Powered by Deep Web Technologies
Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

Event Logistics Checklist and Contacts Questions to consider  

E-Print Network [OSTI]

will my space need to include? 4. How many people will be attending? a. For every 250 people, one security/Chairs/Tents Questions to Consider: 1. Will people be sitting at your event? 2. How many people are attending? 3. Do you people, an EMT is expected. GTPD can provide contacts for EMTs. Relevant Contacts: 1. Beverly Peace

Sherrill, David

2

WDTS Committees of Visitors | U.S. DOE Office of Science (SC)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear SecurityTensile Strain Switched Ferromagnetism inS-4500IIVasudhaSurface. |VolunteeringMap2-5:LiquidsExactlyBudgetWDTS

3

Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Contacts Contacts Bradbury Science Museum P.O. Box 1663 Mail Stop C330 Los Alamos National Laboratory Los Alamos, NM 87545 email: web-bsm@lanl.gov PHONE: 505-667-4444 FAX:...

4

Contacts | NREL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

list of important phone numbers. Contact a Staff Member at NREL Our searchable staff directory has contact information for staff. Questions or Comments? Please use our feedback...

5

Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - WorkingContactContact

6

Contacts:  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformationE-Gov Contacts for E-GovContacts News News Home

7

Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1Contact CommunityContact

8

Website Contact  

Broader source: Energy.gov [DOE]

Contact the website administrator with questions, comments, or issues related to the Federal Energy Management Program website. If your inquiry is in regard to a specific Web page, please include...

9

Other Participants 1995 | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

News Media WDTS Home Contact Information National Science Bowl U.S. Department of Energy SC-27 Forrestal Building 1000 Independence Ave., SW Washington, DC 20585 P:...

10

Other Participants 1997 | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

News Media WDTS Home Contact Information National Science Bowl U.S. Department of Energy SC-27 Forrestal Building 1000 Independence Ave., SW Washington, DC 20585 P:...

11

Workshop Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear SecurityTensile Strain Switched FerromagnetismWaste and MaterialsWenjun1 TableContacts Workshop Contacts Questions?

12

Questions & Answers  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Question: Is the new SOW language the definitive management approach (short of a GOCO) that consolidates responsibility and accountability for the NSE stockpile surety into...

13

For general inquiries, information, or questions, contact  

E-Print Network [OSTI]

in high performance computing, webscience,datascience,networkscience, cognitive computing, and immersive, parallel, and high performance computing. christopher carothers Massively parallel computing, parallel

Linhardt, Robert J.

14

Composing questions  

E-Print Network [OSTI]

This dissertation motivates a new syntax and semantics for simplex and multiple wh-questions, concentrating on English and German data. The proposed theory combines Cable's (2007; 2010) Q-based syntax for wh-movement and ...

Kotek, Hadas

2014-01-01T23:59:59.000Z

15

Contact us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Contact us Participate with us Participate Become a Volunteer Share Your Stories Museum Fan Downloads Q&A Blog Contact us invisible utility element Contact us We want to hear from...

16

If you have any questions, please contact Career Services, Recruiting Coordinator, Sue Clayton, via email at srclay01@syr.edu, or via phone at 315-443-2009.  

E-Print Network [OSTI]

. CALENDAR Employers can view Career events and log personal events in the Calendar section. Important Dates like to publish events to other users, please contact the Career Services. COMPANY PROFILE Employers can create comprehensive online profiles in the Profile section. Build a Company Profile · Click

Doyle, Robert

17

WDTS Budget | U.S. DOE Office of Science (SC)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear SecurityTensile Strain Switched Ferromagnetism inS-4500IIVasudhaSurface. |VolunteeringMap2-5:LiquidsExactly

18

WDTS Budget | U.S. DOE Office of Science (SC)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear SecurityTensile Strain Switched Ferromagnetism inS-4500IIVasudhaSurface. |VolunteeringMap2-5:LiquidsExactlyBudget

19

Unreviewed Safety Question Requirements  

Broader source: Energy.gov (indexed) [DOE]

Unreviewed Safety Question Requirements FUNCTIONAL AREA GOAL: A fully compliant Unreviewed Safety Question (USQ) program is implemented and maintained across the site....

20

Contact Us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial ValidationContactContact Us Contact

Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

Contact Us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial ValidationContactContact Us Contact

22

Contact Us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact InContactContact

23

Contact Us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContactContact Contact Us

24

Still Have a Question?  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Contact Us Plan Your Visit Visit About the Museum Museum Hours Directions & Maps When to Visit Arrange for a Visit Around Los Alamos Contact Us invisible utility element Still Have...

25

Frequently Asked Questions 1. Technology Transfer  

E-Print Network [OSTI]

Frequently Asked Questions 1. Technology Transfer 2. Patent 3. Requirements for obtaining a patent is not addressed, please contact Colleen Michael at 631-344 -4919. #12;What is Technology Transfer? Technology Transfer is the process of developing practical applications for the results of scientific research

26

ARM - Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformationbudapest Comments? We would love toContact Information Related Links TWP-ICE HomeContacts

27

WINDExchange: Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLasDelivered energy consumption byAbout Printable Version Bookmark and Share Contacts

28

Frequently Asked Questions  

Broader source: Energy.gov [DOE]

Frequently asked questions (FAQs) and their corresponding answers regarding industrial distributed energy (DE) and combined heat and power (CHP) are provided below.

29

Questions? Contact Nate Patrick: Patrick.148@buckeyemail.osu.edu  

E-Print Network [OSTI]

. For Macs 1. Launch Disk Utility (Applications > Utilities). 2. Insert your blank DVD. 3. Drag and drop the .iso file you downloaded to the left pane in Disk Utility. Now both the blank disk and the .iso should be listed. 4. Select the .iso file you downloaded, and click on the Burn button. A dialogue box confirming

Howat, Ian M.

30

Eyeglass allergic contact dermatitis  

E-Print Network [OSTI]

T, Iijima M, Maibach HI. Eyeglass frame allergic contactNakada T, Maibach HI. Eyeglass allergic contact dermatitis.Eyeglass allergic contact dermatitis Kimberly Scott 1 ,

Scott, Kimberly; Levender, Michelle M; Feldman, Steven R

2010-01-01T23:59:59.000Z

31

Contact Us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial ValidationContact

32

ARM - Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformationbudapest Comments? We would love toContact Information Related Links TWP-ICE Home

33

ARM - Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformationbudapest Comments? We would love toContact Information Related Links TWP-ICE

34

LANL Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest Region serviceMission Statement Titan TargetInJupiter Lasertowards|Contacts

35

Contact Information  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact In

36

Contact Us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact

37

Problem of Questioning  

ScienceCinema (OSTI)

Le Prof.Leprince-Ringuet, chercheur sur le plan scientifique, artistique et humain, parle de la remise en question des hommes et la remise en question scientifique fondamentale ou exemplaire- plusieurs personnes prennent la parole p.ex Jeanmairet, Adam, Gregory. Le Prof.Gregory clot la soirée en remerciant le Prof.Leprince-Ringuet

None

2011-04-25T23:59:59.000Z

38

Some Questions About Neurocognitive  

E-Print Network [OSTI]

Some Questions About Neurocognitive Networks Steven Bressler Center for Complex Systems & Brain is a Brain Network? · A brain network is a large-scale system in the brain consisting of distributed neuronal ­ Dynamic Interdependency #12;Does The Brain Need Networks? · Serial processing, as found in the PNS, is too

Bressler, Steven L.

39

QUESTIONS ABOUT GLOBAL WARMING  

E-Print Network [OSTI]

QUESTIONS ABOUT GLOBAL WARMING ¥IS IT REAL? ¥IS IT IMPORTANT? ¥WHAT IS IT DUE TO? ¥HOW MUCH MORE in the atmosphere, giving Earth its temperate climate. Global Atmosphere, Global Warming GLOBAL TEMPERATURE TREND�t a cure for global warming! Aerosols only last a short while in the atmosphere, they would have

40

Doing Business Frequently Asked Questions  

Broader source: Energy.gov [DOE]

The following are frequently asked questions about working with in partnership with DOE laboratories.

Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

Chemical Management Contacts  

Broader source: Energy.gov [DOE]

Contacts for additional information on Chemical Management and brief description on Energy Facility Contractors Group

42

ARM - Science Questions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc Documentation RUC :ProductsSCM Forcing DataScience Questions Related Links ISDAC Home AAF Home

43

ARM - Science Questions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc Documentation RUC :ProductsSCM Forcing DataScience Questions Related Links ISDAC Home AAF

44

ARM - Science Questions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc Documentation RUC :ProductsSCM Forcing DataScience Questions Related Links ISDAC Home AAFScience

45

ARM - Science Questions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc Documentation RUC :ProductsSCM Forcing DataScience Questions Related Links ISDAC Home

46

The contact angle in inviscid fluid mechanics  

E-Print Network [OSTI]

We show that in general, the specification of a contact angle condition at the contact line in inviscid fluid motions is incompatible with the classical field equations and boundary conditions generally applicable to them. The limited conditions under which such a specification is permissible are derived; however, these include cases where the static meniscus is not flat. In view of this situation, the status of the many `solutions' in the literature which prescribe a contact angle in potential flows comes into question. We suggest that these solutions which attempt to incorporate a phenomenological, but incompatible, condition are in some, imprecise sense `weak-type solutions'; they satisfy or are likely to satisfy, at least in the limit, the governing equations and boundary conditions everywhere except in the neighbourhood of the contact line. We discuss the implications of the result for the analysis of inviscid flows with free surfaces.

P N Shankar; R Kidambi

2005-08-17T23:59:59.000Z

47

The Question The Standard Construction  

E-Print Network [OSTI]

The Question The Standard Construction The ZFC construction Bibliography Solution to a Problem Construction The ZFC construction Bibliography Outline 1 The Question 2 The Standard Construction 3 The ZFC construction Dilip Raghavan Solution to a Problem of Van Douwen #12;The Question The Standard Construction

Raghavan, Dilip

48

Thermal contact resistance  

E-Print Network [OSTI]

This work deals with phenomena of thermal resistance for metallic surfaces in contact. The main concern of the work is to develop reliable and practical methods for prediction of the thermal contact resistance for various ...

Mikic, B. B.

1966-01-01T23:59:59.000Z

49

General Questions | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Questions Where can I find more information regarding federal and state programs to help weatherize my home? The U.S. Department of Energy (DOE) Weatherization Assistance...

50

QuestionQuestion How does nitrogen deposition affect roadside  

E-Print Network [OSTI]

al. 2004. Concentrations of ammonia and nitrogen dioxide at roadside verges, and their contributionQuestionQuestion How does nitrogen deposition affect roadside plant community composition? 1. Is there a gradient of nitrogen deposition to freeway verges from traffic exhaust? 2. Are there other sources of N

Hall, Sharon J.

51

Contacts | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:YearRound-Up fromDepartmentTieCelebrate Earth CodestheatforContacts Contacts Contact Information

52

Contacts | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:YearRound-Up fromDepartmentTieCelebrate Earth CodestheatforContacts Contacts Contact

53

Jens Hjorth the Urbino Questions  

E-Print Network [OSTI]

reduce the effects of air pollution to human health and the environment in Europe by 2020. The strategy-DRIVEN SYNTHESIS Answers by the atmospheric chemistry and air pollution research community to questions posed Strategy on Air Pollution 5.06 #12;editors Frank Raes Jens Hjorth Answers to the Urbino Questions ACCENTs

54

Federal NEPA Contacts  

Broader source: Energy.gov [DOE]

CEQ and most Federal agencies identify primary points of contact for NEPA compliance. Normally a senior environmental professional, environmental law attorney, or member of agency leadership, these...

55

Optical contact micrometer  

SciTech Connect (OSTI)

Certain examples provide optical contact micrometers and methods of use. An example optical contact micrometer includes a pair of opposable lenses to receive an object and immobilize the object in a position. The example optical contact micrometer includes a pair of opposable mirrors positioned with respect to the pair of lenses to facilitate viewing of the object through the lenses. The example optical contact micrometer includes a microscope to facilitate viewing of the object through the lenses via the mirrors; and an interferometer to obtain one or more measurements of the object.

Jacobson, Steven D.

2014-08-19T23:59:59.000Z

56

TECHNICAL QUESTIONS What Every Parent ...  

Broader source: Energy.gov (indexed) [DOE]

through: & 10 Common Questions About Internet Safety 1. How and why do I check the Web browser history? 2. How and why do I review temporary Internet files? 3. How and why do...

57

Questions  

E-Print Network [OSTI]

N o t e t h a t t h e sam e p h e n o m e n o n o c c u r s w h e n t h e rea l n u m b er s are re ga r de d a s a su bfie ld o f t h e c o m p l e x fi e ld ,. a n d it a l so o ccu ...

CamScanner

2014-06-17T23:59:59.000Z

58

Questions  

E-Print Network [OSTI]

Let fbe a real function de?ned on (a, b). Prove that the set of points at which f has a simple discontinuity is at most countable. Hint: Let E be the set on which.

CamScanner

59

Questions  

E-Print Network [OSTI]

(a) Ian = Ui'=1 Ar, prove that B" = ULI 3,, for n =1, 2, 3, . (b) HR = U'iil A“ prove ... Let Kc R1 consist of 0 and the numbers 1/11, for n = 1, 2, 3, ... . Prove that K lS.

CamScanner

60

Contact Us - Hanford Site  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContactContact Contact

Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

Contact | ornl.gov  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1Contact CommunityContact SHARE Contact

62

Contacts & Resources  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1Contact CommunityContactContacts &

63

Contact thermal lithography  

E-Print Network [OSTI]

Contact thermal lithography is a method for fabricating microscale patterns using heat transfer. In contrast to photolithography, where the minimum achievable feature size is proportional to the wavelength of light used ...

Schmidt, Aaron Jerome, 1979-

2004-01-01T23:59:59.000Z

64

Some open questions in hydrodynamics  

E-Print Network [OSTI]

When speaking of unsolved problems in physics, this is surprising at first glance to discuss the case of fluid mechanics. However, there are many deep open questions that come with the theory of fluid mechanics. In this paper, we discuss some of them that we classify in two categories, the long term behavior of solutions of equations of hydrodynamics and the definition of initial (boundary) conditions. The first set of questions come with the non-relativistic theory based on the Navier-Stokes equations. Starting from smooth initial conditions, the purpose is to understand if solutions of Navier-Stokes equations remain smooth with the time evolution. Existence for just a finite time would imply the evolution of finite time singularities, which would have a major influence on the development of turbulent phenomena. The second set of questions come with the relativistic theory of hydrodynamics. There is an accumulating evidence that this theory may be relevant for the description of the medium created in high energy heavy-ion collisions. However, this is not clear that the fundamental hypotheses of hydrodynamics are valid in this context. Also, the determination of initial conditions remains questionable. The purpose of this paper is to explore some ideas related to these questions, both in the non-relativistic and relativistic limits of fluid mechanics. We believe that these ideas do not concern only the theory side but can also be useful for interpreting results from experimental measurements.

Mateusz Dyndal; Laurent Schoeffel

2014-12-16T23:59:59.000Z

65

Contact urticaria to raw potato  

E-Print Network [OSTI]

allergen in latex-induced potato allergy. Ann Allergy Asthmaof allergy to cooked potatoes in children. Allergy 2007;62(contact dermatitis from potato flesh. Contact Dermatitis

Lagrán, Z Martínez de; Frutos, FJ Ortiz de; Arribas, M González de; Vanaclocha-Sebastián, F

2009-01-01T23:59:59.000Z

66

QUESTIONS & ANSWERS ABOUT LUNG CANCER  

E-Print Network [OSTI]

QUESTIONS & ANSWERS ABOUT LUNG CANCER Q: What are the early signs of lung cancer? How would I know I have it? A: Some of the early warning signs of lung cancer are: · A cough that doesn't go away what may be causing these symptoms. Q: How is lung cancer diagnosed? A: Your doctor may do one or more

67

WDTS Committees of Visitors | U.S. DOE Office of Science (SC)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear SecurityTensile Strain Switched Ferromagnetism inS-4500IIVasudhaSurface.

68

Workforce Development for Teachers and Scientists (WDTS) Homepage | U.S.  

Office of Science (SC) Website

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear SecurityTensile Strain Switched5 Industrial CarbonArticles News News Homeuniversity-research/ TheWeb Policies WebDOE

69

10 CFR 707 Frequently Asked Questions  

Broader source: Energy.gov [DOE]

NOTE: The Questions on this site were compiled from questions asked during the four DOE complex wide tele-videos, as well as, questions submitted by e-mail and telephone. The answers provided are...

70

Bilevel contact solar cells  

SciTech Connect (OSTI)

This patent describes a solar cell. It comprises a body of semiconductor material having at least one P/N junction therein, the body including a front face having no electrodes thereon, and a bilevel elevation back face having at least one P-doped region at a first level interdigitated with at least one N-doped region at a second level, wherein the at least one P-doped region and the at least one N-doped region partially overlap to form at least one compensated region; and a positive electrode contacting the at lease one P-doped region and a negative electrode contacting the at least one N-doped region, both electrodes contacting the solar cell on the back face.

Sinton, R.A.

1991-10-01T23:59:59.000Z

71

Submit to: vendor.services@ttu.edu or fax 806/742-3820 For questions call 806/742-3844  

E-Print Network [OSTI]

Submit to: vendor.services@ttu.edu or fax 806/742-3820 For questions call 806/742-3844 VENDOR DIRECT DEPOSIT AND ADVANCE PAYMENT NOTIFICATION FORM FOR EXISTING VENDORS Company Name (Required) Business Name (if different) TTU Vendor Number (if known) Tax ID/Federal ID (Required) Contact Name Contact

Westfall, Peter H.

72

Contact Us - Hanford Site  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial ValidationContactContact Us

73

Contacts | Advanced Photon Source  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformationE-Gov Contacts for E-Gov LeAnnProjectContacts

74

Contacts: Tel: Locations: Tel:  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformationE-Gov Contacts for E-GovContacts News News

75

Contact JLab | Jefferson Lab  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact InContact Visiting

76

Contact Us - Pantex Plant  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContactContact

77

Contact Us | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - Working WithContact Us »

78

Contact Us | NREL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - Working WithContact Us

79

Contact: Nathan Howard  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1Contact CommunityContact SHARENathan

80

Contacts | Argonne National Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" ContactsContacts for the

Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

Sandia National Laboratories: Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear Security Administration the1 -the Mid-Infrared0EnergySandia Involves Wind-Farm OwnersContacts SSLS Contacts On

82

Frequently Asked Questions | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

& Forms Frequently Asked Questions Frequently Asked Questions U.S. Department of Energy U.S. Nuclear Regulatory Commission Nuclear Materials Management & Safeguards...

83

Cybersecurity Capability Maturity Model - Frequently Asked Questions...  

Broader source: Energy.gov (indexed) [DOE]

- Frequently Asked Questions (February 2014) Cybersecurity Capability Maturity Model - Frequently Asked Questions (February 2014) The Cybersecurity Capability Maturity Model (C2M2)...

84

TO: HR and Business Contacts FROM: Division of Human Resources  

E-Print Network [OSTI]

TO: HR and Business Contacts FROM: Division of Human Resources DATE: September 6, 2012 RE: Human Resources Fall 2012 Forum The Division of Human Resources will sponsor an HR Forum from 1-4 p in person or by webinar. Any questions about the forum may be e-mailed to the Division of Human Resources

Almor, Amit

85

RAPID/Contact | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 No revisionEnvReviewNonInvasiveExploration JumpSanyalTempWellheadWahkiakum CountyPzero JumpQuestionQuinhagakContact

86

CONTACT INFO BUILDING SHELTER  

E-Print Network [OSTI]

CONTACT INFO SIGNALS BUILDING SHELTER THE DISABLED B.E.R.T. TEAM B.E.R.T.* EMERGENCY RESPONSE GUIDE, SIUC*Building Emergency Response Team Siren* Long Blast: Tornado High/Low: Any Other Emergency Radio needed. 2. Find two or three B.E.R.T. "buddies" who are willing to help you in the event of an emergency

King, David G.

87

Technology Advertising Contact Information  

E-Print Network [OSTI]

Overview #12;Technology Advertising Contact Information Alex Sheath 8596 4063 asheath Overview Our online Technology section is geared towards an IT professional environment, reaching a range of technology enthusiasts from every day gadget consumers to business decision makers where enterprise solutions

Peters, Richard

88

Contact Center Sales Office  

E-Print Network [OSTI]

PSTN Contact Center India Plant Ohio Sales Office Russia Remote Worker Arizona Plant China GPS petrochemical industry. The demands to improve supply and demand balances and increase business velocity have of diverse organizations in the petrochemical industry ­ from crude oil to refinery to processing

Fisher, Kathleen

89

Whom to Call Below are resources for questions about specific topic areas and related LBNL policies and  

E-Print Network [OSTI]

Whom to Call Below are resources for questions about specific topic areas and related LBNL policies and procedures. In addition, the LBNL Ombuds may be contacted at 510-642-7843. Workplace Topic Policies are resources for questions about specific topic areas and related LBNL policies and procedures. In addition

Geddes, Cameron Guy Robinson

90

General Questions | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) " ,"ClickPipelinesProvedDecember 2005DepartmentDecember U.S.FinancialofFuelDepartment ofGeneral Questions

91

Inquiring Minds - Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFunInfrared Land Surface Emissivity inFermilab Paving the wayPowerQuestion on

92

Inquiring Minds - Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFunInfrared Land Surface Emissivity inFermilab Paving the wayPowerQuestion

93

Inquiring Minds - Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFunInfrared Land Surface Emissivity inFermilab Paving the wayPowerQuestionThe

94

Inquiring Minds - Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFunInfrared Land Surface Emissivity inFermilab Paving theIsBigQuestion: From

95

Inquiring Minds - Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFunInfrared Land Surface Emissivity inFermilab Paving theIsBigQuestion:

96

Inquiring Minds - Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFunInfrared Land Surface Emissivity inFermilabWhich AtomsHow do YouQuestion on

97

Inquiring Minds - Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFunInfrared Land Surface Emissivity inFermilabWhich AtomsHow do YouQuestion

98

Contact stress sensor  

DOE Patents [OSTI]

A method for producing a contact stress sensor that includes one or more MEMS fabricated sensor elements, where each sensor element of includes a thin non-recessed portion, a recessed portion and a pressure sensitive element adjacent to the recessed portion. An electric circuit is connected to the pressure sensitive element. The circuit includes a pressure signal circuit element configured to provide a signal upon movement of the pressure sensitive element.

Kotovsky, Jack

2014-02-11T23:59:59.000Z

99

ARM - NSA Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc Documentation RUC : XDCResearchWarmingMethane Background Information OutreachContacts NSA

100

Contacts / Hours - Hanford Site  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us -

Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

DOE Radiation Records Contacts List  

Broader source: Energy.gov [DOE]

DOE radiation records contact list for individuals to obtain records of occupational exposure directly from a DOE site.

102

Answering Key Fuel Cycle Questions  

SciTech Connect (OSTI)

The Advanced Fuel Cycle Initiative (AFCI) program has both “outcome” and “process” goals because it must address both waste already accumulating as well as completing the fuel cycle in connection with advanced nuclear power plant concepts. The outcome objectives are waste geological repository capacity and cost, energy security and sustainability, proliferation resistance, fuel cycle economics, and safety. The process objectives are readiness to proceed and adaptability and robustness in the face of uncertainties. A classic decision-making approach to such a multi-attribute problem would be to weight individual quantified criteria and calculate an overall figure of merit. This is inappropriate for several reasons. First, the goals are not independent. Second, the importance of different goals varies among stakeholders. Third, the importance of different goals is likely to vary with time, especially the “energy future.” Fourth, some key considerations are not easily or meaningfully quantifiable at present. Instead, at this point, we have developed 16 questions the AFCI program should answer and suggest an approach of determining for each whether relevant options improve meeting each of the program goals. We find that it is not always clear which option is best for a specific question and specific goal; this helps identify key issues for future work. In general, we suggest attempting to create as many win-win decisions (options that are attractive or neutral to most goals) as possible. Thus, to help clarify why the program is exploring the options it is, and to set the stage for future narrowing of options, we have developed 16 questions, as follows: · What are the AFCI program goals? · Which potential waste disposition approaches do we plan for? · What are the major separations, transmutation, and fuel options? · How do we address proliferation resistance? · Which potential energy futures do we plan for? · What potential external triggers do we plan for? · Should we separate uranium? · If we separate uranium, should we recycle it, store it or dispose of it? · Is it practical to plan to fabricate and handle “hot” fuel? · Which transuranic elements (TRU) should be separated and transmuted? · Of those TRU separated, which should be transmuted together? · Should we separate and/or transmute Cs and Sr isotopes that dominate near-term repository heating? · Should we separate and/or transmute very long-lived Tc and I isotopes? · Which separation technology? · What mix of transmutation technologies? · What fuel technology best supports the above decisions?

Steven J. Piet; Brent W. Dixon; J. Stephen Herring; David E. Shropshire; Mary Lou Dunzik-Gougar

2003-10-01T23:59:59.000Z

103

Uniform Methods Project Contacts | Department of Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Contacts Uniform Methods Project Contacts The primary contacts for the Uniform Methods Project are: U.S. Department of Energy Michael Li Carla Frisch National Renewable Energy...

104

Transmission - Contact Information  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas ConchasPassiveSubmittedStatusButler TinaContact-Information-Transmission Sign In About |

105

Transmission Contact Information  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas ConchasPassiveSubmittedStatusButler TinaContact-Information-Transmission Sign In

106

ARM - Instrument Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformation InExplosionAnnouncements MediagovCampaignsList ofgovInstrumentsContacts

107

SRNL LDRD - Program Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear Security Administration the1 -the Mid-Infrared0 ResourceAwards SAGE Awards ,#2446SmallnAbout LDRDProgram Contacts

108

FOR IMMEDIATE RELEASE CONTACT:  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsing ZirconiaPolicy andExsolutionFES Committees of9,of Energy8 CH2M CONTACT:

109

ARM - Contact Information  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformationbudapest Comments? We would love toContact Information Related Links TWP-ICE Home Tropical

110

Contacts | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energyon ArmedWaste andAccessCO2Administrative Operations Contacts for theAbout the State

111

Geothermal: Contact Us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFun with Big Sky Learning FunNeuTel2011Programmatic ReportsContact Us Geothermal

112

How to Contact NERSC  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest Region service area.Portal SolarAbout Energy.govHonorsAbout » Contact us

113

Climate VISION: Contact Us  

Office of Scientific and Technical Information (OSTI)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartmentNationalRestart ofMeasuring DopamineEnergy,6. Radiative Forcing of ClimateCONTACT US

114

Contact Us - SRSCRO  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContactContactcontact

115

Contacts | Jefferson Lab  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - News Media Assembling A

116

Fermilab | Contact Fermilab  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest Region service area. TheEPSCI Home It isGasERPSpun OffTechnologies|21,Contact

117

NREL: Library - Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear Security Administration the Contributions and Achievements ofLizResultsGeothermal Energy TheContacts A photo

118

Media Contact: Will Callicott  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas Conchas recovery challenge fund LasDubey MathematicaMeasuring andSecurity Contact: Will

119

Contact | The Ames Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 BuildingContactCoordinators|

120

Contact Issue 1  

E-Print Network [OSTI]

, '\\ ..... ,. '" ' ; ') I f. I , j ------------------~ The tall lean Earthman stepped up to the8!nterprise trio who had just beamed down onto his porch. "Welcome to the Kes sler Colonr.' gentlemen, " he greeted them. "I'm Leon Kessler at your service l' The man... DEDICATION This zi_e is dedicated to all STAR TREK raas who saw aad uaderstood that special quality ia the "Kirk/Spock Relatioash!p", aad to WILLIAM SHATNER .ad LEONARD NIMOY, who made it happe_. ? Copyright December, 1915, CONTACT. No reprlats...

Multiple Contributors

1976-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

A Web-based Question Answering System  

E-Print Network [OSTI]

The Web is apparently an ideal source of answers to a large variety of questions, due to the tremendous amount of information available online. This paper describes a Web-based question answering system LAMP, which is ...

Zhang, Dell

122

On the interpretation of concealed questions  

E-Print Network [OSTI]

Determiner phrases have the ability to act as "concealed questions" (CQs), embedded questions in sentences like John knows the time (i.e., John knows what time it is). The fact that know and wonder differ in their ability ...

Nathan, Lance Edward

2006-01-01T23:59:59.000Z

123

Attn Technology Transfer Questions.txt - Notepad  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Attn Technology Transfer Questions.txt From: eschaput esandc@prodigy.net Sent: Monday, January 26, 2009 10:31 PM To: GC-62 Subject: Attn: Technology Transfer Questions We have...

124

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Using an accelerator to create a new element Hello, My name is Andrew and I was wondering if this is the right email forum for my question. I am only 11 so my question is as...

125

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Hello, I am so happy to visited your site It was full of answers to my questions So, I have a question about thermal Energy...We have some kind of energy in the world. electric...

126

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Centripedal Forces Plus Relativity You wrote: Hello, I'm not sure if this address is the right one to write to asking a physics question. But I saw a list of questions and answers...

127

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

have a question, but first, thank you for the terrific new web site. You did a fantastic job. Question: Where does present theory say the energy of a red shifted photon goes? The...

128

A Question of Prosperity Poverty in Saskatchewan  

E-Print Network [OSTI]

JUNE 2008 A Question of Prosperity Poverty in Saskatchewan Garson Hunter and Fiona Douglas with Sarah Pedersen #12;A Question of Prosperity: Poverty in Saskatchewan June 2008 Hunter, G. F. Douglas & S. Pedersen. "A Question of Prosperity: Poverty in Saskatchewan." Poverty Profiles 1, 2008. Regina

Argerami, Martin

129

Monthly Research Award Summary For comments or questions, please contact the Office of Research at  

E-Print Network [OSTI]

.7 3,441 $1,019.2 74% -6% 2% Research and Other 3,410 1,144.0 3,421 1,176.3 3,189 1,136.9 2,943 941.0 3 a project or activity (usually the sponsor does not have programmatic involvement). A pu

Van Volkenburgh, Elizabeth

130

Method for forming metal contacts  

DOE Patents [OSTI]

Methods of forming metal contacts with metal inks in the manufacture of photovoltaic devices are disclosed. The metal inks are selectively deposited on semiconductor coatings by inkjet and aerosol apparatus. The composite is heated to selective temperatures where the metal inks burn through the coating to form an electrical contact with the semiconductor. Metal layers are then deposited on the electrical contacts by light induced or light assisted plating.

Reddington, Erik; Sutter, Thomas C; Bu, Lujia; Cannon, Alexandra; Habas, Susan E; Curtis, Calvin J; Miedaner, Alexander; Ginley, David S; Van Hest, Marinus Franciscus Antonius Maria

2013-09-17T23:59:59.000Z

131

Page 1 of 24 Question & Answers  

E-Print Network [OSTI]

Page 1 of 24 Question & Answers Pilot-Scale and Commercial-Scale Advanced Biofuels with the California Energy Commission on biofuel production facilities important to California objectives

132

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Question About Splitting Molecules "Can you use particle accelerators to break up molecules into their elements?" The short answer is yes. The long answer is more complicated. You...

133

Program Evaluation Topics and Questions Library  

Broader source: Energy.gov [DOE]

Menu of initial questions for a program administrator to use in developing a real-time evaluation survey to collect qualitative data from program contractors.

134

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Radiation Direction Hello, What is the direction of radiation emitted from an atom ? Thanks, Bob Patton Bob, Your question has always been an area of research whenever new...

135

Questions and Answers March 9, 2012  

E-Print Network [OSTI]

-602 Alternative Fuels Infrastructure: Electric, Natural Gas, Propane, E85 & Diesel Substitutes Terminals 5Questions and Answers March 9, 2012 for PON-11-602 Alternative Fuels Infrastructure: Electric, Natural Gas, Propane, E85 & Diesel Substitutes Terminals General Definitions/Clarification 1. QUESTION

136

Rangeland ecology: Key global research issues & questions  

E-Print Network [OSTI]

1 Rangeland ecology: Key global research issues & questions Robin Reid1 and Maria Fernandez Ecology Lab 2Associate Professor Colorado State University, Fort Collins, Colorado, USA Global Issues and Questions in Rangeland Ecology · Despite the focus here on global issues, we need to recognize that Mongolia

137

48C Qualifying Advanced Energy Project Credit Questions | Department...  

Broader source: Energy.gov (indexed) [DOE]

48C Qualifying Advanced Energy Project Credit Questions 48C Qualifying Advanced Energy Project Credit Questions 48C Qualifying Advanced Energy Project Credit Questions More...

138

Questions and Answers for the Smart Grid Investment Grant Program...  

Energy Savers [EERE]

Questions and Answers for the Smart Grid Investment Grant Program: Frequently Asked Questions Questions and Answers for the Smart Grid Investment Grant Program: Frequently Asked...

139

Questions and Answers for the Smart Grid Investment Grant Program...  

Energy Savers [EERE]

Questions and Answers for the Smart Grid Investment Grant Program: Buy American Questions and Answers for the Smart Grid Investment Grant Program: Buy American Additional questions...

140

Solar cell with back side contacts  

DOE Patents [OSTI]

A III-V solar cell is described herein that includes all back side contacts. Additionally, the positive and negative electrical contacts contact compoud semiconductor layers of the solar cell other than the absorbing layer of the solar cell. That is, the positive and negative electrical contacts contact passivating layers of the solar cell.

Nielson, Gregory N; Okandan, Murat; Cruz-Campa, Jose Luis; Resnick, Paul J; Wanlass, Mark Woodbury; Clews, Peggy J

2013-12-24T23:59:59.000Z

Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

Questioning the questions that have been asked about the infant brain using near-infrared spectroscopy  

E-Print Network [OSTI]

Questioning the questions that have been asked about the infant brain using near-infrared, University of Rochester, Rochester, NY, USA Near-infrared spectroscopy (NIRS) is a noninvasive diffuse; Near-infrared spectroscopy. "Sheddinglight"onascientificquestiontookonnew meaning when

Aslin, Richard N.

142

Protein folding using contact maps  

E-Print Network [OSTI]

We present the development of the idea to use dynamics in the space of contact maps as a computational approach to the protein folding problem. We first introduce two important technical ingredients, the reconstruction of a three dimensional conformation from a contact map and the Monte Carlo dynamics in contact map space. We then discuss two approximations to the free energy of the contact maps and a method to derive energy parameters based on perceptron learning. Finally we present results, first for predictions based on threading and then for energy minimization of crambin and of a set of 6 immunoglobulins. The main result is that we proved that the two simple approximations we studied for the free energy are not suitable for protein folding. Perspectives are discussed in the last section.

Michele Vendruscolo; Eytan Domany

1999-01-21T23:59:59.000Z

143

Method for lubricating contacting surfaces  

DOE Patents [OSTI]

A method is provided for tribological lubrication of sliding contact surfaces, where two surfaces are in contact and in motion relative to each other, operating in a vapor-phase environment containing at least one alcohol compound at a concentration sufficiently high to provide one monolayer of coverage on at least one of the surfaces, where the alcohol compound continuously reacts at the surface to provide lubrication.

Dugger, Michael T. (Tijeras, NM); Ohlhausen, James A. (Albuquerque, NM); Asay, David B. (Boalsburg, PA); Kim, Seong H. (State College, PA)

2011-12-06T23:59:59.000Z

144

FOIA Contacts | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehicles »Exchange Visitors Program Exchange VisitorsContacts FOIA Contacts

145

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Color of Atoms Mr. Pordes- I have a question for science. As you probably know, we have been studying all about particles and the particle model of matter and John Dalton and...

146

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Pure Antineutron Beams Hello, I am a physics student in Germany. I haven't had particle physics yet, so I'd be glad if you answered me one question: How do you create more or less...

147

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Question: How many studies have been done to figure out what escapes from the accelerators into the environment and how much of it escapes? I heard from a tour guide that...

148

Questions about Groundwater Conservation Districts in Texas  

E-Print Network [OSTI]

Groundwater conservation districts (GCDs) are being created in many parts of Texas to allow local citizens to manage and protect their groundwater. This publication answers frequently asked questions about groundwater and GCDs....

Lesikar, Bruce J.; Silvy, Valeen

2008-09-22T23:59:59.000Z

149

TECHNOLOGY TRANSFER QUESTIONS..txt - Notepad  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

rfien@campbellap.com Sent: Monday, January 26, 2009 5:34 PM To: GC-62 Subject: TECHNOLOGY TRANSFER QUESTIONS. Sensitivity: Confidential To Whom It May Concern, Campbell Applied...

150

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Higgs boson Elisabeth, You asked: Could you help me with the following question. Is there any evidense for the existence of the Higgs bosson or Higgs field? According to the New...

151

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Rotation of Black Holes Hello Alyssa -- The questions you sent to Fermilab about physics didn't get lost, they just got routed to a couple of lazy postdocs. That's why it took so...

152

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

How many neutrons? Dear Mrs. Pordes, Hello. My name is Andrew Schmidt. I am writing to you concerning a question I have. I am in your daughters science class and it would be...

153

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

be quite right. Thank you for the opportunity to ask this question. Regards, Bob Dowe Hello Bob, Let us start from the beginning. First I have to tell you that there are usually...

154

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

appreciate it if you could send it to me. That would be awesome. Thanks Luke Luke - Hello. I am a scientist here at Fermilab and your question got forwarded to me. In some...

155

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Charged Objects and Virtual Photons Hello, I am fascinated by the universe of physics, and I have a few questions. Actually, I was wondering about photons. I have come to...

156

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Why can radio waves pass through a wall but light cannot? Hello, My name is Mike P. and this is my question. If radio & light waves are both properties of the electromagnetic...

157

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

proton and an anti electron (a positron, i do not know the anti particle of proton). Hello Killian, thanks for your very interesting question. When you talk about particles, the...

158

The Big Questions For Biodiversity Informatics  

E-Print Network [OSTI]

of biodiversity information. This emerging field of biodiversity informatics has been growing quickly, but without overarching scientific questions to guide its development; the result has been developments that have no connection to genuine insight and forward...

Peterson, A. Townsend; Knapp, Sandra; Guralnick, Robert P.; Soberó n, Jorge; Holder, Mark T.

2010-01-01T23:59:59.000Z

159

Solar Instructor Training Network Frequently Asked Questions  

Broader source: Energy.gov [DOE]

These frequently asked questions (FAQs) relate to the solar instructor training network. This project was launched by the U.S. Department of Energy (DOE) Solar Energy Technologies Program (SETP or...

160

AGREE-DISAGREE QUESTIONS: PROBLEMS AND SOME  

E-Print Network [OSTI]

AGREE-DISAGREE QUESTIONS: PROBLEMS AND SOME SOLUTIONS Allyson L. Holbrook Associate Professor that established a woman's right to an abortion?" #12;EXAMPLE SCALES: HANDBOOK OF MARKETING SCALES (2010) Ten

Illinois at Chicago, University of

Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

Ten questions and answers about superconductivity  

E-Print Network [OSTI]

This work answers the basic questions of superconductivity in a question-and-answer format. We extend a basic hypothesis to various superconductors. This hypothesis is that superconductivity requires that the pairing gap locates around the Fermi level. On the basis of this hypothesis our calculations give the so-called three factor theory with which some key problems of the high temperature superconductivity are explained.

Tian De Cao

2012-11-13T23:59:59.000Z

162

Utility Energy Service Contract Contacts | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Contacts Utility Energy Service Contract Contacts For more information about utility energy service contracts, contact: Contact Organization David McAndrew 202-586-7722 Federal...

163

From Question Answering to Visual Exploration  

SciTech Connect (OSTI)

Research in Question Answering has focused on the quality of information retrieval or extraction using the metrics of precision and recall to judge success; these metrics drive toward finding the specific best answer(s) and are best supportive of a lookup type of search. These do not address the opportunity that users? natural language questions present for exploratory interactions. In this paper, we present an integrated Question Answering environment that combines a visual analytics tool for unstructured text and a state-of-the-art query expansion tool designed to compliment the cognitive processes associated with an information analysts work flow. Analysts are seldom looking for factoid answers to simple questions; their information needs are much more complex in that they may be interested in patterns of answers over time, conflicting information, and even related non-answer data may be critical to learning about a problem or reaching prudent conclusions. In our visual analytics tool, questions result in a comprehensive answer space that allows users to explore the variety within the answers and spot related information in the rest of the data. The exploratory nature of the dialog between the user and this system requires tailored evaluation methods that better address the evolving user goals and counter cognitive biases inherent to exploratory search tasks.

McColgin, Dave W.; Gregory, Michelle L.; Hetzler, Elizabeth G.; Turner, Alan E.

2006-08-11T23:59:59.000Z

164

Contacts of space--times  

SciTech Connect (OSTI)

The concept of contact between manifolds is applied to space--times of general relativity. For a given background space--time a contact approximation of second order is defined and interpreted both from the point of view of a metric pertubation and of a higher order tangent manifold. In the first case, an application to the high frequency gravitational wave hypothesis is suggested. In the second case, a constant curvature tangent bundle is constructed and suggested as a means to define a ten parameter local space--time symmetry.

Maia, M.D.

1981-03-01T23:59:59.000Z

165

Non- contacting capacitive diagnostic device  

DOE Patents [OSTI]

A non-contacting capacitive diagnostic device includes a pulsed light source for producing an electric field in a semiconductor or photovoltaic device or material to be evaluated and a circuit responsive to the electric field. The circuit is not in physical contact with the device or material being evaluated and produces an electrical signal characteristic of the electric field produced in the device or material. The diagnostic device permits quality control and evaluation of semiconductor or photovoltaic device properties in continuous manufacturing processes.

Ellison, Timothy

2005-07-12T23:59:59.000Z

166

Contact Us | Department of Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUs Contact UsContact

167

Contact Us | Department of Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUs Contact UsContactUs

168

Contact Us | The Ames Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUsContact UsContact Us

169

Sandia National Laboratories: Contact Us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest RegionatSearch WelcomeScience SSRL ScienceCRFCareersandContact Us Contact Us

170

Contact OAK RIDGE NATIONAL LABORATORY  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact InContact

171

Contact Us | Argonne National Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - Working With UsContact Us

172

Contact | Photosynthetic Antenna Research Center  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - WorkingContact

173

Improved Electrical Contact For Dowhhole Drilling Networks  

DOE Patents [OSTI]

An electrical contact system for transmitting information across tool joints while minimizing signal reflections that occur at the tool joints includes a first electrical contact comprising an annular resilient material. An annular conductor is embedded within the annular resilient material and has a surface exposed from the annular resilient material. A second electrical contact is provided that is substantially equal to the first electrical contact. Likewise, the second electrical contact has an annular resilient material and an annular conductor. The two electrical contacts configured to contact one another such that the annular conductors of each come into physical contact. The annular resilient materials of each electrical contact each have dielectric characteristics and dimensions that are adjusted to provide desired impedance to the electrical contacts.

Hall, David R. (Provo, UT); Hall, Jr., H. Tracy (Provo, UT); Pixton, David S. (Lehi, UT); Dahlgren, Scott (Provo, UT); Fox, Joe (Spanish Fork, UT); Sneddon, Cameron (Provo, UT)

2005-08-16T23:59:59.000Z

174

Name and Contact Information * Indicates a required field * Date of Birth (MM/DD/YYYY)  

E-Print Network [OSTI]

Name and Contact Information * Indicates a required field * Date of Birth (MM/DD/YYYY) * o Female o courses offered as part of a certificate or diploma program are exempt from GST, even if you are only certificates and diplomas for eligible students. If you have any questions or requests about the collection

175

Ian Hinchliffe Answers Your Higgs Boson Questions  

SciTech Connect (OSTI)

contingent with the ATLAS experiment at CERN, answers many of your questions about the Higgs boson. Ian invited viewers to send in questions about the Higgs via email, Twitter, Facebook, or YouTube in an "Ask a Scientist" video posted July 3: http://youtu.be/xhuA3wCg06s CERN's July 4 announcement that the ATLAS and CMS experiments at the Large Hadron Collider have discovered a particle "consistent with the Higgs boson" has raised questions about what scientists have found and what still remains to be found -- and what it all means. If you have suggestions for future "Ask a Scientist" videos, post them below or send ideas to askascientist@lbl.gov

Hinchliffe, Ian

2012-01-01T23:59:59.000Z

176

Ian Hinchliffe Answers Your Higgs Boson Questions  

ScienceCinema (OSTI)

contingent with the ATLAS experiment at CERN, answers many of your questions about the Higgs boson. Ian invited viewers to send in questions about the Higgs via email, Twitter, Facebook, or YouTube in an "Ask a Scientist" video posted July 3: http://youtu.be/xhuA3wCg06s CERN's July 4 announcement that the ATLAS and CMS experiments at the Large Hadron Collider have discovered a particle "consistent with the Higgs boson" has raised questions about what scientists have found and what still remains to be found -- and what it all means. If you have suggestions for future "Ask a Scientist" videos, post them below or send ideas to askascientist@lbl.gov

Hinchliffe, Ian

2013-05-29T23:59:59.000Z

177

Contact Symmetries and Hamiltonian Thermodynamics  

E-Print Network [OSTI]

It has been shown that contact geometry is the proper framework underlying classical thermodynamics and that thermodynamic fluctuations are captured by an additional metric structure related to Fisher's Information Matrix. In this work we analyze several unaddressed aspects about the application of contact and metric geometry to thermodynamics. We consider here the Thermodynamic Phase Space and start by investigating the role of gauge transformations and Legendre symmetries for metric contact manifolds and their significance in thermodynamics. Then we present a novel mathematical characterization of first order phase transitions as equilibrium processes on the Thermodynamic Phase Space for which the Legendre symmetry is broken. Moreover, we use contact Hamiltonian dynamics to represent thermodynamic processes in a way that resembles the classical Hamiltonian formulation of conservative mechanics and we show that the relevant Hamiltonian coincides with the irreversible entropy production along thermodynamic processes. Therefore, we use such property to give a geometric definition of thermodynamically admissible fluctuations according to the Second Law of thermodynamics. Finally, we show that the length of a curve describing a thermodynamic process measures its entropy production.

A. Bravetti; C. S. Lopez-Monsalvo; F. Nettel

2015-02-22T23:59:59.000Z

178

University Assessment Contacts Academic Units  

E-Print Network [OSTI]

.j.arp@oregonstate.edu 541-737-2331 Notes: Agricultural and Resource Economics Assessment Rep: Email: Phone: Penelope DiebelUniversity Assessment Contacts Academic Units COLLEGE OF AGRICULTURAL SCIENCES Assessment Rep.Capalbo@oregonstate.edu 541-737-5639 Notes: Agricultural Education and Agricultural Sciences Assessment Rep: Email: Phone

Escher, Christine

179

Contact Information Elias M. Marvinney  

E-Print Network [OSTI]

Contact Information Elias M. Marvinney 619 Fillmore St Davis, CA 95616 Cell: 617-721-9636 Email: emarvinney@ucdavis.edu Employment History University of California Davis, College of Agriculture accounts for upstream emissions associated with material production and transport, fuel combustion

DeJong, Theodore

180

APRIL 18, 2013 Media Contact  

E-Print Network [OSTI]

Solar Project State Partners with Project Owners to Purchase Conservation Land The California Department of Fish and Wildlife (CDFW), the California Energy Commission (Energy Commission) and the Ivanpah SolarAPRIL 18, 2013 Media Contact: Jordan Traverso, CDFW Communications, (916) 654-9937 California

Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

Questions in Cuban and CaribbeanQuestions in Cuban and Caribbean Archaeology:Archaeology  

E-Print Network [OSTI]

Questions in Cuban and CaribbeanQuestions in Cuban and Caribbean Archaeology:Archaeology: Across was not only the biggest language in the Caribbean, but was also used as lingua franca throughout the region evidence about their language, only place names · Theory: the only non-Arawak language in the Caribbean Sea

Martin, Jeff

182

Fish and Wildlife Management Questions and RM&E Strategies Key Management Questions  

E-Print Network [OSTI]

1 Fish and Wildlife Management Questions and RM&E Strategies Key Management Questions 1. Are we meeting biological and programmatic performance objectives established within the Columbia Basin Fish implemented and accomplished as proposed? Strategic Category: Fish Population Status Monitoring The following

183

Got a Question? We Have an Answer!  

Broader source: Energy.gov [DOE]

Editor's Note: This entry has been cross-posted from energysavers.gov. Ever had a question -- maybe about energy efficiency, renewable energy, the Department of Energy or the like -- and not had any idea where to find the answer? The EERE Information Center might be able to help.

184

Background Material Important Questions about Magnetism  

E-Print Network [OSTI]

Background Material Important Questions about Magnetism: 1) What is Magnetism?Magnetism is a force or repulsion due to charge is called the electric force. But what about magnetism, is there a fundamental property of some matter that makes things magnetic? The answer is: "sort of." Electric current

Mojzsis, Stephen J.

185

Student Learning Commons Questions & Answers for Faculty  

E-Print Network [OSTI]

Student Learning Commons Questions & Answers for Faculty What is the SFU Student Learning Commons? The Student Learning Commons (SLC), is an academic learning centre which provides peer-based assistance with library reference, computer assistance, and other student academic support services. SLC programs

186

CRAD, Facility Safety- Unreviewed Safety Question Requirements  

Broader source: Energy.gov [DOE]

A section of Appendix C to DOE G 226.1-2 "Federal Line Management Oversight of Department of Energy Nuclear Facilities." Consists of Criteria Review and Approach Documents (CRADs) that can be used for assessment of a contractor's Unreviewed Safety Question (USQ) process.

187

Common Questions Why should I soil test?  

E-Print Network [OSTI]

Common Questions Why should I soil test? Soil testing is an important diagnostic tool to evaluate nutrient imbalances and understand plant growth. The most important reason to soil test is to have a basis for intelligent application of fertilizer and lime. Testing also allows for growers and homeowners to maintain

Isaacs, Rufus

188

Physics 321 Exam 1 Sample Questions  

E-Print Network [OSTI]

of motion. Briefly explain the meaning of each law. 4. Describe one case where Newton's third law does .T At what frequency is the response a maximum? What does FWHM mean? What is the expression we usePhysics 321 Exam 1 Sample Questions 1. Write the second order differential equation as two first

Hart, Gus

189

Rangeland ecology: Key global research issues & questions  

E-Print Network [OSTI]

1 Rangeland ecology: Key global research issues & questions Robin Reid and Maria Fernandez-Gimenez This paper discusses developments in our understanding about rangeland ecology and rangeland dynamics in the last 20 years. Before the late 1980's, the mainstream view in range ecology was that livestock

190

Question and Answers Alternative Fuel Readiness Plans  

E-Print Network [OSTI]

Question and Answers Alternative Fuel Readiness Plans PON-13-603 September 3, 2013 Eligibility Q1 to readiness plans? A1 This solicitation is limited to readiness planning only for alternative fuels. Q2 In regards to PON-13-603 - Alternative Fuel Readiness Plans, is electricity used for transportation

191

Extracting Simplified Statements for Factual Question Generation  

E-Print Network [OSTI]

Minister Vladimir V. Putin, the country's paramount leader, cut short a trip to Siberia, returning to Moscow to oversee the federal response. Mr. Putin built his reputation in part on his success set of questions:3 (2) Prime Minister Vladimir V. Putin is the country's paramount leader. (3) Prime

Eskenazi, Maxine

192

#AskEnergySaver: Answering Your Home Heating Questions | Department...  

Broader source: Energy.gov (indexed) [DOE]

AskEnergySaver: Answering Your Home Heating Questions AskEnergySaver: Answering Your Home Heating Questions October 16, 2014 - 4:05pm Q&A Have questions about renewable energy...

193

Contact  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial Validation andPWRContaCt The nuclear

194

Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation AdministrationEnvironmental Review-NEPAContacts

195

Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation AdministrationEnvironmental

196

CONTACT  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASL Symposium: CelebratingMission Welcomefor

197

Contact  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVision Predict,Researchhome /

198

Solar cell contact formation using laser ablation  

DOE Patents [OSTI]

The formation of solar cell contacts using a laser is described. A method of fabricating a back-contact solar cell includes forming a poly-crystalline material layer above a single-crystalline substrate. The method also includes forming a dielectric material stack above the poly-crystalline material layer. The method also includes forming, by laser ablation, a plurality of contacts holes in the dielectric material stack, each of the contact holes exposing a portion of the poly-crystalline material layer; and forming conductive contacts in the plurality of contact holes.

Harley, Gabriel; Smith, David; Cousins, Peter

2012-12-04T23:59:59.000Z

199

Solar cell contact formation using laser ablation  

DOE Patents [OSTI]

The formation of solar cell contacts using a laser is described. A method of fabricating a back-contact solar cell includes forming a poly-crystalline material layer above a single-crystalline substrate. The method also includes forming a dielectric material stack above the poly-crystalline material layer. The method also includes forming, by laser ablation, a plurality of contacts holes in the dielectric material stack, each of the contact holes exposing a portion of the poly-crystalline materiat layer; and forming conductive contacts in the plurality of contact holes.

Harley, Gabriel; Smith, David D.; Cousins, Peter John

2014-07-22T23:59:59.000Z

200

Details of Forestry Commission and DARDNI Plant Health Contacts for UK Points of Entry UK Principle Ports Contacts Contact Details  

E-Print Network [OSTI]

Ports Contacts Contact Details Felixstowe Richard Fergusson Pat Mitchell Philip Evans Roland Fry Fax Other GB Ports John Hunter Joanne McAuley Fax 0131-314-6148 Tel : 0131-314-6182 or Tel : 0131

Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

University of California Response to DOE Questions Regarding...  

Broader source: Energy.gov (indexed) [DOE]

University of California Response to DOE Questions Regarding Price-Anderson Renewal University of California Response to DOE Questions Regarding Price-Anderson Renewal Comments...

202

DOE response to questions from AHAM on the supplemental proposed...  

Energy Savers [EERE]

response to questions from AHAM on the supplemental proposed test procedure for residential clothes washers DOE response to questions from AHAM on the supplemental proposed test...

203

Forty Most Asked Questions Concerning CEQ's National Environmental...  

Energy Savers [EERE]

Forty Most Asked Questions Concerning CEQ's National Environmental Policy Act Regulations Forty Most Asked Questions Concerning CEQ's National Environmental Policy Act Regulations...

204

Discordances ontologiques et questions d'interoprabilit  

E-Print Network [OSTI]

liens, et en quoi elles sont pertinentes pour les sciences sociales. Mots clés : Epistémologie, ontologie, interopérabilité, intégration de schémas, homologie structurale Summary : Beyond the search terrain d'étude ethnologique. Après avoir quelque peu précisé ces deux questions, ainsi que les liens qu

Boyer, Edmond

205

Twenty-five questions for string theorists  

SciTech Connect (OSTI)

In an effort to promote communication between the formal and phenomenological branches of the high-energy theory community, we provide a description of some important issues in supersymmetric and string phenomenology. We describe each within the context of string constructions, illustrating them with specific examples where applicable. Each topic culminates in a set of questions that we believe are amenable to direct consideration by string theorists, and whose answers we think could help connect string theory and phenomenology.

Binetruy, Pierre; /Orsay, LPT; Kane, G.L.; /Michigan U., MCTP; Lykken, Joseph D.; /Fermilab; Nelson, Brent D.; /Pennsylvania U.

2005-09-01T23:59:59.000Z

206

Clean Cities Program Contacts (Fact Sheet)  

SciTech Connect (OSTI)

This fact sheet provides contact information for program staff of the U.S. Department of Energy's Clean Cities program, as well as contact information for the nearly 100 local Clean Cities coalitions across the country.

Not Available

2012-03-01T23:59:59.000Z

207

University of Michigan -Traveler Contact Information Name __________________________________  

E-Print Network [OSTI]

University of Michigan - Traveler Contact Information Name __________________________________ Phone __________________________________ Email __________________________________ University of Michigan/Clinic __________________________________ Address __________________________________ Phone __________________________________ University of Michigan

Eustice, Ryan

208

Electrical Contacts to Individual Colloidal Semiconductor Nanorods  

E-Print Network [OSTI]

stable nanostructured electrical devices with interestingElectrical Contacts to Individual Colloidal Semiconductorand its effect on electrical properties has important

Trudeau, Paul-Emile

2008-01-01T23:59:59.000Z

209

Questions for IIT Waste Diversion RFP Question: What are the recycling/waste goals of IIT?  

E-Print Network [OSTI]

for commercial weights? We cannot provide exact weights by location for commercial cans due to rear load trucks expected to haul the Black outside Hawk bins? Answer: No, this is handled by our staff. Question: Have you

Heller, Barbara

210

2013 Better Buildings Federal Award Frequently Asked Questions  

Broader source: Energy.gov [DOE]

Document answers frequently asked questions for the Federal Energy Management Program's 2013 Better Buildings Federal Award.

211

Advanced Source/Drain and Contact Design for Nanoscale CMOS  

E-Print Network [OSTI]

Barrier Modeling of Metal and Silicide Contacts,” IEEE Elec.Redistributions in Metal and Silicide Contacts,” IEEE Trans.Redistributions in Metal and Silicide Contacts,” IEEE Trans.

Vega, Reinaldo

2010-01-01T23:59:59.000Z

212

Contact DMSE | The Ames Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial Validation andPWRContaCt TheContact

213

Contact Information | The Ames Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial Validation andPWRContaCtContact

214

Contact Information | The Ames Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial ValidationContact Information Human

215

Contact Us | Argonne National Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)Don HillebrandContact Us

216

Contact Us | DOE Data Explorer  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)Don HillebrandContact

217

Contact Us | Department of Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUs Contact Us For

218

Contact Us | Department of Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUs Contact Us

219

Contact Us | Department of Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUs Contact

220

Contact Us | The Ames Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUsContact Us

Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

Contacts | National Nuclear Security Administration  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformationE-Gov Contacts for E-Gov

222

Contact EM | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orAChief MedicalDepartmentWorking withAbout Us » Contact

223

Contact Us | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orAChief MedicalDepartmentWorking withAbout Us »Contact Us

224

Contact Us | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orAChief MedicalDepartmentWorking withAbout Us »Contact

225

Contact Us | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orAChief MedicalDepartmentWorking withAbout UsContact Us

226

Contact Us | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orAChief MedicalDepartmentWorking withAbout UsContact UsUs

227

Contact Us | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orAChief MedicalDepartmentWorking withAbout UsContact

228

Contact Us | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orAChief MedicalDepartmentWorking withAboutUs » Contact Us

229

Contact Us | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehiclesTankless orAChief MedicalDepartmentWorking withAboutUs » Contact

230

contact | netl.doe.gov  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLasDelivered energy consumption byAbout SRNL HomeYoungClean EnergyContact NETL Technology

231

contact | netl.doe.gov  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLasDelivered energy consumption byAbout SRNL HomeYoungClean EnergyContact NETL TechnologyOn-Site

232

contacts | netl.doe.gov  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLasDelivered energy consumption byAbout SRNL HomeYoungClean EnergyContact NETL

233

contacts | netl.doe.gov  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLasDelivered energy consumption byAbout SRNL HomeYoungClean EnergyContact NETLcontacts

234

EMSL Integration 2015: Contacts | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed NewcatalystNeutronEnvironment > Voluntary ReportingAbout Us Doc.prepared2Contacts

235

Sandia National Laboratories: PV Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear Security Administration the1 -theErik Spoerke SSLSMolten-Salt StorageNoLong RangePILSResourcesPV Contacts PV

236

Media Contacts | Argonne National Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas Conchas recovery challenge fund LasDubey MathematicaMeasuring andSecurity Contact:

237

contacts | netl.doe.gov  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear SecurityTensile Strain Switched5 Industrial Carbon Capture and Storage CleanDiscoveryCompletedContacts Operating

238

Contact Information | The Ames Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 Building 9201-1 wasFAboutContact

239

Contact Information | The Ames Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 Building 9201-1 wasFAboutContact

240

Contact Information | The Ames Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 Building 9201-1 wasFAboutContact

Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

Contact Us | The Ames Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 BuildingContact UsNNSAContact Us

242

University of Delaware | Contact CCEI  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest RegionatSearchScheduledProductionCCEIResearch Thrust PyrolysisContact

244

Frequently Asked Questions | ornl.gov  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest Region service area. TheEPSCI HomeTours,Frequently Asked Questions

245

Fermilab | Science | Questions for the Universe  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series toESnet4:Epitaxialtransatlantic networkHomelandWorkforceQuestions for

246

Frequently Asked Questions | DOE Data Explorer  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-SeriesFlickr Flickr Editor's note: SincePlantFreedom ofFrequently Asked Questions

247

Rolling Contact Fatigue of Ceramics  

SciTech Connect (OSTI)

High hardness, low coefficient of thermal expansion and high temperature capability are properties also suited to rolling element materials. Silicon nitride (Si{sub 3}N{sub 4}) has been found to have a good combination of properties suitable for these applications. However, much is still not known about rolling contact fatigue (RCF) behavior, which is fundamental information to assess the lifetime of the material. Additionally, there are several test techniques that are employed internationally whose measured RCF performances are often irreconcilable. Due to the lack of such information, some concern for the reliability of ceramic bearings still remains. This report surveys a variety of topics pertaining to RCF. Surface defects (cracks) in Si{sub 3}N{sub 4} and their propagation during RCF are discussed. Five methods to measure RCF are then briefly overviewed. Spalling, delamination, and rolling contact wear are discussed. Lastly, methods to destructively (e.g., C-sphere flexure strength testing) and non-destructively identify potential RCF-limiting flaws in Si{sub 3}N{sub 4} balls are described.

Wereszczak, Andrew A [ORNL; Wang, W. [Bournemouth University, Bournemouth, United Kingdom; Wang, Y. [Bournemouth University, Bournemouth, United Kingdom; Hadfield, M. [Bournemouth University, Bournemouth, United Kingdom; Kanematsu, W. [National Institute of Advanced Industrial Science and Technology, Japan; Kirkland, Timothy Philip [ORNL; Jadaan, Osama M. [University of Wisconsin, Platteville

2006-09-01T23:59:59.000Z

248

BISON Contact Improvements CASL FY14 Report  

SciTech Connect (OSTI)

The BISON code is the foundation for multiple fuel performance modeling efforts, and is cur- rently under heavy development. For a variety of fuel forms, the effects of heat conduction across a gap and mechanical contact between components of a fuel system are very significant. It is thus critical that BISON have robust capabilities for enforcement of thermal and mechanical contact. BISON’s solver robustness has generally been quite good before mechanical contact between the fuel and cladding occurs, but there have been significant challenges obtaining converged so- lutions once that contact occurs and the solver begins to enforce mechanical contact constraints. During the current year, significant development effort has been focused on the enforcement of mechanical contact to provide improved solution robustness. In addition to this work to improve mechanical contact robustness, an investigation into ques- tionable results attributable to thermal contact has been performed. This investigation found that the order of integration typically used on the surfaces involved in thermal contact was not suffi- ciently high. To address this problem, a new option was provided to permit the use of a different integration order for surfaces, and new usage recommendations were provided.

B. W. Spencer; J. D. Hales; D. R. Gaston; D. A. Karpeev; R. L. Williamson; S. R. Novascone; D. M. Perez; R. J. Gardner; K. A. Gamble

2014-09-01T23:59:59.000Z

249

Clean Cities Program Contacts (Fact Sheet)  

SciTech Connect (OSTI)

This fact sheet contains contact information for program staff and coalition coordinators for the U.S. Department of Energy's Clean Cities program.

Not Available

2012-10-01T23:59:59.000Z

250

Clean Cities Program Contacts (Fact Sheet)  

SciTech Connect (OSTI)

This fact sheet contains contact information for program staff and coalition coordinators for the U.S. Department of Energy's Clean Cities program.

Not Available

2013-01-01T23:59:59.000Z

251

Clean Cities Program Contacts (Fact Sheet)  

SciTech Connect (OSTI)

This fact sheet contains contact information for program staff and coalition coordinators for the U.S. Department of Energy's Clean Cities program.

Not Available

2012-09-01T23:59:59.000Z

252

Contact Form - DOE Directives, Delegations, and Requirements  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Contact Form by Diane Johnson Directives are the Department of Energy's Primary means of establishing policies, requirements, responsibilities, and procedures for Departmental...

253

Have a Question About Energy Efficiency or Renewable Energy?...  

Broader source: Energy.gov (indexed) [DOE]

Have a Question About Energy Efficiency or Renewable Energy? Ask Ener-Gee Whiz Have a Question About Energy Efficiency or Renewable Energy? Ask Ener-Gee Whiz May 26, 2009 -...

254

Nano Lect 1 Questions and Keypoints Key Points  

E-Print Network [OSTI]

Nano Lect 1 ­ Questions and Keypoints Key Points 1. What is nano technology: a. Very small technology with device in the 1nm to 100nm lots of useful properties Questions 1. Define nanotechnology. Is an nano

Smy, Tom

255

PFP: Protein Function Prediction server For any questions regarding PFP contact the administration at info@kiharalab.org  

E-Print Network [OSTI]

also click on "Load Sample" link to load this sequence in the text box and follow the next steps "Enter Query Sequence(s)". Consider the following sequence that you can enter. >sp|P56851|EP3B. Clicking on "Clear" link will clear the text box for sequence and load default ESG parameters in the boxes

Kihara, Daisuke

256

2015 Federal Energy and Water Management Awards: Frequently Asked Questions  

Broader source: Energy.gov [DOE]

Document answers frequently asked questions about the 2015 Federal Energy and Water Management Awards' guidelines and criteria for nominations.

257

Frequently Asked Questions: About Federal Fleet Management (Brochure)  

SciTech Connect (OSTI)

Answers to frequently asked questions about Federal fleet management, Federal requirements, reporting, advanced vehicles, and alternative fuels.

Not Available

2009-10-01T23:59:59.000Z

258

Questions about? Needing help wards? Worried about? Who can  

E-Print Network [OSTI]

Questions about? Needing help wards? Worried about? Who can bout? Needing help with? Headi can help? Questio g towards? Worrie elp? Questions about? Needing he bout? Needing help with? Headi ed about? Who can help? Quest ng help with? Heading towards? W an help? Questions about? Needin ng towards? Worried

Netoff, Theoden

259

Improved Answer Ranking in Social Question-Answering Portals  

E-Print Network [OSTI]

@cl.uni-heidelberg.de ABSTRACT Community QA portals provide an important resource for non-factoid question; Community question answering; Query expansion 1. INTRODUCTION Community Question-Answering (QA) portals can more recent work deploys Yahoo! Answers data for complete QA [24, 25], we focus on the aspect of answer

Riezler, Stefan

260

Silicone oil contamination and electrical contact resistance degradation of low-force gold contacts.  

SciTech Connect (OSTI)

Hot-switched low-force gold electrical contact testing was performed using a nanomechanical test apparatus to ascertain the sensitivity of simulated microelectromechanical systems (MEMS) contact to silicone oil contamination. The observed cyclic contact resistance degradation was dependent on both closure rate and noncontact applied voltage. The decomposition of silicone oil from electrical arcing was hypothesized as the degradation mechanism.

Dugger, Michael Thomas; Dickrell, Daniel John, III

2006-02-01T23:59:59.000Z

Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

Electrical contact resistance degradation of a hot-switched simulated metal MEMS contact.  

SciTech Connect (OSTI)

Electrical contact resistance testing was performed by hot-switching a simulated gold-platinum metal microelectromechanical systems contact. The experimental objective was to determine the sensitivity of the contact resistance degradation to current level and environment. The contact resistance increased sharply after 100 hot-switched cycles in air. Hot-switching at a reduced current and in nitrogen atmosphere curtailed contact resistance degradation by several orders of magnitude. The mechanism responsible for the resistance degradation was found to be arc-induced decomposition of adsorbed surface contaminants.

Dugger, Michael Thomas; Dickrell, Daniel John, III

2005-03-01T23:59:59.000Z

262

Contact SSRL | Stanford Synchrotron Radiation Lightsource  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact InContactContact Us

263

Contact Us | Y-12 National Security Complex  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - WorkingContact Us Contact

264

Contact us | Energy Frontier Research Centers  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - WorkingContact UsContact us

265

Contact | MIT-Harvard Center for Excitonics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - WorkingContact UsContact

266

Contact Us | Linac Coherent Light Source  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 BuildingContact Us ContactContact

267

2005, in Etudes croles nXXVIII n1,Contacts de croles, croles en contacts, L'Harmattan, 23-57. CONTACTS DE CREOLES A MANA (GUYANE FRANAISE)  

E-Print Network [OSTI]

2005, in Etudes créoles n°XXVIII n°1,Contacts de créoles, créoles en contacts, L'Harmattan, 23°1,Contacts de créoles, créoles en contacts, L'Harmattan, 23-57. 2 de langues, notamment à la gestion

Paris-Sud XI, Université de

268

Questions and Answers about National Environmental Policy Act...  

Energy Savers [EERE]

(DOE) State Energy Program (SEP) in the DOE Office of Energy Efficiency and Renewable Energy. sepnepafaqs.pdf More Documents & Publications Questions and Answers on the...

269

Sample Questions | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

Regionals Middle School Rules, Forms, and Resources Sample Questions National Science Bowl (NSB) NSB Home About High School Middle School Middle School Students Middle...

270

Sample Questions | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

Regionals High School Rules, Forms, and Resources Sample Questions National Science Bowl (NSB) NSB Home About High School High School Students High School Coaches High...

271

University of California Response to DOE Questions Regarding...  

Broader source: Energy.gov (indexed) [DOE]

Response to DOE Questions Regarding Price-Anderson Renewal January 30, 1998 -1- Q 1. Should the DOE Price-Anderson indemnification be continued without modification? Answer:...

272

Council on Environmental Quality - Forty Most Asked Questions...  

Open Energy Info (EERE)

navigation, search OpenEI Reference LibraryAdd to library Memorandum: Council on Environmental Quality - Forty Most Asked Questions Concerning CEQ's NEPA Regulations Abstract...

273

Electric Vehicle Deployment: Policy Questions and Impacts to...  

Energy Savers [EERE]

regarding policy questions and impacts to the electric grid from the energy demands of electric vehicles. EAC - Electric Vehicle Deployment - Impacts to the US Electric Grid -...

274

FW Response to Notice of Inquire on Questions Concerning Technology...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

esponse to Notice of Inquire on Questions Concerning Technology Transfer Tractices at DOE Laboratories. From: Malozemoff, Alex AMalozemoff@amsc.com Sent: Tuesday, January 27,...

275

Questions and Answers for the Smart Grid Investment Grant Program...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Questions and Answers for the Smart Grid Investment Grant Program: Applicability of Buy American Provision of Section 1605 of the Recovery Act to Projects Under the Smart Grid...

276

Frequently Asked Questions about the CALiPER Program  

Broader source: Energy.gov [DOE]

This page addresses many of the questions manufacturers, testing laboratories, consumers, retailers, and energy efficiency program sponsors may have about the DOE SSL Commercially Available LED...

277

Contact Information College of Business and Economics  

E-Print Network [OSTI]

Contact Information College of Business and Economics Center for Business Research and Economic Research and Economic Development Center What's your challenge? We help businesses and organizations can lie in Accountancy, Economics, Information Technology and Supply Chain Management, International

Barrash, Warren

278

Front contact solar cell with formed emitter  

SciTech Connect (OSTI)

A bipolar solar cell includes a backside junction formed by an N-type silicon substrate and a P-type polysilicon emitter formed on the backside of the solar cell. An antireflection layer may be formed on a textured front surface of the silicon substrate. A negative polarity metal contact on the front side of the solar cell makes an electrical connection to the substrate, while a positive polarity metal contact on the backside of the solar cell makes an electrical connection to the polysilicon emitter. An external electrical circuit may be connected to the negative and positive metal contacts to be powered by the solar cell. The positive polarity metal contact may form an infrared reflecting layer with an underlying dielectric layer for increased solar radiation collection.

Cousins, Peter John

2014-11-04T23:59:59.000Z

279

Front contact solar cell with formed emitter  

DOE Patents [OSTI]

A bipolar solar cell includes a backside junction formed by an N-type silicon substrate and a P-type polysilicon emitter formed on the backside of the solar cell. An antireflection layer may be formed on a textured front surface of the silicon substrate. A negative polarity metal contact on the front side of the solar cell makes an electrical connection to the substrate, while a positive polarity metal contact on the backside of the solar cell makes an electrical connection to the polysilicon emitter. An external electrical circuit may be connected to the negative and positive metal contacts to be powered by the solar cell. The positive polarity metal contact may form an infrared reflecting layer with an underlying dielectric layer for increased solar radiation collection.

Cousins, Peter John (Menlo Park, CA)

2012-07-17T23:59:59.000Z

280

Contact fatigue : life prediction and palliatives  

E-Print Network [OSTI]

Fretting fatigue is defined as damage resulting from small magnitude (0.5-50 microns) displacement between contacting bodies where at least one of the bodies has an applied bulk stress. The applicability and limits of a ...

Conner, Brett P. (Brett Page), 1975-

2002-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

DOE Headquarters Contact Information: Employee Concerns Program...  

Broader source: Energy.gov (indexed) [DOE]

Office ECP Contact Information: Albuquerque Complex (NNSA) Eva Glow Brownlow Michelle Rodriguez de Varela Hotline: 800-688-5713 Fax: 505-845-4020 E-mail: ecp@nnsa.doe.gov...

282

NUMERICAL MODELING OF CATHODE CONTACT MATERIAL DENSIFICATION  

SciTech Connect (OSTI)

Numerical modeling was used to simulate the constrained sintering process of the cathode contact layer during assembly of solid oxide fuel cells (SOFCs). A finite element model based on the continuum theory for sintering of porous bodies was developed and used to investigate candidate low-temperature cathode contact materials. Constitutive parameters for various contact materials under investigation were estimated from dilatometry screening tests, and the influence of processing time, processing temperature, initial grain size, and applied compressive stress on the free sintering response was predicted for selected candidate materials. The densification behavior and generated stresses within a 5-cell planar SOFC stack during sintering, high temperature operation, and room temperature shutdown were predicted. Insufficient constrained densification was observed in the stack at the proposed heat treatment, but beneficial effects of reduced grain size, compressive stack preload, and reduced thermal expansion coefficient on the contact layer densification and stresses were observed.

Koeppel, Brian J.; Liu, Wenning N.; Stephens, Elizabeth V.; Khaleel, Mohammad A.

2011-11-01T23:59:59.000Z

283

Clean Cities Program Contacts (Fact Sheet)  

SciTech Connect (OSTI)

Contact information for the U.S. Department of Energy's Clean Cities program staff and for the coordinators of the nearly 100 local Clean Cities coalitions across the country.

Not Available

2013-12-01T23:59:59.000Z

284

Louise Guy, Administrative Contact College of Education  

E-Print Network [OSTI]

provide leadership, scholarship and training across the following programs: · Educational Specialist/Severe Disabilities, Orientation & Mobility, and Vocational Special Education). · Certificate programs offeredLouise Guy, Administrative Contact College of Education Department of Special Education 1600

285

Cooperativity and Contact Order in Protein Folding  

E-Print Network [OSTI]

The effects of cooperativity are studied within Go-Lennard-Jones models of proteins by making the contact interactions dependent on the proximity to the native conformation. The kinetic universality classes are found to remain the same as in the absence of cooperativity. For a fixed native geometry, small changes in the effective contact map may affect the folding times in a chance way and to the extent that is comparable to the shift in the folding times due to cooperativity. The contact order controlls folding scenarios: the average times necessary to bring pairs of amino acids into their near native separations depend on the sequential distances within the pairs. This dependence is largely monotonic, regardless of the cooperativity, and the dominant trend could be described by a single parameter like the average contact order. However, it is the deviations from the trend which are usually found to set the net folding times.

Marek Cieplak

2004-01-11T23:59:59.000Z

286

Colorado State University Extension Contact: Joanne Littlefield  

E-Print Network [OSTI]

Colorado State University Extension Contact: Joanne Littlefield Director, Outreach and Engagement weather situation in Colorado is requiring often quick property and safety decisions; recovery efforts and rapidly shifting conditions along Colorado's Front Range. From food safety issues related to crops

Stephens, Graeme L.

287

Elastic–Plastic Spherical Contact Modeling Including Roughness Effects  

E-Print Network [OSTI]

A multilevel model for elastic–plastic contact between ajunction growth of an elastic–plastic spherical contact. J.nite element based elastic–plastic model for the contact of

Li, L.; Etsion, I.; Talke, F. E.

2010-01-01T23:59:59.000Z

288

Exploring Korean Americans’ Interracial Contact Experiences During Recreational Sport Activities  

E-Print Network [OSTI]

This thesis follows the style of Journal of Leisure Research. 2 of friendship, as an essential condition for successful intergroup contact (Pettigrew, 1997; Pettigrew & Tropp, 2006). Since the contact hypothesis was first introduced, intergroup contact... conditions for successful intergroup contact. Their meta-analysis of 713 independent samples from 515 intergroup contact studies revealed four important findings First, 17 intergroup contact typically reduces intergroup prejudice. Second, the positive...

Lee, Kang Jae

2010-07-14T23:59:59.000Z

289

EERE Information Center Contact, PIA, The Office of Energy Efficiency...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Information Center Contact, PIA, The Office of Energy Efficiency and Renewable Energy (EERE) EERE Information Center Contact, PIA, The Office of Energy Efficiency and Renewable...

290

Cell Phone Allergic Contact Dermatitis: Case Report and Review  

E-Print Network [OSTI]

testing in a sample of cell phones in Denmark. ContactCell phone allergic contact dermatitis: Case report andcombination of increased cell phone ownership and unlimited

Rajpara, Anand; Feldman, Steven R

2010-01-01T23:59:59.000Z

291

Questions and Answers For PON-10-604  

E-Print Network [OSTI]

Questions and Answers For PON-10-604 Buy Down Incentives for Natural Gas and Propane Vehicles May Vehicles 2. QUESTION: Are vehicles that are retrofitted with after-market CNG and propane conversion kits-road natural gas and propane vehicles that meet all emission requirements of the Air Resources Board (ARB

292

Sulfate Aerosol Geoengineering: The Question of Justice Toby Svoboda1,*  

E-Print Network [OSTI]

Sulfate Aerosol Geoengineering: The Question of Justice Toby Svoboda1,* , Klaus Keller2 , Marlos of geoengineering as a means to address global climate change. This paper focuses on the question of whether a particular form of geoengineering, namely deploying sulfate aerosols in the stratosphere to counteract some

293

antibody test questions: Topics by E-print Network  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

antibody test questions First Page Previous Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 Next Page Last Page Topic Index 1 Common Questions Why should I...

294

Questions and Answers For PON-10-604  

E-Print Network [OSTI]

Questions and Answers For PON-10-604 Buy Down Incentives for Natural Gas and Propane Vehicles. Individuals may purchase eligible natural gas and propane vehicles from participating OEMs include heavy-duty vehicles powered by ARB-certified natural gas or propane engines. 1 #12;Questions

295

2Name ________________________________ Question 1: What is the usable area  

E-Print Network [OSTI]

the area of a satellite solar panel and estimate the total electrical power that can be generated. Students, the maximum panel area is 12,240 sq. cm, so (8100/12240)x100% = 66% of the panel is covered by solar cells shown below? Question 2: What electrical power can be generated by the panel? Question 3: If there are 8

296

ME/AE/CompE/EE 378 Mechatronics Questions: Actuators  

E-Print Network [OSTI]

frequency plots. QUESTION 5 For a permanent magnet DC motor, explain how the bandwidth changes to an inertial load through a long thin shaft as shown in the Figure below. The shaft may be modeled as a viscous angular velocity, and load angular position. Va La Ra Vb Jm,Bm m, m + - L, L + - Ia JL,BL shaft QUESTION 2

Landers, Robert G.

297

Electric Field and Humidity Trigger Contact Electrification  

E-Print Network [OSTI]

Here, we study the old problem of why identical insulators can charge one another on contact. We perform several experiments showing that, if driven by a preexisting electric field, charge is transferred between contacting insulators. This happens because the insulator surfaces adsorb small amounts of water from a humid atmosphere. We believe the electric field then separates positively from negatively charged ions prevailing within the water, which we believe to be hydronium and hydroxide ions, such that at the point of contact, positive ions of one insulator neutralize negative ions of the other one, charging both of them. This mechanism can explain for the first time the observation made four decades ago that wind-blown sand discharges in sparks if and only if a thunderstorm is nearby.

Zhang, Yanzhen; Liu, Yonghong; Wang, Xiaolong; Zhang, Rui; Shen, Yang; Ji, Renjie; Cai, Baoping

2015-01-01T23:59:59.000Z

298

Electric Field and Humidity Trigger Contact Electrification  

E-Print Network [OSTI]

Here, we study the old problem of why identical insulators can charge one another on contact. We perform several experiments showing that, if driven by a preexisting electric field, charge is transferred between contacting insulators. This happens because the insulator surfaces adsorb small amounts of water from a humid atmosphere. We believe the electric field then separates positively from negatively charged ions prevailing within the water, which we believe to be hydronium and hydroxide ions, such that at the point of contact, positive ions of one insulator neutralize negative ions of the other one, charging both of them. This mechanism can explain for the first time the observation made four decades ago that wind-blown sand discharges in sparks if and only if a thunderstorm is nearby.

Yanzhen Zhang; Thomas Pähtz; Yonghong Liu; Xiaolong Wang; Rui Zhang; Yang Shen; Renjie Ji; Baoping Cai

2015-01-14T23:59:59.000Z

299

Contacts for Integrating Renewable Energy into Federal Construction Projects  

Broader source: Energy.gov [DOE]

Contacts to learn more about integrating renewable energy technologies into Federal construction projects.

300

Ohmic contacts to n-GaSb  

E-Print Network [OSTI]

in the semiconductor is measured during the deposition of the metal contact. In using method 1, the I-V characteristics is plotted. The thermionic emission theory predicts the current-voltage characteristics of Schottky diodes as [13]: J(rhcrmionic) = A" T' exp... of different work functions. This situation is also true for metal contacts to n-GaSb. Polyakov et al. [14] examined the Schottky diodes of Al, Au, In, Pd, Ga, and Sb on Te doped n-GaSb. They used the C-V measurements methods. They reported that barrier...

Yang, Zhengchong

2012-06-07T23:59:59.000Z

Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

Contact Us | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment ofDepartment ofofOxford SiteToledoSampling at the GrandSr:s I1Us |Contact Us Contact

302

Contact Upper Great Plains Regional Office  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial ValidationContact InformationContact

303

Contact Us | Photosynthetic Antenna Research Center  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUs ContactLosContact

304

Contact Us | Y-12 National Security Complex  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUsContact UsContact

305

Contacts for Services | Department of Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformationE-Gov Contacts for E-Gov LeAnnProjectContacts for

306

Contact Information | Princeton Plasma Physics Lab  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact InContact

307

Contact Us - Working With Us | NREL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - Working With Us Contact us

308

Contact Us | Center for Energy Efficient Materials  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - Working With UsContact

309

Contact Us | Y-12 National Security Complex  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 BuildingContact UsNNSAContactContact

310

Contacts For "A" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA" Contacts For

311

Contacts For "B" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA" Contacts ForB"

312

Contacts For "C" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA" Contacts

313

Contacts For "D" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA" ContactsD"

314

Contacts For "E" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA" ContactsD"E"

315

Contacts For "G" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA"G" Contacts For

316

Contacts For "H" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA"G" Contacts

317

Contacts For "I" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA"G" ContactsI"

318

Contacts For "K" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA"G"K" Contacts

319

Contacts For "S" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts ForS" Contacts For

320

Contacts For "T" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts ForS" Contacts

Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

Contacts | Y-12 National Security Complex  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" ContactsContacts for

322

LBNL/ PUB 3000 Chapter 8 Questions on Electrical Cords 2010 Questions have been asked about electrical safety that includes extension cords,  

E-Print Network [OSTI]

LBNL/ PUB 3000 Chapter 8 ­ Questions on Electrical Cords 2010 Questions have been asked about at the Laboratory. #12;LBNL/ PUB 3000 Chapter 8 ­ Questions on Electrical Cords 2010 Avoiding Misuse of Extension

Knowles, David William

323

Aspects of spatial thinking in geography textbook questions  

E-Print Network [OSTI]

This study examined questions embedded in four high school world geography textbooks to evaluate the degree to which the three components of spatial thinking were incorporated: concepts of space, tools of representation, and processes of reasoning...

Jo, Injeong

2009-05-15T23:59:59.000Z

324

Postgraduate Diploma in Social Work/MSW Frequently Asked Questions  

E-Print Network [OSTI]

Postgraduate Diploma in Social Work/MSW Frequently Asked Questions Educational Qualifications Q 1 I months full-time equivalent relevant experience always required of applicants to the MSW at the point

Mottram, Nigel

325

Microsoft Word - Frequently_Asked_Questions_7_20_2011  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

3 Question: I was certified before the electronic profile in the Employee Self Service (ESS) System was implemented. When coming forward for a higher level of certification, do I...

326

Microsoft Word - Response to DOEs Questions.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Goodyear Tire & Rubber Company Response to DOE's Questions Technology Transfer Practices at DOE Laboratories March 24, 2009 Submitted to GC-62@hq.doe.gov Office of the Assistant...

327

Questions concerning Technology Transfer Practices at DOE Labs...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

concerning Technology Transfer Practices at DOE Labs.txt From: Gary S. Selwyn gary.selwyn@apjet.com Sent: Tuesday, February 10, 2009 7:00 PM To: GC-62 Subject: Questions...

328

Questions and answers based on revised 10 CFR Part 20  

SciTech Connect (OSTI)

NUREG/CR-6204 is a collection of questions and answers that were originally issued in seven sets and which pertain to revised 10 CFR Part 20. The questions came from both outside and within the NRC. The answers were compiled and provided by NRC staff within the offices of Nuclear Reactor Regulation, Nuclear Material Safety and Safeguards, Nuclear Regulatory Research, the Office of State Programs, and the five regional offices. Although all of the questions and answers have been reviewed by attorneys in the NRC Office of the General Counsel, they do not constitute official legal interpretations relevant to revised 10 CFR Part 20. The questions and answers do, however, reflect NRC staff decisions and technical options on aspects of the revised 10 CFR Part 20 regulatory requirements. This NUREG is being made available to encourage communication among the public, industry, and NRC staff concerning the major revisions of the NRC`s standards for protection against radiation.

Borges, T.; Stafford, R.S.; Lu, P.Y. [Oak Ridge National Lab., TN (United States); Carter, D. [Nuclear Regulatory Commission, Washington, DC (United States)

1994-05-01T23:59:59.000Z

329

The Export Question: Designing Policy for British Columbia Electricity Trade  

E-Print Network [OSTI]

The Export Question: Designing Policy for British Columbia Electricity Trade Dr. George Hoberg..........................................................................................................................................5 2 BC's Electricity Trade Picture: Context and Trends........................................................................6 2.1 How electricity trading works

Pedersen, Tom

330

Question of the Week: Do Energy-Related Financial Incentives...  

Broader source: Energy.gov (indexed) [DOE]

Do Energy-Related Financial Incentives Prompt You to Be More Energy Efficient? Question of the Week: Do Energy-Related Financial Incentives Prompt You to Be More Energy Efficient?...

331

Question of the Week: How Does Your Community Encourage Energy...  

Broader source: Energy.gov (indexed) [DOE]

sumer.webmaster@nrel.gov. Addthis Related Articles Question of the Week: How Will You Landscape for Energy Efficiency? What Steps Do You Take to Improve Your Fuel Economy? How Are...

332

Berkeley Lab Answers Your Home Energy Efficiency Questions  

ScienceCinema (OSTI)

In this follow-up "Ask Berkeley Lab" video, energy efficiency expert Iain Walker answers some of your questions about home energy efficiency. How do you monitor which appliances use the most energy? Should you replace your old windows? Are photovoltaic systems worth the cost? What to do about a leaky house? And what's the single biggest energy user in your home? Watch the video to get the answers to these and more questions.

Walker, Iain

2013-11-14T23:59:59.000Z

333

Berkeley Lab Answers Your Home Energy Efficiency Questions  

SciTech Connect (OSTI)

In this follow-up "Ask Berkeley Lab" video, energy efficiency expert Iain Walker answers some of your questions about home energy efficiency. How do you monitor which appliances use the most energy? Should you replace your old windows? Are photovoltaic systems worth the cost? What to do about a leaky house? And what's the single biggest energy user in your home? Watch the video to get the answers to these and more questions.

Walker, Iain

2013-02-14T23:59:59.000Z

334

CONTACT INFORMATION The KAVLI NANOSCIENCE INSTITUTE  

E-Print Network [OSTI]

CONTACT INFORMATION The KAVLI NANOSCIENCE INSTITUTE California Institute of Technology 1200 E structures. The Holliston Parking Structure is nearest Steele Laboratory. rev052708 The KAVLI NANOSCIENCE to users from academia, government, and industry. The Kavli Nanoscience Institute has been founded through

335

Thermodynamics of nuclei in thermal contact  

E-Print Network [OSTI]

The behaviour of a di-nuclear system in the regime of strong pairing correlations is studied with the methods of statistical mechanics. It is shown that the thermal averaging is strong enough to assure the application of thermodynamical methods to the energy exchange between the two nuclei in contact. In particular, thermal averaging justifies the definition of a nuclear temperature.

Karl-Heinz Schmidt; Beatriz Jurado

2010-10-05T23:59:59.000Z

336

Thin Silicon MEMS Contact-Stress Sensor  

SciTech Connect (OSTI)

This work offers the first, thin, MEMS contact-stress (CS) sensor capable of accurate in situ measruement of time-varying, contact-stress between two solid interfaces (e.g. in vivo cartilage contact-stress and body armor dynamic loading). This CS sensor is a silicon-based device with a load sensitive diaphragm. The diaphragm is doped to create piezoresistors arranged in a full Wheatstone bridge. The sensor is similar in performance to established silicon pressure sensors, but it is reliably produced to a thickness of 65 {micro}m. Unlike commercial devices or other research efforts, this CS sensor, including packaging, is extremely thin (< 150 {micro}m fully packaged) so that it can be unobtrusively placed between contacting structures. It is built from elastic, well-characterized materials, providing accurate and high-speed (50+ kHz) measurements over a potential embedded lifetime of decades. This work explored sensor designs for an interface load range of 0-2 MPa; however, the CS sensor has a flexible design architecture to measure a wide variety of interface load ranges.

Kotovsky, J; Tooker, A; Horsley, D A

2009-12-07T23:59:59.000Z

337

For additional information, contact: Department of Ecology  

E-Print Network [OSTI]

For additional information, contact: Department of Ecology Montana State University 310 Lewis Hall P.O. Box 173460 Bozeman, MT 59717-3460 Tel: 406-994-4548 Fax: 406-994-3190 www.montana.edu/ecology/ ecology@montana.edu The Department of Ecology at Montana State University offers undergraduate majors

Maxwell, Bruce D.

338

subcollector Schottky collector contact & interconnect metals  

E-Print Network [OSTI]

base collector depletion layer subcollector ohmic metal (a) base collector depletion layer Schottky metal base emitter collector collector We emitter base emitter emitter We Wc Wc (b) Schottky collector contact & interconnect metals Emitter & collector Ohmics undoped collector depletion layer base N

Rodwell, Mark J. W.

339

Contact Anosov flows and the FBI transform  

E-Print Network [OSTI]

This paper is about spectral properties of transfer operators for contact Anosov flows. The main result gives the essential spectral radius of the transfer operators acting on the so-called anisotropic Sobolev space exactly in terms of dynamical exponents. Also we provide a simplified proof by using the FBI transform.

Tsujii, Masato

2010-01-01T23:59:59.000Z

340

Contact Details Journeying Beyond Breast Cancer  

E-Print Network [OSTI]

Home About Contact Details Facebook Search Journeying Beyond Breast Cancer making sense of the cancer experience Feeds: Posts Comments Cancer-fighting fountain pen May 20, 2009 by JBBC A research team be used both as a research tool in the development of next-generation cancer treatments

Espinosa, Horacio D.

Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

Contact details: School of Architecture, BCU  

E-Print Network [OSTI]

With 90% of the UK population living in urban areas, improving urban sustainability has become a pressing Economic Fabric This work package investigated opportunities and barriers to achieving sustainable is to be sustainable in the widest sense. Contact details: Centre for Urban and Regional Studies, U0B Dr. Austin Barber

Birmingham, University of

342

For more information, contact University Parking  

E-Print Network [OSTI]

.275.4524 Have a Flat Tire? Car Won't Start? Need Directions? V.A.P. VEHICLE ASSISTANCE PROGRAM University Tire? Car Won't Start? Contact University Parking and Transportation's Vehicle Assistance Program (V-icer assistance during winter months ·Tire inflations Inclement Travel Information When inclement weather

Mahon, Bradford Z.

343

Edgar_Answers to student questions 414.pdf Student questions: Lauren Edgar colloquium on "Martian Sedimentology as Revealed by the  

E-Print Network [OSTI]

Sedimentology as Revealed by the Curiosity Rover" 3/26/14 Question 1: How are the studies that you've done of the same kinds of instruments to investigate the sedimentology and stratigraphy at each landing site

Rhoads, James

344

Lactation Room Locations Building Location Room Details Contact Name Contact Info Instructions  

E-Print Network [OSTI]

, hot water heater, educational info Natalie Blais narnold@pitt.edu Contact Natalie to receive and request a key to this locked room. Public Health A712 Crabtree Hall table, chairs, storage cabinet, fridge

Jiang, Huiqiang

345

Electrical contact arrangement for a coating process  

DOE Patents [OSTI]

A protective coating is applied to the electrically conductive surface of a reflective coating of a solar mirror by biasing a conductive member having a layer of a malleable electrically conductive material, e.g. a paste, against a portion of the conductive surface while moving an electrodepositable coating composition over the conductive surface. The moving of the electrodepositable coating composition over the conductive surface includes moving the solar mirror through a flow curtain of the electrodepositable coating composition and submerging the solar mirror in a pool of the electrodepositable coating composition. The use of the layer of a malleable electrically conductive material between the conductive member and the conductive surface compensates for irregularities in the conductive surface being contacted during the coating process thereby reducing the current density at the electrical contact area.

Kabagambe, Benjamin; McCamy, James W; Boyd, Donald W

2013-09-17T23:59:59.000Z

346

Direct contact, binary fluid geothermal boiler  

DOE Patents [OSTI]

Energy is extracted from geothermal brines by direct contact with a working fluid such as isobutane which is immiscible with the brine in a geothermal boiler. The geothermal boiler provides a distributor arrangement which efficiently contacts geothermal brine with the isobutane in order to prevent the entrainment of geothermal brine in the isobutane vapor which is directed to a turbine. Accordingly the problem of brine carry-over through the turbine causes corrosion and scaling thereof is eliminated. Additionally the heat exchanger includes straightening vanes for preventing startup and other temporary fluctuations in the transitional zone of the boiler from causing brine carryover into the turbine. Also a screen is provided in the heat exchanger to coalesce the working fluid and to assist in defining the location of the transitional zone where the geothermal brine and the isobutane are initially mixed.

Rapier, Pascal M. (Richmond, CA)

1982-01-01T23:59:59.000Z

347

Active alignment/contact verification system  

DOE Patents [OSTI]

A system involving an active (i.e. electrical) technique for the verification of: 1) close tolerance mechanical alignment between two component, and 2) electrical contact between mating through an elastomeric interface. For example, the two components may be an alumina carrier and a printed circuit board, two mating parts that are extremely small, high density parts and require alignment within a fraction of a mil, as well as a specified interface point of engagement between the parts. The system comprises pairs of conductive structures defined in the surfaces layers of the alumina carrier and the printed circuit board, for example. The first pair of conductive structures relate to item (1) above and permit alignment verification between mating parts. The second pair of conductive structures relate to item (2) above and permit verification of electrical contact between mating parts.

Greenbaum, William M. (Modesto, CA)

2000-01-01T23:59:59.000Z

348

Non-Contact Gaging with Laser Probe  

SciTech Connect (OSTI)

A gage has been constructed using conventional (high end) components for the application of measuring fragile syntactic foam parts in a non-contact mode. Success with this approach has been achieved through a novel method of transferring (mapping) high accuracy local measurements of a coated aluminum master, taken on a Leitz Coordinate Measurement Machine (CMM), to the gage software system. The mapped data is then associated with local voltage readings from two (inner and outer) laser triangulating probes. This couples discreet laser probe offset and linearity characteristics to the measured master geometry. The gage software compares real part measured data against the master data to provide non-contact part inspection that results in a high accuracy and low uncertainty performance. Uncertainty from the part surface becomes the prevailing contributor to the gaging process. The gaging process provides a high speed, hands off measurement with nearly zero impedance.

Clinesmith, Mike

2009-03-20T23:59:59.000Z

349

Photoinduced electron transfer in contact ion pairs  

SciTech Connect (OSTI)

Contact ion pair (CIP) formation is especially relevant to the reactivity of organic and organometallic nucleophiles and electrophiles in solution. The authors felt that the intermolecular charge-transfer (CT) absorptions which commonly accompany the interaction of uncharged nucleophiles (donors) with electrophiles (acceptors) could also provide the experimental means to assess CIP behavior. Accordingly they examined the CT excitations from CIPs of carbonylmetallate anions in this study, since they are known to be effective nucleophiles with relatively low ionization potentials.

Bockman, T.M.; Kochi, J.K.

1988-02-17T23:59:59.000Z

350

Renewable Energy Contacts | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE: AlternativeEnvironment,Institutes and LaunchesRelated FinancialUtility District |Contacts

351

Property:Geothermal/Contact | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data CenterFranconia, Virginia: Energy ResourcesLoadingPenobscot County, Maine:Plug PowerAddressDataFormatGeothermal/Contact" Showing 25

352

Got Questions About the Higgs Boson? Ask a Scientist  

SciTech Connect (OSTI)

Ask a scientist about the Higgs boson. There's a lot of buzz this week over new data from CERN's Large Hadron Collider (LHC) and the final data from Fermilab's Tevatron about the Higgs boson. It raises questions about what scientists have found and what still remains to be found -- and what it all means. Berkeley Lab's Ian Hinchliffe invites you to send in questions about the Higgs. He'll answer a few of your questions in a follow-up video later this week. Hinchliffe is a theoretical physicist who heads Berkeley Lab's sizable contingent with the ATLAS experiment at CERN. • Post your questions in the comment box • E-mail your questions to askascientist@lbl.gov • Tweet to @BerkeleyLab • Or post on our facebook page: facebook/berkeleylab Update on July 5: Ian responds to several of your questions in this video: http://youtu.be/1BkpD1IS62g Update on 7/04: Here's CERN's press release from earlier today on the latest preliminary results in the search for the long sought Higgs particle: http://press.web.cern.ch/press/PressReleases/Releases2012/PR17.12E.htm And here's a Q&A on what the news tells us: http://cdsweb.cern.ch/journal/CERNBulletin/2012/28/News%20Articles/1459460?ln=en CERN will present the new LHC data at a seminar July 4th at 9:00 in the morning Geneva time (3:00 in the morning Eastern Daylight Time, midnight on the Pacific Coast), where the ATLAS collaboration and their rivals in the CMS experiment will announce their results. Tevatron results were announced by Fermilab on Monday morning. For more background on the LHC's search for the Higgs boson, visit http://newscenter.lbl.gov/feature-stories/2012/06/28/higgs-2012/.

Hinchliffe, Ian

2012-01-01T23:59:59.000Z

353

Got Questions About the Higgs Boson? Ask a Scientist  

ScienceCinema (OSTI)

Ask a scientist about the Higgs boson. There's a lot of buzz this week over new data from CERN's Large Hadron Collider (LHC) and the final data from Fermilab's Tevatron about the Higgs boson. It raises questions about what scientists have found and what still remains to be found -- and what it all means. Berkeley Lab's Ian Hinchliffe invites you to send in questions about the Higgs. He'll answer a few of your questions in a follow-up video later this week. Hinchliffe is a theoretical physicist who heads Berkeley Lab's sizable contingent with the ATLAS experiment at CERN. ? Post your questions in the comment box ? E-mail your questions to askascientist@lbl.gov ? Tweet to @BerkeleyLab ? Or post on our facebook page: facebook/berkeleylab Update on July 5: Ian responds to several of your questions in this video: http://youtu.be/1BkpD1IS62g Update on 7/04: Here's CERN's press release from earlier today on the latest preliminary results in the search for the long sought Higgs particle: http://press.web.cern.ch/press/PressReleases/Releases2012/PR17.12E.htm And here's a Q&A on what the news tells us: http://cdsweb.cern.ch/journal/CERNBulletin/2012/28/News%20Articles/1459460?ln=en CERN will present the new LHC data at a seminar July 4th at 9:00 in the morning Geneva time (3:00 in the morning Eastern Daylight Time, midnight on the Pacific Coast), where the ATLAS collaboration and their rivals in the CMS experiment will announce their results. Tevatron results were announced by Fermilab on Monday morning. For more background on the LHC's search for the Higgs boson, visit http://newscenter.lbl.gov/feature-stories/2012/06/28/higgs-2012/.

Hinchliffe, Ian

2013-05-29T23:59:59.000Z

354

Photovoltaic Electrical Contact and Cell Coating Basics | Department...  

Broader source: Energy.gov (indexed) [DOE]

p-type seminconductor, and back contact. A typical solar cell consists of a glass or plastic cover, an antireflective coating, a front contact to allow electrons to enter a...

355

Oak Ridge Site Specific Advisory Board Contacts | Department...  

Office of Environmental Management (EM)

Contacts Oak Ridge Site Specific Advisory Board Contacts Mailing Address Oak Ridge Site Specific Advisory Board P.O. Box 2001, EM-91 Oak Ridge, TN 37831 Phone Numbers (865)...

356

Protein folding using contact maps Michele Vendruscolo and Eytan Domany  

E-Print Network [OSTI]

Protein folding using contact maps Michele Vendruscolo and Eytan Domany Department of Physics 26 I. INTRODUCTION Computational approaches to protein folding are divided into two main categories protein fold prediction. Contact maps are a particularly manageable representation of protein structure

Domany, Eytan

357

atomic aluminum contacts: Topics by E-print Network  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

rear-contact solar cell, we 59 LOSS ANALYSIS OF BACK-CONTACT BACK-JUNCTION THIN-FILM MONOCRYSTALLINE SILICON SOLAR CELLS Renewable Energy Websites Summary: of the...

358

ASYMPTOTIC SHAPE FOR THE CONTACT PROCESS IN RANDOM ENVIRONMENT  

E-Print Network [OSTI]

ASYMPTOTIC SHAPE FOR THE CONTACT PROCESS IN RANDOM ENVIRONMENT OLIVIER GARET AND R´EGINE MARCHAND in stationary random environment. These theorems gen- eralize known results for the classical contact process environment, when the contact process survives, the set Ht/t almost surely converges to a compact set

Paris-Sud XI, Université de

359

Ohmic contact metallization on p-type indium phosphide  

E-Print Network [OSTI]

contact resistivities comparable to those of Au-based contacts, determined by the Cox and Strack structure, can be obtained for a pure Pd contact on p-InP (hole concentration -3xlOl' cm-'). The defects can be identified to be related with phosphorus...

Park, Moonho

1993-01-01T23:59:59.000Z

360

Electrical Contacts to Molecular Layers by Nanotransfer Printing  

E-Print Network [OSTI]

Electrical Contacts to Molecular Layers by Nanotransfer Printing Yueh-Lin Loo, David V. Lang, John of electrical contact. Results show that the nTP method produces superior devices in which the electrical for making electrical contacts in molecular electronics. Organic molecules whose electronic properties can

Rogers, John A.

Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

November 21, 2000 PV Lesson Plan 2 Sample Questions & Answers  

E-Print Network [OSTI]

November 21, 2000 PV Lesson Plan 2 ­ Sample Questions & Answers Prepared for the Oregon Million Solar Roofs Coalition By Frank Vignola ­ University of Oregon Solar Radiation Monitoring Lab John Hocken your understanding: 1. The typical voltage of a silicon solar cell is about 0.5 volts; where does

Oregon, University of

362

Usability testing: some current practices and research questions  

E-Print Network [OSTI]

applications. Keywords User centered design, user testing, usability testing, empirical user test, users for which the system was design), and favors positive attitudes and responses from the intended users [131 Usability testing: some current practices and research questions J.M. Christian Bastien

Paris-Sud XI, Université de

363

Implementation Guide for Use in Addressing Unreviewed Safety Question Requirements  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

This Guide provides information to assist in the implementation and interpretation of Title 10 Code of Federal Regulations (CFR) Part 830.203, Unreviewed Safety Question Process, of the Nuclear Safety Management Rules for applicable nuclear facilities owned or operated by the Department of Energy (DOE), including the National Nuclear Security Administration (NNSA). Canceled by DOE N 251.93.

2001-10-24T23:59:59.000Z

364

Implementation Guide for Use in Addressing Unreviewed Safety Question Requirements  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

This Guide provides information to assist in implementation of Title 10 Code of Federal Regulations Part 830.203, "Unreviewed Safety Question Process," of the Nuclear Safety Management Rules for Category 1, 2, and 3 nuclear facilities owned or operated by the Department of Energy, including the National Nuclear Security Administration. Cancels DOE G 424.1-1.

2006-07-24T23:59:59.000Z

365

Questions I will answer What is a solar cell?  

E-Print Network [OSTI]

grid 4 #12;5 #12;Solar panels on the Interna9onal Space Sta9on 6 #12;Area#12;Questions I will answer · What is a solar cell? · How are solar cells are solar cells made? · How do they work? · How efficient can they be? · How

McGehee, Michael

366

Impact of Syrian Refugees on Jordan's Water Management Research Questions  

E-Print Network [OSTI]

: -Water management in Jordan -Environmental impact assessments of refugee camps -Water resourceImpact of Syrian Refugees on Jordan's Water Management Research Questions: What impact has the influx of 590,000 refugees had on water resources? How can Jordan improve refugee and water management

367

Questions and Issues on Hydrogen Pipeline Transmission of Hydrogen  

E-Print Network [OSTI]

Questions and Issues on Hydrogen Pipelines Pipeline Transmission of Hydrogen Doe Hydrogen Pipeline Working Group Meeting August 31, 2005 #12;Pipeline Transmission of Hydrogen --- 2 Copyright: Air Liquide Transmission of Hydrogen --- 3 Copyright: #12;Pipeline Transmission of Hydrogen --- 4 Copyright: 3. Special

368

Existing Analyses Our Proposal: A Typology of Questions  

E-Print Network [OSTI]

and Ramifications References Sorting Out the Implications of Questions Aviad Eilam and Catherine Lai University of Pennsylvania CONSOLE XVIII, December 17-19, 2009 Aviad Eilam and Catherine Lai Sorting Out the Implications Intervention Effects 4 Remaining Issues and Ramifications Aviad Eilam and Catherine Lai Sorting Out

Pennsylvania, University of

369

Responses to Questions and Answers Advanced Vehicle Technology Manufacturing Solicitation  

E-Print Network [OSTI]

1 Responses to Questions and Answers Advanced Vehicle Technology Manufacturing Solicitation PON successful applicants after the Notice of Proposed Awards to confirm this role and obtain any additional definition of "manufacturing equipment?" For example, would purchases of tooling or assembly line equipment

370

Questioning Inevitability of Energy Pathways: Alternative Energy Scenarios for California  

E-Print Network [OSTI]

Questioning Inevitability of Energy Pathways: Alternative Energy Scenarios for California May 21.6.4 Alternative Scenario 3 ­ Patriotic Energy Independence Section 3: Developing the Scenario Model and Examining, 2002 by Rebecca Ghanadan rebeccag@socrates.berkeley.edu The Energy and Resources Group University

Kammen, Daniel M.

371

Questions and Answers About Drainage Water Management for the Midwest  

E-Print Network [OSTI]

WQ-44 Questions and Answers About Drainage Water Management for the Midwest Jane Frankenberger Nelson, Larry Brown Drainage Water Management Introduction Subsurface tile drainage is an essential water, and modifying drainage system design and operation. Drainage water management is one of these practices

Holland, Jeffrey

372

State DOT: Colorado State Report Questions on MEPDG Implementation  

E-Print Network [OSTI]

State DOT: Colorado State Report Questions on MEPDG Implementation 1. Summarize your state's status as far as MEPDG Implementation. Currently, CDOT is in the process of validating the MEPDG in Colorado and calibrating it to Colorado performance data. 2. What efforts have been made toward local calibration? CDOT has

373

State DOT: PENNSYLVANIA State Report Questions on NDT Testing  

E-Print Network [OSTI]

capacity surveys, management of load restrictions, fatigue tests and compaction control. On concreteState DOT: PENNSYLVANIA State Report Questions on NDT Testing 1. What NDT testing methods for concrete materials, concrete pavements, and overlays are you trying? PennDOT performs Falling Weight

374

Alabama DOT: Alabama Report Questions on NDT Testing  

E-Print Network [OSTI]

Alabama DOT: Alabama Report Questions on NDT Testing 1. What NDT testing methods for concrete materials, concrete pavements, and overlays are you trying? · We perform pavement smoothness testing, pavement friction testing and FWD testing · We are currently using GPR on the I-59 project to locate voids

375

State DOT: Missouri State Report Questions on NDT Testing  

E-Print Network [OSTI]

State DOT: Missouri State Report Questions on NDT Testing 1. What NDT testing methods for concrete maturity meter MoDOT has utilized the rebound hammer to evaluate in-place concrete when cylinder testing materials, concrete pavements, and overlays are you trying? a) Maturity Method b) Rebound Hammer c) Cover

376

State DOT: California State Report Questions on NDT Testing  

E-Print Network [OSTI]

test for this purpose. For concrete pavement, California has used falling weight deflectometer (FWD locations within concrete pavement. 2. In your experience, how does the reliability of NDT testing methodsState DOT: California State Report Questions on NDT Testing 1. What NDT testing methods

377

State DOT: Louisiana State Report Questions on NDT Testing  

E-Print Network [OSTI]

State DOT: Louisiana State Report Questions on NDT Testing 1. What NDT testing methods for concrete materials, concrete pavements, and overlays are you trying? LADOTD does not test concrete pavements or overlays non-destructively. We do use the surface resistivity meter for non-destructive testing

378

Boosting Chinese Question Answering with Two Lightweight Methods  

E-Print Network [OSTI]

Question Answering (QA) research has been conducted in many languages. Nearly all the top performing-limited situations. In this article, we describe how a top- performing Chinese QA system can be designed by using, Academia Sinica, and the thematic program of Academia Sinica under Grant No. AS 95ASIA02. We wish to thank

Chu, Hao-hua

379

FOIA Frequently Asked Questions (FAQs) | Department of Energy  

Energy Savers [EERE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy UsageAUDITVehicles »Exchange Visitors Program Exchange VisitorsContacts

380

Role of chemical termination in edge contact to graphene  

SciTech Connect (OSTI)

Edge contacts to graphene can offer excellent contact properties. Role of different chemical terminations is examined by using ab initio density functional theory and quantum transport simulations. It is found that edge termination by group VI elements O and S offers considerably lower contact resistance compared to H and group VII element F. The results can be understood by significantly larger binding energy and shorter binding distance between the metal contact and these group VI elements, which results in considerably lower interface potential barrier and larger transmission. The qualitative conclusion applies to a variety of contact metal materials.

Gao, Qun; Guo, Jing, E-mail: guoj@ufl.edu [Department of Electrical and Computer Engineering, University of Florida, Gainesville, Florida 32611 (United States)

2014-05-01T23:59:59.000Z

Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

Silicon point contact concentrator solar cells  

SciTech Connect (OSTI)

Experimental results are presented for thin high resistivity concentrator silicon solar cells which use a back-side point-contact geometry. Cells of 130 and 233 micron thickness were fabricated and characterized. The thin cells were found to have efficiencies greater than 22 percent for incident solar intensities of 3 to 30 W/sq cm. Efficiency peaked at 23 percent at 11 W/sq cm measured at 22-25 C. Strategies for obtaining higher efficiencies with this solar cell design are discussed. 8 references.

Sinton, R.A.; Kwark, Y.; Swirhun, S.; Swanson, R.M.

1985-08-01T23:59:59.000Z

382

Federal NEPA Contacts | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergyENERGY TAX POLICIES ANDIndustrialEnergy Federal EfficiencyReportingNEPA Contacts Federal

383

Center for Advanced Solar Photophysics | Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to someone6Energy,MUSEUM DISPLAYCareersCathy-Ehli Sign InCenterContacts

384

Contact Information | Princeton Plasma Physics Lab  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial Validation andPWRContaCtContact

385

Contact OSUR Program | Princeton Plasma Physics Lab  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User Group andCompositionalInitial ValidationContact Information

386

Contact Us | National Nuclear Security Administration  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUs ContactLos Alamos

387

Contact Us-About-PHaSe-EFRC  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformation Administration (EIA)DonUsContact

388

Contacts for Enterprise Architecture | Department of Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformationE-Gov Contacts for E-Gov LeAnn Oliver

389

Contacts for IT Planning | Department of Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to User GroupInformationE-Gov Contacts for E-Gov LeAnn

390

NREL: Email Contact for NREL Newsroom  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas Conchas recoveryLaboratory | National Nuclearover twoPrintable Version Email Contact for NREL

391

NREL: Energy Systems Integration Facility - Contact Us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas Conchas recoveryLaboratory | National Nuclearover twoPrintableContact Us For more information

392

Geothermal Technologies Office Contacts | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of Energy Power.pdf11-161-LNG | Department of EnergyGeothermal Technologies Office Contacts Geothermal

393

ORISE: Contact Us | Worker Health Studies  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas Conchas recoveryLaboratory |CHEMPACK Mapping Application ORISECenterMaking aContact Us

394

Laboratory Equipment Donation Program - Contact Us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment Surfaces and Interfaces Sample6, 2011 LOSEngineering&Dynamos ProfessorContact Us

395

DOE Research and Development Accomplishments Contact Us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series to UserProduct: Crude OilPublicDNALostPlasma PhysicsDOE Plans2BlogContact

396

ARM - ARM Engineering and Operations Contacts  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert SouthwestTechnologies |NovemberARMContactsARM Engineering and Operations Contacts About

397

Contact CEFRC - Combustion Energy Frontier Research Center  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact In This

398

Contact Hanford Fire Department - Hanford Site  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimony |IdahoVisionContact In ThisDepartment

399

Contact Us | Argonne Leadership Computing Facility  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation InInformationCenterResearchCASLNanoporousTestimonyContact Us - Working With Us

400

Fermilab | Illinois Accelerator Research Center | Contact IARC  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest Region service area. TheEPSCI Home It isGasERPSpunphoto Fermilab atContact

Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

SciTech Connect: Contact Us  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas ConchasPassiveSubmitted for USMaterialstheterahertzon HomeScholarshipsSciDBsmartContact

402

Contact Information Systems | The Ames Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 Building 9201-1 wasFAbout UsContact

403

Contact Us | Y-12 National Security Complex  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1 BuildingContact UsNNSAContact

404

Contacts For "F" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA"

405

Contacts For "J" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA"G"

406

Contacts For "L" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA"G"K"

407

Contacts For "M" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1ContactA"G"K"M"

408

Contacts For "O" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts For "O" Shaun

409

Contacts For "P" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts For "O"

410

Contacts For "Q" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts For "O"Q"

411

Contacts For "R" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts For

412

Contacts For "V" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts ForS"

413

Contacts For "W" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts ForS"W"

414

Contacts For "Z" | EMSL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008O" Contacts ForS"W"Z"

415

Air Entrainment by Viscous Contact Lines  

E-Print Network [OSTI]

The entrainment of air by advancing contact lines is studied by plunging a solid plate into a very viscous liquid. Above a threshold velocity, we observe the formation of an extended air film, typically 10 microns thick, which subsequently decays into air bubbles. Exploring a large range of viscous liquids, we find an unexpectedly weak dependence of entrainment speed on liquid viscosity, pointing towards a crucial role of the flow inside the air film. This induces a striking asymmetry between wetting and dewetting: while the breakup of the air film strongly resembles the dewetting of a liquid film, the wetting speeds are larger by orders of magnitude.

Marchand, Antonin; Snoeijer, Jacco H; Andreotti, Bruno

2011-01-01T23:59:59.000Z

416

Method of forming contacts for a back-contact solar cell  

DOE Patents [OSTI]

Methods of forming contacts for back-contact solar cells are described. In one embodiment, a method includes forming a thin dielectric layer on a substrate, forming a polysilicon layer on the thin dielectric layer, forming and patterning a solid-state p-type dopant source on the polysilicon layer, forming an n-type dopant source layer over exposed regions of the polysilicon layer and over a plurality of regions of the solid-state p-type dopant source, and heating the substrate to provide a plurality of n-type doped polysilicon regions among a plurality of p-type doped polysilicon regions.

Manning, Jane

2013-07-23T23:59:59.000Z

417

E-Print Network 3.0 - asked questions faqs Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

directly... Frequently Asked Questions Frequently Asked Question 1.3 What is the Greenhouse Effect? The ... Source: National Oceanic and Atmospheric Administration, Pacific Marine...

418

E-Print Network 3.0 - architecture unanswered questions Sample...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

architecture unanswered questions Search Powered by Explorit Topic List Advanced Search Sample search results for: architecture unanswered questions Page: << < 1 2 3 4 5 > >> 1...

419

Assignment 3 MECH 421/6511 Solutions Question 1  

E-Print Network [OSTI]

and length = 12 ft. The extruder screw rotates at 50 rev/min; it has channel depth = 0.30 in and flight angle (given) curves with the calculated ones. Question 4: An extruder has a barrel diameter = 5.0 inch = 17.7°. The plastic melt has a shear viscosity = 100 x 10-4 lb- sec/in2 . Find: (a) the extruder

Medraj, Mamoun

420

Implementation Guide for Use in Addressing Unreviewed Safety Question Requirements  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

This Guide, including its attachments, provides information to assist in the implementation of Title 10 Code of Federal Regulations (CFR) Section 830.203, “Unreviewed Safety Question Process,” of the Nuclear Safety Management Rules for Category 1, 2, and 3 nuclear facilities owned or operated by the Department of Energy (DOE), including the National Nuclear Security Administration (NNSA). Cancels DOE G 424.1-1A. Admin Chg 1 dated 4-12-13.

2010-04-08T23:59:59.000Z

Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

Contact structure for use in catalytic distillation  

DOE Patents [OSTI]

A method is described for conducting catalytic chemical reactions and fractionation of the reaction mixture comprising feeding reactants into a distillation column reactor, contracting said reactant in liquid phase with a fixed bed catalyst in the form of a contact catalyst structure consisting of closed porous containers containing the catalyst for the reaction and a clip means to hold and support said containers, which are disposed above, i.e., on the distillation trays in the tower. The trays have weir means to provide a liquid level on the trays to substantially cover the containers. In other words, the trays function in their ordinary manner with the addition thereto of the catalyst. The reaction mixture is concurrently fractionated in the column. 7 figs.

Jones, E.M. Jr.

1984-03-27T23:59:59.000Z

422

Contact structure for use in catalytic distillation  

DOE Patents [OSTI]

A method and apparatus are disclosed for conducting catalytic chemical reactions and fractionation of the reaction mixture, comprising and feeding reactants into a distillation column reactor contracting said reactant in a liquid phase with a fixed bed catalyst in the form of a contact catalyst structure, consisting of closed porous containers containing the catalyst for the reaction and a clip means to hold and support said containers, which are disposed above, i.e., on the distillation trays in the tower. The trays have weir means to provide a liquid level on the trays to substantially cover the containers. In other words, the trays function in their ordinary manner with the addition thereto of the catalyst. The reaction mixture is concurrently fractionated in the column. 7 figs.

Jones, E.M. Jr.

1985-08-20T23:59:59.000Z

423

Contact structure for use in catalytic distillation  

DOE Patents [OSTI]

A method for conducting catalytic chemical reactions and fractionation of the reaction mixture comprising feeding reactants into a distillation column reactor contracting said reactant in liquid phase with a fixed bed catalyst in the form of a contact catalyst structure consisting of closed porous containers containing the catatlyst for the reaction and a clip means to hold and support said containers, which are disposed above, i.e., on the distillation trays in the tower. The trays have weir means to provide a liquid level on the trays to substantially cover the containers. In other words, the trays function in their ordinary manner with the addition thereto of the catalyst. The reaction mixture is concurrently fractionated in the column.

Jones, Jr., Edward M. (Friendswood, TX)

1984-01-01T23:59:59.000Z

424

Contact structure for use in catalytic distillation  

DOE Patents [OSTI]

A method and apparatus for conducting catalytic chemical reactions and fractionation of the reaction mixture, comprising and feeding reactants into a distillation column reactor contracting said reactant in a liquid phase with a fixed bed catalyst in the form of a contact catalyst structure, consisting of closed porous containers containing the catalyst for the reaction and a clip means to hold and support said containers, which are disposed above, i.e., on the distillation trays in the tower. The trays have weir means to provide a liquid level on the trays to substantially cover the containers. In other words, the trays function in their ordinary manner with the addition thereto of the catalyst. The reaction mixture is concurrently fractionated in the column.

Jones, Jr., Edward M. (Friendswood, TX)

1985-01-01T23:59:59.000Z

425

Index to the monthly hotline report questions (June 1982 to December 1991)  

SciTech Connect (OSTI)

The document provides four indices to the question and answer sections of the RCRA/Superfund/Oust Monthly Hotline Reports from June 1982 through December 1991. The first index is an alphabetical listing of question titles by year and month. The second index organizes the questions by regulatory citation, beginning with 40 CFR 257. The third index organizes the questions by statuatory citation. Finally, the fourth index references the questions by key word or subject heading.

Not Available

1992-12-01T23:59:59.000Z

426

The contact of elastic regular wavy surfaces revisited  

E-Print Network [OSTI]

We revisit the classic problem of an elastic solid with a two-dimensional wavy surface squeezed against an elastic flat half-space from infinitesimal to full contact. Through extensive numerical calculations and analytic derivations, we discover previously overlooked transition regimes. These are seen in particular in the evolution with applied load of the contact area and perimeter, the mean pressure and the probability density of contact pressure. These transitions are correlated with the contact area shape, which is affected by long range elastic interactions. Our analysis has implications for general random rough surfaces, as similar local transitions occur continuously at detached areas or coalescing contact zones. We show that the probability density of null contact pressures is non-zero at full contact. This might suggest revisiting the conditions necessary for applying Persson's model at partial contacts and guide the comparisons with numerical simulations. We also address the evaluation of the contact perimeter for discrete geometries and the applicability of Westergaard's solution for three-dimensional geometries.

Vladislav A. Yastrebov; Guillaume Anciaux Jean-Francois Molinari

2014-09-05T23:59:59.000Z

427

Nanoscale contact engineering for Si/Silicide nanowire devices.  

E-Print Network [OSTI]

??Metal silicides have been used in silicon technology as contacts to achieve high device performance and desired device functions. The growth and applications of silicide… (more)

Lin, Yung-Chen

2012-01-01T23:59:59.000Z

428

Contacts for the Assistant General Counsel for Legislation, Regulation...  

Energy Savers [EERE]

Legislation, Regulation, and Energy Efficiency Contacts for the Assistant General Counsel for Legislation, Regulation, and Energy Efficiency Office of the Assistant General Counsel...

429

Contacts for the Assistant General Counsel for Technology Transfer...  

Broader source: Energy.gov (indexed) [DOE]

Technology Transfer and Procurement Contacts for the Assistant General Counsel for Technology Transfer and Procurement Subject MatterFunctional Area Lead Backup Technology...

430

Registered_Lobbyist_Contact_Disclosure_Form.pdf | Department...  

Broader source: Energy.gov (indexed) [DOE]

egisteredLobbyistContactDisclosureForm.pdf More Documents & Publications Lobbyist Disclosure Form - AltEn Interested Parties - Shipp Interested Parties - Smith Dawson & Andrews...

431

Ohmic contacts for high-temperature GaP devices  

E-Print Network [OSTI]

REMOVAL 10 13 24 24 26 50 50 52 78 80 83 98 98 99 100 TABLE OF CONTENTS (Continued) APPENDIX D ? 6 LIFT-OFF PREMETAL PREPARATION APPENDIX D ? 7 METAL LIFTOFF Page 100 100 vi LIST OP TABLES Table I Relative High Temperature... with a variety of III-V compound semi- conductors and contact metals. By using a ruby or a COe laser with Au-Sn or Ag-Sn contact metals, specific contact resistances as low as 8. 6 x 19 " 0-cm were reported. (The specific contact resistance...

Van der Hoeven, Willem Bernard

2012-06-07T23:59:59.000Z

432

Implementation Guide for Use in Addressing Unreviewed Safety Question Requirements  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

This Guide, including its attachments, provides information to assist in the implementation of Title 10 Code of Federal Regulations (CFR) Section 830.203, “Unreviewed Safety Question Process,” of the Nuclear Safety Management Rules for Category 1, 2, and 3 nuclear facilities owned or operated by the Department of Energy (DOE), including the National Nuclear Security Administration (NNSA). Cancels DOE G 424.1-1A. Admin Chg 1 dated 4-12-13. Admin Chg 2, dated 6-12-13, cancels DOE G 424.1-1B Admin Chg 1.

2010-04-08T23:59:59.000Z

433

Unreviewed Disposal Question Evaluation: Waste Disposal In Engineered Trench #3  

SciTech Connect (OSTI)

Because Engineered Trench #3 (ET#3) will be placed in the location previously designated for Slit Trench #12 (ST#12), Solid Waste Management (SWM) requested that the Savannah River National Laboratory (SRNL) determine if the ST#12 limits could be employed as surrogate disposal limits for ET#3 operations. SRNL documented in this Unreviewed Disposal Question Evaluation (UDQE) that the use of ST#12 limits as surrogates for the new ET#3 disposal unit will provide reasonable assurance that Department of Energy (DOE) 435.1 performance objectives and measures (USDOE, 1999) will be protected. Therefore new ET#3 inventory limits as determined by a Special Analysis (SA) are not required.

Hamm, L. L.; Smith, F. G. III; Flach, G. P.; Hiergesell, R. A.; Butcher, B. T.

2013-07-29T23:59:59.000Z

434

Research questions reality of 'supersolid' in helium-4  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas ConchasPassive Solar HomePromisingStories »Submitter A B C D E F G H IResearch questions

435

5 Questions for a Scientist: Materials Engineer David Forrest | Department  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South Valley ResponsibleSubmissionof Energy 5 Questions for a Scientist:

436

Fermilab Office of General Counsel - Ethics Program - Submit a Question  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsing ZirconiaPolicyFeasibility ofSmall Works: 2008Submit a Question Ask the Ethicist

437

Question about Map of Wind Farms | OpenEI Community  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 No revisionEnvReviewNonInvasiveExploration JumpSanyalTempWellheadWahkiakum CountyPzero JumpQuestion about Map of Wind

438

Questions about OpenEI? | OpenEI Community  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 No revisionEnvReviewNonInvasiveExploration JumpSanyalTempWellheadWahkiakum CountyPzero JumpQuestion about Map of

439

Questions Asked during the Financing Residential Energy Efficiency with  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion | Department ofT ib l L dDepartment ofList? | Department of Energy Question of thein

440

Questions and Answers about National Environmental Policy Act (NEPA) Compliance  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion | Department ofT ib l L dDepartment ofList? | Department of Energy Question of theinabout

Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

Fermilab | Science | Questions for the Universe | Einstein's Dream of  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series toESnet4:Epitaxialtransatlantic networkHomelandWorkforceQuestions

442

Fermilab | Science | Particle Physics 101 | Questions for the Universe  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest Region service area. TheEPSCI Home ItDark EnergyFermilab'sParticleQuestions

443

Microsoft Word - Amendment 000002 - Question & Answers.docx  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment Surfaces andMappingENVIRONMENTAL IMPACT STATEMENTbelow).A3PM-10978, Alcoa 1Question:

444

A Drucker-Prager model for elastic contact with friction; A Drucker-Prager model for elastic contact with friction.  

E-Print Network [OSTI]

?? In mumerical contact simulations with friction, the simple Coloumb law is usually employed. Standard plasticity models are difficult to use since the balance enforced… (more)

wu, yunxian

2011-01-01T23:59:59.000Z

445

Contact Information: Jeff Williams, MLIS phone (858) 822-2218  

E-Print Network [OSTI]

Contact Information: Jeff Williams, MLIS phone (858) 822-2218 Biology Librarian fax (858) 822-2219 UCSD Biomedical Library j12williams@ucsd.edu Life Sciences Newsletter UCSD Biomedical Library Fall 2004 contact me at (858) 822-2218 or j12williams@ucsd.edu Top Biology Resources ­ http

California at San Diego, University of

446

RELATIVISTIC HEAVY-ION PHYSICS WITHOUT NUCLEAR CONTACT  

E-Print Network [OSTI]

RELATIVISTIC HEAVY-ION PHYSICS WITHOUT NUCLEAR CONTACT The large electromagnetic field generated physics research--for example, for investigating nuclear structure, hadronic structure, atomic physics Berkeley Laboratory--it became clear that heavy-ion physics without nuclear contact could be very useful

Bertulani, Carlos A. - Department of Physics and Astronomy, Texas A&M University

447

Contact Information: Sophia Radlowski, Assistant to the Director for Budgeting  

E-Print Network [OSTI]

Contact Information: Sophia Radlowski, Assistant to the Director for Budgeting Contact regarding will be mailed to you by Sophia Radlowski. 1. Read the offer letter carefully. If you agree to the terms, please form, original drug-free workplace statement, and copy of IDs listed above to: Sophia Radlowski UIC

Illinois at Chicago, University of

448

Energy-efficient Contact Probing in Opportunistic Mobile Networks  

E-Print Network [OSTI]

a trade-off between energy efficiency and the contact opportunities in OppNets. In this paper, in order proposed model. Finally, based on the proposed model, we analyze the trade- off between energy efficiency to a trade-off between energy efficiency and contact opportunities. For strategies which use a constant

Wu, Jie

449

Making Contact: Getting the Group Communicating with Groupware  

E-Print Network [OSTI]

is that people must be in contact with one another. Relationships must be established, and many interactions that overcomes distance barriers is available. Many mundane factors interfere with making contact. People must, people must find each other with minimal effort. People must also select one or more of the many

Greenberg, Saul

450

Air Entrainment by Viscous Contact Lines Antonin Marchand1  

E-Print Network [OSTI]

Air Entrainment by Viscous Contact Lines Antonin Marchand1 , Tak Shing Chan2 , Jacco H. Snoeijer2) The entrainment of air by advancing contact lines is studied by plunging a solid plate into a very viscous liquid by orders of magnitude. Objects that impact on a liquid interface can entrain small bubbles of air

451

Please answer all of the following questions: 1. Have you ever had close contact with persons known or suspected to have active TB? o Yes o No  

E-Print Network [OSTI]

Seychelles Sierra Leone Singapore Solomon Islands Somalia South Africa Sri Lanka Sudan Suriname Swaziland

Rhode Island, University of

452

ESG: Extended Similarity Group method for protein function prediction For any questions regarding ESG contact the administration at info@kiharalab.org  

E-Print Network [OSTI]

box titled "Enter Query Sequence(s)". Consider the following sequence that you can enter. >sp|P56851 KDKSSHMFIYISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSF NYIEFHCSMDGYVDSIEDLKMVEPIGN You can also click on "Load Sample" link to load this sequence in the text box and follow the next steps. Clicking on "Clear" link will clear the text box for sequence

Kihara, Daisuke

453

Document Number: 81308 For technical questions, contact: detectortechsupport@vishay.com www.vishay.com Rev. 1.4, 26-Mar-09 1  

E-Print Network [OSTI]

ambient light sensor is a PIN photodiode with high speed and high photo sensitivity in a clear, surface.vishay.com Rev. 1.4, 26-Mar-09 1 Ambient Light Sensor TEMD6010FX01 Vishay Semiconductors DESCRIPTION TEMD6010FX01.27 · AEC-Q101 qualified · High photo sensitivity · Adapted to human eye responsivity · Supression filter

454

Revision Date: 6/30/2014 For Questions Contact: CAHNRS.grants@wsu.edu Page 1 Grant Proposal and Award Office  

E-Print Network [OSTI]

Whitman County Spokane State Legislative District WA009 State Legislative District WA005 WSU Tri WSU Pullman WSU Spokane Congressional District WA005 Congressional District WA005 CountyCities WSU Vancouver Congressional District WA004 Congressional District WA003 County Benton County

Collins, Gary S.

455

Please contact Lilith Wyatt at lilith.wyatt@mcgill.ca with any questions or concerns. Last reviewed: December 7, 2011 Sustainability Projects Fund  

E-Print Network [OSTI]

Projects must align with the mission of the Sustainability Projects Fund: to build a culture: December 7, 2011 Sustainability Projects Fund Application Criteria ELIGIBILITY Projects must: Contribute to the advancement of sustainability at McGill, from a life-cycle perspective Primarily impact the McGill campus

Shoubridge, Eric

456

If you have any questions or comments, please contact Siena College, ITS Helpdesk at (518)786-5000, or email helpdesk@siena.edu Page 1 of 2  

E-Print Network [OSTI]

)786-5000, or email helpdesk@siena.edu Page 1 of 2 Setting up WebAssign Academic Technology - Siena College WebAssign is a Building Block -- a connection from Blackboard to the WebAssign website. When you use it, you connect to the WebAssign site to use its features. It allows access to WebAssign without a separate login. Creating

457

Direct Loan Servicing Centers for Students [includes PUT loans] For questions about loan repayment or other loan servicing issues, a borrower can contact his or her loan  

E-Print Network [OSTI]

Servicing Center Phone: 800/848-0979 TDD/TTY: 800/848-0983 Overseas: 315/738-6634 Web site: www New York State TDD/TTY: 800/855-2880 outside New York State Web site: www.ed-servicing.com FedLoan Servicing (PHEAA) Phone: 800/699-2908 TDD/TTY: 800/722-8189 Overseas borrowers: 717-720-1985 Web site: www

Grishok, Alla

458

Questions? Contact polygrad@asu.edu or 480.727.4723 innovation.asu.edu Ira A. Fulton Schools of Engineering, The Polytechnic School  

E-Print Network [OSTI]

Energy Technology (3) EST 565 Statistical Process Control (3) MET 598 Alternative Energy Sources (3) ALT) ALT 598 Electrochemical Energy Technology (3) EET 506 Systems Dynamics and Control (3) EET 530

459

Technical Specifications and Usage Procedures and Policies Contact Technical Director Peter Davis at 912.478.7916 with questions regarding technical  

E-Print Network [OSTI]

information is to be arranged through the House Manager. Programs must include FOH information sheet. Reminder: The Performing Arts Center is not liable for loss of or damage to personal property. STAGE DIMENSIONS Proscenium instructions and leave the building as quickly as possible. The Production Manager or Stage Manager is to take

Hutcheon, James M.

460

Neutron irradiation effects on metal-gallium nitride contacts  

SciTech Connect (OSTI)

We have measured the effect of fast and thermal neutrons on GaN Schottky barriers and ohmic contacts using current–voltage and transmission line method electrical techniques, optical, atomic force and scanning electron microscopy morphological techniques, and X-ray photoemission spectroscopy chemical techniques. These studies reveal a 10{sup 15}?n/cm{sup 2} neutron threshold for Schottky barrier ideality factor increases, a 10{sup 15}?n/cm{sup 2} fast plus thermal neutron threshold for ohmic contact sheet and contact resistance increases, and 10{sup 16}?n/cm{sup 2} neutron fluence threshold for major device degradation identified with thermally driven diffusion of Ga and N into the metal contacts and surface phase changes. These results demonstrate the need for protecting metal-GaN contacts in device applications subject to neutron radiation.

Katz, Evan J.; Lin, Chung-Han; Zhang, Zhichun [Department of Electrical and Computer Engineering, The Ohio State University, Columbus, Ohio 43210 (United States); Qiu, Jie; Cao, Lei [Nuclear Engineering Program, Department of Mechanical and Aerospace Engineering, The Ohio State University, Columbus, Ohio 43210 (United States); Mishra, Umesh K. [Departments of Electrical and Computer Engineering and Materials Science and Engineering University of California, Santa Barbara, California 93106 (United States); Brillson, Leonard J., E-mail: brillson.1@osu.edu [Department of Electrical and Computer Engineering, The Ohio State University, Columbus, Ohio 43210 (United States); Department of Physics and Center for Materials Research, The Ohio State University, Columbus, Ohio 43210 (United States)

2014-03-28T23:59:59.000Z

Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

Generalized nuclear contacts and the nucleon's momentum distributions  

E-Print Network [OSTI]

The general nuclear contact matrices are defined, taking into consideration all partial waves and finite-range interactions, extending Tan's work for the zero range model. The properties of these matrices are discussed and the relations between the contacts and the one-nucleon and two-nucleon momentum distributions are derived. Using these relations, a new asymptotic connection between the one-nucleon and two-nucleon momentum distributions, describing the two-body short-range correlations in nuclei, is obtained. Using available numerical data, we extract few connections between the different contacts and verify their relations to the momentum distributions. The numerical data also allows us to identify the main nucleon momentum range affected by two-body short-range correlations. Utilizing these relations and the numerical data, we also verify a previous independent prediction connecting between the Levinger constant and the contacts. This work provides an important indication for the relevance of the contact...

Weiss, Ronen; Barnea, Nir

2015-01-01T23:59:59.000Z

462

Method and apparatus for high-efficiency direct contact condensation  

DOE Patents [OSTI]

A direct contact condenser having a downward vapor flow chamber and an upward vapor flow chamber, wherein each of the vapor flow chambers includes a plurality of cooling liquid supplying pipes and a vapor-liquid contact medium disposed thereunder to facilitate contact and direct heat exchange between the vapor and cooling liquid. The contact medium includes a plurality of sheets arranged to form vertical interleaved channels or passageways for the vapor and cooling liquid streams. The upward vapor flow chamber also includes a second set of cooling liquid supplying pipes disposed beneath the vapor-liquid contact medium which operate intermittently in response to a pressure differential within the upward vapor flow chamber. The condenser further includes separate wells for collecting condensate and cooling liquid from each of the vapor flow chambers. In alternate embodiments, the condenser includes a cross-current flow chamber and an upward flow chamber, a plurality of upward flow chambers, or a single upward flow chamber. The method of use of the direct contact condenser of this invention includes passing a vapor stream sequentially through the downward and upward vapor flow chambers, where the vapor is condensed as a result of heat exchange with the cooling liquid in the contact medium. The concentration of noncondensable gases in the resulting condensate-liquid mixtures can be minimized by controlling the partial pressure of the vapor, which depends in part upon the geometry of the vapor-liquid contact medium. In another aspect of this invention, the physical and chemical performance of a direct contact condenser can be predicted based on the vapor and coolant compositions, the condensation conditions, and the geometric properties of the contact medium. 39 figs.

Bharathan, D.; Parent, Y.; Hassani, A.V.

1999-07-20T23:59:59.000Z

463

Method and apparatus for high-efficiency direct contact condensation  

DOE Patents [OSTI]

A direct contact condenser having a downward vapor flow chamber and an upward vapor flow chamber, wherein each of the vapor flow chambers includes a plurality of cooling liquid supplying pipes and a vapor-liquid contact medium disposed thereunder to facilitate contact and direct heat exchange between the vapor and cooling liquid. The contact medium includes a plurality of sheets arranged to form vertical interleaved channels or passageways for the vapor and cooling liquid streams. The upward vapor flow chamber also includes a second set of cooling liquid supplying pipes disposed beneath the vapor-liquid contact medium which operate intermittently in response to a pressure differential within the upward vapor flow chamber. The condenser further includes separate wells for collecting condensate and cooling liquid from each of the vapor flow chambers. In alternate embodiments, the condenser includes a cross-current flow chamber and an upward flow chamber, a plurality of upward flow chambers, or a single upward flow chamber. The method of use of the direct contact condenser of this invention includes passing a vapor stream sequentially through the downward and upward vapor flow chambers, where the vapor is condensed as a result of heat exchange with the cooling liquid in the contact medium. The concentration of noncondensable gases in the resulting condensate-liquid mixtures can be minimized by controlling the partial pressure of the vapor, which depends in part upon the geometry of the vapor-liquid contact medium. In another aspect of this invention, the physical and chemical performance of a direct contact condenser can be predicted based on the vapor and coolant compositions, the condensation conditions. and the geometric properties of the contact medium.

Bharathan, Desikan (Lakewood, CO); Parent, Yves (Golden, CO); Hassani, A. Vahab (Golden, CO)

1999-01-01T23:59:59.000Z

464

Analysis of a-Si:H/TCO contact resistance for the Si heterojunction back-contact solar cell  

E-Print Network [OSTI]

Analysis of a-Si:H/TCO contact resistance for the Si heterojunction back-contact solar cell Seung- circuit voltage (Voc) and the conversion efficiency of the Si solar cell. Recently, a-Si:H heterojunction (heterojunction with intrinsic thin layer) cell [1] even with practical-sized Czochralski-grown (CZ) wafer. The a-Si:H

Park, Byungwoo

465

Contact Resistance for "End-Contacted" Metal-Graphene and Metal-Nanotube Interfaces from Quantum Mechanics  

E-Print Network [OSTI]

ballistic conductance,12-14 and high thermal conductivity.15 Indeed, significant progress has been made layer graphene has been demonstrated to exhibit high electron mobility (15 000 cm2 /(V s)) and thermalContact Resistance for "End-Contacted" Metal-Graphene and Metal-Nanotube Interfaces from Quantum

Goddard III, William A.

466

Method of forming contacts for a back-contact solar cell  

DOE Patents [OSTI]

Methods of forming contacts for solar cells are described. In one embodiment, a method includes forming a silicon layer above a substrate, forming and patterning a solid-state p-type dopant source on the silicon layer, forming an n-type dopant source layer over exposed regions of the silicon layer and over a plurality of regions of the solid-state p-type dopant source, and heating the substrate to provide a plurality of n-type doped silicon regions among a plurality of p-type doped silicon regions.

Manning, Jane

2014-07-15T23:59:59.000Z

467

5 Questions about the SunShot Prize for Minh Le - Solar Program...  

Office of Environmental Management (EM)

5 Questions about the SunShot Prize for Minh Le - Solar Program Manager at the U.S. Energy Department 5 Questions about the SunShot Prize for Minh Le - Solar Program Manager at the...

468

H.D. Cochran, Questions for the Workshop | U.S. DOE Office of...  

Office of Science (SC) Website

DeSoto Hilton, Savannah, Georgia May 12-14, 1999 Questions for the Workshop H. D. Cochran Oak Ridge National Laboratory Dr. Cochran took the approach of asking questions of the...

469

Frequently Asked Questions | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

Asked Questions Print Text Size: A A A FeedbackShare Page The U.S. Department of EnergyNational Nuclear Security Administration frequently fields questions about the...

470

Question of the Week: Do You Use Renewable Energy in Your Home...  

Broader source: Energy.gov (indexed) [DOE]

Energy-Saving Improvements are on Your To-Do List? Question of the Week: How Will You Landscape for Energy Efficiency? Question of the Week: Are You Considering an Energy-Related...

471

Question of the Week: How Do You Reduce the Energy Used by Computers...  

Broader source: Energy.gov (indexed) [DOE]

Question of the Week: How Do You Reduce the Energy Used by Computers and Office Electronics? Question of the Week: How Do You Reduce the Energy Used by Computers and Office...

472

Using JavaScript to simulate formative assessment questioning in web-based open learning materials   

E-Print Network [OSTI]

This paper provides the JavaScript code for asking questions in web-based learning materials. The paper situates the setting of formative assessment exercises and questioning in the tradition of open learning materials design. Re-usable examples...

Bowerman, Chris; Mansfield, Charlie; Sewell, Keith

1997-12-19T23:59:59.000Z

473

Question of the Week: What are Your Strategies for Saving Money...  

Energy Savers [EERE]

Question of the Week: What are Your Strategies for Saving Money and Energy in the Winter? Question of the Week: What are Your Strategies for Saving Money and Energy in the Winter?...

474

From the Mailbag: Questions and Comments on the New Energy.gov  

Broader source: Energy.gov [DOE]

You asked, we answered! Check out some frequently asked questions on the new and improved Energy.gov.

475

Mechanical contact by constraints and split-based preconditioning  

SciTech Connect (OSTI)

An accurate implementation of glued mechanical contact was developed in MOOSE based on its Constraint system. This approach results in a superior convergence of elastic structure problems, in particular in BISON. Adaptation of this technique to frictionless and frictional contact models is under way. Additionally, the improved convergence of elastic problems results from the application of the split-based preconditioners to constraint-based systems. This yields a substantial increase in the robustness of elastic solvers when the number of nodes in contact is increased and/or the mesh is refined.

Dmitry Karpeyev; Derek Gaston; Jason Hales; Steven Novascone

2014-03-01T23:59:59.000Z

476

The hierarchical properties of contact networks in granular packings  

E-Print Network [OSTI]

The topological structure resulting from the network of contacts between grains (contact network) is studied for very large samples of disorderly-packed monosized spheres with densities ranging from 0.58 to 0.64. The hierarchical organization of such a structure is studied by means of a topological map which starts from a given sphere and moves outwards in concentric shells through the contact network. We find that the topological density of disordered sphere packing is larger than the topological density of equivalent lattice sphere packings.

T. Aste; T. J. Senden

2005-04-14T23:59:59.000Z

477

Contacts - Madison Dynamo Experiment - Cary Forest Group - UW Plasma  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation Proposed New SubstationCleanCommunity2Workshops 2008 To1Contact CommunityContactContacts

478

ES2A7 -Fluid Mechanics Example Classes Model Answers to Example Questions (Set III)  

E-Print Network [OSTI]

ES2A7 - Fluid Mechanics Example Classes Model Answers to Example Questions (Set III) Question 1 10610 40031.8 -- Ã?=Ã?= Ã? Ã? == APN RT d Question 2: Type of Fluid #12;Consider 2 identical vertical tubes are filled with the same height of fluid: A Newtonian fluid is used with tube X whereas a non-Newtonian fluid

Thomas, Peter J.

479

ES2A7 -Fluid Mechanics Example Classes Example Questions (Set III)  

E-Print Network [OSTI]

ES2A7 - Fluid Mechanics Example Classes Example Questions (Set III) Question 1: Distance between.mol- = - Perfect Gas constant: 1 1 R 8.31J.K .mol- - = Question 2: Type of Fluid Consider 2 identical vertical are filled with the same height of fluid: A Newtonian fluid is used with tube X whereas a non-Newtonian fluid

Thomas, Peter J.

480

Some issues in dialogue-based question-answering Arne Jnsson & Magnus Merkel  

E-Print Network [OSTI]

questions, but the Q&A approach has yet not reached the level of sophistication for handling connected. The challenge is to combine the IE techniques and some of the features of Q&A approaches with dialogue systems programs on TV, can ask questions related to the TV program, in this case questions on Nordic birds

Merkel, Magnus

Note: This page contains sample records for the topic "questions contact wdts" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

Awakening Seed Pond Water ChemistryAwakening Seed Pond Water Chemistry Our Question: Is our pond polluted?Our Question: Is our pond polluted?  

E-Print Network [OSTI]

Awakening Seed Pond Water ChemistryAwakening Seed Pond Water Chemistry Our Question: Is our pond polluted?Our Question: Is our pond polluted? Our InvestigationOur Investigation We discussed what kinds of pollutants we should look for. We narrowed down the aspects of pond chemistry that we would investigate

Hall, Sharon J.

482

Bell_Colloquium (4412)_student questions JB.pdf Student questions: Jim Bell colloquium on "Red Rover(s), Red Rover(s): Update on Mars  

E-Print Network [OSTI]

to their solar panels (and the dust that eventually built up on them), but seeing as how MSL is nuclear powered collect any samples of these, if this hasn't already been done? 8) Question 2: What is the difference between a Mars year and an Earth year? 9) Question 1: Which type of properties do you look for in rocks

Elser, Jim

483

Transporting radioactive materials: Q & A to your questions  

SciTech Connect (OSTI)

Over 2 million packages of radioactive materials are shipped each year in the United States. These shipments are carried by trucks, trains, ships, and airplanes every day just like other commodities. Compliance with Federal regulations ensures that radioactive materials are transported safely. Proper packaging is the key to safe shipment. Package designs for radioactive materials must protect the public and the environment even in case of an accident. As the level of radioactivity increases, packaging design requirements become more stringent. Radioactive materials have been shipped in this country for more than 40 years. As with other commodities, vehicles carrying these materials have been involved in accidents. However, no deaths or serious injuries have resulted from exposure to the radioactive contents of these shipments. People are concerned about how radioactive shipments might affect them and the environment. This booklet briefly answers some of the commonly asked questions about the transport of radioactive materials. More detailed information is available from the sources listed at the end of this booklet.

Not Available

1993-04-01T23:59:59.000Z

484

Braking index of isolated pulsars: open questions and ways forward  

E-Print Network [OSTI]

Isolated pulsars are rotating neutron stars with accurately measured angular velocities $\\Omega$, and their time derivatives which show unambiguously that the pulsars are slowing down. Although the exact mechanism of the spin-down is a question of debate, the commonly accepted view is that it arises either through emission of magnetic dipole radiation (MDR) from a rotating magnetized body, through emission of a relativistic particle wind, or via higher order magnetic multipole or gravitational quadrupole radiation. The calculated energy loss by a rotating pulsar is model dependent and leads to the power law $\\dot{\\Omega}$ = -K $\\Omega^{\\rm n}$ where $n$ is called the braking index. The theoretical value for braking index is $n = 1, 3, 5$ for wind, MDR, quadrupole radiation respectively. The accepted view is that pulsar braking is strongly dominated by MDR. Highly precise observations of isolated pulsars yield braking index values in the range $1 < n < 2.8$ which are consistently less than the value pred...

Hamil, Oliver

2015-01-01T23:59:59.000Z

485

Contact Information: Jeff Williams, MLIS phone (858) 822-2218  

E-Print Network [OSTI]

Contact Information: Jeff Williams, MLIS phone (858) 822-2218 Biology Librarian fax (858) 822-2219 UCSD Biomedical Library j12williams@ucsd.edu Life Sciences Newsletter UCSD Biomedical Library Spring

California at San Diego, University of

486

Extrapolating Sparse Large-Scale GPS Traces for Contact Evaluation  

E-Print Network [OSTI]

, such as access points and cell towers, and occasionally also their geo- graphic location. However, given the larger transmission ranges of network elements, whether a short-range contact could take place can only

Ott, Jörg

487

Optics, mask and resist implications on contact CDU  

SciTech Connect (OSTI)

Mask and condenser roughness plays important in contact CDU. Resist blur drives both dose requirements and mask specs. Correlation methods can be used to measure mask contributions to CDU.

Naulleau, Patrick

2010-06-01T23:59:59.000Z

488

Influence of surface roughness and waviness upon thermal contact resistance  

E-Print Network [OSTI]

This work deals with the phenomenon of thermal resistance between contacting solids. Attention is directed towards contiguous solids possessing both surface roughness and waviness. When two such surfaces are brought together ...

Yovanovich, M. Michael

1967-01-01T23:59:59.000Z

489

Images in Emergency Medicine: Irritant Contact Dermatitis from Jet Fuel  

E-Print Network [OSTI]

and penetration of JP-8 jet fuel and its components. Toxicoland other kerosene-based fuels have been shown to cause skinContact Dermatitis from Jet Fuel Christopher C. Trigger, MD

Trigger, Christopher C; Eilbert, Wesley

2009-01-01T23:59:59.000Z

490

Dynamics of clusters and molecules in contact with an environment  

E-Print Network [OSTI]

(embedded, deposited) Fundamental studies on mechanisms (irradiation, deposition) (Nano) Contacts with insulators (ionic crystals, rare gases...) Low energy dynamics (optical response, deposition) Laser irradiation #12;Time Dependent Density Functional Theory (TDDFT) Ensemble of orbitals (1 electron

Giraud, Olivier

491

Impedance Control of a Pneumatic Actuator for Contact Tasks  

E-Print Network [OSTI]

of a pneumatic system is that of compliant actuation. By virtue of the compressibility of air, a pneumatic and stable force control, less damage during inadvertent contact, and the potential for energy storage." [1

Barth, Eric J.

492

Centralized processing of contact-handled TRU waste feasibility analysis  

SciTech Connect (OSTI)

This report presents work for the feasibility study of central processing of contact-handled TRU waste. Discussion of scenarios, transportation options, summary of cost estimates, and institutional issues are a few of the subjects discussed. (JDL)

Not Available

1986-12-01T23:59:59.000Z

493

Hearing Material 1 Perception of Material from Contact Sounds  

E-Print Network [OSTI]

of simulated enviroments. This circumstance is unfortunate, when one considers that sounds provide important, the force of impact, and the location of contact relative to object geometry. In this paper we concentrate

Pai, Dinesh

494

Measurement of normal contact stiffness of fractal rough surfaces  

E-Print Network [OSTI]

We investigate the effects of roughness and fractality on the normal contact stiffness of rough surfaces. Samples of isotropically roughened aluminium surfaces are considered. The roughness and fractal dimension were altered through blasting using different sized particles. Subsequently, surface mechanical attrition treatment (SMAT) was applied to the surfaces in order to modify the surface at the microscale. The surface topology was characterised by interferometry based profilometry. The normal contact stiffness was measured through nanoindentation with a flat tip utilising the partial unloading method. We focus on establishing the relationships between surface stiffness and roughness, combined with the effects of fractal dimension. The experimental results, for a wide range of surfaces, showed that the measured contact stiffness depended very closely on surfaces' root mean squared (RMS) slope and their fractal dimension, with correlation coefficients of around 90\\%, whilst a relatively weak correlation coefficient of 57\\% was found between the contact stiffness and RMS roughness.

Chongpu Zhai; Sébastien Bevand; Yixiang Gan; Dorian Hanaor; Gwénaëlle Proust; Bruno Guelorget; Delphine Retraint

2014-09-03T23:59:59.000Z

495

2014 EMPLOYEE BENEFIT INSURANCE PLAN CONTACTS Health Insurance  

E-Print Network [OSTI]

2014 EMPLOYEE BENEFIT INSURANCE PLAN CONTACTS Health Insurance Anthem Blue Cross and Blue Shield www.anthem.com Ã? BlueAdvantage Point of Service Plan (HMO/POS) Ã? PRIME Health Plan (PPO) and Custom Plus Health Plan Phone

496

Graded Materials for Resistance to Contact Deformation and Damage  

E-Print Network [OSTI]

Graded Materials for Resistance to Contact Deformation and Damage S. Suresh The mechanical response as diverse as tribology, geology, optoelectronics, biomechanics, fracture mechanics, and nanotechnology changes in the elastic properties of sands, soils, and rocks beneath Earth's surface in- fluence

Suresh, Subra

497

aluminum alloyed contacts: Topics by E-print Network  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Modarres Razavi, Sonia 2012-02-14 116 LOSS ANALYSIS OF BACK-CONTACT BACK-JUNCTION THIN-FILM MONOCRYSTALLINE SILICON SOLAR CELLS Renewable Energy Websites Summary: of the...

498

Au-free Ohmic Contacts to Gallium Nitride and Graphene  

E-Print Network [OSTI]

This work deals with Au-free contact metallization schemes for gallium nitride (GaN) and graphene semiconductors. Graphene and gallium nitride are promising materials that can potentially be integrated together in the near future for high frequency...

Ravikirthi, Pradhyumna

2014-08-10T23:59:59.000Z

499

Multifrequency Imaging in the Intermittent Contact Mode of Atomic...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

of the intermittent-contact (IC) 1-4 and noncontact (NC) 5 modes of atomic force micro- scopy (AFM) has opened a pathway towards high-resolution nondestructive imaging of...

500

A multi-scale iterative approach for finite element modeling of thermal contact resistance  

E-Print Network [OSTI]

Surface topography has long been considered a key factor in the performance of many contact applications including thermal contact resistance. However, essentially all analytical and numerical models of thermal contact ...

Thompson, Mary Kathryn, 1980-

2007-01-01T23:59:59.000Z