T E R R A N � E Maroc #12;

  4. Mon cousin le gorille --Contre toute attente, une partie du gnome de l'homme est plus proche de celui

    E-Print Network [OSTI]

    Loewith, Robbie

    femelle de la sous-espèce dite «des plaines de l'ouest» (Gorilla gorilla gorilla) est la première de ses'être humain est le chimpanzé ont donc partiellement raison. Pour certaines sé- quences du génome, il s'agit en'une idée très lacunaire même s'ils en connaissent désormais les grandes lignes. On ignore à quoi

  5. Reservoir characterization of the upper Merecure and lower Oficina Formations sands in the Leona Este Field, Eastern Venezuela Basin

    E-Print Network [OSTI]

    Flores Millan, Maria Carolina

    2001-01-01T23:59:59.000Z

    The "S5", "T" and "U1" sands, traditionally described as part of the lower section of the "Oficina" Formation, and the "U2" sand, as part of the upper interval of the "Merecure" Formation, contain the largest oil remaining reserves of the Leona Este...

  6. Le coup d'oeil du scarabe : Charles Nordmann, ou pourquoi la guerre est l'affaire des savants

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    'Alsace allemande, c'est le choc. Pour la première fois, Nordmann croise des soldats qui reviennent du front colonne de quatre. L'un de ces petits soldats nous raconte que, parmi les monceaux de cadavres prussiens scientifique, à peine atténuée par le fait qu'il décrive l'anéantissement de soldats ennemis. La mort fauche la

  7. Resumen--En este trabajo se describe la aplicacin de tcnicas de descubrimiento de reglas de descripcin de

    E-Print Network [OSTI]

    Granada, Universidad de

    Resumen-- En este trabajo se describe la aplicación de técnicas de descubrimiento de reglas de enseñanza a distancia Moodle. El objetivo consiste en extraer reglas que describan relaciones entre el uso a distancia, algoritmos evolutivos, reglas difusas. I. INTRODUCCI�N En la actualidad existe un incremento de

  8. de la Durance La Provence, dans le sud-est de la France, entretient une longue tradition

    E-Print Network [OSTI]

    La plaine de la Durance La Provence, dans le sud-est de la France, entretient une longue tradition, les canaux d'irrigation créent des milieux humides, riches en biodiversité. Ils alimentent les nappes d'eau souterraines. Et, ils limitent les crues en drainant les eaux de pluie. Des associations

  9. observations l'aide de ma formule, on trouve pour les trois points les constantes sui vantes, dont l'accord est beaucoup plus satisfai-

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    nodales analogues à celles de Chladni ; le centre est un point nodal. 2° Ces figures n'ont jamais un

  10. La muerte del letrado Este trabajo estudia un fenmeno de suma importancia: el paso de una monarqua

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    1 La muerte del letrado Este trabajo estudia un fenómeno de suma importancia: el paso de una frente al reino. Se modificó sobre todo la práctica: la distancia creciente entre una teoría cada vez más, de J.M. Pelorson; El señor inquisidor y otras vidas por oficio, de J. Caro Baroja; los trabajos de J

  11. pastel-00956606,version1-7Mar2014 A partir d'une analyse diachronique de thermographies satellitaires, il est

    E-Print Network [OSTI]

    thermographies satellitaires, il est possible de calculer le courant à la surface de l'océan en faisant appel à 1 thermographies sont issues des données des satellites de la série NDAA, équipés d'un capteur AVHRR. La résolution ensuite filtrées afin d'éliminer les fréquences indésirables. La rroyenne des deux thermographies fournira

  12. IAE Gustave Eiffel Master 2 Gestion de Portefeuille Universit ParisEstCrteil Mathmatiques appliques la finance

    E-Print Network [OSTI]

    Printems, Jacques

    . 4. Dans le cas où les cotes restent les mêmes, expliquer comment un joueur peut tirer parti de cetteIAE Gustave Eiffel Master 2 Gestion de Portefeuille Université Paris­Est­Créteil Mathématiques concernant une course de 4 chevaux. Une cote « a contre b » sur le cheval i signifie que a e pariés sur i

  13. La distribution d'automobiles neuves en Europe est rgie par un rglement d'exemption aux rgles de la

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    La distribution d'automobiles neuves en Europe est régie par un règlement d'exemption aux règles de contexte, les concessionnaires doivent repenser leur métier de distributeurs automobiles pour transformer les menaces en opportunités. Les spéculations sur l'avenir du système de la distribution automobile en

  14. La pntration de l'hydrogne est une action trs lente, compa-rable l'chaunement par conductibilit. Les conditions de cette

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    , on arrive à deux formules identiques à celles qui ont été données plus haut. Ainsi l'effet Peltier est une établie. II. L'effet Peltier peut être considéré comme l'analogue de la polarisation : comme elle, il

  15. sont ceux o la surface est tangente un cne au lieu d'tre tan-plan; ils sont disposs symtriquement deux par deux

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    'unité Siemens et l'unité britannique ou Ohm. L'unité Siemens est la résistance d'un prisme de mercure pur de i million d'Ohms. La conversion des unités Siemens en Ohnms, ou inversement, se fait en sachant que 1 Ohm - 1,0486 unités Siemens, i unité Siemens = o,9536 Ohm. L'étalon est construit en alliage de platine

  16. EST VIRGINIA UNIVERSITY Undergraduate

    E-Print Network [OSTI]

    Mohaghegh, Shahab

    , supplement, or otherwise amend the information, course offerings, requirements, rules, and policies contained be directed to the Section 504, Title IX Coordinator, Office of the President (304) 293-4160. West Virginia

  17. A review of "Isabella d'Este and Francesco Gonzaga: Power Sharing at the Italian Renaissance Court" by Sarah D. P. Cockram

    E-Print Network [OSTI]

    Litchfield, R. Burr

    2014-01-01T23:59:59.000Z

    invasions of Emperor Charles V in the 1520s that eventually made much of Italy a colony of Spain. Isabella d’Este (born 1474) was the eldest daughter of Ercole I d’Este, Duke of Ferrara. As 78 seventeenth-century news a girl, she received a thorough..., Guildobaldo da Montefeltro fled to Mantua, where Isabella sought French support for him, permitting his return to Urbino. Ultimately, reviews 79 Alexander’s successor, Pope Julius II, arranged to capture Cesare in 1504 and sent him to Spain, where he...

  18. L'Antiquit tardive dans l'Est de la Gaule, I, p. 173-207 (30e suppl. la RAE), SAE 2011 * Inrap Grand-Est Sud (stephane.venault@inrap.fr; sylvie.mouton-venault@inrap.fr; nicolas.tisserand@inrap.fr).

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    ERS� : le cas intermédiaire d'une occupation rurale aux iiie et ive siècles ap. J.-C. entre Fragnes et Virey-le-Grand au nord-est de Chalon-sur-Saône (Saône-et-Loire) Stéphane venault*, Sylvie mouton-venault*, Nicolas tisseranD*, Pierre nouvel** Le projet d'aménagement d'un campus industriel au nord-est de Chalon

  19. FISH & WILDLIFE COSTS < 12th ANNUAL REPORt tO thE NORthwEst GOvERNORs < PAGE 1 2012 Columbia River Basin

    E-Print Network [OSTI]

    FISH & WILDLIFE COSTS Basin Fish and Wildlife Program Costs Report 12TH AnnuAL REPORT TO THE nORTHWEST GOvERnORS #12;PAGE 2 > 12th ANNUAL REPORt tO thE NORthwEst GOvERNORs > FISH & WILDLIFE COSTS 851 S.W. SIxTH AvEnuE, Su

  20. Centre de Liqufaction d'hlium du LPS L'hlium (He) est un gaz incolore, inodore et non toxique, inerte chimiquement,

    E-Print Network [OSTI]

    Paris-Sud 11, Université de

    Centre de Liquéfaction d'hélium du LPS L'hélium (He) est un gaz incolore, inodore et non toxique, inerte chimiquement, très léger : 0,125 kg / litre liquide à 4.2 K et 0,1785 mg / litre gaz (à 0 °C, 1 gaz associés au gaz naturel: (Russie, Algérie, Qatar, Etats-Unis ...) Extraction du gaz: Liquéfaction

  1. Des six projets de recherche en concurrence, Graphene est l'un des deux slectionns par le programme FET (Future and emerging tech-

    E-Print Network [OSTI]

    Halazonetis, Thanos

    Des six projets de recherche en concurrence, Graphene est l'un des deux sélectionnés par le reconnu en nano-électronique et en matériaux et représentant suisse du projet Graphene (Graphene agship). Aujourd'hui l'Europe lance un projet de recherche d'une envergure sans précédent ( agship). Graphene

  2. r XXXX American Chemical Society A dx.doi.org/10.1021/es2013424 |Environ. Sci. Technol. XXXX, XXX, 000000 pubs.acs.org/est

    E-Print Network [OSTI]

    , 000­000 ARTICLE pubs.acs.org/est Impact of Fuel Quality Regulation and Speed Reductions on Shipping erin St., Toronto, Canada 3 Aerodyne Research Inc., Billerica, Massachusetts, United States O Centre Science, Harvard University, Cambridge, Massachusetts, United States bS Supporting Information 1

  3. Dans l'espace Le problme en volume est moins simple qu'il n'en a l'air.

    E-Print Network [OSTI]

    Pansu, Pierre

    Dans l'espace Le problème en volume est moins simple qu'il n'en a l'air. Cela ressemble à une de savon maximise l'aire enserrée par la ficelle (en minimisant l'aire du complémentaire). A New

  4. http://dx.doi.org/10.1090/conm/426/08187 Licensed to Penn St Univ, University Park. Prepared on Sun Dec 29 17:35:46 EST 2013 for download from IP 128.118.88.48.

    E-Print Network [OSTI]

    Bressan, Alberto

    on Sun Dec 29 17:35:46 EST 2013 for download from IP 128.118.88.48. License or copyright restrictions may(t,O+),z(t))dt. ~ Licensed to Penn St Univ, University Park. Prepared on Sun Dec 29 17:35:46 EST 2013 for download from IP://www.ams.org/publications/ebooks/terms #12;~ Licensed to Penn St Univ, University Park. Prepared on Sun Dec 29 17:35:46 EST 2013 for download

  5. Dans le Jrid1, rgion d'oasis du Sud-Ouest tunisien, un sentiment de crise qui concerne les ressources foncires et aquifres est sensible. Cette

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    Battesti anthropologue 10/05/05 17:40 Page 201 #12;cas. En général, la référence est centrée sur sa propre origine spatiale (« en France, les rendements... » ou « dans le nord de la Tunisie, les fellahs sont les discours locaux que scienti- fiques deux registres de causes, soit le foncier, soit l'eau d

  6. 1 L. Schneider, Traditions et renouveau de l'habitat de hauteur dans la Gaule du sud-est Entre Antiquit et haut Moyen Age

    E-Print Network [OSTI]

    Boyer, Edmond

    'un habitat de plaine qui pouvait être également groupé (Raynaud 2002a), le concept d explorés. Face à la traditionnelle rhétorique des ruptures et des continuités, il reste toujours à mettre. Schneider, Traditions et renouveau de l'habitat de hauteur dans la Gaule du sud-est habitats de plaine et

  7. EA-1899: Rerouting and Renovating of Estes-Flatiron Three Transmission Lines to Double Circuit 115-kV, Larimer County, Colorado

    Broader source: Energy.gov [DOE]

    DOE’s Western Area Power Administration started to prepare an EA to evaluate the environmental impacts of a proposal to reroute and renovate the Estes-Flatiron Three Transmission Lines in Larimer County, Colorado. Based on comments received during the scoping period, Western ended preparation of DOE/EA-1899 and announced its intent to prepare and environmental impact statement, DOE/EIS-0483.

  8. Rsum --L'industrie automobile est aujourd'hui caractrise par la varit des produits proposs, le cycle de vie toujours plus

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    Résumé -- L'industrie automobile est aujourd'hui caractérisée par la variété des produits proposés constructeur automobile PSA Peugeot Citroën, permettant de mettre en évidence et d'évaluer les impacts globaux, Chaîne logistique, Production automobile. I. CONTEXTE INDUSTRIEL ET PROBLEMATIQUE A. Caractéristiques de

  9. Historia, Nación y Género: La representación de la historia en El ataúd de uso y No pertenezco a este siglo de Rosa María Britton 

    E-Print Network [OSTI]

    George, Ana

    2010-07-14T23:59:59.000Z

    demostrar la relaci?n entre las nuevas naciones y las novelas rom?nticas del siglo XIX, el presente iv estudio se apoya en el trabajo de Doris Sommer. La teor?a de la narrativa y representaci?n hist?rica de Hayden White sirvieron para aclarar la idea de...?tico-sociales. Algunos de los temas que se trataban en dichas obras incluyen el mestizaje y la jerarqu?a de clases, los mismos que apuntaban hacia proyectos nacionales ut?picos. Las dos novelas hist?ricas que se analizan en este trabajo presentan caracter?sticas de las...

  10. Historia, Nación y Género: La representación de la historia en El ataúd de uso y No pertenezco a este siglo de Rosa María Britton

    E-Print Network [OSTI]

    George, Ana

    2010-07-14T23:59:59.000Z

    cotidiana de los personajes, en los detalles m?s intr?nsecos del tiempo hist?rico donde se desarrolla la acci?n, y resaltar lo que es espec?fico a ese tiempo determinado. Por medio de la interacci?n entre los personajes, el tiempo hist?rico determinado y... Britton, el h?roe es un individuo y que por medio de la narraci?n de este individuo se presenta el destino de toda una naci?n. En cuanto a la condici?n hist?rico-filos?fica de la novela, Luk?cs indica que la novela es la ?pica que ha sido abandonada por...

  11. Qu'est-ce que c'est le climat?

    E-Print Network [OSTI]

    Lovejoy, Shaun

    réchauffement anthropogenique dérange notre sen/ment de place et d'importance. -Copernic-arguments superficiellement scien/fiques.... #12;Ca a commencer avec Copernic: les hélioscep

  12. ...ests en la unam ests en tu casa...

    E-Print Network [OSTI]

    Islas, León

    , aplicación de pintura antigraffiti en 64 mil metros cuadrados, sustitución de siete mil 250 luminarias y de

  13. Este trabajo ha contado con la financiacin del Plan Nacional de Ciencia y Tecnologa (CICYT TEL96 1304C0201) y del Departamento de Industria del Gobierno Vasco (PGTI96 CO96RO01).

    E-Print Network [OSTI]

    Miguel-Alonso, José

    Este trabajo ha contado con la financiación del Plan Nacional de Ciencia y Tecnología (CICYT TEL96 formación a distancia: IKASTEL J. Aramberri, F. Abal, M. Gamboa, J. Lasa y J. Miguel Departamento de para el aprendizaje a distancia. Las universidades tradicionales se basan en un modelo de aprendizaje

  14. Prdidas de insercin en diferentes tipos de materiales y rboles El gran avance que se est produciendo en los sistemas WiFi y WiMAX, y su habitual

    E-Print Network [OSTI]

    Autonoma de Madrid, Universidad

    trabajo que operan estos sistemas. Debido a la escasa información que existe con respecto a estas pérdidas escenarios, tanto interiores como exteriores, para las bandas de trabajo de 2.4 GHz, 3.3 GHz y 5.5 GHz. Este estudio se realizará a partir de enlaces de corta distancia, donde el obstáculo se interponga directamente

  15. *. Cet expos a t prpar dans le cadre de l'Amicale 1997 runissant les anciens de la Facult de droit de l'Universit de Sherbrooke qui s'est tenue Sherbrooke le 25 octobre 1997.

    E-Print Network [OSTI]

    Spino, Claude

    *. Cet exposé a été préparé dans le cadre de l'Amicale 1997 réunissant les anciens de la Faculté de droit de l'Université de Sherbrooke qui s'est tenue à Sherbrooke le 25 octobre 1997. **. Professeure à . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 284 #12;#12;(1997-98) 28 R.D.U.S. Le patrimoine familial : aspects civils et fiscaux 259 1. E

  16. Cela fait maintenant plus d'une douzaine d'annes que l'on parle d'un TGV Rhin-Rhne : c'est en effet au

    E-Print Network [OSTI]

    Boyer, Edmond

    (raccor- dement de Lutterbach). Après avoir traversé la plaine de la Saône, il longe de plus ou moins près. Il est ainsi le premier TGV qui n'a pas pour but exclusif de relier Paris à la province, renforçant encore le rôle centra- lisateur de la capitale. Au contraire, il serait le premier TGV interrégional. Les

  17. MEIC Electron Cooling Simulation Using Betacool

    SciTech Connect (OSTI)

    Zhang, He [JLAB; Zhang, Yuhong [JLAB

    2013-12-01T23:59:59.000Z

    Electron cooling of ion beams is the most critical R&D issue in Jefferson Lab's MEIC design. In the ion collider ring, a bunched electron beam driven by an energy-recovery SRF linac assisted by a circulate ring will be employed to cool protons or ions with energies up to 100 GeV/u, a parameter regime that electron cooling has never been applied. It is essential to understand how efficient the electron cooling is, particularly in the high energy range, to confirm the feasibility of the design. Electron cooling is also important in LEIC design although the ion energy is 25 GeV/u, lower than MEIC. In this paper, we will present first results of the simulation studies of electron cooling processes in the collider ring of both MEIC and LEIC using BETACOOL code.

  18. Une haie-vive : qu'est-ce que c'est ? Une haie est compose de buissons,

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    Nord de la Cote d'Ivoire D.Louppe Créer une haie vive Principales espèces concernées Actuellement, les haies concernent essentiellement les zones de savanes du Nord de la Côte d'Ivoire où il peut y avoir des. En Côte d'Ivoire, on multiplie aisément les espèces suivantes : Erythrina senegalensis, Euphorbia

  19. Apres le deluge, c`est moi

    SciTech Connect (OSTI)

    Muench, W.F. [Hawaiian Electric Co., Honolulu, HI (United States)

    1996-08-01T23:59:59.000Z

    This paper is basically intended for the companies that have already started their AM/FM/GIS project and are planning for the transitional period upon completion. From an end-user`s perspective, it will present the challenges that arose during the start-up phase and how HECo has (and has not) fared. During project development, we had a consultant on board to help us with the initial planning, specifications, vendor selection digitizing, and QA/QC. Now that the project is installed, however, all the consultants and vendors are gone, and we`re now left on our own to struggle with this new technology. As the division head for HECo`s Mapping and Records Division, I now find myself as a principal end-user with the charge of now having to prove out all those benefits I promised 6 years ago as the project manager for the original AM/FM design project This paper will discuss the problems of: (1) re-organizing the work flow, (2) acquiring adequate manpower, (3) backlog buildup, (4) training, (5) tracking the benefits, (6) bringing this new technology into a company that is also trying to face the myriad of other challenges facing all utilities today.

  20. UNIVERSIT PARIS-EST COLE DOCTORALE

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    hydrocarbures liée au trafic maritime Thèse codirigée par : M. Jean-Michel FOURNIAU, Directeur de recherche à l La pollution de la mer Méditerranée par les hydrocarbures liée au trafic maritime Thèse codirigée par-00598492,version1-6Jun2011 #12;7 Résumé Le transport maritime, surtout le transport des hydrocarbures, ne

  1. THESE DE DOCTORAT UNIVERSITE PARIS EST

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    MINERALES POUR L'IMMOBILISATION ET LA VALORISATION DES DECHETS ULTIMES DE L'INCINERATION DES DECHETS

  2. : t -.:]:este UHoRAKEYE Etainable Developmen!

    E-Print Network [OSTI]

    Peinke, Joachim

    -r-,: :uihors lEir: it.1: ''!: .:.r l1r:i_: -a:'1 -tt':ne'::. t-horakeye r!.r.:l:-: -.i rural electrification and economic assessment olthe utilisation oljatropha oil for 108 rural electrification purposes in Mali Luc on enhancing : r::=:: ;harge adaptive capacity of rural communities in Nepal: A case ;--r_, :: a renewable

  3. Julho de 2013 Controle de acesso est

    E-Print Network [OSTI]

    Souza, Max O.

    radiologia do Huap entra na era digital Huap iniciará a reforma da UTI e UI neonatal e maternidade Mais

  4. 4 Mars 2012 Quelle est votre formation ?

    E-Print Network [OSTI]

    Gutkin, Boris

    Science Drilling program, président de la division Climate Past, Present & Future de l présente. Géographes, théoriciens de la dynamique des fluides, physiciens, éco- logistes, mathématiciens

  5. Introduccin Un nmero creciente de estudios est

    E-Print Network [OSTI]

    Traveset, Anna

    integración de especies invasoras en las comunidades nativas, además de determinar el éxito de muchas de las reestablecimiento de las especies originales. Algunas invasoras se benefician al ser introducidas en regiones del

  6. EST-380-NEDA | netl.doe.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville Power AdministrationField Campaign:INEA :Work4/11 ENVIROISSUES ESF 12 Events

  7. Incubateur PACA Est | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are8COaBulkTransmissionSitingProcess.pdfGetecGtel JumpCounty,Jump to:Unconventional Gas MarketIncreaseGlobalCoalPACA

  8. Energy Saving Trust EST | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directedAnnualPropertyd8c-a9ae-f8521cbb8489 No revision|LLC Place: Ketchum,SPARQLFailed to load RSS feed

  9. Updated May 22, 2014 Equipment Type Type of Service Requested Est Hrs Est $

    E-Print Network [OSTI]

    hrs 2 $110 Trouble shoot system problems - 2 hrs 2 $110 Minus 80 Freezer 6 month preventative maintenance - 1 hr 1 $55 Replace backup battery - 1 hr 1 $55 Replace compressor started relay - 2 hrs 2 $110 Replace door seal - 2 hrs 2 $110 Shut down - 1 hr 1 $55 Trouble shoot power supply problem - 3 hrs 3 $165

  10. Acta Cryst. (1976). A32, 281 Application of Multivariate Distribution Theory to Phase Extension for a Crystalline Protein

    E-Print Network [OSTI]

    Yonath, Ada E.

    1976-01-01T23:59:59.000Z

    were calculated in the range from 3"3 to 2.5 A (2000 phases) using as a starting set the phases out of usefulness in structure determination. Predictions with the two different starting sets were studied using to protein structures (Reeke & Lipscomb, 1969; Weinzierl, Eisenberg & Dickerson, 1969; Coulter & Dewar, 1971

  11. BULLETIN OF THE UNITED STATES FISH COMMISSION. 125 With reference to the quantity packed in.the maritime provinces an-

    E-Print Network [OSTI]

    consists of water carrying in suspension a dark oily ~ubstance,which passes iiito Rock (;reek either of such discharges in afi'ectingunfavorably the conditions of life in the water. 1 1 beg, respectfully, to report into usoful matter. (E) The establishment engaged in the conversion of the cod tar pro. duct from the ~`~Shi

  12. NEED HELP WITH YOUR APPLICATION? Visit HealthCare.gov or call us at 1-800-XXX-XXXX. Para obtener una copia de este formulario en Espaol, llame 1-800-XXX-XXXX. If you need help in a language other than English, call 1-800-XXX-XXXX and tell the

    E-Print Network [OSTI]

    Acton, Scott

    NEED HELP WITH YOUR APPLICATION? Visit HealthCare.gov or call us at 1-800-XXX-XXXX. Para obtener una copia de este formulario en Español, llame 1-800-XXX-XXXX. If you need help in a language other than English, call 1-800-XXX-XXXX and tell the customer service representative the language you need

  13. Le projet de Sorbonne Paris Cit est un des laurats de la deuxime vague des appels Ini a ves d'excellence lancs dans le cadre des Inves ssements d'avenir. Au total, 8 projets, dont 4 en Ile-de-France, ont t slec onns par un

    E-Print Network [OSTI]

    Powell, Geoffrey

    Le projet de Sorbonne Paris Cité est un des lauréats de la deuxième vague des appels Ini a ves d-économique. L'appel à projets Ini a ve d'excellence a été lancé par l'Etat en 2011 dans le cadre du programme capables de rivaliser avec les meil- leures universités du monde. Les ini a ves d'excellence "réuniront

  14. '¿Est?ás Triste?' : coauthoring empathy and emotion in interaction

    E-Print Network [OSTI]

    Duncan, Whitney L.

    2008-01-01T23:59:59.000Z

    responsibility No pero no estás sola No but you’re not alonetrip 14. L: O:h ¿te sientes sola? Oh, you feel alone? 15: M:familia aquí Estoy sola, no tenemos para— supuestamente

  15. Colorado 11/2002 3 mono SPI ESTES PAR!,

    E-Print Network [OSTI]

    , 0:34 STERUNG 0'26 -6.54 LAMAR 0~1 O~0 0:15 0:2 0:20 0:66 0:92 SPRINGFIELD CORTEZ 0:49-6.10 TRINIDAD·92 0*.47 0*.09 BURUNGT~N 0*.16 0*.690*.14 CHEYENNE WE 0·66 0*.650*.25 0'15 0*.441 LAMAR 0*.27 0*.65 O:29 -6.93 -6.9 0.0.. ~ CHEYENNE WE -6.02 LAMAR -6.12 BURIJNGT~N -6.78 -6.77 -6.25 -6.77 AKRON -6

  16. Qu'est-ce qu'un crime de masse ?

    E-Print Network [OSTI]

    Boyer, Edmond

    atrocités commises par des soldats contre d'autres soldats dans la dyna- mique même du combat2 : car il

  17. Est Chile preparado para el Retail de Energa Elctrica?

    E-Print Network [OSTI]

    Rudnick, Hugh

    Santiago Gastos e Inversiones por ~180 MMUSD/año Inversiones por más de 800 MM USD en 12 años 0 10 20 30 40 50 60 70 80 90 100 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 Inversión anual en

  18. Universit Paris-Est cole Doctorale Ville et Environnement

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    into account urban climate in urban planning Directeur de thèse Youssef Diab Jury ACHARD Gilbert Rapporteur jury de thèse : Gilbert Achard, Luc Adolphe, Valéry Masson et Bruno Tassin. Je tiens également à, Pierre Kermen, Raphaëlle Kounkou-Arnaud, Frédéric Jacques, Sophie Labbouz, Sophie Morel, Didier Olivry

  19. UNIVERSIT PARIS-EST Sciences, Ingnierie et Environnement

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    of California, San Diego, USA Rapporteur M. Filoche D.R., CNRS, Ecole Polytechnique, Palaiseau, France les rapporteurs, Chantal Darquenne et Marcel Filoche, mais également le président du jury Emmanuel

  20. al este del: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Information Sciences Websites Summary: Roma. Alan Turing's legacy | L'eredit di Alan Turing Roma 12 e 13 Ottobre 2012 Accoglienza dei Numerico Giuseppe Longo h. 16.45-17.30...

  1. Universit Paris-Est cole Doctorale Ville et Environnement

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    , qui m'a mise sur les chemins de la recherche en m'aidant à mener cette thèse, du montage du dossier quand la pendaison de crémaillère ?), Anthony (une jolie complicité, de très bons moments), Arnaud (un

  2. arcticus est libraries: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    to David Cabitto, our graphics artist, for his skill in compiling the many excellent charts and graphs. The graphics add much to the clarity of the text. Next, to Marilyn...

  3. sobre salrios Em causa est o clculo da

    E-Print Network [OSTI]

    Instituto de Sistemas e Robotica

    Reitores e Governo não se entendem sobre salários Em causa está o cálculo da reposição dos salários. Governo faz com corte de 3,9% mas reitores dizem que é de 3%. O Governo e os reitores estão a fazer contas milhões de euros) na sua dotação, em relação ao ano an- terior. No entanto, em Outubro, o Governo aprovou

  4. artichoke est database: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    sensitive data. The security of the data depends on physical security, OS security and DBMS security. Database security can be compromised by obtaining sensitive data, changing...

  5. UNIVERSITE PARIS-EST DROIT EUROPE ET SOCIETE

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    BONNE GOUVERNANCE ET DES REALITES SOCIOPOLITIQUES EN AFRIQUE : LE CAS DE LA COTE D'IVOIRE Jury Madame Gbagbo, le père de la démocratie en Côte d'ivoire, toute la famille Krizoua Enfin. Ma pensée va à tous

  6. Th`ese de Doctorat Universite Paris-Est

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    testing is time-consuming (creep test on concrete is rec- ommended to be carried out over several months of cementitious materials, by comparing creep functions obtained by minutes-long microindentation testing that minutes-long microin- dentation testing can provide a measurement of the long-term creep properties

  7. THSE de DOCTORAT de l'universit Paris-Est

    E-Print Network [OSTI]

    Boyer, Edmond

    et son respect sans faille des délais serrés de relecture des documents que je lui ai adressés m'ont laboratoire : Mohamed, El-Jadj, Lokman, Ayech, Sébastien, Stefano, Laurent, Quing (pas sûr de l réduction de variance de type "variable de contrôle" pour la simulation par la méthode de Monte-Carlo qui

  8. EIS-0483: Estes to Flatiron Substation Transmission Lines Rebuild Project,

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels DataDepartment of Energy Your Density Isn't Your Destiny:Revised FindingDepartmentDepartment ofDepartment ofStatement | Department ofLarimer

  9. Le logo du CNRS est-il convexe ?

    E-Print Network [OSTI]

    Henrion, Didier

    2008-01-01T23:59:59.000Z

    In october 2008, CNRS adopts a new logo with a round shape. We study the mathematical representation of this shape, and in particular its convexity.

  10. Genesis Industries Holding Est GIH | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directedAnnual SiteofEvaluating A PotentialJumpGermanFifeGEXAGarnet VRXRate-Making Jump

  11. DOE - Office of Legacy Management -- Estes Gulch Disposal Cell - 010

    Office of Legacy Management (LM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA group currentBradleyTable ofArizonaBuffalo -Elk River Reactor - MNEra Tool

  12. Town of Estes Park, Colorado (Utility Company) | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directedAnnualProperty Edit withTianlin Baxin Hydropower Station JumpOpenEITown of Eatonville,Town ofTown of

  13. le pont est dsquilibr et l'on dtecte une certaine Pratiquement le champ magntique continu est

    E-Print Network [OSTI]

    Boyer, Edmond

    , giochi di ruolo online, software collaborativi, ecc...) Lo scenario: Software as a Service - I From Wikipedia [en.wikipedia.org/wiki/Software_as_a_service]: Software as a service (Saa hardware and software maintenance and support to the SaaS provider. [...] The term "software as a service

  14. An insect assay for essential fatty acids

    E-Print Network [OSTI]

    Kerur, Dundappa Ramachandrappa

    1956-01-01T23:59:59.000Z

    ~ " ' ?, ? '-' exyex wen4ji'. M@leahi@. th@4 tJie yieaenee:. . of douM. 'e:boccie st ths'6t'f en@ g(10' poa3;Mgna, couzL52Eg, -'gx QN. Mle le?Q~ Th's'b'loant9vkty'6eexeaaea. vhen the nueLbeg . of-. . double, honda '. gene'alon nay aoiuel3, @ 9nezsieas the eaaen~3. a... ~ ~ &&. 7 3; @. 8; '' &7 . " T9;& C 3. 2$ ~G . K . . x6. g 1. g. 5 g . G. x e::. e ', , g5 gx. '8, '; ', l. ( N ops imp@i ieveio ' coxx&dgetje amex'pence q? f~i j ' gcvnL~G@ I 'motIA ie 'abahvvet3@', . -Xejg. ex' QQgg6ecect 52$t. -'i~leic acid...

  15. 9" La temprature critique de l'ther est gale 197,0 C. La pression critique est gale 27 1 8,mm == :~5alm, )'66. Le volume

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    de naphtaline ou de pétroles. Les pétroles ont été obtenus par distillation fractionnée, et l'on peut obtenir avec eux des températures varian t de 2620 à 2770 par fraction de degré. Les températures qui, tout d'abord, avaient été déterminées au moyen d'un thermomètre à air, ont été mesurées à l'aide d

  16. September 2011 Publicado por la O cina de Asuntos Internacionales Toda la informacin contenida en este folleto est disponible en linea. Para informacin ms

    E-Print Network [OSTI]

    Wu, Yih-Min

    requeridos Hay dos centros de lenguaje en NTU. Por favor contac- tarlos directamente para la solicitud

  17. Geology of an area between Bluff and Honey Creeks, Mason County, Texas

    E-Print Network [OSTI]

    Fritz, Joseph Francis

    1954-01-01T23:59:59.000Z

    , the proWambrian rooks oonaist ef two metsmorphio unite y tho mar'bl o and the gneiss y an4 'two tnt rus i vs bodies ~ the ooareo~rainsd granite and the fino~ained granite. The Cambrian reeks aro 4ivido4 into tho Riley snd Nil borne formations... of the marble outcrop are 1} in- trusive caxtacts with precambrian granites, 8) overlap by basal Palsoso1c bede, snd 5) fault ccntacts with lower Paleosoic beds. There are two different precambrian granites which have intrusive contaots w1th ths marble unit...

  18. EST analysis of male accessory glands from Heliconius butterflies with divergent mating systems

    E-Print Network [OSTI]

    Walters, James R.; Harrison, Richard G.

    2008-12-08T23:59:59.000Z

    proteins observed in the male accessory gland cDNA libraries. Dots (.) indicate identity between sequences; tildes (~) represent alignment gaps; Hme00007 MNKILILLVVILGAMCLVEAEHDSNLDSKRAAGCPPGQEEYYGMCYGTRKSESGRRDQSGGLNNNNRRSQ Her00048 .KN..N..L..MA...I.A.....YYPS.N.RQ.P.........N.R...S.QG.I.ELG..R~~HHIG...E Hme00007 NEGLNNNNRRSQWEGLNNNNRRSQREGLNNNNRRSQSRELNNNNRRSQSGELNNNNRRSQREGLNNNNRR Her00048 .S* Hme00007...

  19. Si la loi de Joule est rigoureuse, oc = o, d'o [3 -

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    tria le, 19 (1897). Article published online by EDP Sciences and available at http://dx.doi.org/10 électrodes du tube qui maintenant reste générale- ment obscur. On continue à faire le vide jusqu'à ce que le tube s'illu- mine de nouveau ; à ce moment on fait une nouvelle série de mesures. On continue à faire

  20. Societatea de Matematica Sud-Est Europeana (Mathematical Society of Southeastern Europe MASSEE)1

    E-Print Network [OSTI]

    Niculescu, Constantin P.

    ¸ti (Balkan Mathematical Olympiad, Junior Balkan Mathematical Olympiad etc.) ¸si va urm¼ari crearea unor

  1. C'est quoi, au fond, l'informatique ? Sacha Krakowiak

    E-Print Network [OSTI]

    Pous, Damien

    (1936) Andrew Hodges, Alan Turing: The Enigma, Simon & Schuster Vintage edition, 1992 #12;© 2010, S machine de Turing Andrew Hodges, Alan Turing: The Enigma, Simon & Schuster Vintage edition, 1992 #12 représentable par une machine de Turing Andrew Hodges, Alan Turing: The Enigma, Simon & Schuster Vintage edition

  2. Plus c`est la meme chose: The future of nuclear weapons in Europe

    SciTech Connect (OSTI)

    Maaranen, S.A.

    1996-07-01T23:59:59.000Z

    Since the end of the Cold War, the United States perhaps more than any other nuclear weapon state has deeply questioned the future role of nuclear weapons, both in a strategic sense and in Europe. It is probably the United States that has raised the most questions about the continuing need for and efficacy of nuclear weapons, and has expressed the greatest concerns about the negative consequences of continuing nuclear weapons deployment. In the US, this period of questioning has now come to a pause, if not a conclusion. In late 1994 the United States decided to continue to pursue reductions in numbers of nuclear weapons as well as other changes designed to reduce the dangers associated with the possession of nuclear weapons. But at the same time the US concluded that some number of nuclear forces would continue to be needed for national security for the foreseeable future. These necessary nuclear forces include a continuing but greatly reduced stockpile of nuclear bombs deployed in Europe under NATO`s New Strategic Concept. If further changes to the US position on nuclear weapons in Europe are to occur, it is likely to be after many years, and only in the context of dramatic additional improvements in the political and geo-political climate in and around Europe. The future role of nuclear weapons in Europe, as discussed in this report, depends in part on past and future decisions by the United States. but it must also be noted that other states that deploy nuclear weapons in Europe--Britain, France, and Russia, as well as the NATO alliance--have shown little inclination to discontinue their deployment of such weapons, whatever the United States might choose to do in the future.

  3. atmospherique est-il toujours: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    la conversion en LPI, car vos logi- ciels travaillent de cette faon.) Les (niv. gris et couleurs) 100% 266 300 DPI. 2. TRAVAIL DE LUXE Sur papier...

  4. La pollution marine est gnralement provoque par les eaux uses, d'origines

    E-Print Network [OSTI]

    AneeseTotahJr/Dreamstime.com Hydrocarbures Bien que spectaculaires, les accidents maritimes n'expliquent que 5% des rejets d'hydrocarbures

  5. Published: 18 hours ago, 15:31 EST, May 08, 2007 Mechanoluminescence event yields novel emissions,

    E-Print Network [OSTI]

    Suslick, Kenneth S.

    exceed the speed of sound. Crystal particles suspended in a sonicated liquid collide and fracture, the use of sound energy to agitate particles or other substances, causes high intensity collisions of crystal particles in liquid slurries. The resulting mechanoluminescence is an order of magnitude brighter

  6. Les huiles essentielles La flore de la Nouvelle-Caldonie est extrmement diversifie, avec un taux

    E-Print Network [OSTI]

    Royaume-Uni et d'Europe, et ce, dès les années 1890. Turbina inopinata ou Guirlande des bois, espèce

  7. En vue d'obtenir le grade de DOCTEUR DE L'UNIVERSIT PARIS-EST

    E-Print Network [OSTI]

    bâtiment Copernic. Et puis merci aussi à Patrice, car même si la réponse était toujours « non », les

  8. Thse de doctorat de l'Universit Paris-Est Amnagement de l'Espace, Urbanisme

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    and Coimbatore in India ­ we argue that solid waste management in Southern cities cannot be conceived excluding Grounded on empirical investigations in two ordinary cities of emerging countries ­ Vitória in Brazil of appropriation conflicts, which arise with the introduction of municipal selective collection schemes and which

  9. fois, ils semblent aussi impliqus dans une tape postrieure l'initiation qui est la promo-

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    E.A. & Recknagel R.O. (1983) Carbon tetrachloride and bromotrichloromethane toxi- city. Dual role.A., Fernan- dez Y. & Mitjavila S. (1986) Radical activation of car- bon tetrachloride in foetal and maternal

  10. AVERTISSEMENT Ce document est le fruit d'un long travail approuv par le

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    Pharma / Solvay, Daix tel-00610626,version1-22Jul2011 #12;tel-00610626,version1-22Jul2011 #12;tel Souchet Docteur, Fournier Pharma / Solvay, Daix tel-00610626,version1-22Jul2011 #12;tel-00610626,version1

  11. INTRODUCCIN En este manual de buenas prcticas se explicarn las diferentes medidas que se

    E-Print Network [OSTI]

    Rey Juan Carlos, Universidad

    RENOVABLES. La energía solar térmica o la biomasa son una solución excelente para cubrir total o parcialmente

  12. MicroNanoMap (Micromagntisme des nanostructures et Mathmatiques Appliques) est articul sur trois actions

    E-Print Network [OSTI]

    un modèle 1D capable de décrire le profil de vortex obhttp://prb.aps.org/abstract/PRB/v54/i13/p9353

  13. Genus quid est? Roman Scholars on Grammatical Gender and Biological Sex*

    E-Print Network [OSTI]

    Corbeill, Anthony P.

    2008-01-01T23:59:59.000Z

    From at least as early as Varro, Roman scholars and grammarians occupy themselves with cataloguing peculiar instances of grammatical gender. The practice, with little extant precedent in Greek tradition, finds the grammarians ...

  14. Ecole Doctorale Ville, Transports et Territoires Thse de doctorat d'Universit Paris-Est

    E-Print Network [OSTI]

    the effectiveness of various forms of taxes, subsidies and regulations implemented to correct for market failures heating in France, which allows to identify the dynamic mechanisms by which instruments can correct for the main market

  15. Droit de l'Environnement marin 1. Qu'est ce que le littoral marin ?

    E-Print Network [OSTI]

    Boudouresque, Charles F.

    1681 · Code napoléon 1804 · XIX siècle :théorie de l'antipropriétarisme · XX siècle :développement du renouvellement urbain, création des SCOT) Code de l'Environnement, révision (janvier-février 2004) Loi cadre de l Mise en Valeur de laMer) Loi ...parcs nationaux, parcs naturels marins... (14 avril 2006) Principales

  16. UNE FENETRE SUR L'AVENIR L'Institut Weizmann des Sciences est un

    E-Print Network [OSTI]

    matériaux ou encore à déchiffrer le code génétique propre à tous les êtres vivants, plantes ou animaux. A LA construction d'un parc d'industries technologiques situé à l'entrée de Rehovot. L'Institut Weizmann a aussi

  17. www.rmgh.org La mucoviscidose est la maladie autosomique rcessive

    E-Print Network [OSTI]

    Boyer, Edmond

    that the prevalence of CF in the native Moroccan population between 1 / 1680 and 1 / 4150. La mucoviscidose au Maroc Ibn Batouta, BP 769, 11400 Rabat, Maroc 2 Centre de Génomique Humaine, Faculté de Médecine et de Pharmacie, Université Mohamed V Souissi, Rabat, Maroc *Auteur correspondant: Ilham RATBI Département de

  18. La coleccin del Centro de Documentacin Estadstica est formada por estadsticas espaolas, estadsticas

    E-Print Network [OSTI]

    Autonoma de Madrid, Universidad

    . Población activa 02.02.01 Bienestar social. Costos sociales 06.03 Sistemas de enseñanza 09.01.03 Consumo.01 Comercio. Demanda. de mano de obra. Ganancia 02.01.01 Desarrollo económico y social 06.01.00 Estadísticas trabajo 02.02 Política social Financiación de la educación 09.01.02 Competitividad. 13.01.02 Mano de obra

  19. funding and ways to garner public inter-est in the often dry and complex issue.

    E-Print Network [OSTI]

    Minnesota, University of

    , joining Oberstar in a panel discussion, also shared some Inside · CTS Web site threat for on-the-job law enforcement officers. In Minnesota and nation- wide, approximately 50 percent or more lanes in the same direction), providing a full lane of buffer space. To get the word out

  20. Institut de Chimie et des Matriaux Paris-Est UMR 7182

    E-Print Network [OSTI]

    préparation des échantillons ; Patrick Ochin, Christian Jolivet Michel Parise et Jean-Louis Bonnentien pour l

  1. Wed Jan 18 10:44:38 EST 2012 Spring 2012 Mathematics Page No ...

    E-Print Network [OSTI]

    ... James 741 15200 011 54907 MWF 8:30- 9:20 REC 307 Lau,Joel James 741 .... 101 54737 Th 7:30- 8:20 MSEE B010 Vogt Geisse,Katia Patricia 611 16600 102 ... 633 22200 001 21967 MWF 7:30- 8:20 PHYS 338 Hoffman,Andrew Joseph ...

  2. ARTIGO INTERNET Europa est a desenvolver biblioteca digital de matemtica 24.02.2010 -

    E-Print Network [OSTI]

    Instituto de Sistemas e Robotica

    chama meta-dados) é armazenada em bases de dados ­ mas as várias instituições usam software e modelos de base de dados diferentes, o que cria mais uma dificuldade na criação de um único motor de pesquisa. E

  3. ierrette garde des enfants depuis plus de 30 ans. Son travail est sa passion.

    E-Print Network [OSTI]

    Rossion, Bruno

    une anecdote. Un jour, à l'hôpital où Pier- rette était en convalescence, j'ai revêtu une blouse d'infirmier

  4. Facult des sciences infirmires Le Baccalaurat en sciences infirmires est offert selon divers par-

    E-Print Network [OSTI]

    Parrott, Lael

    -Baccalauréat intégré et à l'intention des infirmières et infirmiers en exercice. ­ Les programmes 1-630-4-0, 1 professionnelles L'article 36 de la Loi sur les infirmières et les infirmiers (Lii, art. 36, 2002) présente ainsi le champ de pratique des infirmières : « L'exercice infirmier consiste à évaluer l'état de santé d

  5. automated est-based approach: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Approach to Sensor Selection- prehensive automated Failure Modes and Effects Analysis (FMEA) using qualitative model based reasoning au- tonomous aircraft. Automated failure mode...

  6. INTRODUCCIN Este Plan Estratgico de los Servicios Tcnicos de Investigacin forma parte

    E-Print Network [OSTI]

    Escolano, Francisco

    social donde presta sus servicios. Además el Plan Estratégico debe incluir unas acciones concretas que públicas o privadas que lo soliciten, sustentado en la profesionalidad de su componente humano y en la

  7. STATEJVU:NT OF CONSIJ mnATIONS RFQllEST B'{ CREE, JNC. (CREE...

    Broader source: Energy.gov (indexed) [DOE]

    or 20%. This vaiver is contingc11,; upon the Petitioner maintaining the above cost sharing percentage over the course of the agrc ,ement. The technology developed under this...

  8. Job: ID Job Title Employer End Date Majors/Concentrations Class Level 56903 Engineer/Est

    E-Print Network [OSTI]

    Wang, Hai

    (Environmental Engineering), Chemical Engineering (Nanotechnology), Chemical Engineering (Petroleum Engineering (Software Engineering) Sophomore,Junior,Senior,Gradu ate Student 62817 Programmer U2OPYA 11/25/2014 Chemical Engineering, Chemical Engineering, Chemical Engineering (Biochemical Engineering), Chemical Engineering

  9. Tue Jan 13 14:48:16 EST 2009 Spring 2009 Mathematics Page No ...

    E-Print Network [OSTI]

    ... 9:20 PHYS 338 Smith,Gabriel 615 15200 003 21818 MWF 9:30-10:20 PHYS ..... course** ACOUSTICS OF POROUS MEDIA 59800 016 34040 TR 1:30- 2:45 ...

  10. Thse prsente pour obtenir le grade de Docteur de l'Universit Paris-Est

    E-Print Network [OSTI]

    -BODIN . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Rapporteur Mme Anne VENTURA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Rapporteur M'avoir accepté de présider ce jury. Je le remercie également, ainsi que Mme Anne VENTURA de l'Université de

  11. Thse prsente pour obtenir le grande de Docteur de l'Universit Paris-Est

    E-Print Network [OSTI]

    Boyer, Edmond

    foams: Experiments at the bubble scale and on vertical film For investigating glass foams stability; stability; evaporation; glass; foam tel-00664444,version1-30Jan2012 #12;La thése été préparée dans les faiblement visqueux. Les mots clés: bulle; drainage; stabilite; évaporation; verre; mousse Stability of glass

  12. Energy Secretary Steven Chu to host DOE's first google hangout at 2 EST |

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directedAnnual SiteofEvaluating A PotentialJump to:Emminol Jump to:EnergEnergyEnergyOpenEI Community

  13. DLA Energy RFP - Deadline: August 19, 2013 - 12:00pm EST | OpenEI Community

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directedAnnual Siteof EnergyInnovationinConcentratingEnergyCoosaPageEnergy InformationDEFRADEIF

  14. It's Equal Pay Day - Join our #STEMEqualPay Tweet Up at 3pm EST |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page onYouTube YouTube Note: Since the.pdfBreaking ofOil & Gas » Methane HydrateEnergyIs a Small WindImpactDepartment

  15. It's Equal Pay Day - Join our #STEMEqualPay Tweet Up at 3pm EST |

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33Frequently Asked Questions for DOEtheInspection15 PATRICIA HOFFMANEnergyIowaIs

  16. *Este informe se ha elaborado tras un encuentro entre policy makers de enero de 2013, que discuti muchos de los temas tratados en este documento (vase el anexo para la lista de

    E-Print Network [OSTI]

    Jensen, Max

    que han encontrado un terreno común en temas espinosos, desarrollo rural; (2) los dos meses de alto al

  17. Le Camp Massawippi du Centre de radaptation MAB-Mackay est un camp de vacances bilingue qui reoit des campeurs gs entre 6 et 30 ans, qui vivent avec une dficience motrice, auditive, ou visuelle. Le Camp est situ

    E-Print Network [OSTI]

    'équipe de soins infirmiers; Établir les normes et procédures pour le déroulement des activités d'urgence et Langue de travail : Bilingue : Français et Anglais Exigences : Diplôme d'études en soins infirmiers complété; Membre de l'Ordre des infirmiers et infirmières du Québec (OIIQ); Excellent en communication et

  18. Reservoir characterization of the upper Merecure and lower Oficina Formations sands in the Leona Este Field, Eastern Venezuela Basin 

    E-Print Network [OSTI]

    Flores Millan, Maria Carolina

    2001-01-01T23:59:59.000Z

    The "S5", "T" and "U1" sands, traditionally described as part of the lower section of the "Oficina" Formation, and the "U2" sand, as part of the upper interval of the "Merecure" Formation, contain the largest oil remaining ...

  19. o y est la valeur de l'lment de comparaison (plaque de rglage). L'expression (8) indique dans

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    utilisée. BIBLIOGRAPHIE. [1] GLASSTONE S. et EDLUND M. C. - The elements of nuclear reactor theory. Mc

  20. o r est la coordonne du neutron s celle du nuclon optique. La formule (1) conduit une distribution

    E-Print Network [OSTI]

    Boyer, Edmond

    . Szteinsznaider and myself. We have measured the angular distribution of the inelastic scattered neutrons on 56Fe neu- trons the number of neutrons scattered at 30° is the same as at 150° with 20 % approximation. To conclude, we have not detected any direct interaction in the inelastic scattering of neutrons at low energy

  1. Proceedings of the Biomass Pyrolysis Oil Properties and Combustion Meeting, 26-28 September 1994, Estes Park, Colorado

    SciTech Connect (OSTI)

    Milne, T.

    1995-01-01T23:59:59.000Z

    The increasing scale-up of fast pyrolysis in North America and Europe, as well as the exploration and expansion of markets for the energy use of biocrude oils that now needs to take place, suggested that it was timely to convene an international meeting on the properties and combustion behavior of these oils. A common understanding of the state-of-the-art and technical and other challenges which need to be met during the commercialization of biocrude fuel use, can be achieved. The technical issues and understanding of combustion of these oils are rapidly being advanced through R&D in the United States. Canada, Europe and Scandinavia. It is obvious that for the maximum economic impact of biocrude, it will be necessary to have a common set of specifications so that oils can be used interchangeably with engines and combustors which require minimal modification to use these renewable fuels. Fundamental and applied studies being pursued in several countries are brought together in this workshop so that we can arrive at common strategies. In this way, both the science and the commercialization are advanced to the benefit of all, without detracting from the competitive development of both the technology and its applications. This United States-Canada-Finland collaboration has led to the two and one half day specialists meeting at which the technical basis for advances in biocrude development is discussed. The goal is to arrive at a common agenda on issues that cross national boundaries in this area. Examples of agenda items are combustion phenomena, the behavior of trace components of the oil (N, alkali metals), the formation of NOx in combustion, the need for common standards and environmental safety and health issues in the handling, storage and transportation of biocrudes.

  2. Introduccion al Calculo Cientifico 1. Objetivos: Este curso pretende brindar una introduccion al Calculo Cientifico, que resulte un com-

    E-Print Network [OSTI]

    Morin, Pedro

    las carreras de Ingenier´ia. Se presupone que los alumnos ya poseen nociones b´asicas de C´alculo Num´erico-Hall, 2000. (b) Richard L. Burden y J. Douglas Faires, An´alisis Num´erico, sexta edici´on, International

  3. RESUMEN. Este trabajo representa una revisin y ac-tualizacin de la avifauna del estado de Sonora, Mxi-

    E-Print Network [OSTI]

    Montana, University of

    ). Por esta razón, los listados de especies o inventarios bio- lógicos son esenciales para entender la

  4. Highlights 119 El nmero est dedicado al Dr. Omar Solorza Feria, Profesor Titular del Depto. de Qumica, por su

    E-Print Network [OSTI]

    . Solorza-Feria, Evaluation of Ru x W y Se z Catalyst as a Cathode Electrode in a Polymer Electrolyte and Characterization of Pd 0.5 Ni x Se (0.5-x) Electrocatalyst for Oxygen Reduction Reaction in Acid Media. Int. J-Feria, Low Pt content on Pd 45 Pt 5 Sn 50 cathode catalyst for PEM fuel cells. J. Power Sources, In press

  5. Highlights 118 En este nmero iniciamos la edicin de Highlights 2010, por lo que queremos aprovechar la

    E-Print Network [OSTI]

    of RuxWySez Catalyst as a Cathode Electrode in a Polymer Electrolyte Membrane Fuel Cell. Fuel Cells. In press 2010. - G. Ramos-Sánchez, O. Solorza-Feria, Synthesis and Characterization of Pd0.5Nix Se(0.5-x.J. Salvador-Pascual, V. Collins-Martínez, A. López-Ortiz, O. Solorza-Feria, Low Pt content on Pd45Pt5Sn50

  6. Forprint est un Campus numrique destin la FOAD d'tudiants scientifiques trangers, en franais et " la

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    Aix-Marseille II · Université Pierre et Marie Curie Paris 6 Entre français général, français sur'intégration dans l'enseignement supérieur Guy ACHARD-BAYLE* - Christian COLIN** - Stéphane GUILLET*** - Mylène MALPAS**** - François MARRON***** - Michel METZ****** - Claude MOREAU******* * Université Pierre et Marie

  7. Summary Observations on the net carbon exchange of for-ests in the European Mediterranean region, measured recently

    E-Print Network [OSTI]

    of Mediterranean soils stimulates decomposition and carbon dioxide emission: the "Birch effect" PAUL JARVIS,1,2 ANA REY,1,3 CHARALAMPOS PETSIKOS,1 LISA WINGATE,1 MARK RAYMENT,1 JOÃO PEREIRA,4 JOÃO BANZA,4 JORGE DAVID,4

  8. ANO XLIII N. 001 02/01/2013 ESTE BOLETIM DE SERVIO CONSTITUDO DE 66 (SESSENTA E SEIS) PGINAS

    E-Print Network [OSTI]

    Souza, Max O.

    Instituto Nacional de Metrologia, Qualidade e Tecnologia - INMETRO. OBJETO: desenvolvimento de cooperação

  9. valeur inferieure celle, calculee partir du 3,10 du neutron, et qui est M2 = 2.

    E-Print Network [OSTI]

    Boyer, Edmond

    authorization and access control services on top of Kerberos #12;5© Ravi Sandhu 2000-2004 TRUST: BILATERAL denial of service by impersonation of Kerberos IP address network monitoring at multiple points can help

  10. The facies, environments of deposition and cyclicity of the Yates Formation, North Ward-Estes field, Ward County, Texas

    E-Print Network [OSTI]

    Johnson, Ronnie Delane

    1997-01-01T23:59:59.000Z

    The Yates Formation is part of the Artesia Group, a sequence of interbedded carbonates, clastics and evaporates that was deposited across the back-reef shelves of the Permian basin in Late Permian (Upper Guadalupian) time. The Artesia Group...

  11. OFFRE D'EMPLOI Le Conservatoire botanique national du Massif central est un tablissement public, agr par le Ministre

    E-Print Network [OSTI]

    -Loire, du Parc naturel régional Livradois-Forez, du Syndicat mixte d'aménagement territorial du Haut botanique national définies par l'article L414-10 du code de l'environnement comme suit : Contribuer, dans code de l'environnement dans la mesure compatible avec le respect des habitats et des espèces et

  12. respectivement, ont t mesures et analyses. Parce que la valeur d B de l'tat suprieur est beaucoup

    E-Print Network [OSTI]

    Boyer, Edmond

    Representation Formalisms and Methods]. General Terms Documentation, Human Factors, Verification. Keywords

  13. ANO XLIII N. 117 08/08/2013 ESTE BOLETIM DE SERVIO CONSTITUDO DE 27 (VINTE E SETE) PGINAS

    E-Print Network [OSTI]

    Souza, Max O.

    ANDRADE PINTO, do cargo de Técnico em Radiologia, matrícula SIAPE n.º 1580035, código de vaga 239394, do

  14. s.haszeldine@ed.ac.uk Scottish Centre for Carbon Storage, Petrobras 2008 1 University of Edinburgh (est 1583)

    E-Print Network [OSTI]

    Haszeldine, Stuart

    , and HWU Chem Eng Legislation and regulation UoE Europa Institute, Dundee CEPMLP Energy systems & Social, environmental impacts (HWU, BGS UoE) Licensing and regulation Enhanced hydrocarbon recovery (HWU #12;s for Carbon Storage, Petrobras 2008 9 Sci-tech. background Geoscience, Power plant Capture, Pipeline Legal

  15. The facies, depositional environment, and cyclicity of the Queen Formation (Guadalupian, Permian), North Ward-Estes Field, Ward County, Texas

    E-Print Network [OSTI]

    Eide, Michael Gary

    1993-01-01T23:59:59.000Z

    of the Delaware Basin (Figure 5). By Late Guadalupian time the Midland Basin had bccn filled with sediments and was a vast area of sabkha, playa, and salina deposition. The Delaware Basin persisted into Ochoan time during which time it was filled... is part of thc Artesia Group a complex series of carbonates, clasties, and evaporites that were deposited on back-reef shelves of thc Goat Seep and Capitan reef complexes of the Permian Basin during Guadalupian time. The origins ol' the carbonates...

  16. Al-Hamdan, M. Z.; Crosson, W. L.; Limaye, A. S.; Rickman, D. L.; Quattrochi, D. A.; Estes, M.

    E-Print Network [OSTI]

    (8):33- 41, 55-6. · Charleston AE. New Enviornmental Public Health Tracking Network Includes Spatial Analy Public Health Management Practice, 2008, 14(6), 507­514. · Charleston AE, Banerjee A, Carande-Kulis VG. J Public Health Management Practice, 2008, 14(6), 600-604. · Conti, L., Kearney, G, Whitehead

  17. ANO XLIII N. 178 20/11/2013 ESTE BOLETIM DE SERVIO CONSTITUDO DE 43 (QUARENTA E TRS) PGINAS

    E-Print Network [OSTI]

    Souza, Max O.

    Cooperação Científica e Tecnológica PARTÍCIPES: Universidade Federal Fluminense ­ UFF e a Baker Hughes do Cunha de Apoio Institucional à UFF ­ FEC e RODRIGO FARIAS, Diretor da Baker Hughes do Brasil Ltda

  18. ANO XLIII N. 122 16/08/2013 ESTE BOLETIM DE SERVIO CONSTITUDO DE 20 (VINTE) PGINAS

    E-Print Network [OSTI]

    Souza, Max O.

    .012906/2012-20 INSTRUMENTO: Contrato PARTÍCIPES: Baker Hughes e a Universidade Federal Fluminense ­ UFF. OBJETO: Divulgação Pesquisa e Tecnologia do Rio de Janeiro ­ Baker Hughes. Publique-se LEILA MARIA PEREIRA Chefe da Seção de

  19. The oration "Non est apud me dubium" of Enea Silvio Piccolomini (Aspach 1436). Ed. and transl. by Michael von

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    a happy life on Earth and how to gain eternal life in Heaven. The choice of subject is indicative as a valley of tears and of the flight from the world (fuga mundi) to the sphere of the divine. In his prescriptions for a happy life on Earth, Piccolomini relies heavily on classical, Stoic concepts of eliminating

  20. NR 13-004 Embargoed until noon EST, November 22, 2013 MCMASTER RESIDENT PHYSICIANS TO RECEIVE NATIONAL AWARDS

    E-Print Network [OSTI]

    Thompson, Michael

    NATIONAL AWARDS OTTAWA ­ The Canadian Association of Internes and Residents (CAIR) is pleased to announce that the following individuals are being recognized with the following Awards: · Dr. Farhan Asrar, a fifth of the Dr. Joseph Mikhael CAIR Award for Medical Education. · Dr. Daisy Liu, a second-year resident

  1. Extension of the core map of common bean with EST-SSR, RGA, AFLP, and putative functional markers

    E-Print Network [OSTI]

    2010-01-01T23:59:59.000Z

    to common bacterial blight of beans. Crop Sci Yu K, Park SJ,microsatellite DNA sequences in beans (Phaseolus and Vigna).linkage map of common bean (Phaseolus vulgaris L. ). J

  2. Seminar COST 356 EST "Towards the definition of a measurable environmentally sustainable transport", 20 February 2008, Oslo, Norway

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    . For instance the global warming potential evaluates the global temperature increase and not really the final on the causes of the impact, because the impact cannot be linked by a one-to-one relationship with the accidents, hazards, among others cause death and injuries. The account of death and injuries due to the accident

  3. Grce l'emploi de moteurs asservis, la direction du dplacement de la croix est celle de la projection

    E-Print Network [OSTI]

    Boyer, Edmond

    the results of some experiments which show that the surface damage of glasses by intense laser radiation depends of the optical quality and adsorption properties of the glass surface. REVUE DE PHYSIQUE APPLIQUE

  4. ANO XLIII N. 139 12/09/2013 ESTE BOLETIM DE SERVIO CONSTITUDO DE 40 (QUARENTA) PGINAS

    E-Print Network [OSTI]

    Souza, Max O.

    Licenciatura, do Instituto de Ciências da Sociedade e Desenvolvimento Regional ­ Campos dos Goytacazez Instituto de Ciências da Sociedade e Desenvolvimento Regional ­ Campos dos Goytacazez. Esta designação, no uso de suas atribuições legais, estatutárias e regimentais, RESOLVE: I - Determinar, consoante o

  5. ANO XLIII N. 159 18/10/2013 ESTE BOLETIM DE SERVIO CONSTITUDO DE 20 (VINTE) PGINAS

    E-Print Network [OSTI]

    Souza, Max O.

    , estatutárias e regimentais, RESOLVE: 1- Determinar, consoante o constante no Processo nº 23069. 009972 e Desenvolvimento Regional a Profª KÁTIA REGINA DE SOUZA LIMA ­ SIAPE 0311332-8, Profª MARIA DAS-Graduação em Serviço Social e Desenvolvimento Regional a Coordenadora de Curso Profª MARIA DAS GRA�AS OS�RIO P

  6. ANO XLIII N. 119 12/08/2013 ESTE BOLETIM DE SERVIO CONSTITUDO DE 65 (SESSENTA E CINCO) PGINAS

    E-Print Network [OSTI]

    Souza, Max O.

    ).................05 MESTRADO ACAD�MICO EM SERVI�O SOCIAL E DESENVOLVIMENTO REGIONAL...............................09 ­ Determinar, consoante o constante no Processo nº 23069.078158/2013-29, a Instauração de Processo

  7. Tune In To Our Online Town Hall With Sec. Chu at 12:45PM EST | Department

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn April 23,EnergyChicopeeTechnologyfact sheetTransferringInc.SOLAREnergyof Energy

  8. les corps qui entourent la lame jouent le rle de la toile dans la premire exprience; par consquent, il est probable que de l'lec-

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    Sciences and available at http://dx.doi.org/10.1051/jphystap:018880070015501 #12;I56 avoir déterminé ces grandeurs par l'expérience, ce physicien exa- mine jusqu'à quel point les valeurs obtenues peuvent s ni = 2. Mais voici maintenant la partie importante de la question, telle qu'elle se pose pour 1VI

  9. quelle le potentiel varie graduellement de V1 V2. Dans cette couche, l'unit de masse lectrique est sollicite se mouvoir par

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    force électrique. Le phénomène Peltier correspond donc à la différence de ces deux travaux voisins en. On voit alors cette image dans la lunette, oi1 il suffit de faire légèrement tourner celle-ci autour de l

  10. DbitVisu est un banc exprimental pour les T.P. en Mcanique des Fluides. Il a t ralis avec les objectifs suivants

    E-Print Network [OSTI]

    /s (conduite droite PVC DN 53,6mm) Cuve principale 600 L et cuve pesée 200 L Conduites collées GF PVC-U PN16 �ext 63 mm, DN 53,6 mm. Robinets à bille GF PVC-U type 546 �63 Vanne 3 voies pneumatique Valpes d63 : manchons union PVC-U d63 (GF 721 510 111) - Prises de pression et purges : trous G1/4, connectique rapide

  11. L'objectif de ce sminaire autour des moyens d'exploration, des bio marqueurs et de la thrapeutique cible est

    E-Print Network [OSTI]

    Ingrand, François

    ronde animée par Bernard Gout, Vice-Président de Bio Médical Alliance : Jean-Jacques Romatet (CHU

  12. MAPA DE SERVIZOS DA CIDADE DA CORUA Este mapa de servizos foi elaborado pola Oficina de Cooperacin e Voluntariado no mes de

    E-Print Network [OSTI]

    Fraguela, Basilio B.

    698 123 477 881 926 467 C/ Azahar, 8, bloque 48, bajo Ecodesarrollo Gaia Axuda alimentaria/ Azahar, 10, bloque 48, bajo Renacer Entrevista previa con director 981 249 221 630 852 591 C/ Sargento 897 Plaza José Toubes Pego , 1, 2º Cáritas L a Vi (9:30-14:30 e 17-19H) 981 269 066 981 269 549 C

  13. Este artculo es copia fiel de la ponencia presentada al "SIMPOSIO SOBRE LAS RELACIONES UNIN EUROPEA-AMRICA LATINA: LA DIMENSIN PARLAMENTARIA" con ocasin del

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    EUROPEA-AM�RICA LATINA: LA DIMENSI�N PARLAMENTARIA" con ocasión del VI Congreso CEISAL, Toulouse, (Francia encuentros entre la UE y los distintos bloques regionales (Mercosur, CAN y Centroamérica), con los países2010 Author manuscript, published in "Independencias - Dependencias - Interdependencias VI Congreso

  14. Au fil du temps, la pche dans le golfe d'Arguin s'est intensifie. Pour les scientifiques, il existe aujourd'hui un risque de surexploitation

    E-Print Network [OSTI]

    .Campredon Pêche en pirogue à moteur Fishing with a motorised pirogue Port artisanal de Nouakchott Traditional port in Nouakchott Pêche à pied Beach fishingLanche Traditional fishing boat with sail Transformation du poisson FishGulfofArguindeveloped? Traditionally, the Imraguen practiced subsistence fishing between October and February; their catches consisted

  15. Los Alamos National Laboratory Est. 1943 MPA Materials Matter--Newsletter of the Materials Physics and Applications Division I N S I D E

    E-Print Network [OSTI]

    -powered fuel cells. "11" has participated in or been responsible for key breakthroughs that enable today's fuel for the introduction of hydrogen and fuel cell technology, because of the potential impact that re- powering--Newsletter of the Materials Physics and Applications Division I N S I D E 2 From Cathy's Desk 3 sCientists take a giant step

  16. Este encuentro internacional pretende proponer, a nivel de Europa occidental, un debate sobre cuestiones relacionadas con la arquitectura funeraria y la

    E-Print Network [OSTI]

    Escolano, Francisco

    cuestiones relacionadas con la arquitectura funeraria y la gestión de los conjuntos sepulcrales-14 ARQUITECTURAS FUNERARIAS Y MEMORIA: LA GESTI�N DE LAS NECR�POLIS EN EUROPA OCCIDENTAL(SIGLOS X-III a.C.) ARQUITECTURAS FUNERARIAS Y MEMORIA: LA GESTI�N DE LAS NECR�POLIS EN EUROPA OCCIDENTAL (SIGLOS X-III a

  17. r XXXX American Chemical Society A dx.doi.org/10.1021/es2023626 |Environ. Sci. Technol. XXXX, XXX, 000000 pubs.acs.org/est

    E-Print Network [OSTI]

    Fisher, Andrew

    in emissions of N2O which is a powerful greenhouse gas.14,15 Denitrification rates in shallow sediments

  18. FLIP CHIP FC 150 La machine de FC150 est utilise pour aligner et reporter avec prcision une ou plusieurs puces sur un

    E-Print Network [OSTI]

    Ingrand, François

    CHARACTERISTICS Bonding accuracy ± 3µm Temperature set point up to 450°C Temperature control to 10°C/s UV cured EXAMPLES Thermocompression welding This technique is used for the realization of electrical contacts Chip

  19. littrature. Dans cet article, un nombre important de solutions analytiques aux quations de SaintVenant est dcrit dans un formalisme unifi. Elles englobent

    E-Print Network [OSTI]

    Lucas, Carine - Le Laboratoire de Mathématiques

    , 10], tsunami [11­13]. This system of partial differential equa- tions (PDEs), proposed by Adhémar laws describing the evolution of the height and mean velocity of the fluid. In real situations

  20. Nacional de Educacin / proyecto presentado por J.B. Zubiaur. Buenos Aires: Est. Tip. El Comercio, 1906. ARGENTINA. MINISTERIO DE OBRAS PBLICAS, Red de

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    Comercio, 1906. ARGENTINA. MINISTERIO DE OBRAS P�BLICAS, Red de Ferrocarriles en la fecha del centenario-1908. [Argentina?]: [s.n.], [1908?] [Escuelas e Institutos Evangélicos Argentinos]. 30 Programa de la División de 1810...: celebra la Sociedad Rural Argentina, desde el 3 de Junio hasta el 31 de Julio de 1910 en

  1. Cette oeuvre est mise disposition selon les termes de la Licence Creative Commons Attribution -Pas d'Utilisation Commerciale -Pas de Modification 3.0 France.

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    - Pas d'Utilisation Commerciale - Pas de Modification 3.0 France. http://creativecommons.org/licenses/by-nc-nd/3.0/fr Université de Nice Sophia-Antipolis et CNRS GREDEG CNRS/UNSA Groupe de Recherche en Droit termes de la Licence Creative Commons Attribution - Pas d'Utilisation Commerciale - Pas de Modification 3.0

  2. C.M. Hladik, S. Krief, B. Simmen & P. Pasquet Page Le got n'est pas le propre de l'homme

    E-Print Network [OSTI]

    Boyer, Edmond

    éliminées par sélection naturelle. Avec nos collègues Göran Hellekant et Viktoria Danilova de l

  3. Le hakka, par Hilary Chappell et Laurent Sagart Le dialecte hakka est parl par quelque 35 millions de locuteurs, principalement dans le nord du

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    répandu hors de Chine, en particulier en Malaisie, dans le nord de Bornéo, en Guyane, au Surinam et à ont pu entraîner une forte animosité avec les populations chinoises plus anciennement établies. Cette («Puntis») dans la province de Canton. Méprisés par la société cantonaise, et assimilés aux She, population

  4. ngatif des tubes oxygne rarfi, il s'est trouv conduit modi-fier sa conclusion prcdente et regarder la premire bande

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    précédente et à regarder la première bande (5182) comme étant due à l'azote et la bande (5592) comme étant

  5. La Centrifugeuse est une salle de spectacle de 300m d'une capacit d'accueil de 200 400 personnes.

    E-Print Network [OSTI]

    Dambrine, Marc

    : Système HF : -1 CD Sony CDP-M203-1 -1 MD Sony MD 570 - 3 x Micro-cravate TOA -1 CD Yamaha CDX497 - 3 x Micro Main TOA -1 DAT Sony -1 DAT Fostex D-15 Player/Recorder -1 Préampli ALTO ESOTAR 8in Système son -2 moniteurs vidéo blindés Sony 51 cm (exposition) -2 moniteurs vidéo blindés Sony 36 cm (retours

  6. facteurs de criticit et stratgies publiques franaise et europenne. enjeux et rponses industrie minrale est une industrie trs capitalistique et technologique, mettant

    E-Print Network [OSTI]

    Boyer, Edmond

    of the infrastructures in Shanghai, China. © Fotolia. criticité Facteurs de criticité et stratégies publiques française groupes miniers et métallurgiques de pays émergents :chinois (Aluminium Corp. of China, Baosteel, Jiangxi Copper, Minmetals...), indiens (Arcelor Mittal, Tata Steel...), brésiliens (CBBM,Vale) ou mexicains

  7. Este manuscrito constituye el captulo 6 del libro en prensa: Bardaj, I. (Ed.) 2014. La Reforma de la PAC. Cajamar Caja Rural. Almera.

    E-Print Network [OSTI]

    Oñate, Juan J.

    de la PAC. Cajamar Caja Rural. Almería. La componente ambiental en la nueva PAC Juan J. Oñate. Bien es verdad que las causas últimas de estos cambios se relacionan con los procesos de desarrollo, desarrollo y aplicación de fertilizantes de síntesis y productos fitosanitarios, etc. Pero ya desde hace

  8. Applying New Technologies: ANT Automation es una empresa de Automatizacin Industrial, con operaciones en USA, Argentina y Espaa. La empresa est conformada por un slido grupo de

    E-Print Network [OSTI]

    Maguitman, Ana Gabriela

    Applying New Technologies: ANT Automation es una empresa de Automatización Industrial, con más de 12 años de experiencia en Software/Automatización Industrial y por nuevos jóvenes talentos con el desarrollo de productos de software industrial: OPC, SCADA, MES, VISION ARTIFICIAL, MODELOS

  9. Communiqu de presse | 13 novembre 2014 L'Afrique de l'Ouest est touche, depuis mars 2014, par la plus grave pidmie d'Ebola jamais observe.

    E-Print Network [OSTI]

    Santé (OMS) dénombrait 5160 décès pour 14 098 cas recensés dans 8 pays. Les équipes de recherche Côte d'Ivoire (EBOCI) Les projets EBBEN et EBOCI ont pour objectif de développer une analyse surveillance, de veille, de prévention et de signalement des cas ; des prises en charge d'éventuels cas

  10. Perspectives Le th`eme f'ed'erateur de mes travaux de recherche est donc l''etude des excitations non

    E-Print Network [OSTI]

    Dauxois, Thierry

    les projets suivants. Dans l'esprit du th`eme A, avec Peter Holdworth et Stefano Ruffo, nous avons les m'ethodes d'eterministes (dynamique mol'eculaire) et les m'ethodes stochastiques (Monte Carlo que la m'ethode de Monte Carlo produit une distribution homog`ene d'orientation de spin. Nous voulons

  11. En este nmero del boletn los puntos de atencin son las relaciones comerciales de Mxico y los aspectos sustantivos vinculados a la produc-

    E-Print Network [OSTI]

    Islas, León

    transformaciones que ha venido sufriendo Pemex. Arturo Ortiz Wadgymar escribió la nota "La revisión de la política existentes en el país exportan. El proceso de apertura de Pemex a la inversión privada nacional y extranjera-Padilla quien elaboró la nota "Pemex en crisis. Génesis y desarrollo de la apertura petro- lera en México". La

  12. The Third Interagency Conference on Research in the Watersheds, 8-11 September 2008, Estes Park, CO 155 Using a Coupled Groundwater/Surface-

    E-Print Network [OSTI]

    . Hay, John Doherty Abstract A major focus of the U.S. Geological Survey's Trout Lake Water, Energy in northern Wisconsin is underlain by a highly conductive outwash sand aquifer. In this area, streamflow change scenarios culled from the IPCC Fourth Assessment Report of the Intergovernmental Panel on Climate

  13. Los Alamos National Laboratory Est. 1943 MPA Materials Matter--Newsletter of the Materials Physics and Applications Division I N S I D E

    E-Print Network [OSTI]

    facility in each review. This year, we used radiation damage as a topical area for extreme environments for radiation damage and to MaRIE. The verbal out-brief of the committee was very positive on the quality of t collaborators. As a CINT scientist, she supports the center's nanophotonics and optical nanomaterials science

  14. r XXXX American Chemical Society A dx.doi.org/10.1021/es2005418 |Environ. Sci. Technol. XXXX, XXX, 000000 pubs.acs.org/est

    E-Print Network [OSTI]

    -effective technologies for gen- erating electricity from waste heat. Nonetheless, when it comes to real-world application for waste heat recovery. This is because energy cost is more important than the efficiency of energy

  15. r XXXX American Chemical Society A dx.doi.org/10.1021/es103692f |Environ. Sci. Technol. XXXX, XXX, 000000 pubs.acs.org/est

    E-Print Network [OSTI]

    Jacobson, Mark

    as cloud condensation nuclei (CCN) affecting cloud radiative and physical properties. Under supersaturated enough sizes to precipitate.2 The impact of aerosols on clouds, referred to as the indirect effect impact climate.1 They scatter and absorb incoming short wave and outgoing long wave radiation, and act

  16. La nature telle que nous la voyons aujourd'hui, est le rsultat d'une volution de prs de quatre milliards d'annes. Depuis que la vie est apparue sur notre plante, les tres vivants n'ont pas cess de s'adapter

    E-Print Network [OSTI]

    planète dont 70% des surfaces sont occupées par des mers. En effet, du littoral aux plaines abyssales, ou placés à l'emplacement où ils vivent (au sol, au sommet des arbres, dans les herbes...). Le choix des impose des contraintes multiples aux organismes : ils doivent assurer leur flottabilité, échapper aux

  17. A Generic Model for the Resuspension of Multilayer Aerosol Deposits by Turbulent Flow

    SciTech Connect (OSTI)

    Friess, H.; Yadigaroglu, G. [Swiss Federal Institute of Technology (Switzerland)

    2001-06-15T23:59:59.000Z

    An idealized lattice structure is considered of multilayer aerosol deposits, where every particle at the deposit surface is associated with a resuspension rate constant depending on a statistically distributed particle parameter and on flow conditions. The response of this generic model is represented by a set of integrodifferential equations. As a first application of the general formalism, the behavior of Fromentin's multilayer model is analyzed, and the model parameters are adapted to experimental data. In addition, improved relations between model parameters and physical input parameters are proposed. As a second application, a method is proposed for building multilayer models by using resuspension rate constants of existing monolayer models. The method is illustrated by a sample of monolayer data resulting from the model of Reeks, Reed, and Hall. Also discussed is the error to be expected if a monolayer resuspension model, which works well for thin aerosol deposits, is applied to thick deposits under the classical monolayer assumption that all deposited particles interact with the fluid at all times.

  18. Le produit r a est, on le voit, loin d'tre constant ; il dcrot quand la temprature s'lve, et cela de 12 pour 100 de sa valeur,

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    'UN LIQUIDE; PAR M. E. BOUTY. [SUITE (1) ]. II. ---· MESURE ABSOLUE DU PHÉNOMÈNE DE PELTIER AU CONTACT D production du phénomène de Peltier, s'il existe ; enfin le dégagement de chaleur résultant d possible de celles de Inexpérience. . Pour réaliser cette étude préliminair e, j'entoure le réservoir du

  19. Voici un livre qui tombe pic : la question des relations entre la religion et l'Etat est au coeur des dbats ns de la rvolution qui a clat en janvier 2011 en gypte.

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    confidence d'un ancien soldat de la guerre Iran-Irak, lors d'une visite en Irak durant les années noires de l

  20. Couvents du Lithazomenon et du Pont Saint-Pierre Le Lithazomenon est un lieu-dit l'ouest d'Alexandrie, sans doute assez proche de la ville.

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    avait là, du temps de Moschos, un monastère où s'était retiré Jean le Soldat (Prat. [PG 87,3], 2925). La

  1. Antes de nada queremos darles una cordial bienvenida a la pgina web de nuestro servicio en la confianza de que este vehculo de informacin y de comunicacin nos permita llevar a cabo un doble objetivo: por una parte

    E-Print Network [OSTI]

    Escolano, Francisco

    en el Servicio de Contabilidad además de la gestión de su patrimonio e inventario y la gestión de las Servicio las subdirecciones de Gestión Económica, Presupuestos, Contratación y Patrimonio e Inventario cada

  2. Este curso, en ESPAOL, es un programa de capacitacin intensiva de 31 das lectivos. El curso es organizado por el Centro para el Manejo y Capacitacin en reas Protegidas en la Universidad Estatal de

    E-Print Network [OSTI]

    (incluyendo sitios donde hay explotación de madera, petróleo, gas natural, otros minerales, flora y fauna y

  3. N 27, quinta-feira, 7 de fevereiro de 2013 61ISSN 1677-7069 Este documento pode ser verificado no endereo eletrnico http://www.in.gov.br/autenticidade.html,

    E-Print Network [OSTI]

    Liu, I-Shih

    -X, Metrologia de Tempo e Frequência, Metrologia Quântica (Efeitos Hall e Josephson), Dinâmica dos Fluidos e

  4. Last updated on January 12, 2014 at 14:07 EST Log In and Sign Up with: SearchHome Video News Images Health Education Topics Blogs On Science

    E-Print Network [OSTI]

    Chiao, Jung-Chih

    -scale semiconductor device layouts so complex 3D moveable mechanical structures can be self-assembled from two the University of Texas at Arlington have developed a micro-windmill that can generate wind energy despite beingPhones As Earthquake Sensors New `Micro-Printing' Process Could Improve Prosthetics And Other Medical Devices Unveiling

  5. N 27, quinta-feira, 7 de fevereiro de 201366 ISSN 1677-7069 Este documento pode ser verificado no endereo eletrnico http://www.in.gov.br/autenticidade.html,

    E-Print Network [OSTI]

    Liu, I-Shih

    Públicas Brasileira - ICP-Brasil. 3 b) restando vagas, aos estudantes do grupo indicado no in- ciso II do, aos estudantes do grupo indicado no in- ciso I do artigo 8º, prioritariamente aos estudantes de que alínea "a", do inciso II do artigo 8º; e b) restando vagas, aos estudantes do grupo indicado no in- ciso

  6. Abstract In previous studies of saccadic eye movement reaction time, the manipulation of initial eye position re-vealed a behavioral bias that facilitates the initiation of movements towards the central orbital position. An inter-esting

    E-Print Network [OSTI]

    Munoz, Douglas Perry

    Abstract In previous studies of saccadic eye movement reaction time, the manipulation of initial eye position re-vealed a behavioral bias that facilitates the initiation of movements towards of positions that the eyes can take in the orbits delimits the extent of visual exploration by head

  7. 3 ACTION SOUTIEN ET FORMATION L'action du dpartement soutien et formation est conforme la ralisation de l'une des trois missions de l'IRD : la recherche,

    E-Print Network [OSTI]

    efficientes (notamment dans le domaine de la formation) ; dans ce cas, le Département s'appuie sur les

  8. qui concerne l'acier. Ainsi la diffrence de phase d-d' 03BB est, une incidence de 4o degrs, o,of.to pour la lumire du thallium,

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    sonores ; 2° Méthode de Chladni (7) au moyen des verges; 3° Méthode de Kundt; 4- Méthodes de Stefan ( ) et Sciences, t. LV, p. 662. (9) Acoustique de Chladni. (10) Sitzlln

  9. 5 Le coton-poudre rend positifs presque tous les corps (le sulfure de cuivre est la seule exception trouve par M. Hagenbach) avec lesquels on le frotte. Ce

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    rentrant les uns dans les autres, comme ces pilcs de verres de Bohême dont on se sert dans les laboratoires

  10. N 6, quinta-feira, 9 de janeiro de 2014 3ISSN 1677-7050 Este documento pode ser verificado no endereo eletrnico http://www.in.gov.br/autenticidade.html,

    E-Print Network [OSTI]

    Públicas Brasileira - ICP-Brasil. 2 RETIFICA��O Na Portaria MCTI nº 13, de 7 de janeiro de 2014, publicada no Diário Oficial da União. FERNANDO LÁZARO FREIRE JR. COMISS�O NACIONAL DE ENERGIA NUCLEAR DIRETORIA DE Nacional de Energia Nuclear (CNEN), no uso da atribuição que lhe foi conferida pela Portaria CNEN/PR nº 33

  11. N 9, quinta-feira, 12 de janeiro de 2012 17ISSN 1677-7042 Este documento pode ser verificado no endereo eletrnico http://www.in.gov.br/autenticidade.html,

    E-Print Network [OSTI]

    Floeter, Sergio Ricardo

    : Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (CAPES/MEC) Assunto: Aprecia a proposta de://portal.mec.gov.br/cne/). Brasília, 11 de janeiro de 2012. ATAÍDE ALVES Secretário Executivo COORDENA��O DE APERFEI�OAMENTO DE docentes. O Presidente da Coordenação de Aperfeiçoamento de Pes- soal de Nível Superior - Capes, no uso das

  12. N 55, tera-feira, 22 de maro de 2011 15ISSN 1677-7042 Este documento pode ser verificado no endereo eletrnico http://www.in.gov.br/autenticidade.html,

    E-Print Network [OSTI]

    Floeter, Sergio Ricardo

    constar os resultados obtidos, conforme estabelece a legisla- ção em vigor. COORDENA��O DE APERFEI�OAMENTO

  13. N 107, quinta-feira, 6 de junho de 2013 13ISSN 1677-7050 Este documento pode ser verificado no endereo eletrnico http://www.in.gov.br/autenticidade.html,

    E-Print Network [OSTI]

    Floeter, Sergio Ricardo

    APERFEI�OAMENTO DE PESSOAL DE NÍVEL SUPERIOR PORTARIAS DE 4 DE JUNHO DE 2013 O PRESIDENTE DA COORDENA��O DE

  14. N 4, quinta-feira, 5 de janeiro de 2012 27ISSN 1677-7042 Este documento pode ser verificado no endereo eletrnico http://www.in.gov.br/autenticidade.html,

    E-Print Network [OSTI]

    Floeter, Sergio Ricardo

    abril de 2007, seção 2, página 6. JOS� HENRIQUE PAIM FERNANDES COORDENA��O DE APERFEI�OAMENTO DE PESSOAL docentes. O Presidente da Coordenação de Aperfeiçoamento de Pes- soal de Nível Superior - Capes, no uso das

  15. N 144, quinta-feira, 28 de julho de 2011 9ISSN 1677-7042 Este documento pode ser verificado no endereo eletrnico http://www.in.gov.br/autenticidade.html,

    E-Print Network [OSTI]

    Floeter, Sergio Ricardo

    UNIVERSIDADE FERAL DE VI�OSA COL�GIO UNIVERSITARIO 6 CAMPUS DE FLORESTAL 9 COORDENA��O DE APERFEI�OAMENTO DE Aperfeiçoamento de Pessoal de Nível Superior-Capes, no uso das atribuições que lhe são conferidas pelo Decreto nº

  16. N 48, tera-feira, 12 de maro de 2013 69ISSN 1677-7069 Este documento pode ser verificado no endereo eletrnico http://www.in.gov.br/autenticidade.html,

    E-Print Network [OSTI]

    Liu, I-Shih

    anexo do laboratório de energia solar, denominado prédio 42715. Fundamento Legal: 8666/93 . Vigência: 11

  17. Rf. : FIC_STAGE_2012_06_hyperspectral Page : 1/1 Ce document est la proprit de Magellium. Il ne peut tre ni reproduit, ni communiqu sans autorisation crite pralable.

    E-Print Network [OSTI]

    Dobigeon, Nicolas

    'HSI en cours de conception en interne (matlab), puis éventuellement portage en C++, dans une libraire de traitement d'images spatiales. - Portage en openCL (programmation sur Graphical Processing Unit (GPU)) d

  18. PRINTEMPS DES SCIENCES-2003 D'un bout l'autre de la chane

    E-Print Network [OSTI]

    Liège, Université de

    » ( Paracelse) qui signifie : tout est poison, rien n'est poison, seule la dose fait le poison. En effet

  19. Le Rseau d'changes sur les enjeux en sant environnementale est un regroupement virtuel de professionnels qui s'intressent au domaine de la sant environnementale et qui changent leurs savoirs, expriences et pratiques sur des thmes et enjeux scientifiques e

    E-Print Network [OSTI]

    Montréal, Université de

    toxicologie, INSPQ Karine Dubé Université Laval Retour d'expérience sur la pollution à l'ETBE 16 avril 2013 d

  20. UNIVERSIDAD DE BUENOS AIRES Facultad de Ciencias Exactas y Naturales

    E-Print Network [OSTI]

    Duran, Ricardo

    distancia a un compacto est´e en la clase de Muckenhoupt Ap. Este resultado es auxiliar en este trabajo Sobolev con peso apropiado. Los pesos consi- derados son potencias de la distancia al borde de dominio ecuaci´on de divergencia. Los pesos considerados en este caso son potencias de la distancia a la c

  1. J. Bot. Res. Inst.Texas 1(1): 149 170. 2007 TWO NEW SPECIES OF GRATIOLA (PLANTAGINACEAE) FROM EASTERN NORTH

    E-Print Network [OSTI]

    Small, Randall

    de Norte América y las restantes cuatro especies están principalmente en el este de Norte América. La este de Norte América. En este artículo, se describen e ilustran ambas especies, y se compraran con su

  2. Introduction `a l'apprentissage automatique Apprentissage `a l'aide d'arbres de decisions

    E-Print Network [OSTI]

    Denis, François

    M + b = 1 si M est positif -1 sinon. . Dans ce cas, la marge de H est ´egale `a 1/||w|| et tous les

  3. Probabilidad II Tercero de Matematicas

    E-Print Network [OSTI]

    Fernández Gallardo, Pablo

    una fracci´on si la fortuna est´a por encima del nivel inicial, y otra fracci´on si la fortuna est

  4. Universit de Montral quations diffrentielles retard et leur application en

    E-Print Network [OSTI]

    Bernard, Samuel

    avec un retard discret (EDR) en E est stable. Autrement dit, l'EDLDR est stable si l'EDR correspondante

  5. Page 1 sur 4 Campagne d'emplois Enseignant-Chercheur 2013

    E-Print Network [OSTI]

    : stockage (hydrocarbure, eau, déchets, CO2 La géophysique est l'outil adapté dans cette perspective

  6. Memory & Cognition 2002, 30 (4), 607-613

    E-Print Network [OSTI]

    Steyvers, Mark

    .g., Glanzer & Adams, 1990; Mad- dox & Estes, 1997),multipleretrievalprocesses (e.g., Joor- dens & Hockley

  7. Una institucin rigurosa DESPUS DE OR

    E-Print Network [OSTI]

    Vásquez, Carlos

    precisamente deseables y que no discutiremos en este espacio. Por fortuna, aunque lentamente, entre nosotros

  8. MEMORIA DEL TRABAJO DE INVESTIGACIN PARA LA OBTENCIN DEL DIPLOMA DE ESTUDIOS AVANZADOS DISTRIBUCIN INVERNAL DE AVES (O. PASERIFORME)

    E-Print Network [OSTI]

    Seoane, Javier

    ..................................... 41 Implicaciones de este estudio en el contexto de calentamiento global actual

  9. CSMA 201110e Colloque National en Calcul des Structures

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    Le frittage flash (aussi appelé SPS, Spark Plasma Sintering) est une technique non conventionnelle de

  10. Thermoreflectance based thermal microscope James Christoffersona

    E-Print Network [OSTI]

    crystal based thermography, which re- quires potentially destructive surface preparation. The high- est

  11. Ornithological Monographs Volume (2010), No. 67, 4253

    E-Print Network [OSTI]

    2010-01-01T23:59:59.000Z

    continentales, aunque este resultado es altamente sensible a la definición de insularidad. Simulaciones a poste

  12. 8h30 : Accueil 9h00 : Mot d'ouverture par Mariane Frenay (UCL), doyenne de la facult de

    E-Print Network [OSTI]

    Nesterov, Yurii

    'enseignant est un praticien réflexif » : Eveline Charlier (FUNDP), Etienne Bocquet (UCL), Geneviève De Cock (HE

  13. INSTITUTO SUPERIOR DE AGRONOMIA REPRESENTAO TOPOGRFICA DO

    E-Print Network [OSTI]

    Lisboa, Universidade Técnica de

    o sentido contrário, para o centro da Terra). O eixo P tem o sentido do Norte cartográfico e o eixo referência. A B Norte Este M P DAB MA PA MB PB Plano MP (horizontal) A B A B Norte Este M P DAB MA PA MB PB Plano MP (horizontal) Norte Este M P DAB Norte Este M P Norte Este M P DABDAB MA PA MB PB MA PA MA PA MB

  14. Expresso Online Pas: Portugal

    E-Print Network [OSTI]

    Instituto de Sistemas e Robotica

    Madrid está de volta com show Imagens que estão a marcar esta quarta-feira, 19 de setembro Página Inicial show · Imagens que estão a marcar esta ... · A crise política e a subida dos juros · �ngelo Correia PÁGINA INICIAL · Real Madrid está de volta com show · Imagens que estão a marcar esta ... · A crise

  15. Theorie des langages Elise Bonzon

    E-Print Network [OSTI]

    Bonzon, Elise

    longueur de w X est l'alphabet x est une lettre de X |w|x est le nombre d'occurences de x dans w. Exemple´enation (produit) Propri´et´es Le produit est associatif w1, w2, w3 X , w1.(w2.w3) = (w1.w2).w3 = w1.w2.w3 est l mot sur l'alphabet X est une s´equence finie et ordonn´ee, ´eventuelle- ment vide, d'´el´ements de l

  16. ETUDE EN TEMPS PETIT DES SOLUTIONS D'EDS CONDUITES ...

    E-Print Network [OSTI]

    2014-02-18T23:59:59.000Z

    b . Il est bien connu que (Xt)t?0 est un processus de Markov de semi-groupe Pt = e. 1. 2 t ?n ... dans (??) sont comprises au sens de l'intégrale de Lyons, [?].

  17. atoll pour stocker: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    de l'nergie. Le but est de dcider, lorsqu'un vhicule est connect la smart-grid, si sa'nergie, Smart Grids, V2G, Vehicle-to-Grid, PLNE 1. Introduction 1.1....

  18. Monte Carlos Describase el metodo del rechazo para generar numeros aleatorios que

    E-Print Network [OSTI]

    Aretxaga, Itziar

    est´andar (gaussiana con promedio 0 y desviaci´on est´andar 1). · Dis´e~nese un experimento num´erico

  19. National Veterans Small Business Engagement | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    National Veterans Small Business Engagement National Veterans Small Business Engagement December 9, 2014 7:00AM EST to December 11, 2014 3:00PM EST Georgia World Congress Center...

  20. Buildings Events | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    EST ZERH Webinar: High-Performance Home Sales Training Part I 12:00PM to 1:00PM EST ESPC 2.0: How New Twists on Energy Savings Performance Contracting are Improving Energy...

  1. BNL Gas Storage Achievements, Research Capabilities, Interests...

    Broader source: Energy.gov (indexed) [DOE]

    BNL Complex Metal Hydride Project Team Dr. James Wegrzyn (ES&T) Project Manager James Reilly (ES&T) Nanocomposite metal hydride; 95 papers and 17 patents Dr. Gary...

  2. STEM Education Programs | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Brookhaven Teaching Fellows Program 9:00PM to 9:00PM EST TARGET: Science and Engineering Program 5:30PM to 9:30PM EST Internship for Italian Students at Fermilab...

  3. HLADIK, C.M., PASQUET, P. & SIMMEN, B. (2004) --Cultural o biolgico : qu significado tienen umbrales gustativos en trminos evolutivos? In : A. Milln-Fuertes, L. Cantarero, X. Medina, M. Montejano

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    Vicktoria Danilova, reconocidos por sus investigaciones sobre las reacciones de los nervios gustativos a diferentes estímulos (Hellekant, Danilova et al., 1997). Nuestros trabajos sobre reacciones gustativas están

  4. RSURGENCES 111, Rue Consolat -13001 Marseille

    E-Print Network [OSTI]

    van Tiggelen, Bart

    adulte. #12;6 #12;7 Ce sera quoi ma famille? La famille c'est la protection de tes parents. C'est une filles te relayent à la cuisine, pour la va

  5. Patrones de Diseo Jess Garca Molina

    E-Print Network [OSTI]

    Molina, Jesús García

    . Este Oeste Norte 1tr 3tr 4tr 2tr 1tr. 2tr. 3tr. 4tr. Este 20 25 90 20 Oeste 30 38 32 32 Norte 47 47 45

  6. Now Accepting Applications: BUILD Funding Opportunity | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 14, 2014 5:00PM EST to December 19, 2014 5:00PM EST Through its annual Buildings University Innovators and Leaders Development (BUILD) funding opportunity, the Energy...

  7. International Conference on Ocean Energy | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    on Ocean Energy International Conference on Ocean Energy November 4, 2014 1:00PM EST to November 6, 2014 10:00PM EST Halifax, Nova Scotia, Canada http:www.icoe2014canada.org...

  8. Renewable Resource Integration Project - Scoping Study of Strategic Transmission, Operations, and Reliability Issues

    E-Print Network [OSTI]

    Budhraja, Vikram

    2008-01-01T23:59:59.000Z

    production level from small hydro as recorded in 2006.  kWH Geothermal Biomass Small Hydro 830 est Wind Solar TotalRPS Geothermal Biomass Small Hydro 830 est Wind Solar Total

  9. Mobilit Donnes structures Mdia d'affichage WAP SOAP AJAX Rfrences Mobilit, Portabilit, Prennit

    E-Print Network [OSTI]

    van Tiggelen, Bart

    SOAP AJAX Références Constats Exemple : la PLM la PLM est faite pour faciliter la mobilité l'accès au structurées Média d'affichage WAP SOAP AJAX Références Constats Exemple : la PLM la PLM est faite pour

  10. El VII Festival de Teatro Hispano (Miami, 1992)

    E-Print Network [OSTI]

    Escarpanter, José A.

    1992-10-01T23:59:59.000Z

    . La presencia de este grupo resultó un brillante cierre para las jornadas de este festival, que año tras año ha ido ganando en calidad, proyección internacional y, afortunadamente, público interesado en él. Auburn University ...

  11. Etudes des transferts d'assimilats entre tiges de luzerne (Medicago sativa L.) par l'utilisation

    E-Print Network [OSTI]

    Boyer, Edmond

    ; Study of assimilate translocations between stems of lucerne plant using 14CO2 labelling. During regrowth - morphogenesis - lucerne Introduction La luzerne (Medicago sativa L.) est une plante fourragère pérenne qui est

  12. Revue de l'cole doctorale ED 382 Pratiques sociales

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    'auteur est un réalisateur à qui l'on doit notamment le documentaire à succès intitulé Laughing With Hitler. 105) et Hitler est un « braillard à la moustache en brosse à dents » (p. 277). Ce ton peut s

  13. AWEA Wind Resource & Project Energy Assessment Seminar 2014 ...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AWEA Wind Resource & Project Energy Assessment Seminar 2014 AWEA Wind Resource & Project Energy Assessment Seminar 2014 December 2, 2014 8:00AM EST to December 3, 2014 5:00PM EST...

  14. ARPA-E Energy Innovation Summit | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ARPA-E Energy Innovation Summit ARPA-E Energy Innovation Summit February 9, 2015 7:00AM EST to February 11, 2015 5:00PM EST Gaylord National Hotel and Convention Center 201...

  15. Unproductive splicing of SR genes associated with highly conserved and ultraconserved

    E-Print Network [OSTI]

    elements Liana F. Lareau1 *, Maki Inada2 *, Richard E. Green1 {, Jordan C. Wengrod1 & Steven E. Brenner1 expressed sequence tag (EST) libraries for SR transcripts, aligned these ESTs to the human genome to infer

  16. Humain behavior

    ScienceCinema (OSTI)

    None

    2011-04-25T23:59:59.000Z

    Le Dr.Muriel James est ingénieur, conseiller/consultant dans plusieurs commissions (p.ex.justice criminelle au Japon) et universités et est l'auteur de nombreux livres (11) traduits dans plusieurs langues. Le plus connu de ses ouvrages est "Born to win". Dans son exposé elle se réfère à son livre "O.K.Boss" et parle d'un modèle spécifique du comportement humain et de ses qualités essentielles qui est la base de son travail.

  17. RAPPORT DE RECHERCHE N 2012 -4

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    , baptisé SISMICs, qui est un Simulateur Inter-Sectoriel pour la Mesure des Impacts des Cotisations Sociales

  18. Un bréviaire des vaincus : la Passion de l’exilé dans l’oeuvre de Chateaubriand

    E-Print Network [OSTI]

    Morel, Anne-Sophie

    2006-01-01T23:59:59.000Z

    est ainsi comparee au Deluge: "De temps en temps, ladeposes par la les flots du deluge" le (MOT. geologic de

  19. 35, rue de la Gare 75935 Paris Cedex 19 Standard : 01 44 02 00 00

    E-Print Network [OSTI]

    Mesbah, Mounir

    salive émises lors de la toux, des sécrétions nasales et pharyngées. Le malade est contagieux avant même

  20. Original article Mycoplasma hyopneumoniae infection in pigs

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    quatrième groupe, non infecté, reçoit le milieu de culture. La toux est apparue 2 semaines après la première

  1. JOURNAL.DEPHYSIQUE I V Colloque Cl, supplment au Journal d e Physique Ill, Volume 2, avril 199'2

    E-Print Network [OSTI]

    Boyer, Edmond

    prédictibtepar des iBglesissuesdacompo&.ntes verbales(~olinger1972), le proMBme est de savoir comment situerles

  2. Remerciements Je voudrai tout d'abord remercier sincrement les membres de ce jury qui m'ont fait l'honneur

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    'est indiscutablement dans l'esprit. Comme toujours, dans ces expériences, il y a le soldat inconnu dont la contribution

  3. La Torture dans Muriel... d'Alain Resnais, une rflexion cinmatographique sur l'indicible et l'inmontrable

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    film se situe immédiatement après la guerre ; l'ancien soldat est rentré depuis quelques mois seulement

  4. limbes de Gernimo de Vivar : reprsentations et appropriation de la nature chilienne pendant la Con Extrait du Artelogie

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    Philippe II. La suite du texte ne nous en apprend guère plus. Assez pour affirmer que Vivar est un soldat

  5. Proceedings of COLING 2014, the 25th International Conference on Computational Linguistics: Technical Papers, pages 10591070, Dublin, Ireland, August 23-29 2014.

    E-Print Network [OSTI]

    artichauts et les asperges. (def.) (3) His brother became a soldier. (indef.) Son frère est devenu soldat

  6. Vendredi 7 novembre 2014 Recherche UCL

    E-Print Network [OSTI]

    Nesterov, Yurii

    personnel (je faisais la file pour obtenir du pain quand un soldat est venu vers moi pour me demander mes

  7. SOUTENANCE DE THESE EMMANUEL TAVERNIER

    E-Print Network [OSTI]

    Baudoin, Geneviève

    'EXPLOITATION DES HYDROCARBURES Résumé : La rentabilité d'un réservoir d'hydrocarbures est traditionnellement liée à

  8. BOLETIN DE AVES MARINAS LATINOAMERICANAS VOLUMEN 3j NUMERO 1

    E-Print Network [OSTI]

    Duffy, David Cameron

    hacer este tipo de investigaci6n. 1 #12;CONTAMINACION CON PETROLEO EN URUGUAY En una carta de J. Carlos

  9. Posgrado en Ciencias de la Tierra (PLANES DE ESTUDIO)

    E-Print Network [OSTI]

    Grutter, Michel

    Atmosféricas, Espaciales y Planetarias. http://www.geofisica.unam.mx/posgrado/planesEst/campo4.php #12;

  10. Stages de M2 modlisation en biologie 2011-2012 Contact :ovidiu.radulescu@univ-montp2.fr

    E-Print Network [OSTI]

    Radulescu, Ovidiu

    , DIMP UMR 5235, CNRS/ Université de Montpellier 1&2 Description : La modélisation stochastique est

  11. SIDEREUS NUNCIUS fiches enseignants

    E-Print Network [OSTI]

    Maume-Deschamps, Véronique

    Deux cratères sont bien visibles : Tycho au sud et Copernic. #12;Observation de Galilée : la Lune est

  12. The Trajectory approach for AFDX FIFO networks revisited and corrected

    E-Print Network [OSTI]

    Boyer, Edmond

    GEORGE Universit´e Paris-Est / LIGM Bat Copernic - 5, bd Descartes 77454 Champs sur Marne, France Email

  13. Amnesty International

    ScienceCinema (OSTI)

    None

    2011-04-25T23:59:59.000Z

    Martin Ennals est secrétaire général d'Amnesty International et fait un discours sur les droits de l'homme

  14. Capitulo 7 Estudio de la finalizacion

    E-Print Network [OSTI]

    Romero, Ignacio

    este caso se debe a desenrollamiento de cadenas polim´ericas. Por ´ultimo, los materiales cer´amicos o

  15. Modliser et simuler l'amnagement nergtique d'un territoire par les systmes multi-agents

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    Réunion se situe au centre du projet GERRIi (qui est à la fois l'acronyme de Green Energy Revolution

  16. Direccin de Personal Unidad Desarrollo Social

    E-Print Network [OSTI]

    Pérez, Carlos E.

    prolongación hasta el acceso de la Reserva, lugar donde termina este camino #12;Parque Jorge Alessandri #12

  17. UNIVERSIT PAUL VALRY -MONTPELLIER III Arts et Lettres, Langues et Sciences Humaines et Sociales

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    distancia que nos separa. Este trabajo de investigación es el resultado de mucho esfuerzo y paciencia

  18. ECOLE DE TECHNOLOGIE SUPERIEURE UNIVERSITE DU QUEBEC

    E-Print Network [OSTI]

    Québec, Université du

    1362-1998 Concept of Operations (CONOPS) Document. Le resultat de cette these est I'identification d

  19. Privacy Challenges in Patient-Centric Health Information Systems Anupam Datta , Nipun Dave , John Mitchell , Helen Nissenbaum , Divya Sharma

    E-Print Network [OSTI]

    'un tel classement, malgré ses imperfections, rendrait de nombreux services. C'est dans ce but que nous

  20. facebook.com/groups/UdeMBrasilCanada twitter.com/UdeMBrasil

    E-Print Network [OSTI]

    Montréal, Université de

    governo do Quebec, e um visto de estudante emitido pelo governo do Canadá. É essencial você obtiver estes

  1. JOURNAL DE PHYSIQUE Colloque C6, supplment au n 8, Tome 39, aot 1978, page C6-665 B. Dugnoille et A. Pilatte

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    approximative de Brillouin, Kramers et Wentzel (BKW). Dans ces conditions, l'expression de AG est complètement

  2. Diplme d'Universit THRAPEUTIQUE HOMOPATHIQUE 2013-2014

    E-Print Network [OSTI]

    Brest, Université de

    s'inscrit dans le quotidien de nombreux médecins : elle est efficiente et présente un intérêt majeur

  3. Etude cologique en immunofluorescence de Rhizobium japonicum dans le sol et la rhizosphre

    E-Print Network [OSTI]

    Boyer, Edmond

    'une association efficiente entre la plante hôte et la bactérie du genre Rhizobium. Lorsque le Rhizobium est absent

  4. PHYSISCOPE

    ScienceCinema (OSTI)

    None

    2011-10-06T23:59:59.000Z

    Peut-on survivre à une décharge de 100000 volts? Le corps humain est-il conducteur? Qu'est-ce la charge électrique? L'air est-il conducteur? Quel est le meilleur conducteur connu? Autant de question que l'on se posera durant cette découverte de la physique et le l'électricité, par une approche originale, ludique et participative.  Venez glisser en lévitation sur une trottinette supraconductrice !

  5. Facult des arts et des sciences Dpartement de science politique

    E-Print Network [OSTI]

    Parrott, Lael

    ? Comment la lutte entre les factions contribue-t-elle au développement de la liberté politique ? Est

  6. Comment Hollywood figure l'intriorit dans les films hollywoodiens de David Lynch,

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    film dans le film dont le tournage est perturbé par une lutte entre plusieurs factions (175). Todd Mc

  7. UNIVERSIDAD SIMN BOLVAR DIRECCIN DE ADMISIN Y CONTROL DE ESTUDIOS

    E-Print Network [OSTI]

    Vásquez, Carlos

    NACARETH Lic.en Matemáticas (Est. y Mat.Computacional) Sartenejas 7232 RAMOS CABRERA JUAN ALEJANDRO

  8. Sujet de thse / LGPM mars 2011 Modlisation double chelle de la transformation arobie et anarobie de la

    E-Print Network [OSTI]

    Bezerianos, Anastasia

    /utilisation du modèle sur au moins une configuration réelle. Le stockage de la bagasse de canne à sucre est l

  9. Diplme d'Universit De l'information la concordance

    E-Print Network [OSTI]

    Brest, Université de

    équivalent - Infirmiers DE, kinésithérapeutes DE, psychologues titulaires d'un DESS Le nombre d'inscrits est

  10. Paru dans Nathalie Nabert (d.), Figures du Mal aux XIV et XV sicles, Paris, 1996, p. 187-210.

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    'hérésie cathare, le christianisme s'est toujours efforcé de se démarquer du dualisme, notamment en insistant sur

  11. Production d'hydrogne au moyen d'un cycle thermo-lectrochimique mettant en oeuvre l'nergie solaire

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    (batterie sodium-soufre, accumulateur zinc- air) le stockage électrique n'est pas encore perfor- mant. Une

  12. La mtastructure VUEL et la gestion des reprsentations multiples

    E-Print Network [OSTI]

    nouvelle structure est basée sur le concept de VUEL (View Chapitre rédigé par Yvan BEDARD, Eveline BERNIER

  13. MESURE DE LA DIFFRENCE DE POTENTIEL VRAIE DE DEUX MTAUX AU CONTACT;

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    'un autre côté, le phénomène Peltier ne permet pas, ainsi que je l'ai montré ( ~ ), d'obtenir la différence électrique double et de celle qui se trouve sur les armatures d'un condensateur est encore plus com- plète électro- motrice de polarisation est inférieure à celle qui est nécessaire pour produire la décomposition

  14. SUR LA CAUSE DE L'LECTRISATION DES NUAGES ORAGEUX; PAR M. H. PELLAT.

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    , Peltier a admis, pour expliquer les phé- nomènes électriques dont notre atmosphère est le siège, que le Peltier, qui est, non une hypothèse, mais bien une réalité. On sait, en effet, que par le beau temps le milieu isolant augmente en s'éloignant de la surface d'un conducteur, celle-ci est chargée d

  15. L'AFFAIRE DES POISONS : ENTRE SCIENCE ET LITTRATURE, UNE RESSOURCE POUR

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    L'AFFAIRE DES POISONS : ENTRE SCIENCE ET LITTÉRATURE, UNE RESSOURCE POUR L'ENSEIGNEMENT Philippe épisode de l'« Affaire des poisons », laquelle s'est étalée sur la période 1672-1682. Un résumé des faits est consultable sur le site internet du ministère de la justice3 . « L'« Affaire des poisons » est l

  16. SYMPOSIUM DE GENIE ELECTRIQUE (SGE'14) : EF-EPF-MGE 2014, 8-10 JUILLET 2014, ENS CACHAN, FRANCE Influence de la gomtrie du conducteur sur la

    E-Print Network [OSTI]

    Boyer, Edmond

    postes isolés à l'air (AIS) car il est isolé au SF6 (hexafluorure de souffre) sous pression. Le SF6 est concentriques contenant du SF6 Pour cette étude, on se concentre sur un module composant le PSEM : le jeu de concentriques contenant du SF6 (Fig.1). Le cylindre intérieur (conducteur) est un cylindre creux dans lequel

  17. Rcents Progrs en Gnie des Procds, Numro 104 -2013 ISSN: 1775-335X ; ISBN: 978-2-910239-78-7, Ed. SFGP, Paris, France

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    présenté ici est un procédé de type Power-to-Gas dont l'objectif est de produire un gaz de synthèse partir de gaz naturel. Mots-clés: Power-to-Gas, SOEC, réversible, CH4, CO2 1. Introduction L'autres voies de résolution du problème. Le concept Power-to-Gas est une des solutions envisagées. Il consiste à

  18. EXPOSE ET MISE AU POINT BIBLIOGRAPH 1 QUE PROPAGATION DES CHOCS INTERATOMIQUES DANS LES SOLIDES

    E-Print Network [OSTI]

    Boyer, Edmond

    'effet des radiations sur les solides est un probl6me extremement complexe. Le compor- tement des solides la nature de la radiation utilis6e. Un des effets des radiations est de deplacer un certain nombre d atomes au repos. Leur liaison avec la maille est simplement sch6matis6e par 1'existence d'un seuil 6nerg6

  19. Universidad de Buenos Aires Facultad de Ciencias Exactas y Naturales

    E-Print Network [OSTI]

    Figueira, Santiago

    demostrador basado en este c´alculo. En este trabajo incorporamos orden y selecci´on al c´alculo propuesto en guiarme hasta ac´a salvando, literalmente, una gran distancia. Tambi´en al jurado, por tomarse el tiempo de leer y corregir este trabajo. A mi familia porque siempre me dio ´animo pero sin presionar nunca

  20. Actes JFPC 2012 Un Solveur Leger Efficace pour

    E-Print Network [OSTI]

    Deville, Yves

    est un langage de requ^etes standard pour ces bases de donn´ees. L'´evaluation de telles requ^etes est des APIs dédiées à certains sites (par exemple, Google API), ou recourir à l'écriture d'un analyseur'exécution de requêtes SPARQL. Sur des benchmarks standards, Castor est compétitif avec les moteurs existants et

  1. Solucin a la tarea 1: Pregunta II

    E-Print Network [OSTI]

    Meza, Oscar J.

    conjunto: L = { w { 0, 1}* : w=0 ó (w = 1v0 con v{ 0, 1}*)} , es decir, los números pares en binario sin estructural que E L, es decir todo w en E está en L: - 0 que está en E también está en L - Veamos que 1w, con w en E, está en L. Por inducción estructural w está L, así que w termina en 0, por lo cual 1w

  2. Interprte/orateur : pour le meilleur et pour le pire Elsa Yazbek Charabati

    E-Print Network [OSTI]

    Boyer, Edmond

    est là, là-bas : donc présent, en cabine ; et dans le noir, c'est à dire dans les coulisses. Il est là pour transmettre les paroles de l'orateur dans une autre langue. Il est là-bas, dans les coulisses dans l'oreille d'une grande célébrité, il est là ou là-bas, mais on ne le voit pas. Sans l'orateur, l

  3. Presentation at a visit by Danida and IFU at Ris National Laboratory on Thursday 16th

    E-Print Network [OSTI]

    Department Risø National Laboratory #12;9 Electricity from Wind Power Cumulative Est. average Est. average Est. electricity MW - end full load hours capacity factor production in Country/Region 2004 2004 TWh2) Germany 1) 16,649 1,794 20.5% 29.87 Spain 8,263 2,100 24.0% 17.35 USA 6,750 2,300 26.3% 15.53 Denmark 3

  4. VULNERABILITE ET DROIT DE LA CONSOMMATION (Colloque sur la vulnrabilit et le droit, organis par l'Universit P. Mends-France,

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    moyen, au regard notamment du Code de la consommation, ne peut plus être considéré comme l'homme actif, instruit, diligent, avisé qu'était le bon père de famille, dans le Code Napoléon, mais comme un être plus'est pas parce qu'il est systématiquement lésé, mais parce qu'il est susceptible de l'être pour la simple

  5. VIOL (Histoire du) Depuis la loi n80-1041 du 23 dcembre 1980, l'article 332 du code pnal prcise que

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    1 VIOL (Histoire du) Depuis la loi n°80-1041 du 23 décembre 1980, l'article 332 du code pénal'autrui par violence, contrainte, ou surprise est un viol. » En 1994, le nouveau Code pénal, reprenait cette la victime Le plaisir est doublement au coeur de la définition du viol, parce qu'il est nécessaire à

  6. info401 : Programmation fonctionnelle Contr^ole des connaissances 2

    E-Print Network [OSTI]

    Hyvernat, Pierre

    de commentez votre code. Un point est r´eserv´e pour la pr´esentation. Partie 1 : questions de cours (25 min) (2) Question 1. Suite `a ce morceau de code Caml, quelles sont les valeurs de x1, x2, x3 et x derni`ere expression, c'est parce que la fonction toute seule est de type int -> int -> float*int et qu

  7. Antoine Fleury, 2009, Potsdamer Platz : l'envers du dcor , Le Mensuel de l'universit Potsdamer Platz : l'envers du dcor

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    , aujourd'hui occupé par des bureaux. Au nord-ouest de la place, un second projet est confié à Sony qui y installe son siège européen. Conçu par Helmut Jahn, le Sony Center est un ensemble de verre et d multinationales comme Daimler-Benz et Sony4 est emblématique d'un

  8. RALISATION DE BOBINES POUR CHAMPS MAGNTIQUES SUPRIEURS A 300 KILOGAUSS

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    in a hooped coil at liquid nitrogen temperature. This coil is wound with copper wire. Fields of 250 000 gauss kilogauss ; pour des champs de 500 kGs et plus, on réalise des solénoïdes en forme d'hélice, taillés dans la forme : où X est un paramètre qui est donné graphiquement en fonction de ex et p et n est le nombre de

  9. Rgion Inde et Asie Centrale et de l'Ouest Prvisionnel 2010

    E-Print Network [OSTI]

    Waldschmidt, Michel

    Kurdistan Iraqien a été envisagé, maintenant c'est Turquie qui est sur les rangs). * Iraq La première conférence franco-iraqienne de mathématiques s'est tenue à Erbil au Kurdistan Iraqien en novembre 2009 sous particulier, lors de la conférence, il a été proposé à nos collègues du Kurdistan Iraqien de mettre en place

  10. LE SYSTEME PHONOLOGIQUE DU PUREPECHA Claudine Chamoreau

    E-Print Network [OSTI]

    Boyer, Edmond

    langues : «les langues n'évoluent pas dans des tours d'ivoire » dit justement Martinet3 (p. 89 nombreuses situations de communication sur la langue vernaculaire. Langue parlée au Mexique, au nord-ouest de que le nombre d'enfants est moindre dans les foyers où le purepecha est parlé. Tel n'est pas le cas

  11. Correction fiche TD 1 -L2 Economie-Gestion Exercice 1

    E-Print Network [OSTI]

    Barré, Julien

    Correction fiche TD 1 - L2 ´Economie-Gestion Exercice 1 : 1.et 2. Je vous laisse faire la figure et], donc on laisse de c^ot´e la solu- tion x = -1. On a f (0) = 1/2 donc 0 est un point fixe stable de f/5 est un point fixe stable de f. On fait la conjecture que un 3/5 quand n , et que c'est le cas pour

  12. COURBES LISSES, CYCLE MAXIMAL ET POINTS INFINIMENT VOISINS DES SINGULARITES DE SURFACES

    E-Print Network [OSTI]

    Gonzalez-Sprinberg, Gerard

    S ; on appelle cycle maximal le cycle ZX = miEi d´efini par la partie divisorielle de mOX, o`u m est l seulement si le cycle maximal ZX = miEi de mOX poss`ede une composante r´eduite, i.e. il existe i tel que mi = 1. S'il en est ainsi, mOX est localement principal au voisinage du point exceptionnel P de la

  13. Modlisation Modles dterministes et stochastiques pour les rythmes circadiens

    E-Print Network [OSTI]

    Goldbeter, Albert

    , faculté des sciences, université libre de Bruxelles, Campus Plaine, CP 231, B-1050 Bruxelles, Belgique lumière­obscurité. Lorsque le nombre de molécules d'ARNm et de protéines est faible, il est nécessaire de oscillations circadiennes. Il est en effet possible que le mécanisme d'autorégulation de l'expression génétique

  14. Expresso Online Pas: Portugal

    E-Print Network [OSTI]

    Instituto de Sistemas e Robotica

    agosto ... Grécia: PASOK admite Governo na quarta- feira �ltimas» Multimédia» Imagens que estão a marcar que seus amigos estão fazendo. Cadastre-se Plug-in social do Facebook NA PÁGINA INICIAL · Imagens que ... · Imagens que estão a marcar esta ... · Três eleições sem sobressaltos · Cascais enche-se de motos Harley

  15. la cellule en cuivre en contact avec l'hydrogne liquide (fig. 3). La liaison entre la cellule et le rservoir tritium

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    et le réservoir tritium gazeux est un tube d'acier inoxydable de 2 mm de diamètre. Les essais au tritium, dont le point triple est de 20,3 ~K (communiqué par J. K. Seagrave). Afin d'éviter une solidification dangereuse du tritium, une pressurisation de 0 à 100 g~cm2 environ est prévue sur le cryostat à

  16. Fondation Maison des sciences de l'homme -190 avenue de France -75013 Paris -France http://www.fmsh.fr -FMSH-WP-2014-72

    E-Print Network [OSTI]

    Boyer, Edmond

    - rement à Joyce lui-même, l'héroïne de la nouvelle « Eveline » renonce à l'exil mais quelle est sa repré qui relève de l'imaginaire, du fantasmé, de l'inédit. Est-ce qu'on a, pour ce qui est d'Eveline, le

  17. Aids Epidemic

    ScienceCinema (OSTI)

    None

    2011-04-25T23:59:59.000Z

    Exposé avec dias du développement de cette dangereuse épidémie qui est le sida. Le Dr. M.Koch a fait ses études à Hambourg et Kiel.

  18. September 15-21, 2012 Aboard National Geographic Sea Bird

    E-Print Network [OSTI]

    Aalberts, Daniel P.

    along the Palouse River. #12;4 hELLS CAnyOn: North America's deep- est river gorge, Hells Canyon Palouse river hells Canyon CLArkS

  19. agua potable problemas: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ce este necesar accesul liber (Open Access)? O perspectiv? transatlantic? University of Kansas - KU ScholarWorks Summary: This article was written to raise awareness among...

  20. agricolas por fluorescencia: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Applying New Technologies: ANT Automation es una empresa de Automatizacin Industrial, con operaciones en USA, Argentina y Espaa. La empresa est conformada por un slido grupo de...

  1. AGIR EN PARTENARIAT IRD -RAPPORT D'ACTIVIT 2013

    E-Print Network [OSTI]

    -cadres. L'IRD s'est associé aux Assises de la Re- cherche scientifique et technique de l'université Abdou

  2. abuso del estudio: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    de biocarburantes, podr-an suponer barreras no arancelarias al comercio del bioetanol brasileo. Este anlisis, que involucra el comercio de biocarburantes en el...

  3. arbitraje comercial internacional: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    de biocarburantes, podr-an suponer barreras no arancelarias al comercio del bioetanol brasileo. Este anlisis, que involucra el comercio de biocarburantes en el...

  4. autonoma metropolitana ixtapalapa: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    de biocarburantes, podr-an suponer barreras no arancelarias al comercio del bioetanol brasileo. Este anlisis, que involucra el comercio de biocarburantes en el...

  5. al estudio del: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    de biocarburantes, podr-an suponer barreras no arancelarias al comercio del bioetanol brasileo. Este anlisis, que involucra el comercio de biocarburantes en el...

  6. autonoma metropolitana-azcapotzalco evaluacion: Topics by E-print...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    de biocarburantes, podr-an suponer barreras no arancelarias al comercio del bioetanol brasileo. Este anlisis, que involucra el comercio de biocarburantes en el...

  7. analise comparativa internacional: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    de biocarburantes, podr-an suponer barreras no arancelarias al comercio del bioetanol brasileo. Este anlisis, que involucra el comercio de biocarburantes en el...

  8. avance del marco: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    de biocarburantes, podr-an suponer barreras no arancelarias al comercio del bioetanol brasileo. Este anlisis, que involucra el comercio de biocarburantes en el...

  9. asesor internacional desde: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    de biocarburantes, podr-an suponer barreras no arancelarias al comercio del bioetanol brasileo. Este anlisis, que involucra el comercio de biocarburantes en el...

  10. al comercio agropecuario: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    de biocarburantes, podr-an suponer barreras no arancelarias al comercio del bioetanol brasileo. Este anlisis, que involucra el comercio de biocarburantes en el...

  11. asignativa del mercado: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    de biocarburantes, podr-an suponer barreras no arancelarias al comercio del bioetanol brasileo. Este anlisis, que involucra el comercio de biocarburantes en el...

  12. atendidos por una: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    de biocarburantes, podr-an suponer barreras no arancelarias al comercio del bioetanol brasileo. Este anlisis, que involucra el comercio de biocarburantes en el...

  13. Live with the Energy Innovation Hub Directors

    Broader source: Energy.gov [DOE]

    Tune in today, Tuesday, March 6, 2012, at 2:15pm EST for a live discussion with our three Energy Innovation Hubs directors.

  14. 3/30/2014 Morile de vnt minuscule care ncarc bateria telefonului mobil | Solar-Magazin.ro http://www.solar-magazin.ro/cercetare/inventii-solare/incarcarea-bateriilor-telefoanelor-mobile-cu-mori-de-vant-minuscule.html 1/2

    E-Print Network [OSTI]

    Chiao, Jung-Chih

    telefonul nu mai are baterie, tot ce trebuie s facei este s punei telefonul pe manon, s îl scuturai în aer

  15. anneli zirkel jaanus: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Option Introduction la tricolores l'intersection d'une route principale RP et d'une route secondaire RS. Le principe utilis est Pierre, Laurence 139 Universit...

  16. Une dmonstration de la dcomposition de Dunford inspir de l'algorithme de Newton.

    E-Print Network [OSTI]

    Ressayre, Nicolas

    algorithme qui a le bon gout d'être très rapide). 2 Algorithme de Newton L'algorithme de Newton est un

  17. COLLEGEDESETUDESDOCTORALES 74rueLouisPasteur

    E-Print Network [OSTI]

    Avignon et des Pays de Vaucluse, Université de

    'origine anthropique (CFC-11, CFC-12 et CFC-113 et SF6), particulièrement lorsque le radiocarbone est couplé au SF6 ou

  18. prsente par Franck LECOCQ

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    toux ceux dont l'enthousiasme et la motivation font vivre ce drôle de navire qu'est le CIRED. A tout

  19. In memoriam circulo Grald Tenenbaum

    E-Print Network [OSTI]

    Tenenbaum, Gérald - Institut de Mathématiques Élie Cartan, Université Henri Poincaré

    tournoyant. C'est le destin du soldat, je n'avais pas de haine. Mais les dieux sans doute en avaient décidé

  20. Christian Hottin Monuments aux morts dans l'enseignement suprieur -2006 Le flambeau du savoir et la flamme du souvenir

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    tombe du soldat inconnu prenne place sous l'Arc de Triomphe, est bien celle qui émane de l'ensemble de

  1. CALCUL QUANTIQUE DE L'ANISOTROPIE DIAMAGNTIQUE DES MOLCULES ORGANIQUES III. HYDROCARBURES AROMATIQUES COMPLEXES

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    15. CALCUL QUANTIQUE DE L'ANISOTROPIE DIAMAGNÉTIQUE DES MOLÉCULES ORGANIQUES III. HYDROCARBURES orbitales moléculaires est étendue au cas des hydrocarbures conjugués contenant au moins quatre noyaux

  2. Les deux voyages faits par Jules Verne en Belgique et aux Pays-Bas par Kees Waij en Garmt de Vries

    E-Print Network [OSTI]

    Har?El, Zvi

    'avoir vu aussi une toile de Rembrandt, car le nom de Rembrandt est rayé dans le journal. Á partir du Musée

  3. UNIVERSIDADE TECNICA DE LISBOA INSTITUTO SUPERIOR TECNICO

    E-Print Network [OSTI]

    Instituto de Sistemas e Robotica

    agradecer o es- pelhamento excelente do nosso espelho esf´erico: depois de todos estes anos de opera¸c~ao o

  4. Tendencias poblacionales recientes y distribucin de aves estepricas en las Islas Canarias orientales.

    E-Print Network [OSTI]

    Carrascal, Luis M.

    de su distribución a escala de 1x1 km2. #12;· Este proyecto se nutre de los inventarios y programas

  5. UNIVERSIDAD SIMN BOLVAR VICERRECTORADO ACADMICO

    E-Print Network [OSTI]

    Vásquez, Carlos

    está levantando un inventario de los espacios físicos no utilizados en el actual momento. 7. Casos

  6. MEJORAMIENTO DE ONDAS INTERNAS EN IMGENES SAR USANDO, EN FORMA COMBINADA, LAS TRANSFORMADAS RADON Y WAVELETS (1-D)

    E-Print Network [OSTI]

    Hernández-Walls, Rafael

    distribución especial del oleaje y de las ondas internas, cuando estas están presentes en una imagen SAR. En

  7. Science and society-M.Curie/N.Bohr

    ScienceCinema (OSTI)

    None

    2011-04-25T23:59:59.000Z

    Ugo Amaldi introduit le conférencier du soir, Pierre Radvanyi; le thème de cette conférence est: Marie Curie, Niels Bohr and Science Society- Problems of their time

  8. Science and Society

    ScienceCinema (OSTI)

    None

    2011-04-25T23:59:59.000Z

    Le conférencier (qui? L'introduction manque) est économiste et directeur d'un institut de recherche. Il parlera des conséquences économiques désastreuses des dépenses militaires.

  9. Consortium for Plant Biotechnology Research 2015 Annual Symposium...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5:00PM EST The George Town Club 1530 Wisconsin Avenue Northwest Washington, District of Columbia 20007 Bioenergy Technologies Office Director Jonathan Male will be speaking on...

  10. aplicados ao conversor: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    (step-up) para aplicaes de energy harvest. Este circuito utiliza uma arquitectura Switched capacitor voltage tripler, controlada por um (more) Lameiro, Jos...

  11. atmosfera controlada para: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    (step-up) para aplicaes de energy harvest. Este circuito utiliza uma arquitectura Switched capacitor voltage tripler, controlada por um (more) Lameiro, Jos...

  12. artesanales del occidente: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    a nivel de Europa occidental, un debate sobre cuestiones relacionadas con la arquitectura funeraria y la Engineering Websites Summary: Este encuentro internacional pretende...

  13. SUR LA PNTRATION DE L'0152IL ET LE DIAMTRE DES LMENTS RTINIENS; PAR M. G. MESLIN.

    E-Print Network [OSTI]

    Boyer, Edmond

    'un côté, on sait que l'oeil ne peut distinguer deux points lorsque lenr angle apparent est inférieur à 60

  14. Bernstein inequality and moderate deviation under strong mixing conditions

    E-Print Network [OSTI]

    Boyer, Edmond

    `ede a , Magda Peligrad b 1 and Emmanuel Rio c 2 a Universit´e Paris Est, LAMA, UMR 8050 CNRS, B^atiment Copernic

  15. Muslim Women at a Crossroads: Gender and Development in the Xinjiang Uyghur Autonomous Region, China

    E-Print Network [OSTI]

    Huang, Cindy

    2009-01-01T23:59:59.000Z

    in post-Soviet Kazakhstan. ” In The Transformation ofXinjiang (est. )  China  Kazakhstan  Russia  Uyghurs havekidnapping in post-Soviet Kazakhstan. In my understanding,

  16. aux changements climatiques: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CNRM-GAME | CNRSMto-France Journe Scientifique de Mto & Climat La perception du changement'activit cyclonique est un niveau particulirement bas...

  17. Building America Webinar: High Performance Space Conditioning...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    EST The webinar will continue our series on strategies to improve the performance of HVAC systems for low load homes and home performance retrofits. Presenters and specific...

  18. asian tropical seagrass: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of California eScholarship Repository Summary: 1966, Estes & Water column eutrophication Palmisano 1974,would fol- water column eutrophication on seagrasses (Howardwater...

  19. Science and Society

    SciTech Connect (OSTI)

    None

    2006-07-18T23:59:59.000Z

    "Can nuclear war be controled?"- la guerre nucléaire peut-elle être contrôlée? Tel est le thème de cette conférence avec présentation des dias.

  20. application au chauffage: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Colloque C4, Supplement au n04, Tome 24, Avril 1989 Physics Websites Summary: un aerogel granule dans l'espace intermddiaire des vitrages isolants il est possible...

  1. 3. TTULO ALTE 4. FECHA DE P

    E-Print Network [OSTI]

    abajo.) bajo en la seri manera autom dle System. umental del o/Working Pap según el está amente por el

  2. EVALUATION DES CONSEQUENCES D'ACCIDENTS DE TRANSPORT

    E-Print Network [OSTI]

    Boyer, Edmond

    radioactives matières corrosives matières et objets dangereux divers CLASSE LIMITATIVE oui non non en partie inflammables (polymères, point éclair lithium. * Le degré de toxicité est établi en

  3. Recesion de glaciares y recursos hidricos en la Cordillera Blanca de El Peru

    E-Print Network [OSTI]

    Howat, Ian M.

    impactos sobre la hidrologi´a de la cuenca alta del Ri´o Santa. El efecto de este retroceso sobre los

  4. Club of Rome

    ScienceCinema (OSTI)

    None

    2011-04-25T23:59:59.000Z

    Le Club de Rome s'est fait connaître du grand public par la publication du premier ouvrage "Halte à la croissance" qui a fait l'object d'un débat, il y a 2 ans. Le Prof. Tinbergen a commencé par s'adonner à la physique, il est docteur en physique et très tôt il s'est tourné vers les problèmes sociaux économiques. Il est expert auprès des nombreux gouvernements et organisations internationales et il a vu ses travaux couronnés par le prix Nobel en 1969.

  5. argentinas del virus: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    21 22 23 24 25 Next Page Last Page Topic Index 1 Multiplicador del gasto pblico en Argentina. Open Access Theses and Dissertations Summary: ??Este trabajo proporciona por...

  6. argentinas sobre bacterias: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    21 22 23 24 25 Next Page Last Page Topic Index 1 Multiplicador del gasto pblico en Argentina. Open Access Theses and Dissertations Summary: ??Este trabajo proporciona por...

  7. active microbial phosphoantigen: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    in affected tissues. In chronically Jacob D. Estes; Levelle D. Harris; Nichole R. Klatt; Brian Tabb; Stefania Pittaluga; Mirko Paiardini; G. Robin Barclay; Jeremy Smedley; Rhonda...

  8. Science and Society

    ScienceCinema (OSTI)

    None

    2011-04-25T23:59:59.000Z

    "Can nuclear war be controled?"- la guerre nucléaire peut-elle être contrôlée? Tel est le thème de cette conférence avec présentation des dias.

  9. Webinar: Learn about the BUILD funding opportunity | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    19, 2014 | 3pm to 4pm EST The Energy Department announces the 1 million Buildings University Innovators and Leaders Development (BUILD) Funding Opportunity Announcement...

  10. J. Phys. III France 6 (1996) 907-942 JULY 1996, PAGE 907 S4chage d'un enduit pigment4 avec

    E-Print Network [OSTI]

    Boyer, Edmond

    ments sp6cifiques d'6gout- tage. Le matelas fibreux ainsi obtenu est ensuite press6,s6ch6, caIandr6 et

  11. N d'ordre : 10020 UNIVERSITE PARIS-SUD 11

    E-Print Network [OSTI]

    Boyer, Edmond

    assourdissantes m'ont donn´e le go^ut de la recherche. J'esp`ere que notre collaboration continuera puisqu'il est

  12. Esquema hibrido para amostragem de mapas de iluminac~ao em

    E-Print Network [OSTI]

    Padre. Dende el vientre de mi madre Vine a este mundo a cantar. Que no se trabe mi lengua Ni me falte la

  13. EIS-0483: EPA Notice of Availability of Draft Environmental Impact...

    Office of Environmental Management (EM)

    3: EPA Notice of Availability of Draft Environmental Impact Statement EIS-0483: EPA Notice of Availability of Draft Environmental Impact Statement Estes to Flatiron Substation...

  14. Webinar: Leadership Recognition with Housing Innovation Awards

    Broader source: Energy.gov [DOE]

    Title: Leadership Recognition with Housing Innovation Awards             Date: Wednesday, May 21, 2014Time: 12:00PM - 1:00 PM EST

  15. aquifere poreux dans: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    plus du travaillent dans le monde entier (Canada, ?tats-Unis, Europe, Tunisie, Maroc, etc.) Le magazine POLY est canadiennes soutenant le secteur de l'ducation -...

  16. adaptation canadienne du: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    plus du travaillent dans le monde entier (Canada, ?tats-Unis, Europe, Tunisie, Maroc, etc.) Le magazine POLY est canadiennes soutenant le secteur de l'ducation -...

  17. aupres du futur: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    plus du quart des membres de l'Ordre des ingnieurs du Qubec (OIQ). En, Maroc, etc.) Le magazine POLY est galement rendu disponible auprs des autres membres...

  18. accords sectoriels dans: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    plus du travaillent dans le monde entier (Canada, ?tats-Unis, Europe, Tunisie, Maroc, etc.) Le magazine POLY est canadiennes soutenant le secteur de l'ducation -...

  19. analytiques utilisees dans: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    plus du travaillent dans le monde entier (Canada, ?tats-Unis, Europe, Tunisie, Maroc, etc.) Le magazine POLY est canadiennes soutenant le secteur de l'ducation -...

  20. atmospherique particulaire dans: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    plus du travaillent dans le monde entier (Canada, ?tats-Unis, Europe, Tunisie, Maroc, etc.) Le magazine POLY est canadiennes soutenant le secteur de l'ducation -...

  1. aupres du collisionneur: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    plus du quart des membres de l'Ordre des ingnieurs du Qubec (OIQ). En, Maroc, etc.) Le magazine POLY est galement rendu disponible auprs des autres membres...

  2. adrenergique cardiaque dans: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    plus du travaillent dans le monde entier (Canada, ?tats-Unis, Europe, Tunisie, Maroc, etc.) Le magazine POLY est canadiennes soutenant le secteur de l'ducation -...

  3. atteintes gastro-intestinales dans: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    plus du travaillent dans le monde entier (Canada, ?tats-Unis, Europe, Tunisie, Maroc, etc.) Le magazine POLY est canadiennes soutenant le secteur de l'ducation -...

  4. aromatiques polycycliques dans: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    plus du travaillent dans le monde entier (Canada, ?tats-Unis, Europe, Tunisie, Maroc, etc.) Le magazine POLY est canadiennes soutenant le secteur de l'ducation -...

  5. antimikroba dan sifat: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    plus du travaillent dans le monde entier (Canada, ?tats-Unis, Europe, Tunisie, Maroc, etc.) Le magazine POLY est canadiennes soutenant le secteur de l'ducation -...

  6. symposium summary: Introduced conifer invasions in South America: an update

    E-Print Network [OSTI]

    2010-01-01T23:59:59.000Z

    in a temperate for- est in Patagonia, Argentina. BiologicalSimberloff et al. 2010). In Patagonia, several pine speciesthe Argentinean northern Patagonia. They found high levels

  7. arbustos nativos micorrizados: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    69 Recibido 20110428 Aceptado 20121008 Physics Websites Summary: ') en Santa Cruz, Patagonia austral argentina Laura Rincn Gamba* Resumen: En este trabajo se tral argentina....

  8. arbusto nativo mulinum: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    69 Recibido 20110428 Aceptado 20121008 Physics Websites Summary: ') en Santa Cruz, Patagonia austral argentina Laura Rincn Gamba* Resumen: En este trabajo se tral argentina....

  9. GLOBALIZACIÓN Y CRISIS DE LA DEMOCRACIA EN BRASIL: Perplejidades Contemporáneas

    E-Print Network [OSTI]

    Cunha, Djason B. Della

    2007-01-01T23:59:59.000Z

    DE LA DEMOCRACIA EN BRASIL: Perplejidades ContemporáneasPotiguar – UnP (Natal - Brasil). Resumen Este texto trata depaíses periféricos, notadamente el Brasil? SKLAIR, Leslie.

  10. Posgrado en Investigacin Matemtica, Universidad Complutense de Madrid, Mencin de Calidad MEC (MDC 2006-00482)

    E-Print Network [OSTI]

    Tradacete, Pedro

    Posgrado en Investigación Matemática, Universidad Complutense de Madrid, Mención de Calidad MEC doctorados con Mención de Calidad Este curso no tiene gastos de matriculación siendo libre la asistencia

  11. Posgrado en Investigacin Matemtica, Universidad Complutense de Madrid, Mencin de Calidad MEC (MDC 2006-00482)

    E-Print Network [OSTI]

    Tradacete, Pedro

    Posgrado en Investigación Matemática, Universidad Complutense de Madrid, Mención de Calidad MEC visitantes en estudios de doctorados con Mención de Calidad Este curso no tienen gastos de matriculación

  12. Instituto Superior Tecnico Departamento de Matematica

    E-Print Network [OSTI]

    Ferreira dos Santos, Pedro

    existe sse > 1. Este exerc´icio tamb´em pode ser resolvido com uma transforma¸c~ao de vari´aveis u = xy

  13. Signature CERN-URSS

    ScienceCinema (OSTI)

    None

    2011-04-25T23:59:59.000Z

    Le DG W.Jentschke souhaite la bienvenue à l'assemblée et aux invités pour la signature du protocole entre le Cern et l'URSS qui est un événement important. C'est en 1955 que 55 visiteurs soviétiques ont visité le Cern pour la première fois. Le premier DG au Cern, F.Bloch, et Mons.Amaldi sont aussi présents. Tandis que le discours anglais de W.Jentschke est traduit en russe, le discours russe de Mons.Morozov est traduit en anglais.

  14. Spcification et Validation d'un Contrleur de Performances Sportives

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    - tème médical est la machine de radiation THERAC25 [1], développée par la compagnie AECL1 . Cette

  15. Responsabilidad Civil Extracontractual en Paraguay: un enfoque económico

    E-Print Network [OSTI]

    Perez Talia, Mark E.

    2008-01-01T23:59:59.000Z

    En consecuencia, el bienestar social será menor que elEsta diferencia se llamará Bienestar Social. Consideremos elprecaución Daño Esperado Bienestar social En este ejemplo,

  16. En busca de la solidaridad: feminismo y nación en el Caribe hispano, 1880-1940

    E-Print Network [OSTI]

    Ortiz-Loyola, Brenda

    2013-01-01T23:59:59.000Z

    el progreso y el bienestar social. 55 Este enfoque no sólola democracia, el bienestar social y el comercio sin lasiquiera las metas de bienestar social que habían aglutinado

  17. aislado chileno del: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    terica en torno a conceptos como los mecanismos de seleccin de candidatos y la calidad de la trabajo planteadas. Introduccin El objetivo de este trabajo es describir...

  18. agua nas palhadas: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Agenda Storage : DAS SAN NAS Dploiement VLAN - 802.1Q Gestion d Scurisation de Windows Scurisation de UNIX Qu'est-ce...

  19. atendimento nas unidades: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Agenda Storage : DAS SAN NAS Dploiement VLAN - 802.1Q Gestion d Scurisation de Windows Scurisation de UNIX Qu'est-ce...

  20. agujas con sistema: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    convocatoria est encuadrada dentro de las Mathematics Websites Summary: SISTEMA DE GESTION DE BIBLIOTECAS: MODULO DE INFORMES La accin formativa objeto de la presente...

  1. he Materials Science Laboratory (MSL) is an interdisciplinary facility dedicated to

    E-Print Network [OSTI]

    provides the lat- est in controls and safeguards for protection of the public, the environment- nologies, including recycling and reprocessing tech- niques that are more environmentally acceptable

  2. National Strategy for the Arctic Region Stakeholder Outreach...

    Broader source: Energy.gov (indexed) [DOE]

    7, 2015 1:30PM to 3:30PM EST Unalaska, Alaska Unalaska Public Library 64 Eleanor Dr. Unalaska, AK 99685...

  3. enlaChampionsdelarecerca Amb22ajutsdelConsellEuropeuderecercaobtinguts,laUPFes

    E-Print Network [OSTI]

    Geffner, Hector

    retallades pressu- postàries que el Govern està aplicant en diferents àmbits. Enguany, la Universitat Pompeu

  4. alexandrium spp samples: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    spp., Oils, 1982 and 1983 JEANNE D. JOSEPH Introduction Menhaden, Brevoortia spp., oil, the commercial fish oil produced in great- est volume 73 Four new Ceratocystis spp....

  5. Corrige Contr^ole continu Arithmetique et alg`ebre commutative mercredi 26 fevrier 2014 10h0012h00

    E-Print Network [OSTI]

    van Leeuwen, Marc

    ker(f) = (nX - 1). Le sous-anneau Z[ 1 n ] de Q est celui de toutes les factions pouvant ^etre ´ecrit

  6. Actes de Journes de Bordeaux -1 -sur la Pratique de l'Ergonomie

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    certain nombre d'approches japonaises, de Kaizen, le 5S etc. Ce qui est un petit peu nouveau dans les

  7. Solar Powering America by Recognizing Communities Funding Opportunity...

    Energy Savers [EERE]

    Solar Powering America by Recognizing Communities Funding Opportunity Solar Powering America by Recognizing Communities Funding Opportunity March 5, 2015 5:00PM EST U.S. Department...

  8. Nicolas Chambon, sociologue, Orspere Samdarra CH Le Vinatier, Centre Max Weber Lyon 2 Le migrant prcaire comme nouvelle figure du dbordement

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    . Un infirmier psy décrit cela dans ces termes : « c'est très intriqué, à un moment on ne sait plus par

  9. Genve, le 3 juin 2005 Dies academicus 2005

    E-Print Network [OSTI]

    Loewith, Robbie

    son nom est attaché à une unité de mesure, je veux parler de Nikola Tesla. Nous lui devons notamment l

  10. Ocrebrouma mquinadeTuring

    E-Print Network [OSTI]

    Menczer, Filippo

    da má quina a imitar Tudo isto poderá parecer despro vido de interesse prático mas nada está mais

  11. Remedial action plan and site design for stabilization of the inactive uranium mill tailings sites at Rifle, Colorado: Final report. Volume 3, Appendix F, Final design, specifications, and drawings

    SciTech Connect (OSTI)

    Not Available

    1992-02-01T23:59:59.000Z

    This volume contains Appendix F, bid schedule and specifications for remedial action on three sites: Old Rifle processing site; New Rifle processing site and Estes Gulch disposal site.

  12. Remedial action plan and site design for stabilization of the inactive uranium mill tailings sites at Rifle, Colorado: Final report

    SciTech Connect (OSTI)

    Not Available

    1992-02-01T23:59:59.000Z

    This volume contains Appendix F, bid schedule and specifications for remedial action on three sites: Old Rifle processing site; New Rifle processing site and Estes Gulch disposal site.

  13. University of Leeds MATH 1050 Solutions 3

    E-Print Network [OSTI]

    Wirosoetisno, Djoko

    Posons A = {a + ib 5 C/a, b Z}. 1. Montrer que c'est un anneau. 2. Montrer que l'application A R qui

  14. TROIS CAS D'ALBINISME RENCONTRS EN SUISSE DANS LA RACE BRUNE DES ALPES

    E-Print Network [OSTI]

    Boyer, Edmond

    tyrosinase. Ce caractère biochimique n'est toutefois pas nécessaire pour identifier le locus C : l'absence d

  15. Rencontres gosynthtiques 2011 PERFORMANCE D'UN GSB DANS UNE COUVERTURE D'INSTALLATION DE

    E-Print Network [OSTI]

    Boyer, Edmond

    couverture du site est discutée. Mots-clés : couverture, GSB, ISDND ABSTRACT ­ Six geosynthetic clay liner

  16. Obtaining Disaster Assistance (Spanish)

    E-Print Network [OSTI]

    Cavanagh, Joyce

    2008-09-24T23:59:59.000Z

    n?mero haya sido asignado, servir? para identificarlo a usted y su reclamo ante FEMA. Este n?mero constar? en toda correspondencia oficial relacionada con su reclamo. Cada representante e inspector oficial de FEMA contar? con este n?mero antes... de comunicarse con usted. En caso de que alguien que diga ser oficial de FEMA le solicite este n?mero, no se lo d?. Dado que los representantes oficiales de FEMA ya tienen este n?mero, debe solicitarles la identificaci?n. Se le enviar? una copia...

  17. E-Print Network 3.0 - arabidopsis reveals correlation Sample...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and Ecology ; Biology and Medicine 3 A Populus EST resource for plant functional genomics Fredrik Sterky* Summary: to Arabidopsis proteins (Fig. 1). For sequences exceeding...

  18. DEFINIR HOMEPAGE Tera-feira, 28 de Maio de 2013

    E-Print Network [OSTI]

    Instituto de Sistemas e Robotica

    dinossauro estão na Lourinhã Sismos: Técnicas tornam casas de adobe mais seguras Cientistas encontram sangue

  19. UNIVERSIT DE NANTES FACULT DES SCIENCES ET DES TECHNIQUES

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    remerci´e pour son soutien qui s'est poursuivi par le financement d'une partie des sismos acquis par le

  20. COMIT FRANAIS D'HISTOIRE DE LA GOLOGIE -Troisime srie -

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    commencer, l'accent est mis sur un axe sismo-tectonique filant de la région de Saarbrucken vers Munich et l

  1. Statistical properties of subgroups of free groups Frederique Bassino, Frederique.Bassino@lipn.univ-paris13.fr

    E-Print Network [OSTI]

    of Southampton Cyril Nicaud, nicaud@univ-mlv.fr IGM, Universit´e Paris-Est§ Enric Ventura, enric.ventura

  2. Statistical properties of subgroups of free groups Frederique Bassino, Frederique.Bassino@lipn.univ-paris13.fr

    E-Print Network [OSTI]

    of Southampton Cyril Nicaud, nicaud@univ-mlv.fr Universit´e Paris-Est, IGM§ Enric Ventura, enric.ventura

  3. RESEARCH ARTICLE Isolation from forest reduces pollination, seed predation

    E-Print Network [OSTI]

    Richner, Heinz

    in Swiss farmland Nina Farwig Æ Debra Bailey Æ Este´e Bochud Æ John D. Herrmann Æ Eveline Kindler Æ Niklaus

  4. ment capillaire, long, et donne une lueur blanche, illuminant le tube capillaire dans tonte sa longueur, constitue par un spectre continu;

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    , si la machine charge une batterie d'accumulateurs, le courant est pul- satoire. Il n'est plus de l'intensité sur la différence de potentiel. M. Banti considère la batterie comme fonctionnant à machine, M. Banti insère dans le circuit une résistance inductive. E. ALMANSI. - Sopra un problema di

  5. 3 Capacit. -On a d'o, pour la formule de transformation,

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    PELTIER; PAR M. E. BOUTY. Soit un canal ACBD imperméable à la chaleur, contenant en ACB du sable condensation d'une quantité d'eau égale. Ce phénomène thermique est l'image du phénomène découvert par Peltier à la soudure de deux conducteurs. La soudure A, qui se Fig. i. refroidit, est précisément celle qu

  6. Everest

    ScienceCinema (OSTI)

    None

    2011-04-25T23:59:59.000Z

    Chris Bonington, est né à Hampstead et a fait des études à University Collège School à Londres et au Royal Military Academy à Sundhorst. Il est un alpiniste mondialement connu qui a fait un grand nombre de premiers ascensions, comme celle de la face sud-ouest de l'Everest avec une équipe de 70 hommes en septembre 1975

  7. JOURNAL DE PHYSIQUE Colloque C7, supplment au n012, Tome 48, dcembre 1987

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    conception cylindrique de la cuve, l'écoulement de gaz est généré par une turbine tournant à 3600t/mn. Cet'écoulement des gaz. d) Stabilisation de la puissance du faisceau laser. a) Cavité optique. La cavité optique est:1987731 #12;C7-172 JOURNAL DE PHYSIQUE c) Conception du système d16coulement des gaz. Du fait de la

  8. JOURNAL DE PHYSIQUE IV Colloque C5, supplment au Journal de Physique III, Volume 4, mai 1994 C5-31

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    les turbines ( Fig. no 1). LES SOURCESDE BRUIT DU MOTEUR 2.1.1.Le bruit dejet C 'est un bruit de type pression et à la température des gaz. Il est dû à la génération de fortes turbulences dans la zone ou les gaz éjectés se mélangent à l'air ambiantcettezone de mélangeest située à plusieurs diamètresdu plan de

  9. DISPOSITIFS CRYOGNIQUES POUR LES APPLICATIONS DE LA SUPRACONDUCTIVIT

    E-Print Network [OSTI]

    Boyer, Edmond

    turbines de détente à hélium doivent tourner à très grande vitesse et sont souvent à palier à gaz. Il'hélium liquide qui est actuellement de l'ordre de 35 F le litre, gaz compris, a beaucoup contribué à développer. Dans cette méthode, la plus grande partie de la chaleur sensible du gaz évaporé est perdue. Le ren

  10. Journes Internationales de Thermique Albi, France du 28 au 30 Aot 2007 1

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    gaz dans les parties canal et couche de diffusion cathodique d'une pile à combustible (PEMFC) est'écoulement et la nature du milieu poreux sur la distribution de gaz dans la couche de diffusion. Mots clés la pile à combustible est que les températures sont d'un plus faible niveau que dans les turbines ou

  11. tude d'un changeur contre-courant gaz-gouttes de chlorure de sodium en cours de cristallisation

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    énergie électrique ou mécanique dans une turbine à gaz. Ceci nécessite que la température de sortie du gaz189 Étude d'un échangeur à contre-courant gaz-gouttes de chlorure de sodium en cours de'échangeur contre-courant entre un gaz et un sel fondu est présenté. L'énergie du gaz est directement convertie en

  12. Journes Internationales de Thermique Albi, France du 28 au 30 Aot 2007 1

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    bord d'attaque d'une aube symétrique de turbine à gaz. Pour compléter l'étude le même calcul est calcul ANSYS CFX 5.7.1. Le cas étudié est une aube de turbine à gaz de forme symétrique munie de deux efficace employée dans le domaine du refroidissement des aubes de turbines à gaz. Dans cette technique, de

  13. Radical valuatif et sous-extensions Ahmed Ayache et Paul-Jean Cahen

    E-Print Network [OSTI]

    Cahen, Paul-Jean

    T est contenu dans le corps des fractions de D, on dit que T est un suranneau de D. On note htp la + d.t.[T/q : D/p] htp + d.t.[T : D]. On dit que cette extension v´erifie la formule de la dimension

  14. Weatherization and Intergovernmental Programs Office Events ...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 2015 < prev next > Sun Mon Tue Wed Thu Fri Sat 1 2 3 4 5 6 7 NLC Annual Conference 1:00PM to 9:00PM EST 8 9 10 11 12 13 14 NLC Annual Conference 1:00PM to 9:00PM EST...

  15. J. PROKS. -LAIT On trouvera dans les livres de la mdecine humaine (1) des rensei-

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    enfants successifs est proportionnel à, la durée d'intervalle des grossesses. (A suiore.] LAIT D'ON GOUT'UN GOUT SAL� 353 Mais il en est tout autrement si les vaches sont soumises à une trop grande fatigue; un

  16. DISTILLATION DES LIQUIDES SOUS L'INFLUENCE DE L'LECTRICIT STATIQUE; PAR M. D. GERNEZ.

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    36I DISTILLATION DES LIQUIDES SOUS L'INFLUENCE DE L'ÉLECTRICITÉ STATIQUE; PAR M. D. GERNEZ. La décharge, la distillation se produit aussitôt en sens in- verse (2). Ce phénomène est extrêmemen t n e sens suivant lequel se produit cette distillation est contraire à celui que sem- bleraient indiquer les

  17. Mathmatique de la plante Terre Mathmatique de la plante Terre

    E-Print Network [OSTI]

    de la toux d'un malade tuberculose ou le VIH est mesuré sur une échelle de 1 à 5. · Si chaque travailleur de la santé évalue la gravité de la toux d'un malade, est-il signifiant de dire que la note

  18. DOCUMENT DE TRAVAIL -L.E.S.T.-UMR 6123 Universit de Provence (U1) et Universit de la Mditerrane (U2) -35 avenue J. FERRY -13626 AIX-EN-PROVENCE CEDEX

    E-Print Network [OSTI]

    Boyer, Edmond

    = être soldat. Jusqu'au XII ème siècle, « militer » c'est donc faire la guerre. Et si l'on s' « engageait militant est comme le soldat assujetti à une organisation hiérarchisée. La base délègue son pouvoir à un

  19. http://www.arias.cnrs.fr/ http://www.univ-lyon1.fr/ Fanny Lignon

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    (2004) p. 259 à 265" #12;2 moyenâgeuses jusqu'aux pistolets lasers en passant par les petits soldats ? Très concrètement, un soldat se caractérise d'abord par le fait qu'il utilise une arme. Mais cet attribut est aussi celui des chasseurs et des gangsters. Précisons donc que le soldat est celui qui utilise

  20. Vers une plus grande cohrence de la politique ptrolire de la Russie? S. Boussena,

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    de développement du secteur des hydrocarbures (surtout en matière gazière) mais sans, non plus, se « modèle OPEP ». Dans le premier, le secteur des hydrocarbures reste important mais il n'est pas considéré des hydrocarbures est la principale (voire seule) source de revenu externe

  1. Jeudi 20 novembre 2014 Landhaus Soleure, Landhausquai, 4500 Soleure

    E-Print Network [OSTI]

    Wehrli, Bernhard

    hydrocarbures chlorés ­ Que faire lorsqu'on est dans l'impasse? Critères et exemples d'interruption d'un assainissement Assainissements de sites contaminés par des hydrocarbures chlorés ­ Que faire lorsqu'on est dans l projet ChloroNet) Actualités relatives aux groupes de travail Evaluation de la charge en hydrocarbures

  2. Universit Pierre Mends-France de Grenoble Rflexions sur les difficults conomiques auxquelles sont

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    auxquelles sont confrontés les pays exportateurs d'hydrocarbures Document à l'appui d'une conférence donnée à pour les pays dotés de fortes richesses en hydrocarbures de s'engager sur la voie d'un développement et durable. Ce n'est pourtant pas ce processus qui s'est mis en place dans les pays exportateurs d'hydrocarbures

  3. Les racines des composantes hyperboliques de M sont des quarts d'entiers alg'ebriques

    E-Print Network [OSTI]

    Bousch, Thierry

    'equation est monique en Z 0 et ` a coefficients dans Z[C], donc Z 0 est un entier alg'ebrique sur l signe pr`es) la fonction sym'etrique 'el'ementaire de degr'e k en les ae i , on a la majoration â?? k (C

  4. 12me Colloque National AIP PRIMECA Le Mont Dore -29 Mars-1er avril 2011 DE SYSML A MODELICA : AIDE A LA FORMALISATION DE

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    12ème Colloque National AIP PRIMECA Le Mont Dore - 29 Mars- 1er avril 2011 1 DE SYSML A MODELICA lequel l'approche de l'ingénierie système basée sur les modèles est utilisée. SysML et Modelica sont les graphique et visuelle alors que Modelica est un langage textuel destiné à la simulation des modèles. Dans le

  5. Traitements de la langue naturelle pour la RI Dans cette section, on discute les deux problmes suivants

    E-Print Network [OSTI]

    Nie, Jian-Yun

    essentiellement effectué dans New Mexico State University (CRL). L'idée est aussi d'exploiter la relation entre un dictionnaire est d'exploiter les informations qui se trouvent dans la définition d'un mot pour déterminer le contexte (sauf les stopwords): coal, fire: Coal: AS black mineral which is dug from the earth, which can

  6. JOURNALDE PHYSIQUEIV ColloqueC7,supplmentau Journalde Physique III,Volume 3, novembre 1993

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    samplesin industrial aluminium alloys, several conclusionsfor any type of steelreinforced - aluminium matrix'est le cas des pièces compositesbase aluminium - base fer élaborées par un procédé dérivé de la fonderie sous pression (2). L'aluminium réagissant fortement avec le fer, il est nécessaire de connaître et de

  7. Oil & Gas Science and Technology Rev. IFP, Vol. 61 (2006), No. 1, pp. 5772 Copyright 2006, Institut franais du ptrole

    E-Print Network [OSTI]

    2006-01-01T23:59:59.000Z

    Oil & Gas Science and Technology ­ Rev. IFP, Vol. 61 (2006), No. 1, pp. 57­72 Copyright © 2006. Dans ce contexte, le mode de combustion Highly Premixed Combustion (HPC) est devenu une source d combustion, l'équilibrage de couple cylindre à cylindre est une nécessité. En effet, un léger déséquilibre

  8. Varits abliennes sur les corps finis: thorme de Tate et classification de Honda-Tate

    E-Print Network [OSTI]

    Wittenberg, Olivier

    Variétés abéliennes sur les corps finis: théorème de Tate et classification de Honda-Tate Olivier Wittenberg 5 décembre 2001 Résumé Le but de cet exposé est de montrer (suivant Tate et Honda) que les classes polynôme minimal sur Q. Le théorème que l'on se propose de démontrer est le suivant. Théorème 1.0.2 (Honda

  9. Propuesta de autorizacin para entornos Grid basada en la arquitectura NAS-SAML

    E-Print Network [OSTI]

    Sánchez Cuenca, Manuel

    Propuesta de autorización para entornos Grid basada en la arquitectura NAS-SAML Manuel Sánchez1 que acceden a sus recursos. Se han propuesto varias arquitecturas de autorización para este tipo de como un recurso más. La arquitectura AAA fue diseñada para resolver este problema usando diferentes

  10. 1 L'agrobiodiversit du dattier (Phoenix dactylifera L.) dans l'oasis de Siwa

    E-Print Network [OSTI]

    1 L'agrobiodiversité du dattier (Phoenix dactylifera L.) dans l'oasis de Siwa article est de présenter les premiers résultats d'une recherche en cours à Siwa, l'unique oasis berbère d polyculture, n'était peut-être pas une oasis perdue dans les sables du désert libyque. C'est le premier étage

  11. L'agrobiodiversit du dattier (Phoenix dactylifera L.) dans l'oasis de Siwa (gypte) : entre ce qui se dit, s'crit et s'oublie

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    !!!!!!1! L'agrobiodiversité du dattier (Phoenix dactylifera L.) dans l'oasis de Siwa (Égypte culture commerciale principale de l'oasis de Siwa dans le désert libyque égyptien -- suivi de peu par l toujours porté ce nom, bien sûr). Cette oasis isolée en apparence, difficile d'accès c'est certain, est

  12. De l'lectricit aux systmes embarqus pour la sant

    E-Print Network [OSTI]

    Histace, Aymeric

    essor : c'est l'ère des grandes personnalités comme Copernic, Galilée, Newton. La science est pensée autrement !!!! Copernic Galilée Newton n En 1600, W. Gilbert montre que le verre possède des propriétés

  13. VADE-MECUM DE LA VORTICITE POTENTIELLE Dfinition (PV) P=

    E-Print Network [OSTI]

    Legras, Bernard

    VADE-MECUM DE LA VORTICITE POTENTIELLE Définition (PV) P= rot u2 Unité 1PVU = 106 K kg1 m2 s1 Pour les mouvements inviscides et adiabatiques, la PV est conservée pour chaque particule. Forme 102 s1 . La PV croît en magnitude vers les pôles. Ceci est dû à la croissance de |f| vers les pôles

  14. RSONANCE ET RELAXATION DES FLUORS DANS DES FLUORURES COMPLEXES D'URANIUM VI PULVRULENTS (1)

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    lev6e (par exemple pour UF 6' Ámol 2- 110 X 10-6 cgs) ; un important paramagnetisme de Van Vleck va de temperature ambiante. NaF, soigneusement d6shydrat6, est mis dans un reci- pient de Kel-F et UF6 est introduit

  15. 56 | Observations et indicateurs climatiques Bilan de masse des glaciers et des calottes polaires | 57 Mthode godsique (ou

    E-Print Network [OSTI]

    Berthier, Etienne

    méthode à l'évolution temporelle de ce manteau. Cette limitation est moins forte pour l'altimétrie laser'altitude de la ligne de neige en fin de saison d'ablation* (période durant laquelle le glacier perd de la zone d'ablation* où de la glace est perdue. En extrapolant ces relevés ponctuels (mais aussi nom- breux

  16. Amlioration des proprits de mesure d'un questionnaire de satisfaction des patients hospitaliss : application d'un modle de mesure variable latente centrale

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    , le ministère a choisi le questionnaire Saphora- MCO, validé [Pourin 2003], dont la faisabilité en est un processus essentiel et continu. Le questionnaire Saphora-MCO est un questionnaire générique de satisfaction des patients hospitalisés en MCO, validé. Depuis sa création en 1997, quelques modifications ont

  17. L'tude des dangers : contenu, limites, et spcificits franaises

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    L'étude des dangers : contenu, limites, et spécificités françaises Régis Farret INERIS (Institut aujourd'hui de présenter par le menu ce qu'est une étude de dangers 4, mais de prendre un peu de recul pour exposer la méthode d'analyse des risques qu'est l'étude de dangers et de montrer les

  18. info614 : Mathematiques pour l'informatique TP : signature electronique et chiffrement avec GPG

    E-Print Network [OSTI]

    Hyvernat, Pierre

    info614 : Math´ematiques pour l'informatique TP : signature ´electronique et chiffrement avec GPG utilisant le logiciel GPG (Gnu Privacy Guard : http://www.gnupg.org/). GPG est une version libre du logiciel logiciel est bien install´e avec la commande "$ gpg --version" Installez l'extension Firefox "FireGPG" http

  19. IEEE TRANSACTIONS ON VEHICULAR TECHNOLOGY, VOL. 53, NO. 6, NOVEMBER 2004 1927 On Optimizing Energy Consumption

    E-Print Network [OSTI]

    Pan, Yi

    'un réseau de forme cylindrique réduit beaucoup cette difficulté. On est en train de déve- lopper très la condensation n'est pas homogène et qu'il se forme des agrégats d'atomes ou de molécules sur la surface de la même manière qu'il se forme des cristaux. Ce résultat peut s'interpréter par le fait que les

  20. FACTEURS DE VARIATION EN EVALUATION DES RISQUES POUR LA SANTE LIES AUX SITES ET SOLS POLLUES

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    pour les expliquer, si ce n'est les justifier. ABSTRACT Quantitative risk assessment is a definite'évaluation quantitative des risques est une méthode définie et structurée d'analyses des risques. Pourtant de nombreux and structured method of analysis. Although, many factors playing a part in the calculation can affect

  1. Genomewide comparative analysis of alternative splicing in plants

    E-Print Network [OSTI]

    Brendel, Volker

    Genomewide comparative analysis of alternative splicing in plants Bing-Bing Wang* and Volker in mamma- lian systems but much less in plants. Here we report AS events deduced from EST cDNA analysis in two model plants: Arabidopsis and rice. In Arabidopsis, 4,707 (21.8%) of the genes with EST c

  2. MANUEL VLEZ C. PAULO VLEZ L.

    E-Print Network [OSTI]

    Boyer, Edmond

    perspectiva de la auditoría de sistemas de gestión de la calidad. De esta manera, la intención de este estudio superior, en especial de sus programas de postgrado. En este trabajo se indaga, básicamente sobre, la realidad con la elaboración y publicación de las "DIRECTRICES PARA LA AUDITORÍA DE LOS SISTEMAS DE GESTIÓN

  3. {0, 1}N

    E-Print Network [OSTI]

    r est ric t ion s on the pa ths , su c h a s car d inality r est ric t ion s , d i s join t n ess , et c. a s w e ll a s ap- plicabl e fix ed c h arg es . Alte rna t iv e l y , th i s mo de ...

  4. Fiber Distributed Data Interface: 100 Mbit/s anneau `a jeton sur fibre optique.

    E-Print Network [OSTI]

    Code. Aussi un standard pour paires torsad'ees (pour faciliter l'intro­ duction du FDDI). La longeur commence `a cr'eer le jeton (parce que l'anneau n'est pas en panne). ­ Si une station est en train d

  5. DIESEL et CANCER Dominique Lafon

    E-Print Network [OSTI]

    Boyer, Edmond

    1/5 DIESEL et CANCER Dominique Lafon INERIS (*) De nombreuses questions se posent sur la toxicité des émissions des moteurs diesel. C'est un sujet qui a beaucoup préoccupé les scientifiques ces EMISSIONS DU DIESEL. Avant d'aborder la toxicité des émissions du diesel, un rappel de leur composition est

  6. Universidad Simon Bolivar FS1112. 1er Parcial (30 %). Bloque B Departamento de Fisica Viernes, 22 de Noviembre de 2013

    E-Print Network [OSTI]

    Vásquez, Carlos

    despreciable para formar un cuerpo r´igido con brazos de igual longitud a. Dos de ellas est´an a una distancia apunta en direcci´on opuesta a la velocidad 1 La fuerza de roce es de tipo est´atica y no hace trabajo, y

  7. Estudio de la estabilidad de una familia de toros 2D del Problema Cuasibicircular

    E-Print Network [OSTI]

    Barcelona, Universitat de

    estabilidad est'a asociado al nacimiento de las familias de toros Halo 2D. Para este trabajo se han utilizado QBCP depende de ¯, el par'ametro de masas del sistema Tierra­Luna, a s , la distancia media del Sol al s \\Gamma 1 ' 328900:54 ; ! s = 0:925195985520347 ; tomando las unidades de masa, distancia y tiempo de

  8. Planck, en conjuncin con un mtodo Newton-Raphson para determinar el exceso de deriva en cada paso sucesivo del tiempo. Y aplicamos la

    E-Print Network [OSTI]

    Avellaneda, Marco

    han introducido Hull-White (2001). Este artículo se parte del trabajo Hull- White (2001) y lo extiende proceso riesgo-neutro de distancia al incumplimiento de la entidad de referencia (o proceso riesgo" para el proceso de distancia al incumplimiento. Este exceso de deriva puede interpretarse como la prima

  9. Revista Ingenieria de Sistemas Volumen XXIII, Septiembre 2009 Optimizacion de la Recoleccion de

    E-Print Network [OSTI]

    Bonomo, Flavia

    *** Javier Marenco**** Resumen En este trabajo presentamos una propuesta para optimizar el reco- rrido de los´on lineal entera para este problema. Se obtienen propuestas que minimizan la distancia total recorrida por: minimizar el n´umero de camiones, minimizar la distancia recorrida, conseguir rutas com- pactas o balancear

  10. Un nuevo mtodo para la deteccin de caras basado en Integrales Difusas

    E-Print Network [OSTI]

    Torres, Luis

    diferentes características faciales como por ejemplo la distancia entre ojos o "simetría" de la cara [1, 2 utilizadas para la resolución de este problema. En este trabajo, se presenta un nuevo detector de caras trabajo, mientras que el siguiente apartado se describen las simulaciones realizadas y algunos resultados

  11. EUROAMERITEL `98 CONFERENCE ``Developing Cooperation in Telematics for Health Care and Education and Training''

    E-Print Network [OSTI]

    Miguel-Alonso, José

    and Training'' June 8 th ­ 10 th , Santiago, Chile. Este trabajo ha contado con la financiación del Plan tiene ciertas ventajas sobre otros sistemas de formación a distancia, ademas de su adecuación al sistema th , Santiago, Chile. Este trabajo ha contado con la financiación del Plan Nacional de Ciencia y

  12. Latin American Theatre Review, Volume 23, Number 2: Book Reviews

    E-Print Network [OSTI]

    1990-04-01T23:59:59.000Z

    Huitenzipa. Este bello y tierno joven, convencido de su misión sagrada pero que también la ama, es, al mismo tiempo, hijo del Zipa y de una mujer que éste le arrebató al Sumo Sacerdote de Sogamoso, donde la acción de la obra se desarrolla, y a quien este...

  13. Frdric Truax, Coordonnateur des stages Dpartement de communication, Universit de Montral

    E-Print Network [OSTI]

    Parrott, Lael

    EN MARKETING ET VENTE SONY MUSIC CANADA SESSION AUTOMNE 2014 DESCRIPTION DE L'ORGANISATION Sony Music Canada est responsable des opérations canadiennes de Sony Music Entertainment, une maison de disques SONY MUSIC CANADA SESSION AUTOMNE 2014 DESCRIPTION DE L'ORGANISATION Sony Music Canada est responsable

  14. Revue europenne des lments finis. Volume X n X/2002, pages 1 X Mixed finite element formulation in large

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    to the tangential friction stress following a Coulomb or Tresca law has been presented by the researchers (Mc'éléments finis avec multiplicateurs de Lagrange pour les problèmes de contact avec frottement de Coulomb en grand déplacement est menée dans cet article. Le problème de point-selle correspondant est approché par des éléments

  15. Karl Marx no Brasil (1 Armando Boito

    E-Print Network [OSTI]

    Floeter, Sergio Ricardo

    1 Karl Marx no Brasil (1 ) Armando Boito Luiz Eduardo Motta � crescente o interesse pela obra de Karl Marx no Brasil atual. Essa tendência está perfeitamente integrada à nova vaga de interesse pela no Brasil está marcada, evidentemente, pelas características da formação social brasileira, pelas suas

  16. C A L I F O R N I A E N V I R O N M E N T A L P R O T E C T I O N A G E N C Y Boletn de Prensa

    E-Print Network [OSTI]

    ) 324-9670 William Rukeyser (916) 341-5254 Calidad de Agua y Playas Limpias son la Meta Clave de Acuerdo. "Este importante programa de capacitación trans-fronterizo ayudará a proteger la calidad del agua en programado este curso para proteger la calidad del agua conforme va creciendo la población y la

  17. UNIVERSIT PARIS III -SORBONNE NOUVELLE cole Doctorale 122 Europe latine -Amrique latine

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    espagnole : esp Espagnol parlé au Yucatán : yuc Alphabet Phonétique International : API Alphabet maya de : cps Fermé(e) : f Ouvert(e) : o Décibel : dB Hertz : Hz National Television Standards Commitee1 : NTSC que j'utilise dans cette étude est celui de l'Association Phonétique Internationale (A.P.I). Il est

  18. LaLa moussonmousson enen AfriqueAfrique dede l'Ouestl'Ouest,, tattat moyenmoyen etet

    E-Print Network [OSTI]

    -SudOuest et faible Harmattan de Nord-NordEst Période hivernale (DJF)Période hivernale (DJF) Faible flux de mousson de Sud-SudOuest et faible Harmattan de Nord-NordEst #12;1d )1d ) DynamiqueDynamique en altitude

  19. Detection de la Presence Humaine par Vision Infrarouge : Application `a la Gestion de l'Energie Electrique dans l'habitat

    E-Print Network [OSTI]

    Boyer, Edmond

    domicile et pour les syst`emes de gestion de la consommation ´energ´etique, il est n´ecessaire d'avoir des´eo est un probl`eme qui reste aujourd'hui ouvert. Il y a tout d'abord des probl`emes g´en´eraux, communs

  20. OFFRE D'EMPLOI Guide touristique

    E-Print Network [OSTI]

    granit, située à proximité de la frontière avec les États-Unis, au coeur des Cantons-de-l'Est, est à la'information instructive et divertissante et faire en sorte que les visiteurs apprécient leur visite à la Ville. Le intéressées doivent faire parvenir leur curriculum vitae au plus tard le 14 juin 2014, soit par la poste à l