Powered by Deep Web Technologies
Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Text a Librarian It's as easy as it sounds! Just text your questions to 306-570-1216 and one of  

E-Print Network [OSTI]

as an alternative open space for special activities. The TPC Library includes children's and young adult literature knowledgeable library staff at the Information Desk will answer your queries. This service is an addition to our growing list of mobile resources available to library patrons at the Archer Library. Text a Librarian

Argerami, Martin


Web Feedback & Questions - Hanford Site  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Web Feedback & Questions Web Feedback & Questions Web Feedback & Questions Web Feedback & Questions Email Email Page | Print Print Page |Text Increase Font Size Decrease Font Size...


For questions, contact the Rice Alliance at 713.348.3443 Submit form with payment details via fax at 713.348.3110 or mail to: Rice Alliance for Technology and Entrepreneurship Rice University MS-531 P.O. Box 2932 Houston, TX 77252-2932  

E-Print Network [OSTI]

For questions, contact the Rice Alliance at 713.348.3443 · Submit form with payment details via fax at 713.348.3110 or mail to: Rice Alliance for Technology and Entrepreneurship · Rice University · MS-531 · P.O. Box 2932 · Houston, TX · 77252-2932 Rice Alliance Annual Corporate Underwriter Program 2012


Widget:ExpandableBoxStart | Open Energy Information  

Open Energy Info (EERE)

ExpandableBoxStart ExpandableBoxStart Jump to: navigation, search The widget creates an expandable text box which can contain any standard wiki content. The box will be collapsed upon page load and can be expanded by clicking anywhere on the box. Once expanded, the box can be collapsed by clicking anywhere on the box header (the original box). Users of this widget must use the Start and End variants of the widget, as shown below. While slightly less convenient for the wiki content developer to use two widgets, this allows full wikitext in the expandable text area, which would otherwise just be limited to plaintext. Note: You must also use the accompanying variant of this widget: Widget:ExpandableBoxEnd Parameters label - text label of the box header (optional, default "More


Widget:ExpandableBoxEnd | Open Energy Information  

Open Energy Info (EERE)

ExpandableBoxEnd ExpandableBoxEnd Jump to: navigation, search The widget completes an expandable text box which can contain any standard wiki content. The box will be collapsed upon page load and can be expanded by clicking anywhere on the box. Once expanded, the box can be collapsed by clicking anywhere on the box header (the original box). Users of this widget must use the start and end variants of the widget, as shown below. While slightly less convenient for the wiki content developer to use two widgets, this allows full wikitext in the expandable text area, which would otherwise just be limited to plaintext. Parameters Parameters are set on the starting widget: Widget:ExpandableBoxStart Usage {{#Widget:ExpandableBoxStart|label=Expandable Content|icon=info}} Lorem ipsum stet dicant volumus vim no. Electram deseruisse vix no, eum modus soluta minimum at, est te aperiri dissentiunt.


Open-domain textual question answering techniques  

Science Journals Connector (OSTI)

Textual question answering is a technique of extracting a sentence or text snippet from a document or document collection that responds directly to a query. Open-domain textual question answering presupposes that questions are natural and unrestricted ...

Sanda M. Harabagiu; Steven J. Maiorano; Marius A. Pa?ca



BOX SPLINES Hartmut Prautzsch  

E-Print Network [OSTI]

as density functions of the shadows of higher dimensional boxes and half-boxes. Of particular in- terest and their general theory is given in the book by de Boor, H¨ollig and Riemenschneider [10] who also give valuable = ui . Then, Bk(x) represents the density of the "shadow" of k, i.e., Bk(x) = 1 volkk volk-sk(x) , (1

Prautzsch, Hartmut


Frequently Asked Questions  

Broader source: Energy.gov [DOE]

This section is meant to cover the most common questions regarding the EERE Postdoctoral Research Awards. The Frequently Asked Questions (FAQs) are divided into several broad categories: general...


Impedance Measurement Box  

SciTech Connect (OSTI)

Energy storage devices, primarily batteries, are now more important to consumers, industries and the military. With increasing technical complexity and higher user expectations, there is also a demand for highly accurate state-of-health battery assessment techniques. IMB incorporates patented, proprietary, and tested capabilities using control software and hardware that can be part of an embedded monitoring system. IMB directly measures the wideband impedance spectrum in seconds during battery operation with no significant impact on service life. It also can be applied to batteries prior to installation, confirming health before entering active service, as well as during regular maintenance. For more information about this project, visit http://www.inl.gov/rd100/2011/impedance-measurement-box/

Christophersen, Jon



Frequently Asked Questions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

What happens to my question after I submit it to this service? What happens to my question after I submit it to this service? Questions are received and filtered by the two system operators of NEWTON. Acceptable questions are assigned an appropriate category and are forwarded to the scientists that have volunteered to consider questions from that particular category. If one or more scientists address the question, it is returned to a system operator. The question and answers are returned to the person making the request and a copy is placed into an appropriate web page and posted. When may I expect an answer to my request? Our volunteer scientists respond to acceptable questions usually within a week after it is submitted; most within two days or less. Why have I not heard "anything" about the question I submitted?


On the power of non-local boxes  

E-Print Network [OSTI]

A non-local box is a virtual device that has the following property: given that Alice inputs a bit at her end of the device and that Bob does likewise, it produces two bits, one at Alice's end and one at Bob's end, such that the XOR of the outputs is equal to the AND of the inputs. This box, inspired from the CHSH inequality, was first proposed by Popescu and Rohrlich to examine the question: given that a maximally entangled pair of qubits is non-local, why is it not maximally non-local? We believe that understanding the power of this box will yield insight into the non-locality of quantum mechanics. It was shown recently by Cerf, Gisin, Massar and Popescu, that this imaginary device is able to simulate correlations from any measurement on a singlet state. Here, we show that the non-local box can in fact do much more: through the simulation of the magic square pseudo-telepathy game and the Mermin-GHZ pseudo-telepathy game, we show that the non-local box can simulate quantum correlations that no entangled pair of qubits can in a bipartite scenario and even in a multi-party scenario. Finally we show that a single non-local box cannot simulate all quantum correlations and propose a generalization for a multi-party non-local box. In particular, we show quantum correlations whose simulation requires an exponential amount of non-local boxes, in the number of maximally entangled qubit pairs.

A. Broadbent; A. A. Methot



PFP: Protein Function Prediction server For any questions regarding PFP contact the administration at info@kiharalab.org  

E-Print Network [OSTI]

also click on "Load Sample" link to load this sequence in the text box and follow the next steps "Enter Query Sequence(s)". Consider the following sequence that you can enter. >sp|P56851|EP3B. Clicking on "Clear" link will clear the text box for sequence and load default ESG parameters in the boxes

Kihara, Daisuke


Problem of Questioning  

ScienceCinema (OSTI)

Le Prof.Leprince-Ringuet, chercheur sur le plan scientifique, artistique et humain, parle de la remise en question des hommes et la remise en question scientifique fondamentale ou exemplaire- plusieurs personnes prennent la parole p.ex Jeanmairet, Adam, Gregory. Le Prof.Gregory clot la soire en remerciant le Prof.Leprince-Ringuet




10 Questions for a Mechanical Engineer: Michael Brambley | Department of  

Broader source: Energy.gov (indexed) [DOE]

10 Questions for a Mechanical Engineer: Michael Brambley 10 Questions for a Mechanical Engineer: Michael Brambley 10 Questions for a Mechanical Engineer: Michael Brambley July 17, 2013 - 1:51pm Addthis Pictured here is Michael Brambley in front of equipment that supplies chilled water to PNNL Building Diagnostics Laboratory's air handler. The cooled air from an air handler is distributed to terminal boxes, which are the last point for controlling air temperature and flow before distributing it throughout a building zone. In a new control strategy for commercial buildings, the terminal boxes would process the information collected by occupancy sensors to control the air handler's fan speed for energy savings. | Photo courtesy of Kristin Nolan, freelancer. Pictured here is Michael Brambley in front of equipment that supplies


Design of Flexible-Duct Junction Boxes  

Broader source: Energy.gov (indexed) [DOE]

Design of Flexible-duct Design of Flexible-duct Junction Boxes Robert Beach, IBACOS Duncan Prahl, IBACOS Design of Flexible-duct Junction Boxes Presentation Outline * Current Standards and Practice * Analysis Methods * Recommendations Design of Flexible-duct Junction Boxes * Detailed report is in peer review anticipated to be published T3 this year. - http://www1.eere.energy.gov/library/default.aspx?page=2&spi d=2. * Measure guide to be part of Building America Solutions Center - http://basc.pnnl.gov/ Design of Flexible-duct Junction Boxes Typical Installations As Plenum As Monster Design of Flexible-duct Junction Boxes Current Standards * ASHRAE 2012 HVAC Systems and Equipment, Box Plenum Systems Using Flexible Duct - Constrains Box Width to 2-3x Entrance Width - Constrains Box Length to 2 x Box Width


Questions and Answers  

Broader source: Energy.gov (indexed) [DOE]

The following questions were submitted by DOE employees during the initial stages of the Financial Services A-76 study. Answers to these questions have been provided by subject matter experts. If you have any questions or need further clarification, please contact Paul Anderson at (803) 725-5607 or e-mail him at paul.anderson@srs.gov. This website will be updated regularly and new questions and answers posted as they are received. 1. It appears that, according to the Financial Services Plan of Action and Milestones, in any event, some of us will lose our jobs. How will it be decided which employees will lose our jobs? Answer: It is possible that the study outcome may or may not require a reduction-in-force (RIF). It would be premature at this time to address layoffs (i.e., RIF), which will


Frequently Asked Questions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Questions Questions 1. Technology Transfer 2. Patent 3. Requirements for obtaining a patent 4. Copyright 5. Public Disclosure 6. Record of Invention 7. Publishing before filing a patent 8. Policy about laboratory notebooks 9. Materials Transfer Agreement 10. Non-Disclosure Agreement 11. Open Source Software Program 12. Role of Office of Technology Commercialization and Partnerships (TCP) 13. Role of Intellectual Property Legal Group (IPLG) 14. Location of TCP/IPLG If a specific question related to commercialization or partnerships is not addressed, please contact the TCP staff members that you normally work with or Colleen Michael at 631- 344 -4919. For specific questions related to intellectual property, please contact Dorene Price at 631-



Science Journals Connector (OSTI)

OLYMPIC AIR QUALITY QUESTIONABLE ... Athletes GOING FOR GOLD worry about Beijings air ... Atmospheric chemists say the air quality during the Beijing Games literally rests on which direction the winds blow. ...




Lauren Garcia SU Box 1195  

E-Print Network [OSTI]

Lauren Garcia SU Box 1195 Geos 206 Renewable Energy and the Sustainable Campus Prof. Dethier a lot of fabric in dorms to cover furniture, but how durable is that fabric, how sustainable is it, but it could be applied to any building on campus that houses furniture. I am defining "green" as non

Aalberts, Daniel P.


NETL's JIC in a box  

ScienceCinema (OSTI)

The National Energy Technology Laboratory developed the idea of a portable joint information center AKA JIC in-a-box. This video discribes some of the equipment in the portable JIC as well as some of the methodology that NETL developed as a result of this portable JIC concept.

David Anna


Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


ARM - Key Science Questions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

govScienceKey Science Questions govScienceKey Science Questions Science Research Themes Research Highlights Journal Articles Collaborations Atmospheric System Research (ASR) ARM Science Team Meetings User Meetings Annual Meetings of the Atmospheric System Research (ASR) Science Team and Fall Working Groups Accomplishments Read about the 20 years of accomplishments (PDF, 696KB) from the ARM Program and user facility. Performance Metrics ASR Metrics 2009 2008 2007 2006 Key Science Questions The role of clouds and water vapor in climate change is not well understood; yet water vapor is the largest greenhouse gas and directly affects cloud cover and the propagation of radiant energy. In fact, there may be positive feedback between water vapor and other greenhouse gases. Carbon dioxide and other gases from human activities slightly warm the


ARM - AMF Science Questions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AzoresAMF AzoresAMF Science Questions Azores Deployment AMF Home Graciosa Island Home Data Plots and Baseline Instruments Satellite Retrievals Experiment Planning CAP-MBL Proposal Abstract and Related Campaigns Science Questions Science Plan (PDF, 4.4M) Rob Wood Website Outreach Backgrounders English Version (PDF, 363K) Portuguese Version (PDF, 327K) AMF Posters, 2009 English Version Portuguese Version Education Flyers English Version Portuguese Version News Campaign Images AMF Science Questions Which synoptic-scale features dominate the variability in subtropical low clouds on diurnal to seasonal timescales over the NEA? Do physical, optical, and cloud-forming properties of aerosols vary with these synoptic features? How well can state-of-the-art weather forecast and climate models (run in forecast mode) predict the day-to-day variability of


Download Full-text PDF  

Science Journals Connector (OSTI)

Department of Ocean Ecosystems, Center for Ecological and Evolutionary Studies, University of Groningen, P.O. Box 14,. 9750 AA Haren, The Netherlands.



Download Full-text PDF  

Science Journals Connector (OSTI)

Light can be reduced from total incident light to almost complete darkness by means of shade boxes. Cur- rent speed can be varied by changing the inclination



Eastern Box Turtle Terrapene carolina carolina  

E-Print Network [OSTI]

Eastern Box Turtle Terrapene carolina carolina * * * * * * * Adult male Eastern Box turtle. See.uga.edu/srel/outreach.htm shell). Females have brown eyes and a flat plastron. Box turtles are true omnivores, feeding the turtle to close up very tightly. This feature provides great protection from raccoons, foxes and other

Georgia, University of



E-Print Network [OSTI]

QUESTIONS ABOUT GLOBAL WARMING ¥IS IT REAL? ¥IS IT IMPORTANT? ¥WHAT IS IT DUE TO? ¥HOW MUCH MORE in the atmosphere, giving Earth its temperate climate. Global Atmosphere, Global Warming GLOBAL TEMPERATURE TREND?t a cure for global warming! Aerosols only last a short while in the atmosphere, they would have


Some Questions About Neurocognitive  

E-Print Network [OSTI]

Some Questions About Neurocognitive Networks Steven Bressler Center for Complex Systems & Brain is a Brain Network? · A brain network is a large-scale system in the brain consisting of distributed neuronal ­ Dynamic Interdependency #12;Does The Brain Need Networks? · Serial processing, as found in the PNS, is too

Bressler, Steven L.


Illumination box and camera system  

DOE Patents [OSTI]

A hand portable, field-deployable thin-layer chromatography (TLC) unit and a hand portable, battery-operated unit for development, illumination, and data acquisition of the TLC plates contain many miniaturized features that permit a large number of samples to be processed efficiently. The TLC unit includes a solvent tank, a holder for TLC plates, and a variety of tool chambers for storing TLC plates, solvent, and pipettes. After processing in the TLC unit, a TLC plate is positioned in a collapsible illumination box, where the box and a CCD camera are optically aligned for optimal pixel resolution of the CCD images of the TLC plate. The TLC system includes an improved development chamber for chemical development of TLC plates that prevents solvent overflow.

Haas, Jeffrey S. (San Ramon, CA); Kelly, Fredrick R. (Modesto, CA); Bushman, John F. (Oakley, CA); Wiefel, Michael H. (La Honda, CA); Jensen, Wayne A. (Livermore, CA); Klunder, Gregory L. (Oakland, CA)



Frequently Asked Questions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Frequently Asked Questions Frequently Asked Questions About This Site What is fueleconomy.gov? Adobe Acrobat Icon Fuel Economy Estimates How are fuel economy ratings determined? EPA estimates are based on laboratory tests conducted by manufacturers according to federal regulations. EPA re-tests about 10% of vehicle models to confirm manufacturer's results. For more detailed information, visit our page on How Vehicles Are Tested. Why does my fuel economy differ from EPA estimates? No test can accurately predict fuel economy for all drivers and all driving conditions. Driver behavior, driving conditions, vehicle maintenance, fuel characteristics, weather, and other factors can all affect fuel economy significantly as explained here. What should I do if my fuel economy is excessively low?


Data Provider Questions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Home Home Data Provider Questions At the beginning the process of archival with the ORNL DAAC, you will be asked to fill out a short online form to help us better understand your data set. These questions should only take a few minutes to answer. Information About Your Data Set Have you looked at our recommendations for the preparation of data files and documentation? Who produced this data set? What agency and program funded the project? What awards funded this project? (comma separate multiple awards) Data Set Description Provide a title for your data set. (maximum 84 characters) What type of data does your data set contain? What does the data set describe? (2-3 sentences) What parameters did you measure, derive, or generate? (comma separated, limit to ten) Have you analyzed the uncertainty in your data?


ESG: Extended Similarity Group method for protein function prediction For any questions regarding ESG contact the administration at info@kiharalab.org  

E-Print Network [OSTI]

box titled "Enter Query Sequence(s)". Consider the following sequence that you can enter. >sp|P56851 KDKSSHMFIYISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSF NYIEFHCSMDGYVDSIEDLKMVEPIGN You can also click on "Load Sample" link to load this sequence in the text box and follow the next steps. Clicking on "Clear" link will clear the text box for sequence

Kihara, Daisuke


Doing Business Frequently Asked Questions  

Broader source: Energy.gov [DOE]

The following are frequently asked questions about working with in partnership with DOE laboratories.


Download Full-text PDF  

Science Journals Connector (OSTI)

... of Ocean Sciences, PO. Box 6000, Sidney, B.C. V8L 4B2, Canada ... A simple ecosystem model forced with observed incident solar radiation and mixed-layer...



Broader source: Energy.gov (indexed) [DOE]

Department of Energy Pt. 835 H. UNREVIEWED SAFETY QUESTIONS 1. The USQ process is an important tool to evaluate whether changes affect the safety basis. A contractor must use the USQ proc- ess to ensure that the safety basis for a DOE nuclear facility is not undermined by changes in the facility, the work performed, the associated hazards, or other factors that support the adequacy of the safety basis. 2. The USQ process permits a contractor to make physical and procedural changes to a nuclear facility and to conduct tests and ex- periments without prior approval, provided these changes do not cause a USQ. The USQ process provides a contractor with the flexi- bility needed to conduct day-to-day oper- ations by requiring only those changes and tests with a potential to impact the safety


Q# Question Answer  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

4/2012) 4/2012) Q# Question Answer 1 Could let us know what your interests are in keeping the current staff if another contractor wins? This is a management decision of the vendor 2 Will this RFP not be automatically posted in FedBizOpps? When the RFP is issued, it will be posted on the FBO website through FedConnect. 3 Will this be a small business set-aside, and if so, what is the size standard? Yes, $7.0M 4 Who is the incumbent? Systematic Management Services Inc 5 I would appreciate it if you would provide me with that person's name and contact information. My company is potentially interested in this re-compete and we are trying to obtain sufficient data so as to enable us to make an informed decision. This information can be submitted using a freedom of Information request. The technical


Q# Question Answer  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

6/2012) 6/2012) Q# Question Answer 1 Could let us know what your interests are in keeping the current staff if another contractor wins? This is a management decision of the vendor 2 Will this RFP not be automatically posted in FedBizOpps? When the RFP is issued, it will be posted on the FBO website through FedConnect. 3 Will this be a small business set-aside, and if so, what is the size standard? Yes, $7.0M 4 Who is the incumbent? Systematic Management Services Inc 5 I would appreciate it if you would provide me with that person's name and contact information. My company is potentially interested in this re-compete and we are trying to obtain sufficient data so as to enable us to make an informed decision. This information can be submitted using a freedom of Information request. The technical



Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

3 3 Department of Energy Pt. 835 H. UNREVIEWED SAFETY QUESTIONS 1. The USQ process is an important tool to evaluate whether changes affect the safety basis. A contractor must use the USQ proc- ess to ensure that the safety basis for a DOE nuclear facility is not undermined by changes in the facility, the work performed, the associated hazards, or other factors that support the adequacy of the safety basis. 2. The USQ process permits a contractor to make physical and procedural changes to a nuclear facility and to conduct tests and ex- periments without prior approval, provided these changes do not cause a USQ. The USQ process provides a contractor with the flexi- bility needed to conduct day-to-day oper- ations by requiring only those changes and tests with a potential to impact the safety


BioFuelBox Corporation | Open Energy Information  

Open Energy Info (EERE)

BioFuelBox Corporation BioFuelBox Corporation Jump to: navigation, search Logo: BioFuelBox Corporation Name BioFuelBox Corporation Address 50 Las Colinas Lane Place San Jose, California Zip 95119 Sector Biofuels Product Makes a modular container that produces biofuel cost-effectively Website http://www.biofuelbox.com/ Coordinates 37.237774°, -121.777361° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":37.237774,"lon":-121.777361,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


MDF Overview (Text Version)  

Broader source: Energy.gov [DOE]

This is a text version of the Manufacturing Demonstration Facilities (MDF) overview video, originally presented on March 12, 2012 at the MDF Workshop held in Chicago, Illinois.


Tuesday, March 16, 2010 On Box Models  

E-Print Network [OSTI]

to illustrate some of the basics of box models that are used frequently in the field of atmospheric chemistry L". You can guess that it was named after Marie Curie, someone who studied radioactive elements. #12 to exposure to contaminants. One tool that modelers use to assess exposure to pollutants is the "box model

Toohey, Darin W.

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Optimization Control Strategies for HVAC Terminal Boxes  

E-Print Network [OSTI]

The HVAC terminal boxes are one of the major building HVAC components. They directly impact the building room comfort conditions and the energy costs. How to operate the box in a highly energy efficient way and maintain the room comfort level...

Zhu, Y.; Batten, T.; Noboa, H.; Claridge, D. E.; Turner, W. D.; Liu, M.; Zhou, J.; Cameron, C.; Keeble, D.; Hirchak, R.



NNSA DP does it again! Collects boxes and boxes of toys | National Nuclear  

National Nuclear Security Administration (NNSA)

DP does it again! Collects boxes and boxes of toys | National Nuclear DP does it again! Collects boxes and boxes of toys | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Home > NNSA Blog > NNSA DP does it again! Collects boxes ... NNSA DP does it again! Collects boxes and boxes of toys Posted By Office of Public Affairs NNSA Defense Programs today presented hundreds of toys to the U.S. Marine


Full Text Glossary  

Broader source: Energy.gov [DOE]

The full-text glossary includes terms used throughout the website and in Biomass Program publications. Terms are listed alphabetically for easy reference. The term index lists all of the terms defined in the glossary.


P.O. Box 45339 San Francisco, CA  

E-Print Network [OSTI]

UCSF P.O. Box 45339 San Francisco, CA 94145-0339 UCSF P.O. Box 45339 San Francisco, CA 94145-0339 UCSF P.O. Box 45339 San Francisco, CA 94145-0339 UCSF P.O. Box 45339 San Francisco, CA 94145-0339 UCSF P.O. Box 45339 San Francisco, CA 94145-0339 UCSF P.O. Box 45339 San Francisco, CA 94145-0339 UCSF P

Yamamoto, Keith


Box Elder County, Utah: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

Box Elder County, Utah: Energy Resources Box Elder County, Utah: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 41.5380087°, -113.1918021° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":41.5380087,"lon":-113.1918021,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


Box Butte County, Nebraska: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

Box Butte County, Nebraska: Energy Resources Box Butte County, Nebraska: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 42.1911471°, -103.0817903° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":42.1911471,"lon":-103.0817903,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


Workers Remove Glove Boxes from Ventilation at Hanford's Plutonium...  

Office of Environmental Management (EM)

boxes inside the facility's former processing area. This work is performed inside plastic enclosures to limit the spread of contamination. Preparing the glove boxes for...


A Question of Savings | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

A Question of Savings A Question of Savings A Question of Savings March 15, 2011 - 5:39pm Addthis Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs The New York Times recently published a piece which gave criticism to wide-scale energy efficiency measures. Yesterday, Henry Kelly, the Acting Assistant Secretary for Energy Efficiency and Renewable Energy, published a letter to the editor in response. In addition, Shannon Baker-Branstetter, a policy advisor for Consumers Union, chimed in to clarify some of the Consumer Reports data that was cited. Text of Henry Kelly's letter. Published 3/14/11: To the Editor: John Tierney's column "When Energy Efficiency Sullies the Environment" (Findings, March 8) misses the well-established point that energy efficiency represents the most cost-effective way to reduce energy


Frequently Asked Global Change Questions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Asked Global Change Questions Asked Global Change Questions This page lists global change questions that have been received at CDIAC and the answers that were provided to a diverse audience. If you have a question relating to carbon dioxide and global change and cannot find the answer you need here, you can "Ask Us a Question", and we will be glad to try to help you. Questions Should we grow trees to remove carbon in the atmosphere? What are the present tropospheric concentrations, global warming potentials (100 year time horizon), and atmospheric lifetimes of CO2, CH4, N2O, CFC-11, CFC-12, CFC-113, CCl4, methyl chloroform, HCFC-22, sulphur hexafluoride, trifluoromethyl sulphur pentafluoride, perfluoroethane, and surface ozone? Where can I find information on the naming of halocarbons?


QuestionQuestion How does nitrogen deposition affect roadside  

E-Print Network [OSTI]

al. 2004. Concentrations of ammonia and nitrogen dioxide at roadside verges, and their contributionQuestionQuestion How does nitrogen deposition affect roadside plant community composition? 1. Is there a gradient of nitrogen deposition to freeway verges from traffic exhaust? 2. Are there other sources of N

Hall, Sharon J.


From Question Answering to Visual Exploration  

SciTech Connect (OSTI)

Research in Question Answering has focused on the quality of information retrieval or extraction using the metrics of precision and recall to judge success; these metrics drive toward finding the specific best answer(s) and are best supportive of a lookup type of search. These do not address the opportunity that users? natural language questions present for exploratory interactions. In this paper, we present an integrated Question Answering environment that combines a visual analytics tool for unstructured text and a state-of-the-art query expansion tool designed to compliment the cognitive processes associated with an information analysts work flow. Analysts are seldom looking for factoid answers to simple questions; their information needs are much more complex in that they may be interested in patterns of answers over time, conflicting information, and even related non-answer data may be critical to learning about a problem or reaching prudent conclusions. In our visual analytics tool, questions result in a comprehensive answer space that allows users to explore the variety within the answers and spot related information in the rest of the data. The exploratory nature of the dialog between the user and this system requires tailored evaluation methods that better address the evolving user goals and counter cognitive biases inherent to exploratory search tasks.

McColgin, Dave W.; Gregory, Michelle L.; Hetzler, Elizabeth G.; Turner, Alan E.



Box Splines Hartmut Prautzsch, Wolfgang Boehm  

E-Print Network [OSTI]

as density functions of the shadows of higher dimensional boxes and half­boxes. Of particular interest and their general theory is given in the book by de Boor, H¨ollig and Riemenschneider [10] who also give valuable the density of the ``shadow'' of the unit cube [0; 1) k under the affine map \\Phi(t) = [v 1 : : : v k ]t from

Liblit, Ben


Glove box on vehicular instrument panel  

DOE Patents [OSTI]

A glove box for the upper surface of an automobile dashboard whereby it may be positioned close to the driver. The glove box lid is pivotally supported by arms extending down either side to swing forwardly for opening. A hook is pivotally support adjacent an arm and weighted to swing into engagement with the arm to prevent opening of the lid during abrupt deceleration. A toggle spring assists in maintaining the lid in either the open or closed position.

Atarashi, Kazuya (Saitama, JP)



Enhanced Stuffing Box Rubbers Test Report  

SciTech Connect (OSTI)

The Rocky Mountain Oilfield Testing Center (RMOTC) and Scott's Oil Field Service tested an enhanced stuffing box rubber at the Naval Petroleum Reserve No. 3. The enhanced stuffing box rubbers have saved money from not having to replace packing as often and not spilling valuable oil on the ground. A reduction in environmental hazards and the cost of cleaning up spilled oil have also been a benefit.

Rochelle, J.



Text | Open Energy Information  

Open Energy Info (EERE)

View View New Pages Recent Changes All Special Pages Semantic Search/Querying Get Involved Help Apps Datasets Community Login | Sign Up Search Special page Facebook icon Twitter icon » Text Jump to: navigation, search Properties of type "Text" Showing 139 properties using this type. A Property:Abstract Property:AdditionalRef Property:Available Personnel Types Property:Available Sensors B Property:BestPractices C Property:CBECSDefinition Property:Cameras Property:CaseName Property:Citation Property:CompletionNotes Property:Conference D Property:DIA/Approach Property:DIA/CaseStudies Property:DIA/Inputs Property:DIA/Outputs Property:DIA/Training Property:DOEInvolve Property:DOMproperty Property:Data Comparison to Computational Models Property:DataAcquisition Property:Definition


Jens Hjorth the Urbino Questions  

E-Print Network [OSTI]

reduce the effects of air pollution to human health and the environment in Europe by 2020. The strategy-DRIVEN SYNTHESIS Answers by the atmospheric chemistry and air pollution research community to questions posed Strategy on Air Pollution 5.06 #12;editors Frank Raes Jens Hjorth Answers to the Urbino Questions ACCENTs


LED Frequently Asked Questions | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Frequently Asked Questions LED Frequently Asked Questions This document provides answers to LED frequently asked questions for plant-wide improvements, such as "Are LEDs ready for...


Frequently Asked Questions (FAQs) | Building Energy Codes Program  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Frequently Asked Questions (FAQs) Frequently Asked Questions (FAQs) Where can copies of the energy codes be obtained? Copies of the International Energy Conservation Code (IECC) can be purchased from the International Code Council website. Copies of ASHRAE standards can be purchased from the ... What are the requirements for duct leakage testing? Category: air leakage, ducts Both the 2009 and 2012 IECC require duct tightness to be verified. Verification can take place via either a post-construction test or a rough-in test.For the post-construction test, leakage measurement must be made across the entire system,... How are basement walls input in REScheck? Category: basement, walls After selecting a basement wall type, a basement wall illustration will appear with input boxes for the basement wall height, depth below grade,


LCC-0084 text  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

4 4 July 2002 A Comment on Machine Reliability and Availability Raymond S. Larsen Stanford Linear Accelerator Center Stanford University Menlo Park, California Abstract: There appears to be continuing confusion in the community between the terms reliability and availability. The following is a comment on the salient points, none of which are particularly new to NLC discussions of the past 2 -3 years, but which will soon require serious further study because of potential impact on overall system engineering manpower, costs and schedules. LCC-0084 LCC-0084 text 1 RSL 7/1/02 A Comment on Machine Reliability and Availability R.S. Larsen Stanford Linear Accelerator Center February 15, 2002 The just concluded LC02 discussions on machine reliability were very interesting but due


EECBG Rebate Frequently Asked Questions  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

EECBG Rebate Frequently Asked Questions When do I need to use funds I receive from rebates associated with EECBG funds? Rebates consist of incentives received by a grant recipient...

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


SEED Platform Frequently Asked Questions  

Broader source: Energy.gov [DOE]

This page features answers to the most Frequently Asked Questions about the DOE Standard Energy Efficiency Data (SEED) Platform, specifically on how SEED can help manage large building portfolios' energy performance.



E-Print Network [OSTI]

(a) Ian = Ui'=1 Ar, prove that B" = ULI 3,, for n =1, 2, 3, . (b) HR = U'iil A prove ... Let Kc R1 consist of 0 and the numbers 1/11, for n = 1, 2, 3, ... . Prove that K lS.



Retrieval of snippets of web pages converted to plain text: more questions than answers  

Science Journals Connector (OSTI)

This year's WebCLEF task was to retrieve snippets and pieces from documents on various topics. The extraction and the choice of the most widely used snippets can be carried out using various methods. However, the way in which web pages are usually converted ...

Carlos G. Figuerola; Jos Luis Alonso Berrocal; ngel F. Zazo Rodrguez; Montserrat Mateos



Frequently Asked Questions | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

Asked Questions Print Text Size: A A A FeedbackShare Page The U.S. Department of EnergyNational Nuclear Security Administration frequently fields questions about the...



E-Print Network [OSTI]

QUESTIONS & ANSWERS ABOUT LUNG CANCER Q: What are the early signs of lung cancer? How would I know I have it? A: Some of the early warning signs of lung cancer are: · A cough that doesn't go away what may be causing these symptoms. Q: How is lung cancer diagnosed? A: Your doctor may do one or more


Open-domain question: answering  

Science Journals Connector (OSTI)

The top-performing Question-Answering (QA) systems have been of two types: consistent, solid, well-established and multi-faceted systems that do well year after year, and ones that come out of nowhere employing totally innovative approaches and which ...

John Prager



Product realization of the 2.007 control box  

E-Print Network [OSTI]

A second generation control box using frequency hopping spread spectrum radio was designed and built for use in the Spring 2006 offering of 2.007 Design and Manufacturing I. A third generation control box that could hold ...

Lin, Wey-Jiun



Michigan Saves' New Marketing PSAs Use Boxing to Solve "Energy...  

Broader source: Energy.gov (indexed) [DOE]

Saves' New Marketing PSAs Use Boxing to Solve "Energy Drama" Michigan Saves' New Marketing PSAs Use Boxing to Solve "Energy Drama" An image from the video with a woman and the...


Pre-Solicitation Questions with Answers Q# Question Answer  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Q# Question Answer Q# Question Answer map), but I cannot find the date and time for the site visit. Please tell me the date and time of the site visit and if it is mandatory or not. the tab "Industry Day Information." Attending the Industry Day is not mandatory. 4 Good afternoon, I am interested in attending the pre proposal conference for the Emergency Operations Training and Support (EOTA) contract. Please send me further information on the where about of this conference. I have the time and date from GovWin, which is 1/6/12 at 9am. I look forward to speaking with you shortly. All information is contained in the RFP and in the pre Solicitation Documents in FedConnect and Federal Business Opportunities. This information can also be found in the Reading


10 CFR 707 Frequently Asked Questions  

Broader source: Energy.gov [DOE]

NOTE: The Questions on this site were compiled from questions asked during the four DOE complex wide tele-videos, as well as, questions submitted by e-mail and telephone. The answers provided are...


Building Energy Asset Score Frequently Asked Questions  

Broader source: Energy.gov [DOE]

This page features answers to the most frequently asked questions about the Building Energy Asset Score. Choose from the list of questions below to learn more:


Career Pathways Frequently Asked Questions (FAQs) | Department...  

Energy Savers [EERE]

Questions (FAQs) The following frequently asked questions were developed by OPM's Student Programs Office. They will clarify the use of the authority and assist managers,...


Gas Prices: Frequently Asked Questions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Prices: Frequently Asked Questions Prices: Frequently Asked Questions What determines the price of gasoline? Energy Information Administration What's going on with gasoline prices? Factors Affecting Gasoline Prices This Week in Petroleum (updated weekly) Gasoline Price Pass-through Oil Market Basics Primer on Gasoline Sources and Markets What's up (and down) with gasoline prices? Illustration showing component costs of gasoline What are the average national and regional gasoline prices? Energy Information Administration Gasoline and Diesel Fuel Update (updated weekly) This Week in Petroleum (updated weekly) California Energy Commission California Gasoline & Gasoline Prices What is the outlook for gasoline prices? Energy Information Administration Short-Term Energy Outlook Why are gasoline prices so different from one state (or region) to another?


Oak Ridge Operations PO. Box E  

Office of Legacy Management (LM)

PO. Box E PO. Box E Oak Ridge,Tennessee 37830 E. 6. DeLaney, DRAP, NE-24 COMPLETION OF DECONTAMINATION OF GILMAN HALL, UNIVERSITY OF CALIFORNIA AT BERKELEY Attached is a copy of the final report covering the remedial actions and associated radiological survey work on Gilman Hall. Your attention is called to the last paragraph of the attached letter from Mr. Davis (SAN) which states: "Completion of this work has fulfilled OR's obligation under the Formerly Utilized Sites Remedial Action Program (FuSRAP). No further involvement by OR/FUSRAP in this matter is required." CE-53:EHH Attachment: As Stated E. L. Keller, Director Technical Services Division _I ." ....I__ - . . _. ._ . ..- - --..-l-.l_ U.S. DEPARTMENT OF ENERGY memmcmhm SET. Francisco Operations Office (ESQA)


Question 2: Gas procurement strategy  

SciTech Connect (OSTI)

This article is a collection of responses from natural gas distribution company representatives to questions on how the start-up of the natural gas futures market has changed gas procurement strategies, identification of procurement problems related to pipeline capacity, deliverability, or pregranted abandonment of firm transportation, the competition of separate utility subsidiaries with brokers, marketers, and other gas suppliers who sell gas to large-volume industrial or other 'noncore' customers.

Carrigg, J.A.; Crespo, J.R.; Davis, E.B. Jr.; Farman, R.D.; Green, R.C. Jr.; Hale, R.W.; Howard, J.J.; McCormick, W.T. Jr.; Page, T.A.; Ryan, W.F.; Schrader, T.F.; Schuchart, J.A.; Smith, J.F.; Stys, R.D.; Thorpe, J.A.



Sector 1 Frequently Asked Questions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Sector 1 - General Information Sector 1 - General Information Sector 1 Safety Plan (pdf) Useful X-Ray Related Numbers Si a0 = 5.4308 Angstrom CeO2 a0=5.411 Angstrom Cd-109 gamma = 88.036 keV X-ray energy/wavelength conversion constant = 12.39842 Angstrom/keV Useful 1-ID Operations Information Always set the undulator by closing from large to small gap. Always scan the Kohzu monochromator from high to low energy. A Cd-109 source that can be used to calibrate detectors can be obtained by contacting Ali. It has Ag flourescent lines and a 88.036 keV gamma line. Tim Mooney's telephone number is 2-5417. Frequently Asked Questions The following questions come up often when using the Sector 1 beamlines. If you have a question (and maybe answer) that would be of general interest to Sector 1 users, please give it to Jon or Greg for inclusion in this list.



Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Thursday, November 18, 2010 Thursday, November 18, 2010 james-r.giusti@srs.gov Paivi Nettamo, SRNS, (803) 292-2484 paivi.nettamo@srs.gov SRS Recovery Act TRU Waste Project Ahead of Schedule with Box Remediation Program Aiken, SC - The U.S. Department of Energy's Savannah River Site (SRS) started off the last 12 months of the American Recovery and Reinvestment Act with an enormous success in its legacy transuranic (TRU) waste program. The H-Canyon


Text analysis methods, text analysis apparatuses, and articles of manufacture  

DOE Patents [OSTI]

Text analysis methods, text analysis apparatuses, and articles of manufacture are described according to some aspects. In one aspect, a text analysis method includes accessing information indicative of data content of a collection of text comprising a plurality of different topics, using a computing device, analyzing the information indicative of the data content, and using results of the analysis, identifying a presence of a new topic in the collection of text.

Whitney, Paul D; Willse, Alan R; Lopresti, Charles A; White, Amanda M



Potpourri of deposition and resuspension questions  

SciTech Connect (OSTI)

Twenty questions and answers are listed dealing with particulate deposition, resuspension, and precipitation scavenging.

Slinn, W.G.N.



Text analysis devices, articles of manufacture, and text analysis methods  

DOE Patents [OSTI]

Text analysis devices, articles of manufacture, and text analysis methods are described according to some aspects. In one aspect, a text analysis device includes processing circuitry configured to analyze initial text to generate a measurement basis usable in analysis of subsequent text, wherein the measurement basis comprises a plurality of measurement features from the initial text, a plurality of dimension anchors from the initial text and a plurality of associations of the measurement features with the dimension anchors, and wherein the processing circuitry is configured to access a viewpoint indicative of a perspective of interest of a user with respect to the analysis of the subsequent text, and wherein the processing circuitry is configured to use the viewpoint to generate the measurement basis.

Turner, Alan E; Hetzler, Elizabeth G; Nakamura, Grant C


Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Pre-Solicitation Questions with Answers Q# Question Answer  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

it if you would provide me with that person's name and it if you would provide me with that person's name and contact information. My company is potentially interested in this re- compete and we are trying to obtain sufficient data so as to enable us to make an informed decision. This information can be submitted using a freedom of Information request. The technical point of contact cannot disclose any information regarding the future contract source selection. 6 Is this new work? This is a re-compete of a previous contract 7 Can you please tell me who is the incumbent and what is the name of the contract they are providing support under? See Question 4 above. Emergency Operations Training Academy (EOTA) Support Services. 8 Will this reading room be a physical location, or will this be a forum online? Online web address (Virtual Library)


Unlocking the Mysteries of the Bounding Box  

E-Print Network [OSTI]

Service is available online at http://www.fs.fed.us/institute/ecoregions/ eco_download.html 16. The ?1:2,000,000-Scale Hydrologic Unit Boundaries? from the US Geological Survey is available online at http://water.usgs.gov/GIS/huc.html 17. Circularity...Coordinates Series A, No. 2 Unlocking the Mysteries of the Bounding Box Persistent URL for citation: http://purl.oclc.org/coordinates/a2.pdf Date of Publication: 08/29/05 Douglas R. Caldwell Douglas R. Caldwell (e-mail: Douglas.R. Caldwell...

Caldwell, Douglas R.




Broader source: Energy.gov (indexed) [DOE]

SOURCING/A-76 SOURCING/A-76 QUESTIONS AND ANSWERS COMPETITIVE SOURCING What is the President's Competitive Sourcing Initiative? The President stated, as part of his Management Agenda, that "Government should be market- based - we should not be afraid of competition, innovation, and choice. I will open government to the discipline of competition." He charged each agency with conducting a review of at least fifty percent of its federal workforce performing commercial activities to determine if any of the activities being performed could be provided by the private sector at less cost to the government. Agencies are being asked to study fifteen percent of their commercial activity inventories by the end of FY 2003. President Bush's mandate follows the enactment of the Federal Activities Inventory Reform Act


ParaText : scalable text modeling and analysis.  

SciTech Connect (OSTI)

Automated processing, modeling, and analysis of unstructured text (news documents, web content, journal articles, etc.) is a key task in many data analysis and decision making applications. As data sizes grow, scalability is essential for deep analysis. In many cases, documents are modeled as term or feature vectors and latent semantic analysis (LSA) is used to model latent, or hidden, relationships between documents and terms appearing in those documents. LSA supplies conceptual organization and analysis of document collections by modeling high-dimension feature vectors in many fewer dimensions. While past work on the scalability of LSA modeling has focused on the SVD, the goal of our work is to investigate the use of distributed memory architectures for the entire text analysis process, from data ingestion to semantic modeling and analysis. ParaText is a set of software components for distributed processing, modeling, and analysis of unstructured text. The ParaText source code is available under a BSD license, as an integral part of the Titan toolkit. ParaText components are chained-together into data-parallel pipelines that are replicated across processes on distributed-memory architectures. Individual components can be replaced or rewired to explore different computational strategies and implement new functionality. ParaText functionality can be embedded in applications on any platform using the native C++ API, Python, or Java. The ParaText MPI Process provides a 'generic' text analysis pipeline in a command-line executable that can be used for many serial and parallel analysis tasks. ParaText can also be deployed as a web service accessible via a RESTful (HTTP) API. In the web service configuration, any client can access the functionality provided by ParaText using commodity protocols ... from standard web browsers to custom clients written in any language.

Dunlavy, Daniel M.; Stanton, Eric T.; Shead, Timothy M.



On the interpretation of concealed questions  

E-Print Network [OSTI]

Determiner phrases have the ability to act as "concealed questions" (CQs), embedded questions in sentences like John knows the time (i.e., John knows what time it is). The fact that know and wonder differ in their ability ...

Nathan, Lance Edward



Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Hello, I am so happy to visited your site It was full of answers to my questions So, I have a question about thermal Energy...We have some kind of energy in the world. electric...


Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

have a question, but first, thank you for the terrific new web site. You did a fantastic job. Question: Where does present theory say the energy of a red shifted photon goes? The...


Ex Parte Memorandum on Set Top Boxes and Network Equipment |...  

Energy Savers [EERE]

provides a summary of a May 1, 2012, meeting with DOE officials concerning potential test procedures and energy conservation standards for set-top boxes and network equipment....


Home Energy Score Program Update Webinar (Text Version) | Department of  

Broader source: Energy.gov (indexed) [DOE]

Program Update Webinar (Text Version) Program Update Webinar (Text Version) Home Energy Score Program Update Webinar (Text Version) Below is a text version of the webinar titled "Home Energy Score: Program Update for Interested Stakeholders," originally presented on July 23, 2012. In addition to this text version of the audio, you can access the presentation slides and a recording of the webinar. Joan Glickman: Slide 1: Thank you very much and good afternoon, or good morning to those of you on the west coast. Thanks for calling in and viewing today. As Cortney said, I am going to spend, I don't know maybe a half an hour going through our program update and we will take questions, so maybe we can have 15 minutes for questions and the last 15 minutes I can go through some slides that are specifically for those types of organizations who might be


A Question of Prosperity Poverty in Saskatchewan  

E-Print Network [OSTI]

JUNE 2008 A Question of Prosperity Poverty in Saskatchewan Garson Hunter and Fiona Douglas with Sarah Pedersen #12;A Question of Prosperity: Poverty in Saskatchewan June 2008 Hunter, G. F. Douglas & S. Pedersen. "A Question of Prosperity: Poverty in Saskatchewan." Poverty Profiles 1, 2008. Regina

Argerami, Martin


Frequently Asked Questions | National Nuclear Security Administration  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Frequently Asked Questions | National Nuclear Security Administration Frequently Asked Questions | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Frequently Asked Questions Home > About Us > Our Operations > Management and Budget > Human Resources > Pay-banding > Frequently Asked Questions Frequently Asked Questions General What is a demonstration project?


Fermi Site Office Post Office Box 2000  

Broader source: Energy.gov (indexed) [DOE]

Fermi Site Office Fermi Site Office Post Office Box 2000 Batavia, Illinois 60510 JAN 14 2011 Scott Blake Harris, General Counsel GC-1 FORS SUBJECT: FERMl SITE OFFICE (FSO) 201 1 ANNUAL NATIONAL ENVIRONMENTAL POLICY ACT (NEPA) PLANNING SUIMMARY The Department of Energy (DOE) Order 451 .I B, Change 2, requires Secretarial Officers and Heads of Field Organizations to submit a NEPA Annual Planning Summary to the Office of General Counsel. Per your December 8, 2010 memorandum and guidance provided by the Office of NEPA Policy and Compliance (GC-54), our Annual NEPA Planning Summary is enclosed. We have identified one on-going environmental assessment (EA). No environmental impact statements (EISs) are on-going and two new EAs and one EIS are expected to be prepared beginning in the next 12 to 24 months.


text | OpenEI Community  

Open Energy Info (EERE)

text text Home Dc's picture Submitted by Dc(10) Member 17 September, 2013 - 12:39 Are you willing to reply to a text message once a day with information about your comfort level at your indoor location? building comfort design improve incentive indoor message sms text Yes 50% (2 votes) No 0% (0 votes) Maybe if I had an incentive 25% (1 vote) Maybe if my reply is confidential and anonymous 0% (0 votes) Maybe if the data will be used to improve building design 25% (1 vote) Total votes: 4 Buildings account for roughly 40% of all U.S. energy use (70% of all electricity): residential buildings account for 22% of all U.S. energy use and commercial buildings account for 18% of all U.S. energy use[i]. There is an unanswered need for information about buildings in use and how building design affects building occupant comfort, productivity, and, by


Masquerader: High Mobility Group Box-1 and Cancer  

Science Journals Connector (OSTI)

...Since its identification a third of a century ago, the high-mobility group box-1...transcription factor modifications, including cAMP-responsive element binding protein...Since its identification a third of a century ago, the high-mobility group box-1...

Jessica E. Ellerman; Charles K. Brown; Michael de Vera; Herbert J. Zeh; Timothy Billiar; Anna Rubartelli; and Michael T. Lotze



Meter Damage: Many customers have questions about who is responsible for repair to the electrical service at their homes. These pages may help to answer  

E-Print Network [OSTI]

Meter Damage: Many customers have questions about who is responsible for repair. weather head stack meter base connectors house knob weather head connectors mast clamp stack meter base meter meter #12; Let's start with definitions: Meter base: This is the metal box mounted

Rose, Annkatrin


Whats the use of high-school physics texts?  

Science Journals Connector (OSTI)

Do students read physics texts? How do teachers use physics texts? How can students be persuaded to read the text? Should physics teachers encourage the reading of texts? These questions are addressed and recommendations are given for choosing a text for your high school physics class.

Physics Textbook Review Committee



Attn Technology Transfer Questions.txt - Notepad  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Attn Technology Transfer Questions.txt Attn Technology Transfer Questions.txt From: eschaput [esandc@prodigy.net] Sent: Monday, January 26, 2009 10:31 PM To: GC-62 Subject: Attn: Technology Transfer Questions We have reviewed the DOE "Questions Concerning Technology Transfer Practices at DOE Laboratories" (Federal Register notice of November 26, 2008), with the following comments and suggestions for your consideration. DOE asked five questions and the following thoughts be provided for your consideration: Question #1 - Are existing arrangements adequate? Answer #1 - The existing types of arrangement are generally adequate, but their application should be broadened and their implementation streamlined. a.. The application of "User Agreements" should be broadened to soften the effect


ICCS questions received by March 19, 2010  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

questions received by March 19, 2010 questions received by March 19, 2010 1. Is property tax on land or equipment directly attributable to the project eligible for cost share? 2. Is insurance, with coverage comparable to that purchased for similar projects, eligible for cost share (construction and operating)? Response: The answer to both questions is yes. The specific cost principle that the Applicants can go to for further information, as well as the regulations on cost sharing are given below. Question 1 - FAR Part 31.205-41, Taxes Question 2 - FAR Part 31.205-19, Insurance and Indemnification Cost Sharing regulations - 10 CFR 600.123; 10 CFR 600.224; or 10 CFR 600.313 Since both questions indicate that the costs to be incurred will be used as potential cost share for the project, additional details will be needed to verify and validate the


Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Question About Splitting Molecules "Can you use particle accelerators to break up molecules into their elements?" The short answer is yes. The long answer is more complicated. You...


Program Evaluation Topics and Questions Library  

Broader source: Energy.gov [DOE]

Menu of initial questions for a program administrator to use in developing a real-time evaluation survey to collect qualitative data from program contractors.

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


CRAD, Facility Safety - Unreviewed Safety Question Requirements...  

Broader source: Energy.gov (indexed) [DOE]

a recommended approach and the types of information to gather to assess elements of a DOE contractor's programs. CRAD, Facility Safety - Unreviewed Safety Question Requirements...


Measure Guideline: Optimizing the Configuration of Flexible Duct Junction Boxes  

SciTech Connect (OSTI)

This measure guideline offers additional recommendations to heating, ventilation, and air conditioning (HVAC) system designers for optimizing flexible duct, constant-volume HVAC systems using junction boxes within Air Conditioning Contractors of America (ACCA) Manual D guidance (Rutkowski, H. Manual D -- Residential Duct Systems, 3rd edition, Version 1.00. Arlington, VA: Air Conditioning Contractors of America, 2009.). IBACOS used computational fluid dynamics software to explore and develop guidance to better control the airflow effects of factors that may impact pressure losses within junction boxes among various design configurations (Beach, R., Prahl, D., and Lange, R. CFD Analysis of Flexible Duct Junction Box Design. Golden, CO: National Renewable Energy Laboratory, submitted for publication 2013). These recommendations can help to ensure that a system aligns more closely with the design and the occupants' comfort expectations. Specifically, the recommendations described herein show how to configure a rectangular box with four outlets, a triangular box with three outlets, metal wyes with two outlets, and multiple configurations for more than four outlets. Designers of HVAC systems, contractors who are fabricating junction boxes on site, and anyone using the ACCA Manual D process for sizing duct runs will find this measure guideline invaluable for more accurately minimizing pressure losses when using junction boxes with flexible ducts.

Beach, R.; Burdick, A.



Ballot box and tinder box : can electoral engineering save multiethnic democracy?  

E-Print Network [OSTI]

The objective of this dissertation is to systematize the existing hypotheses in the electoral engineering literature and to test them in a set of selected case studies in order to answer a central question: does the electoral ...

Liaras, Evangelos



Safeguards Approaches for Black Box Processes or Facilities  

SciTech Connect (OSTI)

The objective of this study is to determine whether a safeguards approach can be developed for black box processes or facilities. These are facilities where a State or operator may limit IAEA access to specific processes or portions of a facility; in other cases, the IAEA may be prohibited access to the entire facility. The determination of whether a black box process or facility is safeguardable is dependent upon the details of the process type, design, and layout; the specific limitations on inspector access; and the restrictions placed upon the design information that can be provided to the IAEA. This analysis identified the necessary conditions for safeguardability of black box processes and facilities.

Diaz-Marcano, Helly; Gitau, Ernest TN; Hockert, John; Miller, Erin; Wylie, Joann



Development of homogeneous mobile robots for box-pushing problem  

Science Journals Connector (OSTI)

This paper describes the development of a pair of homogeneous mobile robot using AT89C51 microcontroller with two 6V DC motors to address the box-pushing problem. In this work, two homogeneous mobile robots have been fully developed exclusively to address the box-pushing application that is described as ''Pushing a box-like solid item to reach the goal position already defined by more than one mobile robot through the cooperation among them''. Teaching the mobile robots using reinforcement learning is easier, because of specifying a reward function for every task completed by them.

C. Paramasivam; T. Sornakumar



Questions and Answers March 9, 2012  

E-Print Network [OSTI]

-602 Alternative Fuels Infrastructure: Electric, Natural Gas, Propane, E85 & Diesel Substitutes Terminals 5Questions and Answers March 9, 2012 for PON-11-602 Alternative Fuels Infrastructure: Electric, Natural Gas, Propane, E85 & Diesel Substitutes Terminals General Definitions/Clarification 1. QUESTION


BYU HONORS PROGRAM The Great Questions Requirement  

E-Print Network [OSTI]

, often provoked by new discoveries and developments in technology (e.g., questions of medical ethics, use developing the knowledge, skills, and disposition you will need to write the essay. The essay, therefore of natural resources, including very powerful ones like nuclear energy, etc.). These kinds of questions lie

Olsen Jr., Dan R.



Broader source: Energy.gov (indexed) [DOE]

TECHNOLOGY TRANSFER QUESTIONS..txt TECHNOLOGY TRANSFER QUESTIONS..txt From: Bob Fien [rfien@campbellap.com] Sent: Monday, January 26, 2009 5:34 PM To: GC-62 Subject: TECHNOLOGY TRANSFER QUESTIONS. Sensitivity: Confidential To Whom It May Concern, Campbell Applied Physics, Inc has been working with several DOE labs (e.g., Oak Ridge, Pacific Northwest, Laurence Livermore, Sandia) on various commercialization projects and, has been asked to submit answers to the questions presented in 72036 Federal Register / Vol. 73, No. 229 concerning our experiences. Please accept the following as our response to that request. 1. Existing and Other Agreements (4sub questions): The DOE labs currently offer CRADAs, WFO Agreements, and User Agreements, all briefly referenced below. The DOE Orders and model agreements for CRADAs, WFO and


Frequently Asked Questions | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

Programs > Nuclear Security > Nuclear Materials Programs > Nuclear Security > Nuclear Materials Management & Safeguards System > NMMSS Information, Reports & Forms > Frequently Asked Questions Frequently Asked Questions U.S. Department of Energy / U.S. Nuclear Regulatory Commission Nuclear Materials Management & Safeguards System Frequently Asked Questions (FAQs) User Frequently Asked Questions What is the History of NMMSS? What Are the Other Uses of NMMSS? NMMSS is sponsored by the National Nuclear Security Administration's (NNSA) Office of Materials Integration within the U.S. Department of Energy and the U.S. Nuclear Regulatory Commission Printer-friendly version Printer-friendly version Facebook Twitter Youtube Flickr Learn More Users Frequently Asked Questions What Are the Other Uses of NMMSS?


Questions and Answers for the Smart Grid Investment Grant Program...  

Energy Savers [EERE]

Questions and Answers for the Smart Grid Investment Grant Program: Frequently Asked Questions Questions and Answers for the Smart Grid Investment Grant Program: Frequently Asked...


EECBG Rebate Frequently Asked Questions | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Rebate Frequently Asked Questions EECBG Rebate Frequently Asked Questions This document contains Frequently Asked Questions about EECBG Rebates. finalrebatefaqs120104.pdf More...


Natural Gas from Shale: Questions and Answers | Department of...  

Broader source: Energy.gov (indexed) [DOE]

Shale: Questions and Answers Natural Gas from Shale: Questions and Answers Natural Gas from Shale: Questions and Answers More Documents & Publications Shale Gas Development...


Fermilab Legal Office - Ethics Program - Submit a Question  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Submit a Question Ask the Ethicist Ask the Ethicist Questions & Answers Submit a Question Annual Reminders Reporting Fraud Holiday Parties Complete the form below to submit a...


Questions and Answers for the Smart Grid Investment Grant Program...  

Broader source: Energy.gov (indexed) [DOE]

Questions and Answers for the Smart Grid Investment Grant Program: Buy American Questions and Answers for the Smart Grid Investment Grant Program: Buy American Additional questions...


"Black Box" EMC model for Power Electronics Converter Mikael Foissac  

E-Print Network [OSTI]

"Black Box" EMC model for Power Electronics Converter Mikael Foissac Grenoble Electrical electronics, Electromagnetic compatibility, Reduced order systems, Parameter estimation. I. INTRODUCTION With the generalization of the "Power by Wire" concept, especially in aircraft and automotive applications, the electrical

Paris-Sud XI, Université de


Black-box reductions for cost-sharing mechanism design  

Science Journals Connector (OSTI)

We consider the design of strategyproof cost-sharing mechanisms. We give two simple, but extremely versatile, black-box reductions, that in combination reduce the cost-sharing mechanism-design problem to the algorithmic problem of ...

Konstantinos Georgiou; Chaitanya Swamy



P.O. Box 117, Oak Ridge, TN 37831  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Box 117, Oak Ridge, TN 37831 g (865) 241-8893 g IVsurveys@orau.org On the Web: www.orau.orgenvironmental-assessments-health-physics Oak Ridge Associated Universities (ORAU) is a...


Y-12s Moon Box ? a big hit in Texas  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

on the national television networks and to explain about the "Moon Box" made in Oak Ridge. He was proud of that, but he downplayed the trip when he shared the story with me. He...


What is paradoxical about the "Three-box paradox"?  

E-Print Network [OSTI]

This paper is a comment on quant-ph/0606067 by Ravon and Vaidman, in which they defend the position that the ``three-box paradox'' is indeed paradoxical.

J. Finkelstein



Savings Project: Attic Stairs Cover Box | Department of Energy  

Energy Savers [EERE]

stairs provide an opportunity to improve comfort and save energy and money. You can air seal and insulate the attic stairs opening by building your own insulated cover box or...

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Questioning the questions that have been asked about the infant brain using near-infrared spectroscopy  

E-Print Network [OSTI]

Questioning the questions that have been asked about the infant brain using near-infrared, University of Rochester, Rochester, NY, USA Near-infrared spectroscopy (NIRS) is a noninvasive diffuse; Near-infrared spectroscopy. "Sheddinglight"onascientificquestiontookonnew meaning when

Aslin, Richard N.


Safety evaluation for packaging (onsite) depleted uranium waste boxes  

SciTech Connect (OSTI)

This safety evaluation for packaging (SEP) allows the one-time shipment of ten metal boxes and one wooden box containing depleted uranium material from the Fast Flux Test Facility to the burial grounds in the 200 West Area for disposal. This SEP provides the analyses and operational controls necessary to demonstrate that the shipment will be safe for the onsite worker and the public.

McCormick, W.A.



Questions and Answers | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

Questions and Answers | National Nuclear Security Administration Questions and Answers | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog The National Nuclear Security Administration Questions and Answers Home > About Us > Our Operations > Acquisition and Project Management > Major Contract Solicitations > Environmental Program Services Contract >


Dr. StrangeBox or : how I learned to stop worrying and love urban big box retail  

E-Print Network [OSTI]

Over the past decade, Big Box retailers have been trying to tap into urban markets after years of explicitly avoiding them in favor of suburban environments. In the past few years, retailers have begun experimenting with ...

Press, Jared Harding



Pacific Northwest Site Office P.O. BOX 350, Kg-42  

Broader source: Energy.gov (indexed) [DOE]

Pacific Northwest Site Office Pacific Northwest Site Office P.O. BOX 350, Kg-42 Richland, Washington 99352 JAN 1 8 2019 MEMORANDUM FOR SCOTT B. HARRIS, GENERAL COUNSEL OFFICE OF GENERAL COUNSEL FROM: SUBJECT: GC- I , HQ JULIE K. ERlCKSON PACIFIC NORTHWEST SITE OFFICE 20 1 1 ANNUAL NATIONAL ENVIRONMENTAL POLICY ACT (NEPA) PLANNING SUMMARY DOE 0 45 1.1B requires Secretarial Officers and Heads of Field Organizations to submit a Annual NEPA Planning Summary to the Office of General Counsel. We have consulted your December 8,201 0, memorandum, and guidance posted on the Office of NEPA Policy and Compliailce (GC-54) web site, and have no NEPA activities to report. If you have any questions, please contact me, or your staff may contact Theresa Aldridge, Operations Division, at (509) 372-4508, or Peter Siebach, Integrated Support Center - Chicago


Mr. R. B. Bell, Jr. Combustion Engineering, Inc. Post Office Box 500  

Office of Legacy Management (LM)

g@ *tq g@ *tq 47 e "Y q$ . -0 t: 2 ~ i' ,; B 0 e %d&$ Department of Energy Washington, DC 20585 Mr. R. B. Bell, Jr. Combustion Engineering, Inc. Post Office Box 500 Windsor, Connecticut 06095-0500 Dear Mr. Bell: I have received two copies of the access agreement for the radiological survey of the Combustion Engineering Property at 1000 Prospect Hill Road in Windsor. I have signed the agreements on behalf of the U.S. Department of Energy, and I am returning one signed original copy to you, By copy of this letter, I am requesting that the Oak Ridge Institute for Science and Education contact you or Mr. Moulton to make arrangements for the survey. If you have any questions or if I may be of assistance, please call me at 301-903-8149. Sincerely


Oak Ridge Associated Post Office Box 117 Universities Oak Ridge, Tennessee 37831-0117  

Office of Legacy Management (LM)

Associated Post Office Box 117 Universities Oak Ridge, Tennessee 37831-0117 June 19, 1990 Mr. James Wagoner, II FUSRAP Program Manager Decontamination and Decommissioning Division ' Office of Environmental .Restoration and Waste Management U.S. Department of Energy Washington, DC 20545 Subject: SCOPING VISIT TO FORMER ZUCKERMAN SITE - N. KENM( AVENUE, CHICAGO, ILLINOIS 0 9Yf onment ?ms Division IRE Dear Mr. Wagoner: On June 14, 1990, while in the Chicago area for several other meetings, Ms. Phyllis Cotten and I visited the site of the former Max Zuckerman and Sons 1 facility at 1925 N. Kenmore Avenue, Chicago. On the basis of the information provided in the Weston/OTS note of June 11, the building in question was assumed to be a l-1/2 story brick structure, adjacent to an alleyway. There were no street/


Last Call for Questions | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Last Call for Questions Last Call for Questions Last Call for Questions October 7, 2010 - 5:06pm Addthis Sec. Chu observes as workers demonstrate energy efficient water heaters. | Department of Energy Photo | Courtesy of National Renewable Energy Laboratory | Sec. Chu observes as workers demonstrate energy efficient water heaters. | Department of Energy Photo | Courtesy of National Renewable Energy Laboratory | John Schueler John Schueler Former New Media Specialist, Office of Public Affairs Just a quick reminder that the deadline for submitting your home energy efficiency questions directly to Secretary Chu is midnight tonight (10/07). We've already received some great queries and personal experiences but want to make sure the Secretary has a chance to respond to as many of you


Frequently Asked Questions | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Frequently Asked Questions Frequently Asked Questions Frequently Asked Questions November 1, 2013 - 11:40am Addthis Frequently asked questions (FAQs) and their corresponding answers regarding industrial distributed energy (DE) and combined heat and power (CHP) are provided below. What is CHP? Why is there so much interest in CHP? Is CHP the same as cogeneration? What is the difference between CHP, CCHP, BCHP, DER, IES? Why can't I use my backup generator for on-site power production? Backup generators have been around for decades, what is new about on-site power generation? What types of power generators can I buy? How are generators classified, what is a kW? What is a recuperator and why is it important? What is an HRSG? What is a desiccant dehumidifier? How do desiccant dehumidifiers use waste heat in a CHP system?


Response to Weatherization Questions | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Response to Weatherization Questions Response to Weatherization Questions Response to Weatherization Questions August 30, 2010 - 4:53pm Addthis Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs Last week as part of Vice President Biden's announcement of 200,000 homes weatherized under the Recovery act, we asked you to send us your questions and comments about the weatherization process. Today, we're following up with answers experts from the Department's Weatherization and Intergovernmental Program: 1) From edmooney via Twitter: @Energy Besides caulking, what are the best values in weatherization for the Northeast region. #weatherization Nationwide, the energy-efficient retrofits that consistently provide the best return on investment involve sealing gaps in the building envelope


The Big Questions For Biodiversity Informatics  

E-Print Network [OSTI]

of biodiversity information. This emerging field of biodiversity informatics has been growing quickly, but without overarching scientific questions to guide its development; the result has been developments that have no connection to genuine insight and forward...

Peterson, A. Townsend; Knapp, Sandra; Guralnick, Robert P.; Soberó n, Jorge; Holder, Mark T.




Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

rfien@campbellap.com Sent: Monday, January 26, 2009 5:34 PM To: GC-62 Subject: TECHNOLOGY TRANSFER QUESTIONS. Sensitivity: Confidential To Whom It May Concern, Campbell Applied...


Solar Instructor Training Network Frequently Asked Questions  

Broader source: Energy.gov [DOE]

These frequently asked questions (FAQs) relate to the solar instructor training network. This project was launched by the U.S. Department of Energy (DOE) Solar Energy Technologies Program (SETP or...


Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Pure Antineutron Beams Hello, I am a physics student in Germany. I haven't had particle physics yet, so I'd be glad if you answered me one question: How do you create more or less...


Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Question: How many studies have been done to figure out what escapes from the accelerators into the environment and how much of it escapes? I heard from a tour guide that...


Questions about Groundwater Conservation Districts in Texas  

E-Print Network [OSTI]

Groundwater conservation districts (GCDs) are being created in many parts of Texas to allow local citizens to manage and protect their groundwater. This publication answers frequently asked questions about groundwater and GCDs....

Lesikar, Bruce J.; Silvy, Valeen



BPA Transmission land acquisition frequently asked questions...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Q's and A's Questions and answers 1. What is the PEP form I'm receiving in the mail? BPA sends the Permission to Enter Property (PEP) form to all property owners along a...


Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Color of Atoms Mr. Pordes- I have a question for science. As you probably know, we have been studying all about particles and the particle model of matter and John Dalton and...


Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

How many neutrons? Dear Mrs. Pordes, Hello. My name is Andrew Schmidt. I am writing to you concerning a question I have. I am in your daughters science class and it would be...


Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

be quite right. Thank you for the opportunity to ask this question. Regards, Bob Dowe Hello Bob, Let us start from the beginning. First I have to tell you that there are usually...

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

appreciate it if you could send it to me. That would be awesome. Thanks Luke Luke - Hello. I am a scientist here at Fermilab and your question got forwarded to me. In some...


Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Why can radio waves pass through a wall but light cannot? Hello, My name is Mike P. and this is my question. If radio & light waves are both properties of the electromagnetic...


Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

proton and an anti electron (a positron, i do not know the anti particle of proton). Hello Killian, thanks for your very interesting question. When you talk about particles, the...


UESC Frequently Asked Questions Panel Discussion  

Broader source: Energy.gov [DOE]

Presentationgiven at the April 2012 Federal Utility Partnership Working Group (FUPWG) meetingcovers frequently asked questions (FAQs) about utility energy service contracts (UESCs), including term lengths, bonding, and a UESC within a utility's service territory.


Response to Weatherization Questions | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Response to Weatherization Questions Response to Weatherization Questions Response to Weatherization Questions August 30, 2010 - 4:53pm Addthis Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs Last week as part of Vice President Biden's announcement of 200,000 homes weatherized under the Recovery act, we asked you to send us your questions and comments about the weatherization process. Today, we're following up with answers experts from the Department's Weatherization and Intergovernmental Program: 1) From edmooney via Twitter: @Energy Besides caulking, what are the best values in weatherization for the Northeast region. #weatherization Nationwide, the energy-efficient retrofits that consistently provide the best return on investment involve sealing gaps in the building envelope



E-Print Network [OSTI]

AGREE-DISAGREE QUESTIONS: PROBLEMS AND SOME SOLUTIONS Allyson L. Holbrook Associate Professor that established a woman's right to an abortion?" #12;EXAMPLE SCALES: HANDBOOK OF MARKETING SCALES (2010) Ten

Illinois at Chicago, University of


Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

about learning, I'd like to cordially invite you to Physics Forums - Black Holes to the Speed of Light . Dear Stephen: Your question refers to the fact that "vacuum is not...


Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

between my friends and me. Theorhetical Question: If a vehicle was traveling at the speed of light and a light source was emitted from the vehicle would there be a visible...


The Glass Box offers a unique environment to support research, development and evaluation of software  

E-Print Network [OSTI]

The Glass Box offers a unique environment to support research, development and evaluation of software products used by workers performing real computer- based tasks. The Glass Box instrumentation and to retrieve, store, and share Glass Box data. · Test Bed environment­Glass Box serves as a test bed


Using question classification to model user intentions of different levels  

Science Journals Connector (OSTI)

User information need detection is a fundamental issue in automatic question answering systems. Based on real questions collected from on-line question answering communities, this paper proposes a three-level question type taxonomy to model user information ... Keywords: multi-label classification, pragmatics, question answering, three-level question type taxonomy, user intention modeling

Yaoyun Zhang; Xuan Wang; Xiaolong Wang; Shixi Fan; Daoxu Zhang



Integrated Box Interrogation System (IBIS) Preliminary Design Study  

SciTech Connect (OSTI)

Canberra Industries has won the tendered solicitation, INEEL/EST-99-00121 for boxed waste Nondestructive Assay Development and Demonstration. Canberra will provide the Integrated Box Interrogation System (IBIS) which is a suite of assay instrumentation and a data reduction system that addresses the measurement needs for Boxed Wastes identified in the solicitation and facilitates the associated experimental program and demonstration of system capability. The IBIS system will consist of the next generation CWAM system, i.e. CWAM II, which is a Scanning Passive/Active Neutron interrogation system which we will call a Box Segmented Neutron Scanner (BSNS), combined with a physically separate Box Segmented Gamma-ray Scanning (BSGS) system. These systems are based on existing hardware designs but will be tailored to the large sample size and enhanced to allow the program to evaluate the following measurement criteria:Characterization and correction for matrix heterogeneity Characterization of non-uniform radio-nuclide and isotopic compositions Assay of high density matrices (both high-Z and high moderator contents)Correction for radioactive material physical form - such as self shielding or multiplication effects due to large accumulations of radioactive materials.Calibration with a minimal set of reference standards and representative matrices.THis document summarizes the conceptual design parameters of the IBIS and indicates areas key to the success of the project where development is to be centered. The work presented here is a collaborative effort between scientific staff within Canberra and within the NIS-6 group at LANL.

DR. Stephen Croft; Mr. David Martancik; Dr. Brian Young; Dr. Patrick MJ Chard; Dr. Robert J Estop; Sheila Melton; Gaetano J. Arnone



Better Plants Look Ahead Webinar: Text Version  

Broader source: Energy.gov [DOE]

The Better Plants Program hosted a webinar on January 22, 2015 to review accomplishments to date and detail new initiatives to save partners energy and water. Question and answer session is included. Download presentation slides.


Questions and Answers - Which jobs use electromagnets?  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

does adding coils to anelectromagnet make it stronger? does adding coils to an<br>electromagnet make it stronger? Previous Question (Why does adding coils to an electromagnet make it stronger?) Questions and Answers Main Index Next Question (Why is a non-permanent, but long lasting, magnet called a permanent magnet?) Why is a non-permanent, but long lasting,magnet called a permanent magnet? Which jobs use electromagnets? In today's world almost all jobs other than a goat herder use some type of electromagnet. They are everywhere. Electric motors are a type of electromagnet. Cars have dozens of electromagnets that move things or generate electricity. There are all sorts of interesting applications for larger electromagnets. The most obvious and biggest example is electricity. There are some interesting applications like dumping shredded garbage


Questions and Answers - Who discovered the elements?  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Will scientists everfind smaller elements? Will scientists ever<br>find smaller elements? Previous Question (Will scientists ever find smaller elements?) Questions and Answers Main Index Next Question (What are boiling and melting points?) What are boiling and melting points? Who discovered the element gold, silver, copper, neon, etc...? Below is a list of all of the known elements, who they were discovered by and the year they were discovered. Some elements, such as gold, silver and iron, have been known since ancient times, so it is impossible to credit a single person for their discovery. Other elements were discovered around the same time by two or more scientists who were working independently of each other. In these cases, each scientist is listed along with the year they made their discovery. Other elements were discovered by teams of


Landowners' Frequently Asked Questions about Wind Development  

Wind Powering America (EERE)

Landowners' Frequently Asked Questions Landowners' Frequently Asked Questions about Wind Development 1 Landowners' Frequently Asked Questions about Wind Development Jay Haley, P.E. 1. How much money can I make? Based on wind projects in southern Minnesota and northern Iowa, landowners can expect to receive annual land-lease payments ranging from $2,000 to more than $4,000 per turbine. The amount depends on the size of the wind turbine and how much electricity it produces as well as the selling price of the electricity. The same turbine will produce more in one location than another depending on the annual average wind speed at the site. The payments typically represent from 2% to 4% of the annual gross revenue of the turbine. 2. How many turbines can be placed on a section of


Questions and Answers - What is a meniscus?  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

What is a material with a freezingpoint above 0 degrees Celsius? What is a material with a freezing<br>point above 0 degrees Celsius? Previous Question (What is a material with a freezing point above 0 degrees Celsius?) Questions and Answers Main Index Next Question (How can I explain the Quantum/Wave theory to my class?) How can I explain the Quantum/Wavetheory to my class? What is a meniscus? A meniscus is what happens when you put a liquid into a container. When you put water in a beaker or test tube, you see a curved surface. With most liquids, the attractive force between the liquid and the container is greater than the attraction between the individual liquid molecules. So the liquid "sticks" to the side of the container. Your teacher might have told you that you have to read the test tube to the


Frequently Asked Questions | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Frequently Asked Questions Frequently Asked Questions Frequently Asked Questions Q. Can contractors participate in the CFC? A. Generally contractors are not permitted to participate in CFC events. Contractor personnel, credit union employees and other persons present on Federal premises, as well as retired Federal employees, may make single contributions to the CFC through checks, money orders, or cash, or by electronic means, including credit cards. These non-Federal personnel may not be solicited, but donations offered by such persons must be accepted by the local campaigns. Q. I am online attempting to give through paperless payroll deduction; however I am only given the options of credit card, debit card or electronic check. Is paperless payroll deduction still a viable giving


Questions and Answers - Is krypton dangerous?  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

does krypton look like? does krypton look like? Previous Question (What does krypton look like?) Questions and Answers Main Index Next Question (Why aren't Cl-35 and Cl-37 two different elements?) Why aren't Cl-35 and Cl-37two different elements? Is krypton dangerous? Krypton is a gas that is found in small amounts in the earth's atmosphere. Krypton's atomic structure is very stable. It has just enough electrons to fill its outer 'shell', so it doesn't tend to combine with other elements. Since it doesn't combine with other elements, it doesn't take part in chemical reactions, so it will not burn, cause corrosion, or do other chemical-like things. It is, however, possible for krypton to hurt you. If, for example, a room were to be filled with krypton, anyone entering the room would most likely


Assessing Energy Resources Webinar Text Version | Department...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Text Version Assessing Energy Resources Webinar Text Version Download the text version of the audio from the DOE Office of Indian Energy webinar on assessing energy resources. DOE...


Clean Cities: IdleBox Toolkit for Idle-Reduction Projects  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

IdleBox Toolkit for Idle-Reduction IdleBox Toolkit for Idle-Reduction Projects to someone by E-mail Share Clean Cities: IdleBox Toolkit for Idle-Reduction Projects on Facebook Tweet about Clean Cities: IdleBox Toolkit for Idle-Reduction Projects on Twitter Bookmark Clean Cities: IdleBox Toolkit for Idle-Reduction Projects on Google Bookmark Clean Cities: IdleBox Toolkit for Idle-Reduction Projects on Delicious Rank Clean Cities: IdleBox Toolkit for Idle-Reduction Projects on Digg Find More places to share Clean Cities: IdleBox Toolkit for Idle-Reduction Projects on AddThis.com... Coordinator Basics Outreach Logos, Graphics, & Photographs Print Products & Templates Exhibit Booths Presentations Videos QR Codes Tips Education & Webinars Meetings Reporting Contacts IdleBox Toolkit for Idle-Reduction Projects

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Common Questions Why should I soil test?  

E-Print Network [OSTI]

Common Questions Why should I soil test? Soil testing is an important diagnostic tool to evaluate nutrient imbalances and understand plant growth. The most important reason to soil test is to have a basis for intelligent application of fertilizer and lime. Testing also allows for growers and homeowners to maintain

Isaacs, Rufus


Frequently Asked Questions 1. Technology Transfer  

E-Print Network [OSTI]

Frequently Asked Questions 1. Technology Transfer 2. Patent 3. Requirements for obtaining a patent is not addressed, please contact Colleen Michael at 631-344 -4919. #12;What is Technology Transfer? Technology Transfer is the process of developing practical applications for the results of scientific research


Extracting Simplified Statements for Factual Question Generation  

E-Print Network [OSTI]

Minister Vladimir V. Putin, the country's paramount leader, cut short a trip to Siberia, returning to Moscow to oversee the federal response. Mr. Putin built his reputation in part on his success set of questions:3 (2) Prime Minister Vladimir V. Putin is the country's paramount leader. (3) Prime

Eskenazi, Maxine



E-Print Network [OSTI]

BOMB THREAT CHECKLIST QUESTIONS TO ASK: 1. When is the bomb going to explode? 2. Where is it right ___Clearing Throat ___Laughter ___Deep Breathing __Crying ___Cracking voice __Normal ___Disguised THREAT __Foul ___Taped __Message read by threat maker __Irrational If voice is familiar, who did it sound like

Cui, Yan


Student Learning Commons Questions & Answers for Faculty  

E-Print Network [OSTI]

Student Learning Commons Questions & Answers for Faculty What is the SFU Student Learning Commons? The Student Learning Commons (SLC), is an academic learning centre which provides peer-based assistance with library reference, computer assistance, and other student academic support services. SLC programs


Preprocessing Documents to Answer Dutch Questions  

E-Print Network [OSTI]

Preprocessing Documents to Answer Dutch Questions Valentin Jijkoun Gilad Mishne Maarten de Rijke extraction of certain types of informa- tion from a document collection, and discuss its usage for answering track shows that our strategy yields a significant improvement in the performance of our overall system

Jijkoun, Valentin


Physics 321 Exam 1 Sample Questions  

E-Print Network [OSTI]

of motion. Briefly explain the meaning of each law. 4. Describe one case where Newton's third law does .T At what frequency is the response a maximum? What does FWHM mean? What is the expression we usePhysics 321 Exam 1 Sample Questions 1. Write the second order differential equation as two first

Hart, Gus


Rangeland ecology: Key global research issues & questions  

E-Print Network [OSTI]

1 Rangeland ecology: Key global research issues & questions Robin Reid and Maria Fernandez-Gimenez This paper discusses developments in our understanding about rangeland ecology and rangeland dynamics in the last 20 years. Before the late 1980's, the mainstream view in range ecology was that livestock


Question and Answers Alternative Fuel Readiness Plans  

E-Print Network [OSTI]

Question and Answers Alternative Fuel Readiness Plans PON-13-603 September 3, 2013 Eligibility Q1 to readiness plans? A1 This solicitation is limited to readiness planning only for alternative fuels. Q2 In regards to PON-13-603 - Alternative Fuel Readiness Plans, is electricity used for transportation


Background Material Important Questions about Magnetism  

E-Print Network [OSTI]

Background Material Important Questions about Magnetism: 1) What is Magnetism?Magnetism is a force or repulsion due to charge is called the electric force. But what about magnetism, is there a fundamental property of some matter that makes things magnetic? The answer is: "sort of." Electric current

Mojzsis, Stephen J.


Fish and Wildlife Management Questions and RM&E Strategies Key Management Questions  

E-Print Network [OSTI]

1 Fish and Wildlife Management Questions and RM&E Strategies Key Management Questions 1. Are we meeting biological and programmatic performance objectives established within the Columbia Basin Fish implemented and accomplished as proposed? Strategic Category: Fish Population Status Monitoring The following


Middle School Academic Question Resources | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

Academic Question Resources Academic Question Resources National Science Bowl® (NSB) NSB Home About High School Middle School Middle School Students Middle School Coaches Middle School Regionals Middle School Rules, Forms, and Resources Academic Question Resources Make Your Own National Science Bowl® Competition Buzzer Sample Questions Attending National Event Volunteers 2013 Competition Results News Media WDTS Home Contact Information National Science Bowl® U.S. Department of Energy SC-27/ Forrestal Building 1000 Independence Ave., SW Washington, DC 20585 P: 202-586-6702 E: National.Science.Bowl@science.doe.gov Middle School Rules, Forms, and Resources Academic Question Resources Print Text Size: A A A RSS Feeds FeedbackShare Page For Science: Discovery http://www.discovery.com External link Nature http://www.nature.com External link


Hanford Speakers Bureau

Frequently Asked Questions - Hanford...

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Speakers Bureau > Hanford Speakers Bureau Frequently Asked Questions Hanford Speakers Bureau Hanford Speakers Bureau Request Form Hanford Speakers Bureau Frequently Asked Questions...


Electric Vehicle Deployment: Policy Questions and Impacts to...  

Broader source: Energy.gov (indexed) [DOE]

Vehicle Deployment: Policy Questions and Impacts to the U.S. Electric Grid - EAC Recommendations (November 2011) Electric Vehicle Deployment: Policy Questions and Impacts to the...


Frequently Asked Questions on Energy Efficiency and Conservation...  

Broader source: Energy.gov (indexed) [DOE]

Frequently Asked Questions on Energy Efficiency and Conservation Block Grant Financing Program Compliance and Reporting Frequently Asked Questions on Energy Efficiency and...


Questions and Issues on Hydrogen Pipelines: Pipeline Transmission...  

Broader source: Energy.gov (indexed) [DOE]

Questions and Issues on Hydrogen Pipelines: Pipeline Transmission of Hydrogen Questions and Issues on Hydrogen Pipelines: Pipeline Transmission of Hydrogen Pipping of GH2 Pipeline....


DOE response to questions from AHAM on the supplemental proposed...  

Energy Savers [EERE]

response to questions from AHAM on the supplemental proposed test procedure for residential clothes washers DOE response to questions from AHAM on the supplemental proposed test...


48C Qualifying Advanced Energy Project Credit Questions | Department...  

Broader source: Energy.gov (indexed) [DOE]

Credit Questions More Documents & Publications 48C Qualifying Advanced Energy Project Credit Questions FACT SHEET: 48C MANUFACTURING TAX CREDITS Microsoft Word -...


Home Energy Score: Frequently Asked Questions for Partners |...  

Broader source: Energy.gov (indexed) [DOE]

Partners Home Energy Score: Frequently Asked Questions for Partners Below you will find answers to frequently asked questions for homeowners and Partners about the Home Energy...


SCE Responses to Customer Data Questions  

Broader source: Energy.gov (indexed) [DOE]

SCE Responses to Customer Data Questions SCE Responses to Customer Data Questions 1. Who owns energy consumption data? SCE Response: Customer-specific data gathered or developed by a utility in the course of providing utility services is owned by the utility. Such data is subject to confidentiality and privacy requirements. In California, customers have the right to access their customer- specific information and can authorize third-party access to their information. 2. Who should be entitled to privacy protections relating to energy information? SCE Response: All customers receiving electric service from a utility should be entitled to privacy protections relating to their customer-specific energy information. Furthermore, utilities should not be required to enforce the compliance of customer-authorized third

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Frequently Asked Questions | Superconducting Magnet Division  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Frequently Asked Questions Frequently Asked Questions What is the official EMS Policy at BNL? Refer to the Environmental, Safety, Security, and Health policy. What do you know about EMS? Refer to the information on the Process Evaluations web page. What are the environmental aspects related to your work? An environmental aspect is a waste or an operating/work activity that, if done improperly or if a component fails, could pollute the environment. Some environmental aspects are: Hazardous waste, radioactive waste, atmospheric discharge, soil activation, storage/use of chemicals, etc. For a listing of the SMD Significant Aspects and Processes see the Aspects Matrix (pdf) and the Summary of Significant Aspects. You can also find more information see the Pollution Prevention web page.


EMSL: About EMSL: Frequently Asked Questions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

EMSL Frequently Asked Questions EMSL Frequently Asked Questions What is EMSL's Mission? The Environmental Molecular Sciences Laboratory (EMSL), a U.S. Department of Energy (DOE) national scientific user facility located at Pacific Northwest National Laboratory (PNNL) in Richland, Washington, provides integrated experimental and computational resources for discovery and technological innovation in the environmental molecular sciences to support the needs of DOE and the nation. What is a DOE Scientific User Facility? The Office of Science oversees the construction and operation of some of the Nation's most advanced scientific research and development user facilities, located at national laboratories and universities. These state-of-the-art facilities are made available to the science community


Frequently Asked Questions | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

Operations > Management and Budget > Human Resources Operations > Management and Budget > Human Resources > Pay-banding > Frequently Asked Questions Frequently Asked Questions General What is a demonstration project? What employees are affected by the pay-banding and pay-for-performance demonstration project? When was pay-banding implemented? What is the duration of the demonstration project? What happens after 5 years? What is the process for converting employees from the pay-banding system back to the General Schedule system (in the event of a transfer to another federal agency)? What is a share? What occupational series will be covered in each career path? Conversions What is the process for converting employees to pay-banding? How does conversion to a pay band affect an employee's next step increase?



Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

QUESTIONS BY AREA OF INTEREST : AOI #4 QUESTIONS BY AREA OF INTEREST : AOI #4 Q4. How does the application process work? We are getting conflicting information with the Federal Stimulus money that we need to go through the Clean Cities Coalitions. Do they need to be the applicants? Or can they just be partners in our project? Same with the Transit Authorities..originally we did not need them to be a partner; however, new information states we need to have both the Clean Cities Coalitions and local Transit Authority as participants/applicants? A. For Areas of Interest #1-3, there are no restrictions to eligibility for apply for funds. While it is not mandatory that the applicant be a Clean Cities coalition (designated or non-designated), it is strongly encouraged that teams include one or more Clean Cities


Fermilab | Tune IT Up | Questions & Answers  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Questions & Answers Questions & Answers Posted: November 18, 2009 (Updated on November 24, 2009) Q. I am located at CERN and have no computers at FNAL. My personal laptop is a CERN laptop. Do I still have to complete the Tune IT Up assessment? A. If it is not an FNAL-owned computer at CERN, you do not need to complete the assessment. Posted: September 15, 2009 Q. For which computers do I need to fill out the Tune IT Up assessment? I have a personal desktop and laptop. But I also manage and/or am the custodian for various other servers at Fermilab. A. You should complete the assessment only for the desktop, laptop or smart phone you personally use to do your work. There is no need to do it for servers. Posted: September 15, 2009 Q. If the person who uses a computer is not the person who manages it, who


Biomass Webinar Text Version | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Text Version Biomass Webinar Text Version Dowload the text version of the audio from the DOE Office of Indian Energy webinar on biomass. DOE Office of Indian Energy Foundational...


Solar Webinar Text Version | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Text Version Solar Webinar Text Version Download the text version of the audio from the DOE Office of Indian Energy webinar on solar renewable energy. DOE Office of Indian Energy...


Discordances ontologiques et questions d'interoprabilit  

E-Print Network [OSTI]

liens, et en quoi elles sont pertinentes pour les sciences sociales. Mots clés : Epistémologie, ontologie, interopérabilité, intégration de schémas, homologie structurale Summary : Beyond the search terrain d'étude ethnologique. Après avoir quelque peu précisé ces deux questions, ainsi que les liens qu

Boyer, Edmond


Hanford Workers Achieve Success in Difficult Glove Box Project at Plutonium  

Broader source: Energy.gov (indexed) [DOE]

Workers Achieve Success in Difficult Glove Box Project at Workers Achieve Success in Difficult Glove Box Project at Plutonium Finishing Plant Hanford Workers Achieve Success in Difficult Glove Box Project at Plutonium Finishing Plant June 26, 2013 - 12:00pm Addthis Team members gather for a photo after safely and successfully completing a complicated glove box separation. Team members gather for a photo after safely and successfully completing a complicated glove box separation. Workers separate highly contaminated glove boxes from their connection points in Hanford’s Plutonium Finishing Plant. Workers separate highly contaminated glove boxes from their connection points in Hanford's Plutonium Finishing Plant. Workers pull a glove box apart and encase each section in a protective covering to prevent exposure.


E-Print Network 3.0 - arc box test Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

box test Search Powered by Explorit Topic List Advanced Search Sample search results for: arc box test Page: << < 1 2 3 4 5 > >> 1 Fat arcs for implicitly defined curves Szilvia...


A Text-book of Mechanical Engineering  

Science Journals Connector (OSTI)

... MR. LINEHAM says that the desirability of writing his book was suggested to him by the initiative ... and (2) whether it was desirable so to compress it. After examining Mr. Lineham's book, we must confess to feeling grave doubt whether the second question, at ...



Questions and Answers - What is plasma?  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Why do protons and neutronshave the same mass? Why do protons and neutrons<br>have the same mass? Previous Question (Why do protons and neutrons have the same mass?) Questions and Answers Main Index Next Question (How do you know plasma is real if you can't see it?) How do you know plasmais real if you can't see it? What is plasma? Plasma is the fourth state of matter. Many places teach that there are three states of matter; solid, liquid and gas, but there are actually four. The fourth is plasma. To put it very simply, a plasma is an ionized gas, a gas into which sufficient energy is provided to free electrons from atoms or molecules and to allow both species, ions and electrons, to coexist. The funny thing about that is, that as far as we know, plasmas are the most common state of matter in the universe. They are even common here on earth.


Controlling a Steel Mill with BOXES Michael McGarity, Claude Sammut and David Clements  

E-Print Network [OSTI]

Controlling a Steel Mill with BOXES Michael McGarity, Claude Sammut and David Clements and Chambers (1968) to a large-scale, real-world problem, namely, learning to control a steel mill. By applying BOXES to a model of a skinpass mill (a type of steel mill), we find that the BOXES algorithm can be made

Sammut, Claude


Autodesk MapGuide: There Is No Box Presenter: Jason Birch City of Nanaimo  

E-Print Network [OSTI]

Autodesk MapGuide®: There Is No Box Presenter: Jason Birch ­ City of Nanaimo Assistants: Andrew "think outside the box" to get your job done. Autodesk MapGuide Enterprise 2007 has blown the box wide portal at http://earth.nanaimo.ca/ jason.birch@nanaimo.ca More AU 2006 class information at www.autodesk

Ahmad, Sajjad


PO Box 6050, Irvine, CA 92616-6050 www.extension.uci.edu Accounting Courses  

E-Print Network [OSTI]

PO Box 6050, Irvine, CA 92616-6050 www.extension.uci.edu Accounting Courses (Not a Certificate Program) #12;PO Box 6050, Irvine, CA 92616-6050 www.extension.uci.edu LIST OF COURSES Course # Accounting://learn.uci.edu for more information on how the online courses work. Revised 9/27/12 #12;PO Box 6050, Irvine, CA 92616

Barrett, Jeffrey A.


Queen mandibular pheromone: questions that remain to be resolved  

E-Print Network [OSTI]

Department of Zoology, University of Otago, P.O. Box 56, Dunedin 9054, New Zealand Received 11 July 2011 is an effective attractant over large distances and elicits highly predictable responses in flying drones


2013 Better Buildings Federal Award Frequently Asked Questions  

Broader source: Energy.gov [DOE]

Document answers frequently asked questions for the Federal Energy Management Program's 2013 Better Buildings Federal Award.


Building Technologies Office: Frequently Asked Questions About the  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Frequently Asked Frequently Asked Questions About the Buildings Performance Database to someone by E-mail Share Building Technologies Office: Frequently Asked Questions About the Buildings Performance Database on Facebook Tweet about Building Technologies Office: Frequently Asked Questions About the Buildings Performance Database on Twitter Bookmark Building Technologies Office: Frequently Asked Questions About the Buildings Performance Database on Google Bookmark Building Technologies Office: Frequently Asked Questions About the Buildings Performance Database on Delicious Rank Building Technologies Office: Frequently Asked Questions About the Buildings Performance Database on Digg Find More places to share Building Technologies Office: Frequently Asked Questions About the Buildings Performance Database on AddThis.com...


Environment/Health/Safety/Security (EHSS): Tool Box Safety Topics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Tool Box Safety Topics Tool Box Safety Topics A Review of Haz com standards A Single Second Accident Prevention Acetone Use and Care Aerial Work Platforms Afterthoughts and Regrets Alcohol & the Job Allergies, Antihistamines Appreciating the Hazards, Oxyacetylene Attitude and Behavior Avoid Common Office Injuries Avoiding Electrical Shocks Back Care Back Injury Prevention Backing into Trouble Basic Machine Safety Battery Charging Hazards Be Cautious with Sulfuric Acid Be Prepared for Emergencies Bench & Pedestal Grinders Blood Borne Pathogens Carbon Monoxide Care for Half-Mask Respirators Carelessness Cargo Dock Safety CDT's-How you prevent them Chocking and Blocking Cold Medication.Drowsiness Cold Weather Hazards for Propane Powered Vehicles Come-a-Longs, Hoists & Chains Common Sense & Accidents


Box Canyon Motel Space Heating Low Temperature Geothermal Facility | Open  

Open Energy Info (EERE)

Motel Space Heating Low Temperature Geothermal Facility Motel Space Heating Low Temperature Geothermal Facility Jump to: navigation, search Name Box Canyon Motel Space Heating Low Temperature Geothermal Facility Facility Box Canyon Motel Sector Geothermal energy Type Space Heating Location Ouray, Colorado Coordinates 38.0227716°, -107.6714487° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[]}

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Black Box Approach for Energy Monitoring of Commercial Buildings  

E-Print Network [OSTI]

Page 1 of paper submitted to ICEBO 2008 Berlin Black Box Approach for Energy Monitoring of Commercial Buildings Susanne Komhard M.Sc. student Fraunhofer-Institute for Solar Energy Systems Freiburg, Germany Christian Neumann Project... leader Fraunhofer-Institute for Solar Energy Systems Freiburg, Germany ABSTRACT The potential to save energy by changing operational parameters - especially in existing commercial buildings ? is in the magnitude of 5-30%. In order to realize...

Komhard, S.; Neumann, C.


Multiple-state quantum Otto engine, 1D box system  

SciTech Connect (OSTI)

Quantum heat engines produce work using quantum matter as their working substance. We studied adiabatic and isochoric processes and defined the general force according to quantum system. The processes and general force are used to evaluate a quantum Otto engine based on multiple-state of one dimensional box system and calculate the efficiency. As a result, the efficiency depends on the ratio of initial and final width of system under adiabatic processes.

Latifah, E., E-mail: enylatifah@um.ac.id [Laboratory of Theoretical Physics and Natural Philosophy, Physics Department, Institut Teknologi Sepuluh Nopember, ITS, Surabaya, Indonesia and Physics Department, Malang State University (Indonesia); Purwanto, A. [Laboratory of Theoretical Physics and Natural Philosophy, Physics Department, Institut Teknologi Sepuluh Nopember, ITS, Surabaya (Indonesia)



Frequently Asked Questions | DOE Data Explorer  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Scientific and Technical Information (OSTI). Hundreds of web pages were researched in order to identify the data and other non-text information referenced in the collection...


V-189: Oracle VirtualBox 'tracepath' Bug Lets Local Guest Users Deny  

Broader source: Energy.gov (indexed) [DOE]

9: Oracle VirtualBox 'tracepath' Bug Lets Local Guest Users 9: Oracle VirtualBox 'tracepath' Bug Lets Local Guest Users Deny Service on the Target Host V-189: Oracle VirtualBox 'tracepath' Bug Lets Local Guest Users Deny Service on the Target Host July 1, 2013 - 12:48am Addthis PROBLEM: Oracle VirtualBox 'tracepath' Bug Lets Local Guest Users Deny Service on the Target Host PLATFORM: VirtualBox 4.2.12 ABSTRACT: A vulnerability was reported in Oracle VirtualBox. REFERENCE LINKS: VirtualBox ticket: 11863 SecurityTracker Alert ID: 1028712 IMPACT ASSESSMENT: Medium DISCUSSION: A local user on the guest operating system can issue a 'tracepath' command to cause the network on the target host system to become unavailable. IMPACT: A local user on a guest operating system can cause denial of service conditions on the target host system.


Can An Evolutionary Process Create English Text?  

E-Print Network [OSTI]

MD, 2002. [Foster1991] David Foster, The PhilosophicalEnglish text. For example, David Foster, in a book skeptical

Bailey, David H.



Text Redelegation Procedures - DOE Directives, Delegations, and...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Text Redelegation Procedures by Website Administrator Delegation Procedures Redelegation Procedures Redelegation Procedures for Functional Area Managers This page contains...


Strategic Energy Planning Webinar Text Version  

Broader source: Energy.gov [DOE]

Download the text version of the audio from the DOE Office of Indian Energy webinar on strategic energy planning.


matlab-help-text Inverse Secant.  

E-Print Network [OSTI]

matlab-help-text asec CSC acsc cot acot exp log logic sqrt abs angle conj imag real fix floor ceil and right. Page 2 #12;matlab-help-text axis zoom grid legend - title xiabel - ylabel - mesh surf fills. Echo commands in M-files. Control paged output in command window. Save text of MATLAB session. set

Kleinfeld, David


Incremental Hierarchical Clustering of Text Documents  

E-Print Network [OSTI]

in incremental clustering of text documents as a part of Topic Detection and Tracking initiative ([1], [19], [10Incremental Hierarchical Clustering of Text Documents by Nachiketa Sahoo Adviser: Jamie Callan May 5, 2006 Abstract Incremental hierarchical text document clustering algorithms are important

Gordon, Geoffrey J.


Frontiers of biomedical text mining: current progress  

E-Print Network [OSTI]

Frontiers of biomedical text mining: current progress Pierre Zweigenbaum, Dina Demner-Fushman, Hong of biomedical text mining continue to present interesting challenges and opportunities for great improvements and interesting research. In this article we review the current state of the art in biomedical text mining or `Bio

Yu, Hong


Frequently Asked Questions | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

Frequently Asked Questions Frequently Asked Questions Albert Einstein Distinguished Educator Fellowship (AEF) Program Einstein Fellowship Home Eligibility Benefits Obligations How to Apply Key Dates Frequently Asked Questions Contact WDTS Home Frequently Asked Questions Print Text Size: A A A RSS Feeds FeedbackShare Page TABLE OF CONTENTS General Eligibility Applications Selection Participation Contacts GENERAL When is the application deadline? Applications are due Wednesday December 4, 2013 at 5:00pm EST, including three letters of recommendation. How do I apply? You can apply by going to the application website, which can be reached here External link . Back to Top Back to Top ELIGIBILITY I'm currently in my fifth year of teaching high school, am I eligible to apply? No, you must have completed five years of full-time teaching at the time of


Frequently Asked Questions | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

Frequently Asked Questions Frequently Asked Questions Laboratory Policy and Evaluation (LPE) LPE Home Staff M&O Contracts SC Laboratory Appraisal Process Laboratory Planning Process Work for Others in the Office of Science Laboratory Directed Research and Development (LDRD) DOE's Philosophy on LDRD Frequently Asked Questions Success Stories Brochures Additional Information LDRD Program Contacts Technology Transfer DOE National Laboratories Contact Information Laboratory Policy and Evaluation U.S. Department of Energy SC-32/Forrestal Building 1000 Independence Ave., SW Washington, DC 20585 P: (202) 586-5447 F: (202) 586-3119 Laboratory Directed Research and Development (LDRD) Frequently Asked Questions Print Text Size: A A A RSS Feeds FeedbackShare Page The U.S. Department of Energy/National Nuclear Security Administration


H.D. Cochran, Questions for the Workshop | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

H.D. Cochran, H.D. Cochran, Questions for the Workshop Chemical Sciences, Geosciences, & Biosciences (CSGB) Division CSGB Home About Research Areas Scientific Highlights Reports & Activities Principal Investigators' Meetings BES Home Third DOE BES Separations Research Workshop H.D. Cochran, Questions for the Workshop Print Text Size: A A A RSS Feeds FeedbackShare Page Third DOE/Basic Energy Sciences Separations Research Workshop Savannah DeSoto Hilton, Savannah, Georgia May 12-14, 1999 Questions for the Workshop H. D. Cochran Oak Ridge National Laboratory Dr. Cochran took the approach of asking questions of the audience that would stimulate discussion amongst the members of the workshop. The following are the results of some of the discussion that ensued. Nanoscience: When alluding to nanoscience, new DOE initiatives seem to be


User Facilities Frequently Asked Questions | U.S. DOE Office of Science  

Office of Science (SC) Website

User Facilities Frequently User Facilities Frequently Asked Questions User Facilities ASCR User Facilities BES User Facilities BER User Facilities FES User Facilities HEP User Facilities NP User Facilities User Facilities Frequently Asked Questions User Facility Science Highlights Contact Information Office of Science U.S. Department of Energy 1000 Independence Ave., SW Washington, DC 20585 P: (202) 586-5430 User Facilities Frequently Asked Questions Print Text Size: A A A RSS Feeds FeedbackShare Page The Office of Science User Facilities are a unique resource for the Nation's researchers. Below are answers to some commonly asked questions. What is a user facility? A user facility is a federally sponsored research facility available for external use to advance scientific or technical knowledge under the


Gene expression profiling--Opening the black box of plant ecosystem responses to global change  

SciTech Connect (OSTI)

The use of genomic techniques to address ecological questions is emerging as the field of genomic ecology. Experimentation under environmentally realistic conditions to investigate the molecular response of plants to meaningful changes in growth conditions and ecological interactions is the defining feature of genomic ecology. Since the impact of global change factors on plant performance are mediated by direct effects at the molecular, biochemical and physiological scales, gene expression analysis promises important advances in understanding factors that have previously been consigned to the 'black box' of unknown mechanism. Various tools and approaches are available for assessing gene expression in model and non-model species as part of global change biology studies. Each approach has its own unique advantages and constraints. A first generation of genomic ecology studies in managed ecosystems and mesocosms have provided a testbed for the approach and have begun to reveal how the experimental design and data analysis of gene expression studies can be tailored for use in an ecological context.

Leakey, A.D.B.; Ainsworth, E.A.; Bernard, S.M.; Markelz, R.J.C.; Ort, D.R.; Placella, S.A.P.; Rogers, A.; Smith, M.D.; Sudderth, E.A.; Weston, D.J.; Wullschleger, S.D.; Yuan, S.



Frequently Asked Questions … Certification Grace Period  

Broader source: Energy.gov (indexed) [DOE]

AUGUST 17, 2010 AUGUST 17, 2010 Manufacturers and/or private labelers who have not submitted a certification report and compliance statement for the products identified in Question 1 are in violation of Federal regulations and are subject to enforcement, including civil penalties and injunctive action to prohibit distribution of covered products in commerce in the United States. You should submit the required documents immediately in order to limit potential civil penalties. The information provided below is intended to help companies understand their responsibilities under the energy efficiency/water conservation regulations, with respect to the requirement to certify compliance with the regulations. It is not intended to create or remove any rights or duties, nor is it intended to affect any other aspect of EPCA or


Career Opportunities - Frequently Asked Questions | Argonne National  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Apply for a Job Apply for a Job Connect with Argonne LinkedIn Facebook Twitter YouTube Google+ More Social Media » Career Opportunities - Frequently Asked Questions How do I apply for a job at Argonne? Using Argonne's online application system, create a profile. Note that if you have your resume handy (in Microsoft Word or PDF format), you can upload it, and basic information will be extracted and populate the profile fields. Once you complete your profile, you can apply to any job openings that match your skills and qualifications by logging into the system. Where do I find the online application system? You can find links that will allow you to search full- and part-time openings, postdoctoral openings, or student openings by clicking the appropriate link on the APPLY FOR A JOB page.


Frequently Asked Questions … Certification Grace Period  

Broader source: Energy.gov (indexed) [DOE]

MARCH 16, 2010 MARCH 16, 2010 Manufacturers and/or private labelers who have not submitted a certification report and compliance statement for the products identified in Question are in violation of Federal regulations and are subject to enforcement, including civil penalties and injunctive action to prohibit distribution of covered products in commerce in the United States. You should submit the required documents immediately in order to limit potential civil penalties. 1 The information provided below is intended to help companies understand their responsibilities under the energy efficiency/water conservation regulations, with respect to the requirement to certify compliance with the regulations. It is not intended to create or remove any rights or duties, nor is it intended to affect any other aspect of EPCA or


Carlsbad Field Office P. O. Box 3090 Carlsbad  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

if you have any questions regarding this transmittal. cc: )6se R. al1ager ( Carlsbad Field Office S. Holmes, NMED * ED T. Kliphuis , NMED ED R. Maestas, NMED ED C....


Hydroelectric Webinar Presentation Slides and Text Version  

Broader source: Energy.gov [DOE]

Download presentation slides and a text version of the audio from the DOE Office of Indian Energy webinar onhydroelectric renewable energy.

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Manufacturing Ecosystems and Keystone Technologies (Text Version)  

Broader source: Energy.gov [DOE]

This is a text version of the Manufacturing Ecosystems and Keystone Technologies video, originally presented on March 12, 2012 at the MDF Workshop held in Chicago, Illinois.


Solid-State Lighting: Frequently Asked Questions About the Technology  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Frequently Asked Questions Frequently Asked Questions About the Technology Demonstration GATEWAY Program to someone by E-mail Share Solid-State Lighting: Frequently Asked Questions About the Technology Demonstration GATEWAY Program on Facebook Tweet about Solid-State Lighting: Frequently Asked Questions About the Technology Demonstration GATEWAY Program on Twitter Bookmark Solid-State Lighting: Frequently Asked Questions About the Technology Demonstration GATEWAY Program on Google Bookmark Solid-State Lighting: Frequently Asked Questions About the Technology Demonstration GATEWAY Program on Delicious Rank Solid-State Lighting: Frequently Asked Questions About the Technology Demonstration GATEWAY Program on Digg Find More places to share Solid-State Lighting: Frequently Asked Questions About the Technology Demonstration GATEWAY Program on


#AskEnergySaver: Answering Your Home Heating Questions | Department...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Us Now Addthis Now's your chance to ask Energy Department experts your questions about saving energy at home. This month, we're answering your questions about home heating. |...


Questions remain on funding for cleanup of Oak Ridge Reservation...  

Office of Environmental Management (EM)

Questions remain on funding for cleanup of Oak Ridge Reservation Questions remain on funding for cleanup of Oak Ridge Reservation March 18, 2013 - 12:00pm Addthis There is great...


Nano Lect 1 Questions and Keypoints Key Points  

E-Print Network [OSTI]

Nano Lect 1 ­ Questions and Keypoints Key Points 1. What is nano technology: a. Very small technology with device in the 1nm to 100nm lots of useful properties Questions 1. Define nanotechnology. Is an nano

Smy, Tom


Antidepressants' Black-Box Warning 10 Years Later  

Science Journals Connector (OSTI)

...adolescents, 1.4 million young adults, and 5 million older adults researchers examined automated health care claims data (for 2000 to 2010) derived from 11 health plans in the U.S. Mental Health Research Network. The study revealed significant reductions in antidepressant use within 2 years after... In 2004, the FDA issued a black-box warning linking antidepressants to an increased risk of suicidal thinking, feeling, and behavior in young people. But some worrisome trends suggest that the warning may inadvertently discourage appropriate treatment of depression.

Friedman R.A.



An experimental investigation of a general quadrilateral torsion box  

E-Print Network [OSTI]

'10497 FC ~2 0. 1359 FC At point (46, 17) (Gage $4) o' = 0. 63127 F 2 ? -0. 3209 F At point (26, 21) (Gage $5) 0 = 0. 41414 F 1 ' C 0 2 0'20800 FC To determine the theoretical direction of the principal stresses, the bisector of angle PZQ (Fig. 1... OF FIGURES Figure Page 1. Plan View of Top Panel. Torsion-Box Loading Schematic Strain Gage Orientation 13 Load-Stress Curve Comparison, Gages 2 and 6 22 Load-Stress Curve, Gage 7. Load-Stress Curve, Gage 8. Load-Stress Curve, Gage 9. 28 29 Load...

Champlin, James Lund



2015 Federal Energy and Water Management Awards: Frequently Asked Questions  

Broader source: Energy.gov [DOE]

Document answers frequently asked questions about the 2015 Federal Energy and Water Management Awards' guidelines and criteria for nominations.


Questions and Answers from Storage Pre-Solicitation Meeting  

Broader source: Energy.gov [DOE]

Questions and Answers from "Grand Challenge" Hydrogen Storage Pre-Solicitation Meeting held June 19, 2003 in Washington, DC


Frequently Asked Questions About the Building Performance Database  

Broader source: Energy.gov [DOE]

On this page you will find answers to frequently asked questions pertaining to the DOE Buildings Performance Database (BPD).


Weatherization Assistance Program (WAP) Closeout Frequently Asked Questions  

Broader source: Energy.gov [DOE]

This document provides a list of frequently asked questions in regards to the Weatherization Assistance Program (WAP) Closeout procedures.


Text-book on Practical Astronomy  

Science Journals Connector (OSTI)

... of civil engineering students, who are unlikely to take up a more advanced study of astronomy, and to produce a text-book intermediate between those formally devoted to ... , and to produce a text-book intermediate between those formally devoted to astronomy and geodesy, and the short chapter on ...

H. B. G.



Improved Answer Ranking in Social Question-Answering Portals  

E-Print Network [OSTI]

@cl.uni-heidelberg.de ABSTRACT Community QA portals provide an important resource for non-factoid question; Community question answering; Query expansion 1. INTRODUCTION Community Question-Answering (QA) portals can more recent work deploys Yahoo! Answers data for complete QA [24, 25], we focus on the aspect of answer

Riezler, Stefan


Questions about? Needing help wards? Worried about? Who can  

E-Print Network [OSTI]

Questions about? Needing help wards? Worried about? Who can bout? Needing help with? Headi can help? Questio g towards? Worrie elp? Questions about? Needing he bout? Needing help with? Headi ed about? Who can help? Quest ng help with? Heading towards? W an help? Questions about? Needin ng towards? Worried

Netoff, Theoden


Terminological variants for document selection and question/answer matching  

E-Print Network [OSTI]

retrieved documents. The QALC system, presented in this paper, participated to the Question Answering track documents. The QALC system, presented in this paper, participated to the Question Answering track in the documents. 1 Introduction The Question Answering (QA) track at TREC8 and TREC9 is due to the recent need

Illouz, Gabriel



Gasoline and Diesel Fuel Update (EIA)

202(96/3Q) 202(96/3Q) Distribution Category UC-950 Short-Term Energy Outlook Quarterly Projections Third Quarter 1996 Energy Information Administration Office of Energy Markets and End Use U.S. Department of Energy Washington, DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the Department of Energy. The information contained herein should not be construed as advocating or reflecting any policy position of the Department of Energy or any other organization. Contacts The Short-Term Energy Outlook is prepared by the Energy Information Administration (EIA), Office of Energy Markets and End Use (EMEU). General questions concerning the content of the report may be referred to W. Calvin Kilgore (202-586-1617), Director of EMEU; Mark Rodekohr (202-586-1441), Director of Energy Markets and Contingency


Satellite Television Industry Meeting Regarding DOE Set-Top Box Rulemaking  

Broader source: Energy.gov (indexed) [DOE]

Satellite Television Industry Meeting Regarding DOE Set-Top Box Satellite Television Industry Meeting Regarding DOE Set-Top Box Rulemaking Satellite Television Industry Meeting Regarding DOE Set-Top Box Rulemaking On April 3, 2012 at 11:00 AM, representatives of the U.S. satellite television industry, listed below, met with the DOE officials, listed below, at the Forestall Building to discuss matters of concern to the U.S. satellite television industry regarding the pending DOE rulemaking to establish energy conservation standards on set-top boxes (STBs) under title Ill of the Energy Policy and Conservation Act of 1974, as amended. Memo_Ex_Parte_Comm.pdf More Documents & Publications DOE's Proposed Coverage Determination for Set-Top Boxes Ex Parte Memorandum on Set Top Boxes and Network Equipment Docket No. EERE-2012-BT-TP-0046; RIN 1904-AC52


Questions and Answers for the Smart Grid Investment Grant Program:  

Broader source: Energy.gov (indexed) [DOE]

Meter Installations Meter Installations Questions and Answers for the Smart Grid Investment Grant Program: Reporting of Meter Installations Questions and answers related to the reporting of meter installations in the SmartGrid Integrated Project Reporting Information System (SIPRIS), both for the intial report and subsequent reports. Projects reporting jobs are part of the Smart Grid Investment Grant Project under the American Recovery and Reinvestment Act. Questions and Answers for the Smart Grid Investment Grant Program: Reporting of Meter Installations More Documents & Publications Questions and Answers for the Smart Grid Investment Grant Program: Reporting Webinar Questions and Answers for the Smart Grid Investment Grant Program: Reporting of Jobs Created/Retained in SIPRIS


Users Frequently Asked Questions | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

Users Frequently Asked Questions | National Nuclear Security Administration Users Frequently Asked Questions | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Users Frequently Asked Questions Home > About Us > Our Programs > Nuclear Security > Nuclear Materials Management & Safeguards System > NMMSS Information, Reports & Forms > Frequently Asked Questions > Users Frequently Asked Questions


Terminal Box Airflow Reset: An Effective Operation and Control Strategy for Comfort Improvement and Energy Conservation  

E-Print Network [OSTI]

terminal boxes, the maximum potential zone load during unoccupied hours must be considered. The airflow reset may be implemented using the terminal box controller only. However, central control systems may have to be used for most of the existing... control systems. One method is to develop two control schedules (occupied and unoccupied). Based on the time, the central control system automatically switch between two schedules. (downloads the un-occupied schedule to the terminal box controller...

Liu, M.; Abbas, M.; Zhu, Y.; Claridge, D. E.


Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Semantic associative network for text analysis (SANTA)  

E-Print Network [OSTI]

Based on theories of associations, the Semantic Associative Network for Text Analysis (SANTA) has been developed. Nodes in the network represent words and links between nodes represent the association strengths between them. The links are adjusted...

Airhart, Robert William



Using Thesaurus to Improve Multiclass Text Classification  

Science Journals Connector (OSTI)

With the growing amount of textual information available on the Internet, the importance of automatic text classification has been increasing in the last decade. In this paper, a system was presented for the clas...

Nooshin Maghsoodi



Improving Persian Text Classification Using Persian Thesaurus  

Science Journals Connector (OSTI)

This paper proposes an innovative approach to improve the performance of Persian text classification. The proposed method uses a thesaurus as a helpful knowledge to obtain the ... Three types of relationships are...

Hamid Parvin; Behrouz Minaei-Bidgoli



MDF Form and Function (Text Version)  

Broader source: Energy.gov [DOE]

This is a text version of the Manufacturing Demonstration Facilities (MDF) Form and Function video, originally presented on March 12, 2012 at the MDF Workshop held in Chicago, Illinois.



E-Print Network [OSTI]

GENERATING TEXT DESCRIPTIONS FOR GEOGRAPHICALLY DISTRIBUTED SENSORS Martin Molina and Javier generation of geographic descriptions in natural language for geographically distributed sensors. We describe generation of geographic descriptions in natural language for geographically distributed sensors. We describe

Molina, Martín


Names: a new frontier in text mining  

Science Journals Connector (OSTI)

Over the past 15 years the government has funded research in information extraction, with the goal of developing the technology to extract entities, events, and their interrelationships from free text for further analysis. A crucial component of linking ...

Frankie Patman; Paul Thompson



Names: A New Frontier in Text Mining  

Science Journals Connector (OSTI)

Over the past 15 years the government has funded research in information extraction, with the goal of developing the technology to extract entities, events, and their interrelationships from free text for furt...

Frankie Patman; Paul Thompson



Frequently Asked Questions about the Office of Energy Efficiency and  

Broader source: Energy.gov (indexed) [DOE]

Frequently Asked Questions about the Office of Energy Efficiency Frequently Asked Questions about the Office of Energy Efficiency and Renewable Energy Frequently Asked Questions about the Office of Energy Efficiency and Renewable Energy Below are some of the questions we are regularly asked at EERE. These frequently asked questions cover topics such as EERE, tax credits and financial assistance, home energy, vehicles, industry, and energy education and training. If you don't find the answer to your question, please contact us with your question. General Information What does EERE stand for? What does the EERE do? Tax Credits and Financial Assistance Are there federal tax credits available for energy improvements to my home or business? Can I get a grant or other financial assistance to help me develop my energy-related innovation?


Building Technologies Office: Home Energy Score Frequently Asked Questions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Home Energy Score Home Energy Score Frequently Asked Questions to someone by E-mail Share Building Technologies Office: Home Energy Score Frequently Asked Questions on Facebook Tweet about Building Technologies Office: Home Energy Score Frequently Asked Questions on Twitter Bookmark Building Technologies Office: Home Energy Score Frequently Asked Questions on Google Bookmark Building Technologies Office: Home Energy Score Frequently Asked Questions on Delicious Rank Building Technologies Office: Home Energy Score Frequently Asked Questions on Digg Find More places to share Building Technologies Office: Home Energy Score Frequently Asked Questions on AddThis.com... About Take Action to Save Energy Partner With DOE Activities Solar Decathlon Building America Home Energy Score Get Involved


Questions and Answers for the Smart Grid Investment Grant Program:  

Broader source: Energy.gov (indexed) [DOE]

Questions and Answers for the Smart Grid Investment Grant Program: Questions and Answers for the Smart Grid Investment Grant Program: Miscellaneous Questions and Answers for the Smart Grid Investment Grant Program: Miscellaneous Additional questions and answers from recipients of awards under the Smart Grid Investment Grant Program on the Buy American provision of the American Recovery and Reinvestment Act. Questions and Answers for the Smart Grid Investment Grant Program: Miscellaneous More Documents & Publications Questions and Answers for the Smart Grid Investment Grant Program: Confidentiality (Revised Answer) Q&A for the Smart Grid Investment Program: National Environmental Policy Act (NEPA), January 29, 2010 Questions and Answers for the Smart Grid Investment Grant Program: Davis-Bacon / Buy American Relationship,


Benchmarking and Equipment and Controls Assessment for a 'Big Box' Retail Chain  

E-Print Network [OSTI]

Assessment for a Big Box Retail Chain Philip Haves andperformance of existing and new retail stores belonging to aenergy performance of retail stores of relatively standard

Haves, Philip



C-340 ST-90 Boxes Solid Waste Management Unit (SWMU) Assessment...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)



E-Print Network 3.0 - automobile black boxes Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Search Powered by Explorit Topic List Advanced Search Sample search results for: automobile black boxes Page: << < 1 2 3 4 5 > >> 1 Detecting Automobiles and People for...


Black-Box Test Case Generation from TFM Module Interface Specications and Usage Statistics.  

E-Print Network [OSTI]

??In this thesis, we propose a black-box testing method that derives important test cases by including usage statistics, and enables a product manager to make (more)

Iwata, Katsuya



GesText: accelerometer-based gestural text-entry systems  

Science Journals Connector (OSTI)

Accelerometers are common on many devices, including those required for text-entry. We investigate how to enter text with devices that are solely enabled with accelerometers. The challenge of text-entry with such devices can be overcome by the careful ... Keywords: accelerometers, gestural input, mid-air, text-entry

Eleanor Jones; Jason Alexander; Andreas Andreou; Pourang Irani; Sriram Subramanian



Guided Text Search Using Adaptive Visual Analytics  

SciTech Connect (OSTI)

This research demonstrates the promise of augmenting interactive visualizations with semi- supervised machine learning techniques to improve the discovery of significant associations and insights in the search and analysis of textual information. More specifically, we have developed a system called Gryffin that hosts a unique collection of techniques that facilitate individualized investigative search pertaining to an ever-changing set of analytical questions over an indexed collection of open-source documents related to critical national infrastructure. The Gryffin client hosts dynamic displays of the search results via focus+context record listings, temporal timelines, term-frequency views, and multiple coordinate views. Furthermore, as the analyst interacts with the display, the interactions are recorded and used to label the search records. These labeled records are then used to drive semi-supervised machine learning algorithms that re-rank the unlabeled search records such that potentially relevant records are moved to the top of the record listing. Gryffin is described in the context of the daily tasks encountered at the US Department of Homeland Security s Fusion Center, with whom we are collaborating in its development. The resulting system is capable of addressing the analysts information overload that can be directly attributed to the deluge of information that must be addressed in the search and investigative analysis of textual information.

Steed, Chad A [ORNL; Symons, Christopher T [ORNL; Senter, James K [ORNL; DeNap, Frank A [ORNL



Energy and exergy efficiencies of a solar box-cooker  

Science Journals Connector (OSTI)

A simple and low-cost box-type solar cooker (SBC) was designed and tested. The energy and exergy efficiencies of the SBC were experimentally evaluated. The energy output of the SBC ranges from 2.1 to 61.7 kJ, whereas the exergy output ranges from 0.4 to 6.2 kJ during the same time interval. The average daily energy and exergy outputs of the SBC are 21.6 and 2.5 kJ, respectively. A linear regression is developed to find the relationships between the energy/exergy outputs, and the efficiencies and temperature difference. The energy efficiency of the SBC varies between 1.3 and 55.6%, while the exergy efficiency varies between 0.3 and 6% during the same period. The average daily energy and exergy efficiencies of the SBC are 18.3 and 2.2%, respectively.

H. Huseyin Ozturk



Calculations of electronic states in ultrasmall quantum boxes of diamond  

Science Journals Connector (OSTI)

The electronic structure of ultrasmall quantum boxes (QBs) of diamond with (110) ( 1 1 0 ) and (001) planes saturated by hydrogen is calculated using the extended Hckel-type nonorthogonal tight-binding method. It is shown that in contrast to the QBs with the ideal surfaces which show a clear dependence of the lowest unoccupied molecular orbital (LUMO) energy on the size variation along the [001] direction the energy of the LUMO state in the QBs with a monohydrogenated dimer on the (001) surface depends little on the size variation in agreement with the experiment. It is found that the LUMO state in the latter is surfacelike in character and associated with backbonds of the surface dimers. It is also demonstrated that optical transitions across the energy gap exhibit significant oscillator strength.

Masahiko Nishida



Learning a semantic database from unstructured text  

E-Print Network [OSTI]

In this paper, we aim to learn a semantic database given a text corpus. Specifically, we focus on predicting whether or not a pair of entities are related by the hypernym relation, also known as the 'is-a' or 'type-of' ...

Dhandhania, Keshav



Standardization of corpus texts for the NEID  

E-Print Network [OSTI]

Standardization of corpus texts for the NEID Kevin P. Scannell Saint Louis University May 22, 2009, on paper Entries drafted between Mar. '50 ­ Aug. '56 Standard reference since its publication in 1959 Oifigiúil "The Official Standard" for Irish spelling and grammar, laid out in the 1940's and 1950's

Scannell, Kevin Patrick

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Weeks Lecture Topics Text Reading 1 Introduction  

E-Print Network [OSTI]

Weeks Lecture Topics Text Reading 1 Introduction Measurement and Units Ch 1, Sec 1-6 2 Motion-8 Common Exam 1 Ch. 1 - Ch.3 6 Energy -Work, Kinetic Energy, Work-Energy Theorem Ch. 6, Sec. 1, 3 7 Energy -Potential Energy, Mechanical Energy, Energy conservation, Power Ch. 6, Sec. 4-7, 9, 10 8 Momentum


Computerizing Mathematical Text with MathLang  

Science Journals Connector (OSTI)

Mathematical texts can be computerized in many ways that capture differing amounts of the mathematical meaning. At one end, there is document imaging, which captures the arrangement of black marks on paper, while at the other end there are proof assistants ... Keywords: theorem provers, logical foundations of mathematics, mathematical knowledge management, mathematical typesetting, mathematical vernacular, proof assistants, proof checkers

Fairouz Kamareddine; J. B. Wells




E-Print Network [OSTI]

, and metasearch engines. Key Words: search engine, Web, Surface Web, Deep Web, Web crawler, text retrieval, Vector and the Deep Web (or Hidden Web) (Bergman 2000). The former refers to the collection of web pages) it has more than 45 billion web pages according to www.worldwidewebsize.com. The Deep Web contains web

Meng, Weiyi


Frequently Asked Questions | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

Frequently Frequently Asked Questions Science Undergraduate Laboratory Internships (SULI) SULI Home Eligibility Benefits Participant Obligations How to Apply Key Dates Frequently Asked Questions Contact WDTS Home Frequently Asked Questions Print Text Size: A A A RSS Feeds FeedbackShare Page TABLE OF CONTENTS General Eligibility Applications Selection Participation Sponsor GENERAL When is the application deadline? The application deadline for the 2014 Summer SULI Term is January 10, 2014 5:00 PM ET. Who administers this program for the Department of Energy? The DOE Office of Workforce Development for Teachers and Scientists (WDTS) manages this program in collaboration with the DOE National Laboratories who host the student participants. Back to Top Back to Top ELIGIBILITY Can I apply if I don't currently have legal permanent resident alien (PRA)


Frequently Asked Questions | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

Frequently Frequently Asked Questions Community College Internships (CCI) CCI Home Eligibility Benefits Participant Obligations How to Apply Key Dates Frequently Asked Questions Contact WDTS Home Frequently Asked Questions Print Text Size: A A A RSS Feeds FeedbackShare Page TABLE OF CONTENTS General Eligibility Applications Selection Participation Sponsor GENERAL When is the application deadline? The application deadline for the 2014 Summer CCI Term is January 10, 2014 5:00 PM ET. Who administers the CCI program for the Department of Energy? The DOE Office of Workforce Development for Teachers and Scientists manages this program in collaboration with the DOE National Laboratories who host the student participants. Back to Top Back to Top ELIGIBILITY Can I apply if I don't currently have legal permanent resident alien (PRA)


Frequently Asked Questions | U.S. DOE Office of Science (SC)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Frequently Frequently Asked Questions Small Business Innovation Research (SBIR) and Small Business Technology Transfer (STTR) SBIR/STTR Home About Join the SBIR/STTR Mailing List Frequently Asked Questions Staff Events Funding Opportunity Announcements (FOAs) Applicant and Awardee Resources Commercialization Assistance Other Resources Awards SBIR/STTR Highlights Reporting Fraud Contact Information Small Business Innovation Research and Small Business Technology Transfer U.S. Department of Energy SC-29/Germantown Building 1000 Independence Ave., SW Washington, DC 20585 P: (301) 903-5707 F: (301) 903-5488 E: sbir-sttr@science.doe.gov More Information » About Frequently Asked Questions Print Text Size: A A A RSS Feeds FeedbackShare Page Is my company eligible to submit a DOE Phase I SBIR or STTR grant


Scientists Look to the Clouds to Solve Complex Questions | U.S. DOE Office  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Scientists Scientists Look to the Clouds to Solve Complex Questions News Featured Articles 2014 2013 2012 2011 2010 2009 2008 2007 2006 2005 Science Headlines Presentations & Testimony News Archives Contact Information Office of Science U.S. Department of Energy 1000 Independence Ave., SW Washington, DC 20585 P: (202) 586-5430 10.14.09 Scientists Look to the Clouds to Solve Complex Questions Cloud Computing May Offer More Efficient and Economical Opportunities to Address Complex Scientific Questions Print Text Size: A A A Subscribe FeedbackShare Page The holiday shopping season is just around the corner and many consumers turn to the convenience of online shopping to avoid the crowds while completing their gift lists. Many companies turn to cloud computing to ensure their online services can handle the increased customer load.


Frequently Asked Questions | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

Frequently Frequently Asked Questions Visiting Faculty Program (VFP) VFP Home Eligibility Benefits Participant Obligations How to Apply Key Dates Frequently Asked Questions Contact WDTS Home Frequently Asked Questions Print Text Size: A A A RSS Feeds FeedbackShare Page TABLE OF CONTENTS General Eligibility Applications Selection Participation Sponsor GENERAL When is the application deadline? The application deadline for the 2014 VFP Summer Term for both faculty applicants and invited students participants is January 10, 2014 5:00 PM ET. What are the differences between the Visiting Faculty Program (VFP) and the former Faculty and Student Teams (FaST) Program? There are several changes that have been implemented with the VFP. Some of these changes are: The application deadline for the Summer Term is now much earlier.


Got a Question? We Have an Answer! | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Got a Question? We Have an Answer! Got a Question? We Have an Answer! Got a Question? We Have an Answer! January 28, 2011 - 10:52am Addthis Elizabeth Spencer Communicator, National Renewable Energy Laboratory Editor's Note: This entry has been cross-posted from energysavers.gov. Have you ever had a question-maybe about energy efficiency, renewable energy, the Department of Energy or the like-and not had any idea where to find the answer? Have you ever gone through the Office of Energy Efficiency and Renewable Energy's website and not known where to find what you're looking for? The reason I am asking all these questions is because I want to bring your attention to a well-established resource that you might not know about: the EERE Information Center! You can call us, e-mail your question, or contact us through a new "live


Appliance Rebates: Frequently Asked Questions | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Appliance Rebates: Frequently Asked Questions Appliance Rebates: Frequently Asked Questions Appliance Rebates: Frequently Asked Questions April 26, 2010 - 4:55pm Addthis Andrea Spikes Communicator at DOE's National Renewable Energy Laboratory The appliance rebate program has been wildly successful in many states. So successful, in fact, that people have plenty of questions and aren't always finding the answers they need. Whether you're just learning about the appliance rebate program or have some nagging questions, I hope this information is helpful to you. For the most up-to-date information on rebates in your state, click on your state on Approved Energy Efficient Appliance Rebate Programs. Below is a list of the most common questions, taken from the Energy Savers Appliance Rebates page. (Note: The FAQs below are current as of this


Questions about how plants die leads to climate change answers  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Questions about how plants die leads to climate change answers Questions about how plants die leads to climate change answers Questions about how plants die leads to climate change answers Understanding mechanisms of mortality will provide important input to future climate forecasts. March 12, 2012 Tree in the desert The scientists' goal is to provide basic insights into questions such as how plants die, especially during drought. While the question of plant mortality is easy to conceptualize, it is difficult to study because of the spatial and temporal variation of processes over the plant. Get Expertise Researcher Michelle Espy Applied Modern Physics Email Researcher Sanna Sevanto Earth System Observations Email While the question of plant mortality is easy to conceptualize, it is difficult to study because of the spatial and temporal variation of


Appliance Rebates: Frequently Asked Questions | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Appliance Rebates: Frequently Asked Questions Appliance Rebates: Frequently Asked Questions Appliance Rebates: Frequently Asked Questions April 26, 2010 - 4:55pm Addthis Andrea Spikes Communicator at DOE's National Renewable Energy Laboratory The appliance rebate program has been wildly successful in many states. So successful, in fact, that people have plenty of questions and aren't always finding the answers they need. Whether you're just learning about the appliance rebate program or have some nagging questions, I hope this information is helpful to you. For the most up-to-date information on rebates in your state, click on your state on Approved Energy Efficient Appliance Rebate Programs. Below is a list of the most common questions, taken from the Energy Savers Appliance Rebates page. (Note: The FAQs below are current as of this


Questions and Answers for the Smart Grid Investment Grant Program:  

Broader source: Energy.gov (indexed) [DOE]

Questions and Answers for the Smart Grid Investment Grant Program: Questions and Answers for the Smart Grid Investment Grant Program: Reporting of Jobs Created/Retained in SIPRIS Questions and Answers for the Smart Grid Investment Grant Program: Reporting of Jobs Created/Retained in SIPRIS Questions and answers related to the reporting of jobs in the SmartGrid Integrated Project Reporting Information System (SIPRIS), both for the intial report and subsequent reports. Projects reporting jobs are part of the Smart Grid Investment Grant Project under the American Recovery and Reinvestment Act. Questions and Answers for the Smart Grid Investment Grant Program: Reporting of Jobs Created/Retained in SIPRIS More Documents & Publications Questions and Answers for the Smart Grid Investment Grant Program: Reporting Webinar Recovery Act Recipient Reporting on FederalReporting.gov


Forty Most Asked Questions Concerning CEQ's National Environmental Policy  

Broader source: Energy.gov (indexed) [DOE]

Forty Most Asked Questions Concerning CEQ's National Environmental Forty Most Asked Questions Concerning CEQ's National Environmental Policy Act Regulations Forty Most Asked Questions Concerning CEQ's National Environmental Policy Act Regulations The Council on Environmental Quality, as part of its oversight of implementation of the National Environmental Policy Act, held meetings in the ten Federal regions with Federal, State, and local officials to discuss administration of the implementing regulations. The forty most asked questions were compiled in a memorandum to agencies for the information of relevant officials. G-CEQ-40Questions.pdf More Documents & Publications "Frequently Asked Questions" on the Department of Energy's NEPA Regulations Guidance Regarding NEPA Regulations Policy and Procedures for the Review of Federal Actions Impacting the


Combining the Box Structure Development Method and CSP for Software Development  

Science Journals Connector (OSTI)

In this paper, we combine the Box Structure Development Method (BSDM) [H.D. Mills, R.C. Linger, and A.R. Hevner. Principles of Information Systems Analysis and Design. Academic Press, 1986, S.J. Prowell, C.J. Trammell, R.C. Linger, and J.H. Poore. Cleanroom ... Keywords: Box Structure Development Method, CSP, FDR, Software design verification

Philippa J. Hopcroft; Guy H. Broadfoot



EnergyBox: A Trace-driven Tool for Data Transmission Energy Consumption Studies  

E-Print Network [OSTI]

EnergyBox: A Trace-driven Tool for Data Transmission Energy Consumption Studies Ekhiotz Jon Vergara-awareness and propose EnergyBox, a tool that provides accurate and repeatable en- ergy consumption studies for 3G and WiFi transmissions at the user end. We recognize that the energy consumption of data transmission is highly


Regulating the ethylene response of a plant by modulation of F-box proteins  

SciTech Connect (OSTI)

The invention relates to transgenic plants having reduced sensitivity to ethylene as a result of having a recombinant nucleic acid encoding a F-box protein, and a method of producing a transgenic plant with reduced ethylene sensitivity by transforming the plant with a nucleic acid sequence encoding a F-box protein.

Guo, Hongwei (La Jolla, CA); Ecker, Joseph R. (Carlsbad, CA)



Grey-box modeling of an ocean vessel for operational optimization  

Science Journals Connector (OSTI)

Operational optimization of ocean vessels, both off-line and in real-time, is becoming increasingly important due to rising fuel cost and added environmental constraints. Accurate and efficient simulation models are needed to achieve maximum energy efficiency. In this paper a grey-box modeling approach for the simulation of ocean vessels is presented. The modeling approach combines conventional analysis models based on physical principles (a white-box model) with a feed forward neural-network (a black-box model). Two different ways of combining these models are presented, in series and in parallel. The results of simulating several trips of a medium sized container vessel show that the grey-box modeling approach, both serial and parallel approaches, can improve the prediction of the vessel fuel consumption significantly compared to a white-box model. However, a prediction of the vessel speed is only improved slightly. Furthermore, the results give an indication of the potential advantages of grey-box models, which is extrapolation beyond a given training data set and the incorporation of physical phenomena which are not modeled in the white-box models. Finally, included is a discussion on how to enhance the predictability of the grey-box models as well as updating the neural-network in real-time.

Leifur . Leifsson; Hildur Svarsdttir; Sven . Sigursson; Ari Vsteinsson



1Black Box Software Testing Copyright 2003 Cem Kaner The Role of Testers in XP  

E-Print Network [OSTI]

1Black Box Software Testing Copyright © 2003 Cem Kaner The Role of Testers in XP Cem Kaner August reflect the views of the National Science Foundation (NSF). #12;2Black Box Software Testing Copyright © 2003 Cem Kaner Testing: The Traditional View · Many years ago, the software development community


Questions and Answers for the Smart Grid Investment Grant Program...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Questions and Answers for the Smart Grid Investment Grant Program: Applicability of Buy American Provision of Section 1605 of the Recovery Act to Projects Under the Smart Grid...

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


FW Response to Notice of Inquire on Questions Concerning Technology...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

esponse to Notice of Inquire on Questions Concerning Technology Transfer Tractices at DOE Laboratories. From: Malozemoff, Alex AMalozemoff@amsc.com Sent: Tuesday, January 27,...


Questions about how plants die leads to climate change answers  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Questions about how plants die leads to climate change answers Understanding mechanisms of mortality will provide important input to future climate forecasts. March 12, 2012 Tree...


Frequently Asked Questions about the CALiPER Program  

Broader source: Energy.gov [DOE]

This page addresses many of the questions manufacturers, testing laboratories, consumers, retailers, and energy efficiency program sponsors may have about the DOE SSL Commercially Available LED...


Policy in question: from problem solving to problematology.  

E-Print Network [OSTI]

??Since the postpositivist critique of the policy sciences, policy theory has come into question. More particularly, the ??problem orientation?? upon which Lasswell defined the policy (more)

Turnbull, Nicholas James



Council on Environmental Quality - Forty Most Asked Questions...  

Open Energy Info (EERE)

-FortyMostAskedQuestionsConcerningCEQ%27sNEPARegulations&oldid790920" Categories: References Geothermal References Solar References Utilities References Bulk Transmission...


Questions and Answers about National Environmental Policy Act...  

Energy Savers [EERE]

(DOE) State Energy Program (SEP) in the DOE Office of Energy Efficiency and Renewable Energy. sepnepafaqs.pdf More Documents & Publications Questions and Answers on the...


#AskEnergySaver: Answering Your Home Heating Questions | Department...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

month, we're answering your questions about home heating. | Graphic by Sarah Gerrity, Energy Department. Allison Lantero Allison Lantero Digital Content Specialist, Office of...


#AskEnergySaver: Answering Your Weatherization Questions | Department...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

month, we're answering your questions about weatherization. | Graphic by Sarah Gerrity, Energy Department. Allison Lantero Allison Lantero Digital Content Specialist, Office of...


Frequently Asked Questions About the Technology Demonstration GATEWAY Program  

Broader source: Energy.gov [DOE]

This page addresses many of the questions about the DOE Solid-State Lighting Technology Demonstration GATEWAY program raised by potential eligible participants, such as manufacturers, demonstration...


Sample Questions | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

Regionals High School Rules, Forms, and Resources Sample Questions National Science Bowl (NSB) NSB Home About High School High School Students High School Coaches High...


Sample Questions | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

Regionals Middle School Rules, Forms, and Resources Sample Questions National Science Bowl (NSB) NSB Home About High School Middle School Middle School Students Middle...



E-Print Network [OSTI]

applications (AppFT). In either database, select Quick Search. 2. Enter the first search term in "Term 1" box. Select the field to search. 3. Enter the second term, if any, in the "Term 2" box. Select the field 1. In the Quick Search "Term 1" box, enter the main class/subclass. Select the field: "Current US

Liblit, Ben


X-rays Illuminate Ancient Archimedes Text  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Related Links: Related Links: May 2005 Headlines TIP Article Press Release Walters Art Museum SSRL Home Page SLAC Home Page Stanford Home Page Tuesday, 31 May 2005 X-rays Illuminate Ancient Archimedes Text (contact: Uwe Bergmann, bergmann@slac.stanford.edu) Archimedes Figure Image provided by Will Noel, The Walters Art Museum An early transcription of Archimedes' mathematical theories has been brought to light through the probing of high-intensity x-rays at SSRL's BL6-2. The text contains part of the Method of Mechanical Theorems, one of Archimedes' most important works, which was probably copied out by a scribe in the tenth century. The parchment on which it was written was later scraped down and reused as pages in a twelfth century prayer book, producing a document known as a palimpsest (which comes from the Greek,


Lab Ahead of Schedule Processing Waste in Large Boxes | Department of  

Broader source: Energy.gov (indexed) [DOE]

Lab Ahead of Schedule Processing Waste in Large Boxes Lab Ahead of Schedule Processing Waste in Large Boxes Lab Ahead of Schedule Processing Waste in Large Boxes March 30, 2012 - 12:00pm Addthis A framework agreement between DOE and the State of New Mexico calls for the Lab’s TRU Waste Program to ship 3,706 cubic meters of combustible or dispersible transuranic waste to WIPP for permanent disposal by June 30, 2014. A framework agreement between DOE and the State of New Mexico calls for the Lab's TRU Waste Program to ship 3,706 cubic meters of combustible or dispersible transuranic waste to WIPP for permanent disposal by June 30, 2014. Processing waste in large boxes is ahead of schedule due to worker skill, efficient processing and good planning. Processing waste in large boxes is ahead of schedule due to worker skill,


Recovery Act Begins Box Remediation Operations at F Canyon | Department of  

Broader source: Energy.gov (indexed) [DOE]

Recovery Act Begins Box Remediation Operations at F Canyon Recovery Act Begins Box Remediation Operations at F Canyon Recovery Act Begins Box Remediation Operations at F Canyon May 17, 2011 - 12:00pm Addthis Media Contacts Jim Giusti, DOE (803) 952-7697 james-r.giusti@srs.gov Paivi Nettamo, SRNS (803) 646-6075 paivi.nettamo@srs.gov AIKEN, S.C. - The F Canyon box remediation program, an American Recovery and Reinvestment Act project at Savannah River Site (SRS), has come online to process legacy transuranic (TRU) waste for off-site shipment and permanent disposal at the Waste Isolation Pilot Plant (WIPP), a geological repository in New Mexico. The $40-million facility will process approximately 330 boxes containing TRU waste with a radiological risk higher than seen in the rest of the Site's original 5,000-cubic-meter


A Box-Cox Generalization of the Almost Ideal Demand System with a Special Emphasis on Motor Fuel Price Elasticities.  

E-Print Network [OSTI]

?? This paper uses a Box-Cox generalization of the Almost Ideal Demand System (AIDS). The AIDS model is nested within a framework utilizing Box-Cox transformations (more)

Meux, Eric



ME/AE/CompE/EE 378 Mechatronics Questions: Actuators  

E-Print Network [OSTI]

frequency plots. QUESTION 5 For a permanent magnet DC motor, explain how the bandwidth changes to an inertial load through a long thin shaft as shown in the Figure below. The shaft may be modeled as a viscous angular velocity, and load angular position. Va La Ra Vb Jm,Bm m, m + - L, L + - Ia JL,BL shaft QUESTION 2

Landers, Robert G.


When Stars Go boom Questions Section 1.2  

E-Print Network [OSTI]

/Class # ____________________ ________________ ____________________ ________________ Level TWO Questions (#4-6) 4. What constellation is pictured on this poster years 6. What common force that holds you to the Earth gives a star its energy/Class # ____________________ ________________ ____________________ ________________ Level TWO Questions (#4-6) 4. What constellation is pictured on this poster


Passage Retrieval vs. Document Retrieval for Factoid Question Answering  

E-Print Network [OSTI]

Passage Retrieval vs. Document Retrieval for Factoid Question Answering Charles L. A. Clarke Egidio that identifies documents or pas­ sages where the answer to a question might appear [1--3, 5, 6, 10]. The QA returns the top­ranked documents or passages, and the QA system selects the answers from them. In many QA

Clarke, Charlie


Document Retrieval in the Context of Question Answering  

E-Print Network [OSTI]

- ticipants in the QA track with potentially relevant documents, in case a participating group did not have participants in TREC QA tracks, PRISE failed to return any relevant documents for 28% of the questionsDocument Retrieval in the Context of Question Answering Christof Monz Language & Inference

Monz, Christof

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


2Name ________________________________ Question 1: What is the usable area  

E-Print Network [OSTI]

the area of a satellite solar panel and estimate the total electrical power that can be generated. Students, the maximum panel area is 12,240 sq. cm, so (8100/12240)x100% = 66% of the panel is covered by solar cells shown below? Question 2: What electrical power can be generated by the panel? Question 3: If there are 8


Answering Your Questions about Grid Modernization | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Answering Your Questions about Grid Modernization Answering Your Questions about Grid Modernization Answering Your Questions about Grid Modernization June 18, 2013 - 10:47am Addthis Patricia A. Hoffman Patricia A. Hoffman Assistant Secretary, Office of Electricity Delivery & Energy Reliability Smart Grid Recap Find other articles in the Smart Grid Week series by visiting our Smart Grid page. During last week's Smart Grid Week, we highlighted some of the efforts currently underway to modernize the nation's electric grid. Below are answers to some of the questions submitted by readers. As we continue to build a more reliable, resilient and secure grid, I look forward to an ongoing dialogue. Question: What's the difference between the smart grid and a microgrid? The term "smart grid" has come to mean a range of technologies, tools


Your Unanswered Questions.... Answered - Batch 2 | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Your Unanswered Questions.... Answered - Batch 2 Your Unanswered Questions.... Answered - Batch 2 Your Unanswered Questions.... Answered - Batch 2 February 28, 2011 - 2:46pm Addthis Ginny Simmons Ginny Simmons Former Managing Editor for Energy.gov, Office of Public Affairs Last month, Secretary Chu hosted an online town hall to discuss President Obama's clean energy innovation agenda -- and while he was able to answer about 10 questions submitted online during the event, we received more than 200! For the next fews days, we're answering some of the ones Secretary Chu wasn't able to get to that day. Below is our second batch of questions and answers. From John Fahey over Facebook: How can we create a predictable investment environment for the renewable sector? President Obama's proposal to generate 80 percent of electricity from


Frequently Asked Questions: Lighting Choices to Save You Money | Department  

Broader source: Energy.gov (indexed) [DOE]

Frequently Asked Questions: Lighting Choices to Save You Money Frequently Asked Questions: Lighting Choices to Save You Money Frequently Asked Questions: Lighting Choices to Save You Money August 9, 2012 - 9:20am Addthis Frequently Asked Questions: Lighting Choices to Save You Money Below are some of the most frequently asked questions and answers about the new lighting efficiency standards. Learn more about your lighting choices and find out how to shop for lights by lumens, not watts. Download our Lighting Myths and Facts fact sheet to learn more about your lighting choices and the new lighting standards. Why are my lighting choices changing? What is the Energy Independence and Security Act of 2007 (EISA 2007)? When will the new bulbs be phased in? What will the lighting standards mandated by EISA 2007 mean to consumers?


ESPC ENABLE Webinar for ESCOs Question and Answer Recap  

Broader source: Energy.gov (indexed) [DOE]

ESPC ENABLE Webinar for ESCOs ESPC ENABLE Webinar for ESCOs Question and Answer Session Recap 9/13/2012 ESPC ENABLE Program, Process, and General Questions - Question: Would a copy of these slides be available to the attendees? Answer: Yes, we will be sending them out and posting them on the FEMP website after the webinar. The ESPC ENABLE Website is: http://www1.eere.energy.gov/femp/financing/espc_enable.html Question: Will agencies be permitted to combine financing and appropriations? Answer: It would certainly be allowed, however, it is expected that the majority of the target sites will not have appropriations to apply to these projects. Question: It was mentioned that Option A is used for M&V. Do you require measurement under Option A of loads and operating hours or can they be stipulated such as typical M&V Guidelines may allow?


Answering Your Questions about Grid Modernization | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Answering Your Questions about Grid Modernization Answering Your Questions about Grid Modernization Answering Your Questions about Grid Modernization June 18, 2013 - 10:47am Addthis Patricia A. Hoffman Patricia A. Hoffman Assistant Secretary, Office of Electricity Delivery & Energy Reliability Smart Grid Recap Find other articles in the Smart Grid Week series by visiting our Smart Grid page. During last week's Smart Grid Week, we highlighted some of the efforts currently underway to modernize the nation's electric grid. Below are answers to some of the questions submitted by readers. As we continue to build a more reliable, resilient and secure grid, I look forward to an ongoing dialogue. Question: What's the difference between the smart grid and a microgrid? The term "smart grid" has come to mean a range of technologies, tools


Commercial Building Energy Asset Score Frequently Asked Questions |  

Broader source: Energy.gov (indexed) [DOE]

Frequently Asked Questions Frequently Asked Questions Commercial Building Energy Asset Score Frequently Asked Questions The U.S. Department of Energy's (DOE) Commercial Building Energy Asset Score program has received numerous questions from building owners and operators, state and local governments, realtors, and other stakeholders interested in learning more about the Commercial Building Energy Asset Score. Responses to some of the most frequently asked questions can be found below within the following categories: Program Overview Development Schedule and Pilot Testing Understanding the Asset Score Report and Using the Asset Scoring Tool Scoring Methodology Scoring Scales Identified Opportunities for Energy Efficiency Upgrades Quality Assurance Links to Other Tools Program Overview Q: What is the Commercial Building Energy Asset Score?


Home Energy Score Frequently Asked Questions | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Residential Buildings » Home Energy Score » Home Energy Score Residential Buildings » Home Energy Score » Home Energy Score Frequently Asked Questions Home Energy Score Frequently Asked Questions Below you will find answers to frequently asked questions for homeowners and Partners about the Home Energy Score, from basics such as what a Home Energy Score is and how to become a Partner, to how the Score is calculated and what you can expect from your Score. Frequently Asked Questions for Homeowners (download a printable PDF) Frequently Asked Questions for Partners (download a printable PDF) Highlights Home Energy Scores Completed As of January 7, 2014 Webinars Past Webinars Orange Arrow Home Energy Score Program Update Home Energy Score Pilot Analysis Post-Pilot Update Publications Motivating Home Energy Improvements


Fermilab | Tritium at Fermilab | Frequently asked questions about tritium  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Frequently asked questions about tritium Frequently asked questions about tritium Answers to Frequently Asked Questions about Tritium at Fermilab. If you have any questions about tritium at Fermilab, please call the Office of Communication at 630-840-3351, or submit a question online. Q: What is tritium? A: Tritium is a form of hydrogen. It's a weakly radioactive isotope with a half-life of 12.3 years. When tritium decays into ordinary helium, it emits low-energy particles called beta particles. Although tritium can be found as a gas, its most common form is water. The Earth's atmosphere contains low levels of tritium produced naturally when cosmic rays strike air particles. At Fermilab, small amounts of tritium are produced as a byproduct of accelerator operations. Q: Does the tritium at Fermilab constitute a health risk to employees or


Frequently Asked Questions: Lighting Choices to Save You Money | Department  

Broader source: Energy.gov (indexed) [DOE]

Frequently Asked Questions: Lighting Choices to Save You Money Frequently Asked Questions: Lighting Choices to Save You Money Frequently Asked Questions: Lighting Choices to Save You Money August 9, 2012 - 9:20am Addthis Frequently Asked Questions: Lighting Choices to Save You Money Below are some of the most frequently asked questions and answers about the new lighting efficiency standards. Learn more about your lighting choices and find out how to shop for lights by lumens, not watts. Download our Lighting Myths and Facts fact sheet to learn more about your lighting choices and the new lighting standards. Why are my lighting choices changing? What is the Energy Independence and Security Act of 2007 (EISA 2007)? When will the new bulbs be phased in? What will the lighting standards mandated by EISA 2007 mean to consumers?


It Is Important to Know What Questions to Ask  

Science Journals Connector (OSTI)

Our principal concern in the study of physics is: how does Nature behave? The answer is best gotten by finding the answers to an array of simpler fundamental questions. It is important therefore to know what questions to ask. This paper bears on several instructional points of view: (1) in the professor's narration there is too much communication of fact and too few of the right kinds of questions asked; (2) textbook problems do not cultivate the habit of asking questions; (3) there should be more general analytic exercises which permit the examination of limiting cases for in limiting cases lies the heart of the inquiry; (4) demonstration experiments must be accompanied by appropriate questions. Illustrative examples point up the argument.

Julius Sumner Miller



Tuesday Talk: Secretary Chu Answers Your Questions LIVE | Department of  

Broader source: Energy.gov (indexed) [DOE]

Tuesday Talk: Secretary Chu Answers Your Questions LIVE Tuesday Talk: Secretary Chu Answers Your Questions LIVE Tuesday Talk: Secretary Chu Answers Your Questions LIVE November 30, 2010 - 12:02pm Addthis John Schueler John Schueler Former New Media Specialist, Office of Public Affairs Later today Secretary Chu will be answering your questions as a part of the White House's Tuesday Talk series. The discussion will be broadcast live starting at 1:15 EST and will build off of the Secretary's speech at the National Press Club yesterday, which called on the United States to sharply accelerate innovations in clean energy. You can submit your questions for consideration via the White House's official Facebook page or Whitehouse.gov. You can also utilize the White House Facebook application to discuss the Tuesday Talk as it happens and


Wind Career Map Text Version | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

jobs, and lists advancement opportunities for each career. All jobs link to the Wind Energy Career Map: Resource List and the Frequently Asked Questions (FAQ). You can...


An Isopycnal Box Model with predictive deep-ocean structure for biogeochemical cycling applications  

Science Journals Connector (OSTI)

To simulate global ocean biogeochemical tracer budgets a model must accurately determine both the volume and surface origins of each water-mass. Water-mass volumes are dynamically linked to the ocean circulation in General Circulation Models, but at the cost of high computational load. In computationally efficient Box Models the water-mass volumes are simply prescribed and do not vary when the circulation transport rates or water mass densities are perturbed. A new computationally efficient Isopycnal Box Model is presented in which the sub-surface box volumes are internally calculated from the prescribed circulation using a diffusive conceptual model of the thermocline, in which upwelling of cold dense water is balanced by a downward diffusion of heat. The volumes of the sub-surface boxes are set so that the density stratification satisfies an assumed link between diapycnal diffusivity, ?d, and buoyancy frequency, N: ?d=c/(N?), where c and ? are user prescribed parameters. In contrast to conventional Box Models, the volumes of the sub-surface ocean boxes in the Isopycnal Box Model are dynamically linked to circulation, and automatically respond to circulation perturbations. This dynamical link allows an important facet of ocean biogeochemical cycling to be simulated in a highly computationally efficient model framework.

Philip Goodwin



Regulating the ethylene response of a plant by modulation of F-box proteins  

SciTech Connect (OSTI)

The relationship between F-box proteins and proteins invovled in the ethylene response in plants is described. In particular, F-box proteins may bind to proteins involved in the ethylene response and target them for degradation by the ubiquitin/proteasome pathway. The transcription factor EIN3 is a key transcription factor mediating ethylne-regulated gene expression and morphological responses. EIN3 is degraded through a ubiquitin/proteasome pathway mediated by F-box proteins EBF1 and EBF2. The link between F-box proteins and the ethylene response is a key step in modulating or regulating the response of a plant to ethylene. Described herein are transgenic plants having an altered sensitivity to ethylene, and methods for making transgenic plant haing an althered sensitivity to ethylene by modulating the level of activity of F-box proteins. Methods of altering the ethylene response in a plant by modulating the activity or expression of an F-box protein are described. Also described are methods of identifying compounds that modulate the ethylene response in plants by modulating the level of F-box protein expression or activity.

Guo, Hongwei [Beijing, CN; Ecker, Joseph R [Carlsbad, CA



Corrosion Evaluation of Tank 40 Leak Detection Box  

SciTech Connect (OSTI)

'Leak detection from the transfer lines in the tank farm has been a concern for many years because of the need to minimize exposure of personnel and contamination of the environment. The leak detection box (LDB) is one line of defense, which must be maintained to meet this objective. The evaluation of a failed LDB was one item from an action plan aimed at minimizing the degradation of LDBs. The Tank 40 LDB, which failed in service, was dug up and shipped to SRTC for evaluation. During a video inspection while in service, this LDB was found to have black tubercles on the interior, which suggested possible microbial involvement. The failure point, however, was believed to have occurred in the drain line from the transfer line jacket. Visual, metallurgical, and biological analyses were performed on the LDB. The analysis results showed that there was not any adverse microbiological growth or significant localized corrosion. The corrosion of the LDB was caused by exposure to aqueous environments and was typical of carbon steel pipes in soil environments.'

Mickalonis, J.I.



Shearing Box Simulations of the MRI in a Collisionless Plasma  

SciTech Connect (OSTI)

We describe local shearing box simulations of turbulence driven by the magnetorotational instability (MRI) in a collisionless plasma. Collisionless effects may be important in radiatively inefficient accretion flows, such as near the black hole in the Galactic Center. The MHD version of ZEUS is modified to evolve an anisotropic pressure tensor. A fluid closure approximation is used to calculate heat conduction along magnetic field lines. The anisotropic pressure tensor provides a qualitatively new mechanism for transporting angular momentum in accretion flows (in addition to the Maxwell and Reynolds stresses). We estimate limits on the pressure anisotropy due to pitch angle scattering by kinetic instabilities. Such instabilities provide an effective ''collision'' rate in a collisionless plasma and lead to more MHD-like dynamics. We find that the MRI leads to efficient growth of the magnetic field in a collisionless plasma, with saturation amplitudes comparable to those in MHD. In the saturated state, the anisotropic stress is comparable to the Maxwell stress, implying that the rate of angular momentum transport may be moderately enhanced in a collisionless plasma.

Sharma, Prateek; Hammett, Gregory, W.; Quataert, Eliot; Stone, James, M.



[Type text] [Type text] Approved by Faculty Graduate Student Travel Grant Policy  

E-Print Network [OSTI]

[Type text] [Type text] Approved by Faculty Graduate Student Travel Grant Policy Computer Science Department To support graduate student research publications, the Computer Science Department will support dates will coincide with the Senate Scholarly Activities Committee (SSAC) Travel Grant application due

Delene, David J.


Regulating the ethylene response of a plant by modulation of F-box proteins  

SciTech Connect (OSTI)

The invention relates to transgenic plants having reduced sensitivity to ethylene as a result of having a recombinant nucleic acid encoding an F-box protein that interacts with a EIN3 involved in an ethylene response of plants, and a method of producing a transgenic plant with reduced ethylene sensitivity by transforming the plant with a nucleic acid sequence encoding an F-box protein. The inventions also relates to methods of altering the ethylene response in a plant by modulating the activity or expression of an F-box protein.

Guo, Hongwei (Beijing, CN); Ecker, Joseph R. (Carlsbad, CA)



Modelling and forecasting Oman crude oil prices using Box-Jenkins techniques  

Science Journals Connector (OSTI)

The Box-Jenkins' Auto Regressive Integrated Moving Average (ARIMA) modelling approach has been applied for the time series analysis of monthly average prices of Oman crude oil taken over a period of 10 years. Several seasonal and non-seasonal ARIMA models were identified. These models were then estimated and compared for their adequacy using the significance of the parameter estimates, mean square errors and Modified Box-Pierce (Ljung-Box) Chi-Square statistic. Based on these criterion a multiplicative seasonal model of the form ARIMA (1,1,5)x(1,1,1) was recommended for short term forecasting.

M.I. Ahmad


Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


10 Questions for a Physicist: Christian Bauer | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Physicist: Christian Bauer Physicist: Christian Bauer 10 Questions for a Physicist: Christian Bauer October 13, 2011 - 1:16pm Addthis Lawrence Berkeley National Laboratory Physicist Christian Bauer | Photo courtesy Roy Kaltschmidt, LBNL Lawrence Berkeley National Laboratory Physicist Christian Bauer | Photo courtesy Roy Kaltschmidt, LBNL Niketa Kumar Niketa Kumar Public Affairs Specialist, Office of Public Affairs Meet Christian Bauer - theoretical physicist at Lawrence Berkley National Laboratory and a newly minted recipient of the Presidential Early Career Award for Scientists and Engineers (PECASE). In the latest 10 Questions, Dr. Bauer discusses his work in high-energy physics and shares how these developments are helping craft our understanding of nature's most fundamental questions.


Responses To Questions Concerning Technology Transfer Practices at DOE  

Broader source: Energy.gov (indexed) [DOE]

Responses To Questions Concerning Technology Transfer Practices at Responses To Questions Concerning Technology Transfer Practices at DOE Laboratories Responses To Questions Concerning Technology Transfer Practices at DOE Laboratories AllianceForSustainableEnergy Battelle Department of Economic and Community Development Planar Energy Devices Center for Hydrogen Research Electric Power Research Institute (EPRI) APJeT, Inc. Pacific Northwest National Laboratory (PNNL) American Superconductor (AMSC) Economic Development Partnership Campbell Applied Physics, Inc. Oak Ridge Economic Partnership Purdue University Council on Governmental Relations Cummins University of California ORNL Tech Transfer Jet Propulsion Laboratory (JPL) Eastman Chemical Company Sandia National Laboratories Lawrence Livermore National Laboratory Oak Ridge National Laboratory


Questions and Answers - Do radioactive things glow in the dark?  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Someone told me that Cherenkov radiationis analogous to breaking the sound barrier... Someone told me that Cherenkov radiation<br>is analogous to breaking the sound barrier... Previous Question (Someone told me that Cherenkov radiation is analogous to breaking the sound barrier...) Questions and Answers Main Index Next Question (If energy is formed by a generator, how does it form the energy?) If energy is formed by a generator,how does it form the energy? Do radioactive things glow in the dark? The short answer to your question is "no," radioactive things do not glow in the dark - not by themselves anyway. Radiation emitted by radioactive materials is not visible to the human eye. However, there are ways to"convert" this invisible energy to visible light. Many substances will emit visible light if "stimulated" by the ionizing radiation from


Questions and Answers for the Smart Grid Investment Grant Program:  

Broader source: Energy.gov (indexed) [DOE]

Commercially Valuable Smart Grid Data Commercially Valuable Smart Grid Data Questions and Answers for the Smart Grid Investment Grant Program: Commercially Valuable Smart Grid Data Questions and answers for the Smart Grid Investment Grant Program on commercially valuable smart grid data, presenting an approach for ensuring the confidentiality of information that contains confidential and/or propriety information that recipients of Smart Grid Investment Grant awards under the American Recovery and Reinvestment Act are required to submit in carrying out their Metrics and Benefits Reporting Plan obligations Questions and Answers for the Smart Grid Investment Grant Program: Commercially Valuable Smart Grid Data More Documents & Publications Questions and Answers for the Smart Grid Investment Grant Program:


Questions and Answers for the Smart Grid Investment Grant Program:  

Broader source: Energy.gov (indexed) [DOE]

Jobs Created/Retained in SIPRIS Jobs Created/Retained in SIPRIS Questions and Answers for the Smart Grid Investment Grant Program: Reporting of Jobs Created/Retained in SIPRIS Questions and answers related to the reporting of jobs in the SmartGrid Integrated Project Reporting Information System (SIPRIS), both for the intial report and subsequent reports. Projects reporting jobs are part of the Smart Grid Investment Grant Project under the American Recovery and Reinvestment Act. Questions and Answers for the Smart Grid Investment Grant Program: Reporting of Jobs Created/Retained in SIPRIS More Documents & Publications Questions and Answers for the Smart Grid Investment Grant Program: Reporting Webinar Recovery Act Recipient Reporting on FederalReporting.gov Smart Grid Grant Program Recipient Reporting Guidance


Cool Roofs: Your Questions Answered | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Roofs: Your Questions Answered Roofs: Your Questions Answered Cool Roofs: Your Questions Answered January 6, 2011 - 2:58pm Addthis John Schueler John Schueler Former New Media Specialist, Office of Public Affairs Last month Secretary Chu announced that the Department of Energy had installed a "cool roof" atop the west building of our Washington, DC headquarters. The announcement elicited a fair number of questions from his Facebook fans, so we decided to reach out to the people behind the project for their insight on the specific benefits of switching to a cool roof, and the process that went into making that choice. Jim Bullis (Facebook): So what is the percentage saving of energy bills for this building? Answer: The West Building cool roof is estimated to save about $2,000 per


Ask Your Energy Innovation Hub Questions | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Ask Your Energy Innovation Hub Questions Ask Your Energy Innovation Hub Questions Ask Your Energy Innovation Hub Questions April 22, 2013 - 4:57pm Q&A Want to know what the Energy Innovation Hubs are working on? Ask Us Addthis Ask Your Energy Innovation Hub Questions April Saylor April Saylor Former Digital Outreach Strategist, Office of Public Affairs Tomorrow, energy experts will join policymakers on Capitol Hill to discuss the important work going on at Energy Innovation Hubs across the country. These facilities, which were created in 2010, are integrated research centers that combine basic and applied research with engineering to accelerate scientific discovery in critical energy issue areas. The Hubs are made up of teams of the best researchers and engineers in the United States - all working together to achieve major national energy goals.


NEWTON Ask A Scientist - Question of the Week  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

December 10 - December 17 Question of the Week Name: Millard Status: student Grade: 9-12 Location: MD Country: USA Date: Spring 2013 Question My dad has a classic car, and because it gets driven very little each year, the tires dry rot before he can get much tread wear on them. What could be used to protect the tires from dry rot and cracking? Answers from Our Expert Staff Hi Millard, Thanks for the question. I would recommend keeping the car on blocks so that there is no weight on the tires. Additionally, I would recommend that no electrical equipment (motors, switches, and other things that spark) be used around the car. The sparks generate ozone and ozone can cause rubber items such as tires, belts, and hoses to crack. I hope this helps. Please let me know if you have more questions.


What's the Question? INQUIRY-BASED LEARNING IN  

E-Print Network [OSTI]

study. Library instruction space was expandWhat's the Question? INQUIRY-BASED LEARNING IN LIBRARY INSTRUCTION Sara Miller, Assistant Library in the library's newest classroom. --continues on p.8 SURPRISING STATISTICS A lot happens in a year! We

Liu, Taosheng


Frequently Asked Questions about Wind Energy | Department of...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

lists frequently asked questions about wind energy. What is wind energy? How do wind turbines work? I would like to put up a wind turbine at my house or property. How do I get...


Forensic Genomics: Kin Privacy, Driftnets and Other Open Questions  

E-Print Network [OSTI]

, Human Genome Project, Cold and hot hits, Data protection, Informational privacy. 1. INTRODUCTIONForensic Genomics: Kin Privacy, Driftnets and Other Open Questions Frank Stajano University sequencing the entire genome of a person becomes sufficiently cheap as to become a routine operation

Cambridge, University of


Lunar Atmosphere and Dust Environment Explorer Frequently Asked Questions  

E-Print Network [OSTI]

LADEE Lunar Atmosphere and Dust Environment Explorer Frequently Asked Questions What mystery: was lunar dust, electrically charged by solar ultraviolet light, responsible for the presunrise of space exploration through our expertise in science, engineering, mission operations, and data management

Mojzsis, Stephen J.


The Export Question: Designing Policy for British Columbia Electricity Trade  

E-Print Network [OSTI]

The Export Question: Designing Policy for British Columbia Electricity Trade Dr. George Hoberg..........................................................................................................................................5 2 BC's Electricity Trade Picture: Context and Trends........................................................................6 2.1 How electricity trading works

Pedersen, Tom


Questions and answers based on revised 10 CFR Part 20  

SciTech Connect (OSTI)

NUREG/CR-6204 is a collection of questions and answers that were originally issued in seven sets and which pertain to revised 10 CFR Part 20. The questions came from both outside and within the NRC. The answers were compiled and provided by NRC staff within the offices of Nuclear Reactor Regulation, Nuclear Material Safety and Safeguards, Nuclear Regulatory Research, the Office of State Programs, and the five regional offices. Although all of the questions and answers have been reviewed by attorneys in the NRC Office of the General Counsel, they do not constitute official legal interpretations relevant to revised 10 CFR Part 20. The questions and answers do, however, reflect NRC staff decisions and technical options on aspects of the revised 10 CFR Part 20 regulatory requirements. This NUREG is being made available to encourage communication among the public, industry, and NRC staff concerning the major revisions of the NRC`s standards for protection against radiation.

Borges, T.; Stafford, R.S.; Lu, P.Y. [Oak Ridge National Lab., TN (United States); Carter, D. [Nuclear Regulatory Commission, Washington, DC (United States)



Livermore engineer to answer questions on Reddit | National Nuclear...  

National Nuclear Security Administration (NNSA)

answer questions on Reddit NNSA Blog Ever wonder what it's like to tap into the human brain? Or did you ponder about the best ways to understand neurological diseases and...


Home Energy Score: Frequently Asked Questions for Homeowners  

Broader source: Energy.gov [DOE]

Below you will find answers to frequently asked questions for homeowners about the Home Energy Score, from basics such as what a Home Energy Score is, to how the Score is calculated and what you...


Question of the Week: How Does Your Community Encourage Energy...  

Broader source: Energy.gov (indexed) [DOE]

sumer.webmaster@nrel.gov. Addthis Related Articles Question of the Week: How Will You Landscape for Energy Efficiency? What Steps Do You Take to Improve Your Fuel Economy? How Are...


Questions about OpenEI? | OpenEI Community  

Open Energy Info (EERE)

Questions about OpenEI? Questions about OpenEI? Home > Groups > OpenEI Community Central Graham7781's picture Submitted by Graham7781(2002) Super contributor 5 February, 2010 - 13:59 imported OpenEI What's the best way to find and use OpenEI information? How can you create and edit pages, link to existing information or add your own? How can OpenEI add value to your work? If you have questions like these--or want to share your thoughts about the answers--join the OpenEI Discussion Group. The most active and informed OpenEI members use the group constantly. If you have a question, they'll have the answer. Join in! Groups: OpenEI Community Central Graham7781's blog Latest blog posts Jweers New Robust References! Posted: 7 Aug 2013 - 18:23 by Jweers 1 comment(s)


Ask Your Energy Innovation Hub Questions | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Ask Your Energy Innovation Hub Questions Ask Your Energy Innovation Hub Questions Ask Your Energy Innovation Hub Questions April 22, 2013 - 4:57pm Q&A Want to know what the Energy Innovation Hubs are working on? Ask Us Addthis Ask Your Energy Innovation Hub Questions April Saylor April Saylor Former Digital Outreach Strategist, Office of Public Affairs Tomorrow, energy experts will join policymakers on Capitol Hill to discuss the important work going on at Energy Innovation Hubs across the country. These facilities, which were created in 2010, are integrated research centers that combine basic and applied research with engineering to accelerate scientific discovery in critical energy issue areas. The Hubs are made up of teams of the best researchers and engineers in the United States - all working together to achieve major national energy goals.


10 Questions for a Physicist: Antonio Checco | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

10 Questions for a Physicist: Antonio Checco 10 Questions for a Physicist: Antonio Checco 10 Questions for a Physicist: Antonio Checco February 3, 2011 - 10:00am Addthis Antonio Checco | Source: Brookhaven National Lab Antonio Checco | Source: Brookhaven National Lab Niketa Kumar Niketa Kumar Public Affairs Specialist, Office of Public Affairs Ralph Waldo Emerson once noted, "Men love to wonder, and that is the seed of science." At the Department of Energy, our National Laboratories' scientists, researchers and engineers have big imaginations - they are at the forefront of scientific innovation and ingenuity. Every day, they're advancing a breadth of fields from clean energy and energy efficiency to nanomaterials and nuclear and particle physics. Today, the Energy Blog is launching a new series, 10 Questions, with a

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


REMARKS ON THE BOX PROBLEM. Nets Hawk Katz, Elliot Krop, Mauro Maggioni  

E-Print Network [OSTI]

REMARKS ON THE BOX PROBLEM. Nets Hawk Katz, Elliot Krop, Mauro Maggioni Washington University §0 by a National Science Foundation grant Typeset by AMS-TEX 1 #12;2 NETS HAWK KATZ, ELLIOT KROP, MAURO MAGGIONI

Maggioni, Mauro


Oak Ridge Site Specific Advisory Board * P.O. Box 2001, EM-91...  

Broader source: Energy.gov (indexed) [DOE]

April 12, 2012 Susan Cange Acting Manager for Environmental Management DOE-Oak Ridge Office P.O. Box 2001, EM-90 Oak Ridge, TN 37831 Dear Ms. Cange: Recommendation 209:...


Oak Ridge Site Specific Advisory Board * P.O. Box 2001, EM-91...  

Office of Environmental Management (EM)

October 16, 2012 Susan Cange Deputy Manager for Environmental Management DOE-Oak Ridge Office P.O. Box 2001, EM-90 Oak Ridge, TN 37831 Dear Ms. Cange: Recommendation 211 :...


From Oak Ridge to the Moon (Y-12 Moon Box) | Y-12 National Security...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

From Oak Ridge to the Moon ... From Oak Ridge to the Moon (Y-12 Moon Box) The mp4 video format is not supported by this browser. Download video Captions: On Time: 5:26 min. Y-12...


Workers Remove Glove Boxes from Ventilation at Hanfords Plutonium Finishing Plant  

Broader source: Energy.gov [DOE]

An employee at Hanfords Plutonium Finishing Plant uses a portable band saw to cut the last ventilation duct attached to glove boxes inside the facilitys former processing area.


Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

TR:GS:14-0086:UFC 1200.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 November 4, 2014 Eddy and Lea County Residents: We continue to make...


Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

CBFO:JF:GS:14-0025:UFC 1200.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 April 18, 2014 Eddy and Lea Country Residents: This has been an...


Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

GS:14-0014:UFC 5486 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 March 12, 2014 To Eddy and Lea County Residents: As the Department of...


Carlsbad Field Orfice P. O. Box 3090 Carlsbad, New Mexico 88221  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Orfice P. O. Box 3090 Carlsbad, New Mexico 88221 APR 2 4 2 012 Mr. John Kieling , Acting Bureau Chief Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive...


Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

BW:GS:14-0032:UFC 1200.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 May 2, 2014 Eddy and Lea County Residents: We continue to make...


Shadow: Running Tor in a Box for Accurate and Efficient Experimentation Technical Report  

E-Print Network [OSTI]

Rob Jansen and Nicholas J. Hopper September 23, 2011 #12;#12;Shadow: Running Tor in a Box for Accurate and Efficient Experimentation Rob Jansen U.S. Naval Research Laboratory rob.g.jansen@nrl.navy.mil Nicholas

Minnesota, University of


E-Voting and Forensics: Prying Open the Black Box Matt Bishop and Sean Peisert  

E-Print Network [OSTI]

E-Voting and Forensics: Prying Open the Black Box Matt Bishop and Sean Peisert Department of Computer Science University of California, Davis {bishop, peisert}@cs.ucdavis.edu Candice Hoke Cleveland

Bishop, Matt


EVoting and Forensics: Prying Open the Black Box Matt Bishop and Sean Peisert  

E-Print Network [OSTI]

E­Voting and Forensics: Prying Open the Black Box Matt Bishop and Sean Peisert Department of Computer Science University of California, Davis {bishop, peisert}@cs.ucdavis.edu Candice Hoke Cleveland

Bishop, Matt


a trust-region method for box-constrained nonlinear semidfinite ...  

E-Print Network [OSTI]

Nov 17, 2014 ... Methods and Softw., 28(4):871888, 2013. [21] Y. Xu, W. Sun, and L. Qi. A feasible direction method for the semidefinite program with box.

Akihiko Komatsu, Makoto Yamashita



Satellite Television Industry Meeting Regarding DOE Set-Top Box Rulemaking  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Satellite Television Industry Meeting Regarding DOE Set-Top Box Satellite Television Industry Meeting Regarding DOE Set-Top Box Rulemaking Satellite Television Industry Meeting Regarding DOE Set-Top Box Rulemaking On April 3, 2012 at 11:00 AM, representatives of the U.S. satellite television industry, listed below, met with the DOE officials, listed below, at the Forestall Building to discuss matters of concern to the U.S. satellite television industry regarding the pending DOE rulemaking to establish energy conservation standards on set-top boxes (STBs) under title Ill of the Energy Policy and Conservation Act of 1974, as amended. Memo_Ex_Parte_Comm.pdf More Documents & Publications Memorandum Memorializing Ex Parte Communication, DOE impending determination of coverage for commercial and industrial fans, blowers, and


Berkeley Lab Answers Your Home Energy Efficiency Questions  

SciTech Connect (OSTI)

In this follow-up "Ask Berkeley Lab" video, energy efficiency expert Iain Walker answers some of your questions about home energy efficiency. How do you monitor which appliances use the most energy? Should you replace your old windows? Are photovoltaic systems worth the cost? What to do about a leaky house? And what's the single biggest energy user in your home? Watch the video to get the answers to these and more questions.

Walker, Iain



Examination of a Junction-Box Adhesion Test for Use in Photovoltaic Module Qualification: Preprint  

SciTech Connect (OSTI)

Engineering robust adhesion of the junction-box (j-box) is a hurdle typically encountered by photovoltaic (PV) module manufacturers during product development. There are historical incidences of adverse effects (e.g., fires) caused when the j-box/adhesive/module system has failed in the field. The addition of a weight to the j-box during the 'damp heat' IEC qualification test is proposed to verify the basic robustness of its adhesion system. The details of the proposed test will be described, in addition to the preliminary results obtained using representative materials and components. The described discovery experiments examine moisture-cured silicone, foam tape, and hot-melt adhesives used in conjunction with PET or glass module 'substrates.' To be able to interpret the results, a set of material-level characterizations was performed, including thermogravimetric analysis, differential scanning calorimetry, and dynamic mechanical analysis. PV j-boxes were adhered to a substrate, loaded with a prescribed weight, and then placed inside an environmental chamber (at 85C, 85% relative humidity). Some systems did not remain attached through the discovery experiments. Observed failure modes include delamination (at the j-box/adhesive or adhesive/substrate interface) and phase change/creep. The results are discussed in the context of the application requirements, in addition to the plan for the formal experiment supporting the proposed modification to the qualification test.

Miller, D. C.; Wohlgemuth, J. H.



Carlsbad Field Office P O. Box 3090 Carlsbad  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

March 31 March 31 , 2009 Mr. Steve lappe, Project Leader Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Building 1 Santa Fe , New Mexico 87505-6303 Subject: Transmittal of the Revised Final Audit Report, B6 Checklists, Supplemental Evidence and Responses to Address NMED Comments for CBFO Audit A-09-05 of the General Electric Vallecitos Nuclear Center/Central Characterization Project Dear Mr. lappe : Per your request in the New Mexico Environment Department (NMED) letter dated March 20, 2009 , enclosed are the revised Final Audit Report, B6 checklists , supplemental evidence, and responses associated with CBFO Audit A-09-05 of the General Electric Vallecitos Nuclear Center/Central Characterization Project Should you have any questions, please contact the CBFO Quality Assurance


Questions for the Universe | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

Universe Universe High Energy Physics (HEP) HEP Home About Research Snowmass / P5 Planning Process Intensity Frontier Cosmic Frontier Theoretical Physics Advanced Technology R&D Accelerator R&D Stewardship Research Highlights .pdf file (13.1MB) Questions for the Universe Einstein's Dream of Unified Forces The Particle World The Birth of the Universe Accomplishments Facilities Science Highlights Benefits of HEP Funding Opportunities Advisory Committees News & Resources Contact Information High Energy Physics U.S. Department of Energy SC-25/Germantown Building 1000 Independence Ave., SW Washington, DC 20585 P: (301) 903-3624 F: (301) 903-2597 E: sc.hep@science.doe.gov More Information » Research Questions for the Universe Print Text Size: A A A RSS Feeds FeedbackShare Page


MDF Form and Function (Text Version) | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

out. And I would invite the people on the Web to submit their questions as we go along. Kelly.... KELLY VISCONTI: Good morning, I think we're still in the morning time. Leo talked...

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


MAchine-Readable Cataloging (MARC) Records for Full-text Reports Contained  

Office of Scientific and Technical Information (OSTI)

MAchine-Readable Cataloging (MARC) Records for Full-text Reports Contained MAchine-Readable Cataloging (MARC) Records for Full-text Reports Contained in SciTech Connect Now Available! Download MARC Records The U.S. Department of Energy (DOE)Office of Scientific and Technical Information (OSTI) offers librarians and the library community the opportunity to download records of DOE Scientific and Technical Information (STI) in MARCformat (see MARC FAQs). By using OSTI'sMARC download, librarians can now easily expand access to a variety of scientific research straight from their catalogs. This is a free public service provided by OSTI. We appreciate your thoughts, comments, and questions MARCrecords@osti.gov. SciTech Connect Full-Text MARC Records include all the records from SciTech Connect that contain links to freely available full-text.


Geothermal Webinar Presentation Slides and Text Version | Department...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Geothermal Webinar Presentation Slides and Text Version Geothermal Webinar Presentation Slides and Text Version Download presentation slides and a text version of the audio from...


DOE Challenge Home Comprehensive Building Science Webinar (Text...  

Broader source: Energy.gov (indexed) [DOE]

Comprehensive Building Science Webinar (Text Version) DOE Challenge Home Comprehensive Building Science Webinar (Text Version) Below is the text version of the webinar, DOE Zero...


Questions and Answers for the Smart Grid Investment Grant Program:  

Broader source: Energy.gov (indexed) [DOE]

Applicability of Buy American Provision of Section 1605 of the Recovery Act Applicability of Buy American Provision of Section 1605 of the Recovery Act to Projects Under the Smart Grid Investment Grant Program Questions and Answers for the Smart Grid Investment Grant Program: Applicability of Buy American Provision of Section 1605 of the Recovery Act to Projects Under the Smart Grid Investment Grant Program Q&A for the Smart Grid Investment Grant Program: Applicability of Buy American Provision of Section 1605 of the Recovery Act to Projects Under the Smart Grid Investment Grant Program. Three questions are provided that must be answered in the affirmative in order for the Buy American provision to be applicable to the Recovery Act project.. Questions and Answers for the Smart Grid Investment Grant Program: Applicability of Buy American Provision of Section 1605 of the Recovery Act


Questions and Answers - Are nitrogen, arsenic, and tantalum radioactive?  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

How many neutrons can you add to anatom without it getting unbalanced? How many neutrons can you add to an<br>atom without it getting unbalanced? Previous Question (How many neutrons can you add to an atom without it getting unbalanced?) Questions and Answers Main Index Next Question (How long is the life span of an atom?) How long is the life span of an atom? Are nitrogen, arsenic, and tantalum radioactive? The answer is yes and no. Let's see why. When you want to know about elements, you go look in the periodic table. But what you see listed in the periodic table of the elements is only part of the picture. For every element listed, there are different "flavors" called isotopes. All of the elements have at least one isotope that is radioactive. So, we can say that there is such a thing as radioactive nitrogen, arsenic and tantalum. Some


Fermilab Legal Office - Ethics Program - Ask the Ethicist - Questions &  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Ethicist - Questions & Answers Ethicist - Questions & Answers In This Section: Ask the Ethicist Ask the Ethicist - Q&A Submit a Question Posted: December 22, 2009 Q. What should a FRA employee do with free items (pens, calendars, tote bags, radios and food) left by a vendor? A. As mentioned in the Dec. 18 issue of Fermilab Today, the Code of Conduct prohibits employees from accepting any gratuity, gift or special favor from individuals or organizations with whom FRA is doing business or proposing to do business. The policy states that "except for advertising novelties of minimal value, gratuities shall be refused or returned." This means that your actions depend on what the vendor leaves. Items such as calendars, pens and tote bags generally qualify as advertising novelties


Questions and Answers - Is there anything colder than liquid nitrogen?  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

How cold is liquid nitrogen? How cold is liquid nitrogen? Previous Question (How cold is liquid nitrogen?) Questions and Answers Main Index Next Question (If you jumped into a pool of liquid oxygen, would your body instantly crystallize?) If you jumped into a pool of liquid oxygen,would your body instantly crystallize? Is there anything colder than liquid nitrogen? Yes, there are things colder than liquid nitrogen, like most of the Universe! I assume, though, that you mean things on the Earth. There actually is an entire branch of science called cryogenics that deals with really cold things. Generally the science of cryogenics is when the temperature goes below that which we can reach with conventional refrigeration equipment, around 250 degrees (Fahrenheit) below zero. Many


Questions and Answers - Does an atom smasher really smash atoms?  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

is an accelerator? is an accelerator? Previous Question (What is an accelerator?) Questions and Answers Main Index Next Question (Where and how do you get your electrons for your accelerator?) Where and how do you get yourelectrons for your accelerator? Does an atom smasher really smash atoms? Well, yes, they do, but we now prefer to call them by their less aggression-centered name, "particle harmony disrupters." Of course some atom smashers do much more smashing than others. We use electrons in our accelerator to study the nucleus of an atom. Remember that electrons are negative, as are the electrons surrounding the target. Since like charged particles repel each other, our particles have to have enough energy to blast through that electron cloud to get to the nucleus. The electrons then


Questions and Answers - What is an electric current?  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

type of charge isproduced when...? type of charge is<br>produced when...? Previous Question (What type of charge is produced when...?) Questions and Answers Main Index Next Question (How do you explain electrical resistance?) How do you explainelectrical resistance? What is an electric current? To understand what an electrical current is, you have to understand a little bit about the atom. Check out All About Atoms. Anyway, in a nutshell, atoms are split into two parts. The first is the nucleus that contains protons and sometimes neutrons. Orbiting around the nucleus are electrons. Usually there are the same number of electrons as there are protons. Now protons really determine what a material is, but electrons are where the action is. Almost all of what we interact with and things like


Questions and Answers - What's the difference between hydrogen, nitrogen,  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Which element has 11 protonsand 12 neutrons? Which element has 11 protons<br>and 12 neutrons? Previous Question (Which element has 11 protons and 12 neutrons?) Questions and Answers Main Index Next Question (Does sodium have any isotopes? Is it radioactive?) Does sodium have anyisotopes? Is it radioactive? What's the difference between hydrogen, nitrogen, oxygen, neon, copper, gold and magnesium? Hydrogen, nitrogen, oxygen, neon, copper, gold and magnesium all have different physical and chemical properties. You can find descriptions of all of these elements on our Periodic Table of Elements. The single most important difference between these elements is the number of protons each one contains in its nucleus. The number of protons an atom contains dictates how many electrons it will have. It is the arrangement of


Questions and Answers - What holds an electron revolving around the  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

do I read an electronconfiguration table? do I read an electron<br>configuration table? Previous Question (How do I read an electron configuration table?) Questions and Answers Main Index Next Question (What keeps electrons revolving around the nucleus of an atom?) What keeps electrons revolvingaround the nucleus of an atom? What holds an electron revolving around the nucleus? Why don't they just go zooming around everywhere? What causes the force that holds atoms together? The answer is electricity and magnetism. The atom's center, or nucleus, is positively charged and the electrons that whirl around this nucleus are negatively charged, so they attract each other. The reason the force is strong is because the atom is so small. The distance between the nucleus and the electrons is about 1


10 Questions for a Materials Chemist: Praveen Thallapally | Department of  

Broader source: Energy.gov (indexed) [DOE]

10 Questions for a Materials Chemist: Praveen Thallapally 10 Questions for a Materials Chemist: Praveen Thallapally 10 Questions for a Materials Chemist: Praveen Thallapally February 24, 2011 - 10:03am Addthis Praveen Thallapally | photo courtesy of Pacific Northwest National Lab Praveen Thallapally | photo courtesy of Pacific Northwest National Lab Niketa Kumar Niketa Kumar Public Affairs Specialist, Office of Public Affairs We recently had the opportunity to chat with materials chemist Praveen Thallapally at Pacific Northwest National Lab - he gave us an inside look at how he's working to advance carbon capture and geothermal technologies, developing a new class of materials and "frustrating" organic solids. Q: What sparked your interest to pursue a career in science? Praveen Thallapally: I pursued my career in science because it provides


Questions and Answers - How do you explain electrical resistance?  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

is an electric current? is an electric current? Previous Question (What is an electric current?) Questions and Answers Main Index Next Question (Do you know what an electromagnet is?) Do you know whatan electromagnet is? How do you explain electrical resistance? I'm assuming you are asking for advice on "how to" explain resistance - perhaps to a school class. At any rate, here's a reasonably non-technical description you can consider. In a metal, the atoms are arranged in a crystal-like configuration. The type of metal will determine how the bonds are arranged, and how closely the atoms are grouped. Electrons can inhabit energy levels. Generally, only the "outer" electrons in an atom interact to form the bonds with other atoms. These outer electrons are held to the atom with a relatively small


Questions about Making OUO Determinations - OUO and the FOIA Exemptions |  

Broader source: Energy.gov (indexed) [DOE]

Questions about Making OUO Determinations - OUO and the FOIA Exemptions Questions about Making OUO Determinations - OUO and the FOIA Exemptions Questions about Making OUO Determinations - OUO and the FOIA Exemptions Why is OUO linked to the Freedom of Information Act (FOIA) exemptions? Under the FOIA, any person can request any information from the Government and get it - except for information falling under any one of the nine exemptions specified in the FOIA. Therefore, trying to control information that doesn't fall under the FOIA exemptions wastes Government resources since such information must ultimately be released. As a result, one of the criteria you must use when deciding if information is OUO is whether it falls under a FOIA exemption. Note that information under the purview of a topic in classification or UCNI guidance or in program-issued guidance, has already been determined to


Questions and Answers - Why don't atoms weigh anything?  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

isn't matter being createdor destroyed today? isn't matter being created<br>or destroyed today? Previous Question (Why isn't matter being created or destroyed today?) Questions and Answers Main Index Next Question (What are the relative masses of protons, neutrons and electrons?) What are the relative masses ofprotons, neutrons and electrons? Why don't atoms weigh anything? Oh, but they do weigh something! Weighing sub-atomic particles is one of the things we do here at Jefferson Lab. You can imagine though that the scale we use to weigh particles is pretty bizarre. The weight of a particle is an important piece of information needed to figure out the properties of matter. Knowing the weight of atoms helps solve a completely different, but related, problem of how much the universe weighs. Believe it or not, there


Simulation in the Service of Design - Asking the Right Questions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Simulation in the Service of Design - Asking the Right Questions Simulation in the Service of Design - Asking the Right Questions Title Simulation in the Service of Design - Asking the Right Questions Publication Type Conference Paper LBNL Report Number LBNL-2513E Year of Publication 2009 Authors Donn, Michael, Stephen E. Selkowitz, and Bill Bordass Conference Name 11th International Building Performance Simulation Association Conference - Building Simulation '09 Call Number LBNL-2513E Abstract This paper proposes an approach to the creation of design tools that address the real information needs of designers in the early stages of design of nonresidential buildings. Traditional simplified design tools are typically too limited to be of much use, even in conceptual design. The proposal is to provide access to the power of detailed simulation tools, at a stage in design when little is known about the final building, but at a stage also when the freedom to explore options is greatest.


Fermilab | Fermilab Time and Labor | Questions & Answers  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Questions & Answers Questions & Answers Updated: September 27, 2010 Q. How do I make changes to previously processed timecards? A. Please see this notice sent to all employees to explain the process for making changes to previously processed timecards. Updated: September 2, 2010 Q. When is the monthly vacation accrual reflected for the vacation totals? My pay stub reflects the correct amount, but FTL does not. A. The monthly vacation accrual is reflected in FTL the day it becomes available to use, which is the first of the next month. Updated: July 22, 2010 Q. I have a question about how to report my hours. Where can I look for answers? A. Monthly and weekly employees can check the "Hours of Work" section of the WDRS website. Monthly employees can also read this collection of Q&A.


Questions and Answers - Are quarks confineable for study?  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

is the charge of an up quarkand of down quark? is the charge of an up quark<br>and of down quark? Previous Question (What is the charge of an up quark and of down quark?) Questions and Answers Main Index Next Question (Is vacuum matter? What are ten things that are not matter? ) Is vacuum matter? What are tenthings that are not matter? Are quarks confineable for study? Quarks we study at Jefferson Lab are confined to each other by nature's laws. We shine our electrons on them to observe their behavior in their confined state. This is not so different from turning on a light to see a gold fish swimming in a glass bowl. Author: Nathan Isgur, Theory Group Leader (Other answers by Nathan Isgur) Related Pages: All About Atoms What is the smallest particle of matter known? Could there be anything smaller inside of an electron or inside of a


10 Questions for Biophysical Chemist: Wendy Shaw | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

10 Questions for Biophysical Chemist: Wendy Shaw 10 Questions for Biophysical Chemist: Wendy Shaw 10 Questions for Biophysical Chemist: Wendy Shaw May 12, 2011 - 5:21pm Addthis Wendy Shaw | Photo Courtesy of Pacific Northwest National Lab Wendy Shaw | Photo Courtesy of Pacific Northwest National Lab Niketa Kumar Niketa Kumar Public Affairs Specialist, Office of Public Affairs A while ago, we shared a great video from Pacific Northwest National Lab (PNNL) and Northwest Public Television on how PNNL researchers are working to solve the energy storage challenge. We recently got a chance to talk with one of those scientists, Wendy Shaw, and learn more about her nature-inspired projects, why combustion and construction tools helped spark her interest in science and how she's developing innovative, cost effective catalysts.


Microsoft Word - Response to DOEs Questions.doc  

Broader source: Energy.gov (indexed) [DOE]

The Goodyear Tire & Rubber Company The Goodyear Tire & Rubber Company Response to DOE's Questions Technology Transfer Practices at DOE Laboratories March 24, 2009 Submitted to GC-62@hq.doe.gov Office of the Assistant General Counsel for Technology Transfer and Intellectual Property U.S. Department of Energy Washington, DC By Surendra K. Chawla Senior Director of External Science & Technology Programs The Goodyear Tire & Rubber Company Akron, Ohio schawla@goodyear.com 330-796-1994 Response to DOE's Questions Question 1. Existing and other agreements (i) What improvements to the existing transactions would you suggest that DOE consider? a) The process of finalizing agreements is complex and slow. It takes too much time to start new engagements which adversely affects businesses' need to be faster to

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Frequently Asked Questions About the Buildings Performance Database |  

Broader source: Energy.gov (indexed) [DOE]

Commercial Buildings » Buildings Performance Database » Commercial Buildings » Buildings Performance Database » Frequently Asked Questions About the Buildings Performance Database Frequently Asked Questions About the Buildings Performance Database On this page you will find answers to frequently asked questions pertaining to the DOE Buildings Performance Database (BPD). General What is the purpose of the BPD? What building energy performance data is included in the BPD? Access Information How can I access the database? How can I contribute data to the BPD? Database and Analysis Information What kinds of buildings does the BPD have? What are the data sources that populate the BPD? Does the BPD have time series data? How do you ensure that the data from these multiple sources is consistent and valid? What data format does the BPD utilize?


Microsoft Word - Response to AMPUA Questions_092011.docx  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Sep 20, 2011, at 12:00 PM, "" wrote: Sep 20, 2011, at 12:00 PM, "<mcurtis401@aol.com>" <mcurtis401@aol.com> wrote: > Yes and the Western team has done a great job, spent tremendous amount of time & consideration & my questions are basically answered. Good job. Good presentation. If we have more questions we will write. > Michael Curtis > > -----Original Message----- > From: Debby Emler > To: mcurtis401 > Sent: Tue, Sep 20, 2011 8:45 am > Subject: Re: AMPUA Question-Wapa Consolidation and Cost Allocation Seminar > > Michael: Thank you for attending yesterday's cost allocation presentation. Thanks also to the others on this list that may have attended either in person or by phone.


Frequently Asked Questions about the New ISM Manual  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

FREQUENTLY ASKED QUESTIONS FREQUENTLY ASKED QUESTIONS (ABOUT THE NEW ISM MANUAL) Questions about Attachment 2 Q1: How important is Attachment 2? A: Attachment 2 is very important to obtaining a full understanding of the vision for full ISM implementation, at multiple, interacting levels, from the enterprise-level to the site-level, from the facility-level to the activity-level. The Attachment states: "This Attachment provides the vision for DOE to achieve the essential attributes of a high-performing organization, and further improve the Department's safety record and productivity record. This vision captures the elements needed for DOE to move beyond a compliance-based approach to a performance-based approach, consistent with more mature high-reliability organizations."


Frequently Asked Questions about Natural Gas Regulation | Department of  

Broader source: Energy.gov (indexed) [DOE]

Services » Natural Gas Regulation » Frequently Asked Questions Services » Natural Gas Regulation » Frequently Asked Questions about Natural Gas Regulation Frequently Asked Questions about Natural Gas Regulation Why do I need to have an authorization to import natural gas Do I have to get an authorization to export natural gas? Who is importing and exporting natural gas? What are the requested volumes of natural gas for import or export? What are the countries of origin for natural gas imported into the U.S. and destination of gas exported from the U.S.? What do I have to do to get an Authorization? Do I need to have an import authorization to use Canadian or Mexican natural gas in my factory? I don't know if I should request an import authorization or not. Who can I talk to about filing an application or whether I need to file an


10 Questions for a Cosmologist: Tom Abel | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

10 Questions for a Cosmologist: Tom Abel 10 Questions for a Cosmologist: Tom Abel 10 Questions for a Cosmologist: Tom Abel May 26, 2011 - 1:49pm Addthis Cosmologist Tom Abel | Photo Courtesy of SLAC Cosmologist Tom Abel | Photo Courtesy of SLAC Niketa Kumar Niketa Kumar Public Affairs Specialist, Office of Public Affairs "Some of my latest obsessions have to do with the formation, amplification and distribution of magnetic fields over cosmic history. Our computers are just getting big enough and our algorithms are just getting good enough to be able to tackle this." - Tom Abel After talking to Dr. Tom Abel, going back in time takes on a whole new meaning. Abel, a cosmologist working at SLAC National Accelerator Laboratory, uses supercomputer calculations to help learn about what happened in the first billion years of the history of the Universe. In the


10 Questions for an Automotive Engineer: Thomas Wallner | Department of  

Broader source: Energy.gov (indexed) [DOE]

10 Questions for an Automotive Engineer: Thomas Wallner 10 Questions for an Automotive Engineer: Thomas Wallner 10 Questions for an Automotive Engineer: Thomas Wallner June 17, 2011 - 3:30pm Addthis Argonne mechanical engineer Thomas Wallner adjusts Argonne's "omnivorous engine," an automobile engine that Wallner and his colleagues have tailored to efficiently run on blends of gasoline, ethanol and butanol. | Courtesy of: Argonne National Laboratory. Argonne mechanical engineer Thomas Wallner adjusts Argonne's "omnivorous engine," an automobile engine that Wallner and his colleagues have tailored to efficiently run on blends of gasoline, ethanol and butanol. | Courtesy of: Argonne National Laboratory. Niketa Kumar Niketa Kumar Public Affairs Specialist, Office of Public Affairs Meet Thomas Wallner - automotive engineer extraordinaire, who hails from


Questions and Answers - What's the melting point of steel?  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

If you jumped into a pool of liquid oxygen,would your body instantly crystallize? If you jumped into a pool of liquid oxygen,<br>would your body instantly crystallize? Previous Question (If you jumped into a pool of liquid oxygen, would your body instantly crystallize?) Questions and Answers Main Index Next Question (What is a material with a freezing point above 0 degrees Celsius?) What is a material with a freezingpoint above 0 degrees Celsius? What's the melting point of steel? That depends on the alloy of steel you are talking about. The term alloy is almost always used incorrectly these days, especially amongst bicyclists. They use the term to mean aluminum. What the term alloy really means is a mixture of metals, any kind of metals. Almost all metal used today is a mixture and therefore an alloy. Most steel has other metals added to tune its properties, like strength,


Trial Run of a Junction-Box Attachment Test for Use in Photovoltaic Module Qualification (Presentation)  

SciTech Connect (OSTI)

Engineering robust adhesion of the junction-box (j-box) is a hurdle typically encountered by photovoltaic (PV) module manufacturers during product development and manufacturing process control. There are historical incidences of adverse effects (e.g., fires), caused when the j-box/adhesive/module system has failed in the field. The addition of a weight to the j-box during the 'damp-heat', 'thermal-cycle', or 'creep' tests within the IEC qualification protocol is proposed to verify the basic robustness of the adhesion system. The details of the proposed test are described, in addition to a trial run of the test procedure. The described experiments examine 4 moisture-cured silicones, 4 foam tapes, and a hot-melt adhesive used in conjunction with glass, KPE, THV, and TPE substrates. For the purpose of validating the experiment, j-boxes were adhered to a substrate, loaded with a prescribed weight, and then subjected to aging. The replicate mock-modules were aged in an environmental chamber (at 85 deg C/85% relative humidity for 1000 hours; then 100 degrees C/<10% relative humidity for 200 hours) or fielded in Golden, Miami, and Phoenix for 1 year. Attachment strength tests, including pluck and shear test geometries, were also performed on smaller component specimens.

Miller, D.; Deibert, S.; Wohlgemuth, J.



Gas Storage Potential of Li-decorated ExBox4+  

E-Print Network [OSTI]

The newly developed compound ExBox4+ is explored to check whether it is a proficient hydrogen storage material. Both exoherdal and endohedral hydrogen adsorption on ExBox4+ are studied. Endohedral hydrogen molecules interact strongly than exohedral ones. The hydrogen adsorption energy is as good as the recently studied charged fullerenes. The hydrogen storage capacity appears to be ~4.3 wt%. The endohedral CO sorption is also analysed with the help of DFT. The first principle DFT calculation and MD simulation are performed to investigate the effect of lithium doping on the gas adsorbing capacity and adsorption enthalpy as well as adsorption energy of ExBox4+.The metal atom interaction with ExBox4+is found to be pretty strong, and the interaction energy appears to be higher than the metal cohesive energy.The thermodynamic parameters suggest that metal doping method is spontaneous in nature. The analysis of adsorption energy, thermodynamic properties and MD simulation results suggest that Li doped ExBox4+ can b...

Das, Ranjita



State DOT: Colorado State Report Questions on MEPDG Implementation  

E-Print Network [OSTI]

State DOT: Colorado State Report Questions on MEPDG Implementation 1. Summarize your state's status as far as MEPDG Implementation. Currently, CDOT is in the process of validating the MEPDG in Colorado and calibrating it to Colorado performance data. 2. What efforts have been made toward local calibration? CDOT has


Human-assisted graph search: it's okay to ask questions  

Science Journals Connector (OSTI)

We consider the problem of human-assisted graph search: given a directed acyclic graph with some (unknown) target node(s), we consider the problem of finding the target node(s) by asking an omniscient human questions of the form "Is there a target ...

Aditya Parameswaran; Anish Das Sarma; Hector Garcia-Molina; Neoklis Polyzotis; Jennifer Widom



Boosting Chinese Question Answering with Two Lightweight Methods  

E-Print Network [OSTI]

Question Answering (QA) research has been conducted in many languages. Nearly all the top performing-limited situations. In this article, we describe how a top- performing Chinese QA system can be designed by using, Academia Sinica, and the thematic program of Academia Sinica under Grant No. AS 95ASIA02. We wish to thank

Chu, Hao-hua


Questions and Answers from the University Librarian April 30, 2012  

E-Print Network [OSTI]

the models recommended by the self-study teams call for the transformation of library space. The plan.g. The Education/Psychology Library and Public Health Library are being examined by a space planning committeeQuestions and Answers from the University Librarian April 30, 2012 Why re-envision the Library

California at Berkeley, University of


Our "Friulian" experience Question #1: What is ethics?  

E-Print Network [OSTI]

BIOETHICS Our "Friulian" experience #12;#12;Question #1: What is ethics? A. Ethics has to do with my religious beliefs B. Ethics has to do with what my feelings tell me is right or wrong C. Being ethical is doing what the law requires D. Ethics consists of the standards of behavior our society accepts


Impact of Syrian Refugees on Jordan's Water Management Research Questions  

E-Print Network [OSTI]

: -Water management in Jordan -Environmental impact assessments of refugee camps -Water resourceImpact of Syrian Refugees on Jordan's Water Management Research Questions: What impact has the influx of 590,000 refugees had on water resources? How can Jordan improve refugee and water management


Responses to Questions and Answers Advanced Vehicle Technology Manufacturing Solicitation  

E-Print Network [OSTI]

1 Responses to Questions and Answers Advanced Vehicle Technology Manufacturing Solicitation PON successful applicants after the Notice of Proposed Awards to confirm this role and obtain any additional definition of "manufacturing equipment?" For example, would purchases of tooling or assembly line equipment


November 21, 2000 PV Lesson Plan 2 Sample Questions & Answers  

E-Print Network [OSTI]

November 21, 2000 PV Lesson Plan 2 ­ Sample Questions & Answers Prepared for the Oregon Million Solar Roofs Coalition By Frank Vignola ­ University of Oregon Solar Radiation Monitoring Lab John Hocken your understanding: 1. The typical voltage of a silicon solar cell is about 0.5 volts; where does

Oregon, University of


Usability testing: some current practices and research questions  

E-Print Network [OSTI]

applications. Keywords User centered design, user testing, usability testing, empirical user test, users for which the system was design), and favors positive attitudes and responses from the intended users [131 Usability testing: some current practices and research questions J.M. Christian Bastien

Paris-Sud XI, Université de


Alabama DOT: Alabama Report Questions on NDT Testing  

E-Print Network [OSTI]

Alabama DOT: Alabama Report Questions on NDT Testing 1. What NDT testing methods for concrete materials, concrete pavements, and overlays are you trying? · We perform pavement smoothness testing, pavement friction testing and FWD testing · We are currently using GPR on the I-59 project to locate voids


State DOT: PENNSYLVANIA State Report Questions on NDT Testing  

E-Print Network [OSTI]

State DOT: PENNSYLVANIA State Report Questions on NDT Testing 1. What NDT testing methods Deflectometer (FWD) testing on our pavements by request. We are currently looking into the use of Rolling Weight) to analyze our pavements. 2. In your experience, how does the reliability of NDT testing methods compare

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


State DOT: Colorado State Report Questions on NDT Testing  

E-Print Network [OSTI]

State DOT: Colorado State Report Questions on NDT Testing 1. What NDT testing methods for concrete materials, concrete pavements, and overlays are you trying? a. Maturity meters are used to test PCCP form and false work and continuing to the next phase of construction. b. Testing for dowel bar


Page 1 of 7 QuestionMark Perception PC Author  

E-Print Network [OSTI]

on the "Questions view" icon down the left side of the navigation panel (see image on right). Across the top of the screen, click on the "Add Topic" icon (shown in the image below). If you are not sure which icon to click, hover your cursor over the icon and a brief description of the icon will appear. The "Create Topic" pop

Oliver, Douglas L.


Implementation Guide for Use in Addressing Unreviewed Safety Question Requirements  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

This Guide provides information to assist in implementation of Title 10 Code of Federal Regulations Part 830.203, "Unreviewed Safety Question Process," of the Nuclear Safety Management Rules for Category 1, 2, and 3 nuclear facilities owned or operated by the Department of Energy, including the National Nuclear Security Administration. Cancels DOE G 424.1-1.



Implementation Guide for Use in Addressing Unreviewed Safety Question Requirements  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

This Guide provides information to assist in the implementation and interpretation of Title 10 Code of Federal Regulations (CFR) Part 830.203, Unreviewed Safety Question Process, of the Nuclear Safety Management Rules for applicable nuclear facilities owned or operated by the Department of Energy (DOE), including the National Nuclear Security Administration (NNSA). Canceled by DOE N 251.93.



Questioning Inevitability of Energy Pathways: Alternative Energy Scenarios for California  

E-Print Network [OSTI]

Questioning Inevitability of Energy Pathways: Alternative Energy Scenarios for California May 21.6.4 Alternative Scenario 3 ­ Patriotic Energy Independence Section 3: Developing the Scenario Model and Examining, 2002 by Rebecca Ghanadan rebeccag@socrates.berkeley.edu The Energy and Resources Group University

Kammen, Daniel M.



Science Journals Connector (OSTI)

......these questions, however, must demand some preliminary understanding...civilizations" of ancient Egypt, Babylonia, India, China...India or China (or Babylonia or Egypt, etc.) who, for solitary...and policies to govern their daily life. This "intimate" involve-ment......

J. Fang



HEALTH MATTERS Frequently Asked Questions About the Contraceptive Patch  

E-Print Network [OSTI]

HEALTH MATTERS Frequently Asked Questions About the Contraceptive Patch What is the contraceptive patch? The contraceptive patch is a highly effective, weekly hormonal birth control patch that is worn on the skin to prevent pregnancy. The patch is worn for one week and replaced on the same day of the week

Yener, Aylin


Questions and Answers About Drainage Water Management for the Midwest  

E-Print Network [OSTI]

WQ-44 Questions and Answers About Drainage Water Management for the Midwest Jane Frankenberger Nelson, Larry Brown Drainage Water Management Introduction Subsurface tile drainage is an essential water, and modifying drainage system design and operation. Drainage water management is one of these practices

Holland, Jeffrey


"Where is Everybody?" An Account of Fermi's Question  

DOE R&D Accomplishments [OSTI]

Enrico Fermi's famous question, now central to debates about the prevalence of extraterrestrial civilizations, arose during a luncheon conversation with Emil Konopinski, Edward Teller, and Herbert York in the summer of 1950. Fermi's companions on that day have provided accounts of the incident.

Jones, E. M.



Thinking Outside the (Tool) Box with the Building America Solution Center |  

Broader source: Energy.gov (indexed) [DOE]

Thinking Outside the (Tool) Box with the Building America Solution Thinking Outside the (Tool) Box with the Building America Solution Center Thinking Outside the (Tool) Box with the Building America Solution Center January 17, 2013 - 5:05pm Addthis The Energy Department's new Building America Solution Center provides building professionals with fast, free and reliable building science and efficiency knowledge. | Photo courtesy of the Energy Department. The Energy Department's new Building America Solution Center provides building professionals with fast, free and reliable building science and efficiency knowledge. | Photo courtesy of the Energy Department. Sam Rashkin Chief Architect, Building Technologies Office What is the Building America Solution Center? It is an online tool designed to provide building professionals with


NNSA Defense Programs collects nearly 20 large boxes of items for Toys for  

National Nuclear Security Administration (NNSA)

collects nearly 20 large boxes of items for Toys for collects nearly 20 large boxes of items for Toys for Tots | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Home > NNSA Blog > NNSA Defense Programs collects nearly 20 large ... NNSA Defense Programs collects nearly 20 large boxes of items for Toys for Tots Posted By Office of Public Affairs


Thinking Outside the (Tool) Box with the Building America Solution Center |  

Broader source: Energy.gov (indexed) [DOE]

Thinking Outside the (Tool) Box with the Building America Solution Thinking Outside the (Tool) Box with the Building America Solution Center Thinking Outside the (Tool) Box with the Building America Solution Center January 17, 2013 - 5:05pm Addthis The Energy Department's new Building America Solution Center provides building professionals with fast, free and reliable building science and efficiency knowledge. | Photo courtesy of the Energy Department. The Energy Department's new Building America Solution Center provides building professionals with fast, free and reliable building science and efficiency knowledge. | Photo courtesy of the Energy Department. Sam Rashkin Chief Architect, Building Technologies Office What is the Building America Solution Center? It is an online tool designed to provide building professionals with


Teacher questioning: effect on student communication in middle school algebra mathematics classrooms  

E-Print Network [OSTI]

This study investigates the components within teacher questioning and how they affect communication within the mathematics classroom. Components examined are the type of question, the amount of wait time allowed, the use of follow-up questions...

Matthiesen, Elizabeth Aprilla



Multi-Path Transportation Futures Study: Vehicle Characterization and Scenario Analyses - Main Text and Appendices A, B, C, D, and F  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Main Text and Appendices A, B, C, D, and F Main Text and Appendices A, B, C, D, and F Energy Systems Division Availability of This Report This report is available, at no cost, at http://www.osti.gov/bridge. It is also available on paper to the U.S. Department of Energy and its contractors, for a processing fee, from: U.S. Department of Energy Office of Scientific and Technical Information P.O. Box 62 Oak Ridge, TN 37831-0062


MA511: PRACTICE TEST 2 Answer all questions. No calculators or ...  

E-Print Network [OSTI]

MA511: PRACTICE TEST 2. Answer all questions. No calculators or other electronic devices are allowed. For questions 1 to 3, you may write down the answers...



E-Print Network 3.0 - automated question answering Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

The Problem of Selecting an Approach Based on Prior Success* Summary: for choosing rom among previously answered questions a question that dictates the approach to take......


E-Print Network 3.0 - asked questions faqs Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

directly... Frequently Asked Questions Frequently Asked Question 1.3 What is the Greenhouse Effect? The ... Source: National Oceanic and Atmospheric Administration, Pacific Marine...


E-Print Network 3.0 - architecture unanswered questions Sample...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

architecture unanswered questions Search Powered by Explorit Topic List Advanced Search Sample search results for: architecture unanswered questions Page: << < 1 2 3 4 5 > >> 1...


Automotive and MHE Fuel Cell System Cost Analysis (Text Version...  

Broader source: Energy.gov (indexed) [DOE]

Automotive and MHE Fuel Cell System Cost Analysis (Text Version) Automotive and MHE Fuel Cell System Cost Analysis (Text Version) Below is the text version of the webinar titled...


Secretary of Energy Moniz Keynote (Text Version) | Department...  

Energy Savers [EERE]

Secretary of Energy Moniz Keynote (Text Version) Secretary of Energy Moniz Keynote (Text Version) Below is the text version for the Keynote: The Honorable Ernest J. Moniz, U.S....

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Biomass 2013: Register Now (Text Version) | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

2013: Register Now (Text Version) Biomass 2013: Register Now (Text Version) Below is the text version for the Biomass 2013: Register Now video. The Video opens with "U.S....


Presidential Permits and Export Authorizations - Frequently Asked Questions  

Broader source: Energy.gov (indexed) [DOE]

Permits and Export Permits and Export Authorizations - Frequently Asked Questions Presidential Permits and Export Authorizations - Frequently Asked Questions Presidential Permits Export Authorizations Self Certifications Annual Reports Presidential Permits What are they? Permits for the construction, connection, operation and/or maintenance of electric transmission lines that cross the U.S. international border. What are the criteria? Two primary criteria are used to determine if a proposed project is consistent with the public interest. 1. DOE considers the impact the proposed project would have on the operating reliability of the U.S. electric power supply. 2. DOE must comply with the National Environmental Policy Act of 1969 (NEPA), which requires DOE to consider the environmental consequences


Microsoft Word - Frequently_Asked_Questions_7_20_2011  

Broader source: Energy.gov (indexed) [DOE]

(Updated 7/18/2011) 1 Certification Review Board (CRB) Processes for Grading Past Performance Question: Does the Certification Review Board (CRB or the Board) consider past performance when determining whether to grant or deny Federal Project Director (FPD) certification? Answer: Yes-the Board does consider past performance. An FPD's performance on his/her project(s) is one indicator of his/her ability to successfully manage future projects, especially at Levels 3 and 4 which tend to be more complicated and have a higher level of risk. Question: If I take over a failing project, does that automatically mean that my performance will be judged as inadequate? Answer: No-the Board is interested in a candidate's performance to determine if he/she made a positive


Microsoft Word - BingQuestionThreeLogistics0830.doc  

Gasoline and Diesel Fuel Update (EIA)

Review of Transportation Issues and Comparison of Infrastructure Costs for a Renewable Fuels Standard September 2002 ii Contacts This report was prepared by the Office of Integrated Analysis and Forecasting of the Energy Information Administration. General questions concerning the report may be directed to Mary J. Hutzler (202/586- 2222, mhutzler@eia.doe.gov), Director, Office of Integrated Analysis and Forecasting, or James Kendell (202/586-9646, james.kendell@eia.doe.gov), Director, Oil and Gas Division. Specific questions about the report may be directed to the following analyst: Amar Mann 202/586-2854 amar.man@eia.doe.gov Energy Information Administration/Review of Transportation Issues and Comparison 1 Review of Transportation Issues and Comparison of


10 Questions for a Nanoscientist: Seth Darling | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Nanoscientist: Seth Darling Nanoscientist: Seth Darling 10 Questions for a Nanoscientist: Seth Darling September 8, 2011 - 5:37pm Addthis Nanoscientist Seth Darling | Image courtesy of Argonne National Laboratory Nanoscientist Seth Darling | Image courtesy of Argonne National Laboratory Louise Lerner Media Specialist at Argonne National Laboratory "Materials really are the basis of almost every technology that's out there." - Seth Darling, Nanoscientist Ed. note: This is a cross-post from Argonne National Laboratory. Seth Darling is a scientist at Argonne's Center for Nanoscale Materials. He builds new materials for solar energy, with the aim of creating cheaper and more efficient solar cells. Question: How did you first get interested in science? Seth Darling: I can't remember back that far. I've been interested in


10 Questions for an Electrical Engineer: Rob Guglielmetti | Department of  

Broader source: Energy.gov (indexed) [DOE]

an Electrical Engineer: Rob Guglielmetti an Electrical Engineer: Rob Guglielmetti 10 Questions for an Electrical Engineer: Rob Guglielmetti July 14, 2011 - 12:05pm Addthis After initially majoring in Theatre in college, Rob Guglielmetti pursued a career in electrical engineering, working on daylighting at NREL's RSF highly efficient RSF building. | Photo Courtesy of Dennis Schroeder, NREL After initially majoring in Theatre in college, Rob Guglielmetti pursued a career in electrical engineering, working on daylighting at NREL's RSF highly efficient RSF building. | Photo Courtesy of Dennis Schroeder, NREL Niketa Kumar Niketa Kumar Public Affairs Specialist, Office of Public Affairs "It was a circuitous journey for sure. It started with stand-up comedy, to be honest!" Rob Guglielmetti From comedy to theater to architecture, our latest 10 Questions guest has a


Office of Headquarters Security Operations: Questions and Answers on the  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Questions and Answers on the New Access Control System at DOE Headquarters Questions and Answers on the New Access Control System at DOE Headquarters Q1 Why is the current access control system to security areas being changed? Q2 How is the new access control system different from the existing one? Q3 Who is affected? Q4 When will the new proximity card readers be installed? Q5 How will affected personnel at DOE HQ be notified about the installation of the proximity card readers that will affect their access to the HQ facilities and security areas, and the actions they will be required to take to assure their HSPD-12 badge will operate in the new readers? Q6 What will DOE HQ "Q" and "L" badged employees need to do? Q7 Will all DOE HQ security areas be changed out to the new access control system at the same time?


5 Questions for Indoor Environment Group's William Fisk  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

5 Questions for Indoor Environment Group's William Fisk 5 Questions for Indoor Environment Group's William Fisk William Fisk January 2014 Quantifying the Economic Implications of Indoor Air on Energy Efficiency, Performance, and Health William Fisk is a senior scientist, mechanical engineer, and leader of the Indoor Environment Group at Lawrence Berkeley National Laboratory (LBNL). During his 33 years at the lab, he has researched the interrelated issues of building energy performance, ventilation, indoor environmental quality (IEQ), and occupant health and performance. His research focuses primarily on energy efficient methods of maintaining and improving ventilation and IEQ in buildings and on quantifying the impacts of building ventilation and IEQ on health and performance. He is a fellow of ASHRAE, a member of the


USDOE Technology Transfer, Frequently Asked Questions about Agreement for  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Frequently Asked Questions about ACT: Frequently Asked Questions about ACT: Q1: What is ACT (Agreement for Commercializing Technology)? A1: ACT is a pilot program under which businesses may partner with participating DOE laboratories for research and development that commercializes technology. Q2: Why is this pilot being introduced? A2: ACT is being piloted to address concerns about difficulties in partnering with the DOE laboratories that were raised in public responses to a DOE Request for Information on improving technology transfer. These concerns include requirements for advance payments, indemnification and government use rights in intellectual property. Q3: Who can partner with the laboratories under ACT? A3: ACT is available to a full range of sponsors, including start-ups, small and large businesses that provide private funding to


Energy Information Administration (EIA)- Frequently Asked Questions (FAQ)  

Gasoline and Diesel Fuel Update (EIA)

Frequently Asked Questions about the Commercial Buildings Energy Frequently Asked Questions about the Commercial Buildings Energy Consumption Survey (CBECS) For the 2007 CBECS, why is there information only for large hospitals and not the rest of the commercial building population? What do you mean by "commercial"? Can I get this information by State (or county, or city, etc.)? What does the figure "4,859,000 total commercial buildings" represent? Are the consumption and expenditures estimates annual data? Are historical CBECS data available? Do you have any forecasts for growth in the commercial sector? Are the data available by NAICS or SIC code? Why are the CBECS figures different from the commercial data in the Annual Energy Review or the Monthly Energy Review? Is it possible to obtain a list of all the buildings that


ORP Tank Farms Unreviewed Safety Question Process Implementation  

Broader source: Energy.gov (indexed) [DOE]

0 Report Number: HIAR-HORP-2011-04-18 0 Report Number: HIAR-HORP-2011-04-18 Site: Office of River Protection Subject: Office of Independent Oversight's Office of Environment, Safety and Health Evaluations Activity Report for the Selected Aspects of Tank Farms Unreviewed Safety Question Process Implementation Dates of Activity 02/21/2011 - 04/18/2011 Report Preparer Shivaji S. Seth Activity Description/Purpose: The purpose of the activity, which was performed by the Office of Health, Safety and Security (HSS) as part of the Department of Energy (DOE) Office of River Protection's (ORP's) nuclear safety assessment and oversight, was to review and evaluate selected aspects of the Tank Farms Operating Contractor's (TOC's) implementation of the recently revised unreviewed safety question (USQ) procedure. A major aspect of the revised implemented process (Ref. 1) was to eliminate


Five Questions for Sustainable Energy Systems Group's Michael Sohn  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Five Questions for Sustainable Energy Systems Group's Michael Sohn Five Questions for Sustainable Energy Systems Group's Michael Sohn Michael Sohn November 2013 Assessing Probability and Uncertainty for Smarter Decisions and Policies In this first of a series of Q&As with researchers in the Environmental Energy Technologies Division, Michael Sohn talks about probability and uncertainty in modeling. Michael Sohn is an environmental engineer working to understand how chemicals and energy are used in the world at various scales-global, state, and building. His research interests are in mathematical modeling of environmental systems and quality, uncertainty analysis, value-of-information decision analysis, water-energy integrated assessment, and sensor-data fusion. Sohn has a PhD in Civil and Environmental Engineering and an MS degree in


EIA Forms 826 and 861 Frequently Asked Questions  

Gasoline and Diesel Fuel Update (EIA)

EIA Forms 826 and 861 Frequently Asked Questions EIA Forms 826 and 861 Frequently Asked Questions Advanced Metering Demand Side Management (DSM) - 861 only General Green Pricing Programs Net Metering Advanced Metering Regarding AMR meters, does the EIA only want the company to provide a count of those meters that transmit data one-way AND are read via drive-by vans? What if a meter reader walks by using a hand held reader? Meters queried via hand held readers would be included in the count. If a utility has deployed AMI meters for data collection and billing purposes but does not provide that data to the customer should the AMI meter be counted? The instructions for the EIA Form-861 state that AMI meters measure and record usage at least hourly and provide usage data to provide the customer and the energy company at least daily. So, if the data is not provided to


Home Energy Score: Frequently Asked Questions for Partners | Department of  

Broader source: Energy.gov (indexed) [DOE]

Partners Partners Home Energy Score: Frequently Asked Questions for Partners Below you will find answers to frequently asked questions for homeowners and Partners about the Home Energy Score, from basics such as what a Home Energy Score is and how to become a Partner, to how the Score is calculated. What is a Home Energy Score? What types of homes can get a Home Energy Score? Where is the Home Energy Score offered? Who can become a Home Energy Score Partner? Why should I become a Home Energy Score Partner? What is required of Partners? Partners have to score 200 homes in the first year. When does that start/end? How do I apply to become a Partner? Can the Home Energy Scoring Tool be integrated with other software tools we already use? What are the criteria for Qualified Assessors?


10 Questions for a Physicist: Uwe Bergmann | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Physicist: Uwe Bergmann Physicist: Uwe Bergmann 10 Questions for a Physicist: Uwe Bergmann June 23, 2011 - 1:55pm Addthis Uwe Bergmann | Photo Courtesy of Brad Plummer, SLAC Uwe Bergmann | Photo Courtesy of Brad Plummer, SLAC Niketa Kumar Niketa Kumar Public Affairs Specialist, Office of Public Affairs What are the key facts? Uwe Bergmann works with the world's first free electron x-ray laser to make atomic resolution movie of photosynthesis -- how sunlight splits water into oxygen. He used synchotron x-rays to view the plumage of one of the most iconic fossils, Archaeopteryx, the 150-million-year-old ancestor of modern birds, as well as uncovering some of Archimedes' original writings. While officially billed as a physicist at SLAC National Accelerator Laboratory, our latest 10 Questions guest may be more aptly titled a


Responses to IT-related Questions from the Transition Team  

Broader source: Energy.gov (indexed) [DOE]

IT-related Questions from the Transition Team IT-related Questions from the Transition Team 1. Major IT Infrastructure(s) DOE has a single IT infrastructure that supports most of Federal DOE. It is managed by the Office of the Chief Information Officer (OCIO). It includes a single, integrated, nationwide network and direct support for workstations at headquarters and for Federal employees in the field. It also includes two geographically separated data centers, one a backup for coop purposes. The data centers support workstations and mobile computing, application servers, and network connectivity. The infrastructure includes a single help desk. This IT infrastructure is managed and overseen by DOE federal employees, with most of the technical support, e.g. help desk, system administration, and data center


10 Questions for a Physicist: Antonio Checco | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Physicist: Antonio Checco Physicist: Antonio Checco 10 Questions for a Physicist: Antonio Checco February 3, 2011 - 10:00am Addthis Antonio Checco | Source: Brookhaven National Lab Antonio Checco | Source: Brookhaven National Lab Niketa Kumar Niketa Kumar Public Affairs Specialist, Office of Public Affairs Ralph Waldo Emerson once noted, "Men love to wonder, and that is the seed of science." At the Department of Energy, our National Laboratories' scientists, researchers and engineers have big imaginations - they are at the forefront of scientific innovation and ingenuity. Every day, they're advancing a breadth of fields from clean energy and energy efficiency to nanomaterials and nuclear and particle physics. Today, the Energy Blog is launching a new series, 10 Questions, with a


Home Energy Score: Frequently Asked Questions for Homeowners | Department  

Broader source: Energy.gov (indexed) [DOE]

Homeowners Homeowners Home Energy Score: Frequently Asked Questions for Homeowners Below you will find answers to frequently asked questions for homeowners about the Home Energy Score, from basics such as what a Home Energy Score is, to how the Score is calculated and what you can expect from your Score. What is a Home Energy Score? Why should I get a Home Energy Score? What types of homes can get a Home Energy Score? How do I get a Home Energy Score? What does the Qualified Assessor look for during a Home Energy Score walk-through? How is the Home Energy Score calculated? Does a home with a poor (lower) Score always use more energy than a home with a better (higher) Score? Does the size of my home matter? Would my Score be the same in different parts of the country?


Reaching for answers to questions about the heart  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Reaching for answers to questions about the heart Reaching for answers to questions about the heart Michael Reedy (Duke University) and Tanya Bekyarova (Illinois Institute of Technology) in action on the Bio-CAT beamline 18-ID at the U.S. Department of Energy's Advanced Photon Source (APS), Argonne National Laboratory. They are studying mechanisms of stretch activation in insect flight muscle. Stretch activation is very important in human heart muscle when contraction of one part of the heart stretches adjacent muscle tissue causing it to respond a moment later by generating more force aiding cardiac "ejection," i.e., the amount of blood pumped per beat. Muscle structure and function can be studied using high-brilliance x-ray beams, such as those produced by the APS, and the experimental technique time-resolved small-angle fiber


Fermilab | Traffic Safety at Fermilab | Questions & Answers  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Questions & Answers Questions & Answers I received an e-mail stating that I have received a traffic citation, but I did not. What do I do? The email I received states that I have five working days after receiving a citation to appeal, what does that mean? I filled out the citation appeal form and submitted it, what happens next? I missed the five day deadline, what do I do now? I lost my appeal and disagree with the results, what do I do now? I lost my appeal and received disciplinary action, what do I do now? I received a citation but did not sign it because I disagreed with the charge and that, without my signature, it would not be considered a valid citation. I received an email saying that it was a violation. Why did this happen? Why should I appeal a citation? Employees never win anyway.

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Question about Map of Wind Farms | OpenEI Community  

Open Energy Info (EERE)

Question about Map of Wind Farms Question about Map of Wind Farms Home > Groups > Developer I am curious whether there is a data file that contains the GPS coordinates for all of the wind farms on the Open EI map (en.openei.org/wiki/Map_of_Wind_Farms). I saw that coordinates can be found separately for each wind farm (by clicking on the wind farm name to the right of the map), but I am hoping there is a short cut that could allow me to quickly map all of the wind farms using GIS software. Submitted by Wzeng on 13 July, 2012 - 13:59 1 answer Points: 0 Hi, there is a button labeled "Download CSV" below the map. A recent change was made to make the geographic coordinates available in the download. They appear in a field titled Coordinates as numeric values of latitude and longitude, in decimal degrees. In order to use with GIS software, the


Question about Map of Wind Farms | OpenEI Community  

Open Energy Info (EERE)

Question about Map of Wind Farms Question about Map of Wind Farms Home > Groups > Developer I am curious whether there is a data file that contains the GPS coordinates for all of the wind farms on the Open EI map (en.openei.org/wiki/Map_of_Wind_Farms). I saw that coordinates can be found separately for each wind farm (by clicking on the wind farm name to the right of the map), but I am hoping there is a short cut that could allow me to quickly map all of the wind farms using GIS software. Submitted by Wzeng on 13 July, 2012 - 13:59 1 answer Points: 0 Hi, there is a button labeled "Download CSV" below the map. A recent change was made to make the geographic coordinates available in the download. They appear in a field titled Coordinates as numeric values of latitude and longitude, in decimal degrees. In order to use with GIS software, the


FOIA Frequently Asked Questions (FAQs) | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

FOIA FOIA Frequently Asked Questions (FAQs) FOIA Frequently Asked Questions (FAQs) How can I get records from the DOE? Do I need to file a written FOIA request to receive general information about the DOE? Where can I find examples of previous FOIA requests for DOE documents? What kind of records may I request from the DOE under the FOIA? How long will it take the DOE to respond to my FOIA request? How can I get expedited processing? What kinds of records may the DOE withhold from me? How will I know what records the DOE has withheld from me? What happens if the DOE does not have the records I want? How do I reach the FOIA Officer or the person who is handling my request? How do I get a copy of the DOE FOIA Annual Report? Must I use a special form to file a FOIA request and what


Fuel Cell Technologies Office: Hydrogen Safety (Text Alternative Version)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Safety (Text Safety (Text Alternative Version) to someone by E-mail Share Fuel Cell Technologies Office: Hydrogen Safety (Text Alternative Version) on Facebook Tweet about Fuel Cell Technologies Office: Hydrogen Safety (Text Alternative Version) on Twitter Bookmark Fuel Cell Technologies Office: Hydrogen Safety (Text Alternative Version) on Google Bookmark Fuel Cell Technologies Office: Hydrogen Safety (Text Alternative Version) on Delicious Rank Fuel Cell Technologies Office: Hydrogen Safety (Text Alternative Version) on Digg Find More places to share Fuel Cell Technologies Office: Hydrogen Safety (Text Alternative Version) on AddThis.com... Publications Program Publications Technical Publications Educational Publications Newsletter Program Presentations Multimedia Conferences & Meetings


Fuel Cell Technologies Office: Hydrogen Cars (Text Alternative Version)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Cars (Text Cars (Text Alternative Version) to someone by E-mail Share Fuel Cell Technologies Office: Hydrogen Cars (Text Alternative Version) on Facebook Tweet about Fuel Cell Technologies Office: Hydrogen Cars (Text Alternative Version) on Twitter Bookmark Fuel Cell Technologies Office: Hydrogen Cars (Text Alternative Version) on Google Bookmark Fuel Cell Technologies Office: Hydrogen Cars (Text Alternative Version) on Delicious Rank Fuel Cell Technologies Office: Hydrogen Cars (Text Alternative Version) on Digg Find More places to share Fuel Cell Technologies Office: Hydrogen Cars (Text Alternative Version) on AddThis.com... Publications Program Publications Technical Publications Educational Publications Newsletter Program Presentations Multimedia Conferences & Meetings


Fuel Cell Technologies Office: Hydrogen Storage (Text Alternative Version)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Storage (Text Storage (Text Alternative Version) to someone by E-mail Share Fuel Cell Technologies Office: Hydrogen Storage (Text Alternative Version) on Facebook Tweet about Fuel Cell Technologies Office: Hydrogen Storage (Text Alternative Version) on Twitter Bookmark Fuel Cell Technologies Office: Hydrogen Storage (Text Alternative Version) on Google Bookmark Fuel Cell Technologies Office: Hydrogen Storage (Text Alternative Version) on Delicious Rank Fuel Cell Technologies Office: Hydrogen Storage (Text Alternative Version) on Digg Find More places to share Fuel Cell Technologies Office: Hydrogen Storage (Text Alternative Version) on AddThis.com... Publications Program Publications Technical Publications Educational Publications Newsletter Program Presentations Multimedia Conferences & Meetings


Energy Code Compliance and Enforcement Best Practices (Text Version...  

Broader source: Energy.gov (indexed) [DOE]

Energy Code Compliance and Enforcement Best Practices (Text Version) Energy Code Compliance and Enforcement Best Practices (Text Version) Curtis Framel: Good afternoon, and good...


Energy Saving Performance Contracting (ESPC) Basics (Text Version...  

Broader source: Energy.gov (indexed) [DOE]

Saving Performance Contracting (ESPC) Basics (Text Version) Energy Saving Performance Contracting (ESPC) Basics (Text Version) Chani Vines: Hello. We'll be starting in five...


Assignment 3 MECH 421/6511 Solutions Question 1  

E-Print Network [OSTI]

and length = 12 ft. The extruder screw rotates at 50 rev/min; it has channel depth = 0.30 in and flight angle (given) curves with the calculated ones. Question 4: An extruder has a barrel diameter = 5.0 inch = 17.7°. The plastic melt has a shear viscosity = 100 x 10-4 lb- sec/in2 . Find: (a) the extruder

Medraj, Mamoun


Implementation Guide for Use in Addressing Unreviewed Safety Question Requirements  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

This Guide, including its attachments, provides information to assist in the implementation of Title 10 Code of Federal Regulations (CFR) Section 830.203, Unreviewed Safety Question Process, of the Nuclear Safety Management Rules for Category 1, 2, and 3 nuclear facilities owned or operated by the Department of Energy (DOE), including the National Nuclear Security Administration (NNSA). Cancels DOE G 424.1-1A. Admin Chg 1 dated 4-12-13.



Office of Departmental Personnel Security - Frequently Asked Questions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Frequently Asked Questions (FAQs) Frequently Asked Questions (FAQs) DOE Personnel Security The Personnel Security Program ensures that individuals who are being considered for access to classified information or special nuclear material (SNM) meet national standards of honesty, reliability, and trustworthiness. Because each Federal agency's program is similar, most questions come from personnel who have never had a security clearance (DOE calls it an access authorization) or who are confused because they had clearances at agencies that had requirements that differ slightly from DOE's. Additional information for applicants can be found at "Overview of Access Authorization Process for Applicants". Q: How does drug use impact my ability to get an access authorization? A: Use of illegal drugs, abuse of prescription drugs, and misuse of other substances such as inhalants raise concerns about an individual's eligibility for an access authorization. Such activities call into question the person's willingness to follow rules and requirements, reliability, and good judgment. In general, individuals involved with illegal drugs or substance abuse will not be granted an access authorization if the activity occurred within the year prior to the application for the access authorization. If the activity occurred within two years, the full circumstances surrounding the activity will be evaluated and the individual may qualify for an access authorization, although it is unlikely that he or she will do so. Information pertaining to drug use which occurred more than two years ago will not be automatically disqualifying for an access authorization but will be fully evaluated with all other available information in order to determine whether the individual should be granted an access authorization.


Questions and Answers - How fast do electrons move?  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

If things are made from atoms, why dodifferent things have different properties? If things are made from atoms, why do<br>different things have different properties? Previous Question (If things are made from atoms, why do different things have different properties?) Questions and Answers Main Index Next Question (What do we use to measure mass?) What do we use to measure mass? How fast do electrons move? As fast as you can get them going! Well not quite. One of the facts of life discovered in the 20th century is that the speed of light (300,000 kilometers per second) is the ultimate speed limit. As you add energy to the electron, it will go faster, but as you get it to go close to the speed of light, you find that you have to add even more energy just to bump it a bit faster. For example, with just over 220,000 eV (which stands for a


Questions and Answers for the Smart Grid Investment Grant Program: Grant  

Broader source: Energy.gov (indexed) [DOE]

Questions and Answers for the Smart Grid Investment Grant Program: Questions and Answers for the Smart Grid Investment Grant Program: Grant and Award-Related Frequently Asked Questions Questions and Answers for the Smart Grid Investment Grant Program: Grant and Award-Related Frequently Asked Questions Additional questions and answers from recipients on various grant and award related issues relative to the Smart Grid Investment Grant Program of the American Recovery and Reinvestment Act. Questions and Answers for the Smart Grid Investment Grant Program: Grant and Award-Related Frequently Asked Questions More Documents & Publications Questions and Answers for the Smart Grid Investment Grant Program: Grant and Award-Related Issues Questions and Answers for the Smart Grid Investment Grant Program: Reporting Webinar Questions and Answers for the Smart Grid Investment Grant Program: Buy


DOE Withdraws Proposed Rulemaking (Test Procedure) and Proposed Coverage Determination (Energy Conservation Standard) for Set-Top Boxes  

Broader source: Energy.gov [DOE]

The Department of Energy (DOE) has issued pre-publication Federal Register notices withdrawing the notice of proposed rulemaking for a test procedure for set-top boxes and the proposed coverage determination for set-top boxes and network equipment.


Blackboard Learning Services V-F1 Page 1 Blackboard Inc. Digital Drop Box vs. Assignment Manager Tip Sheet  

E-Print Network [OSTI]

Blackboard Learning Services V-F1 Page 1 Blackboard Inc. Digital Drop Box vs. Assignment Manager Tip Sheet Blackboard Best Practices: Digital Drop Box vs. Assignment Manager A Blackboard Learning causes confusion for students and instructors alike. Adding a File When a user elects to Add File


Arabidopsis EIN3-binding F-box 1 and 2 form ubiquitin-protein ligases that repress ethylene action  

E-Print Network [OSTI]

Arabidopsis EIN3-binding F-box 1 and 2 form ubiquitin-protein ligases that repress ethylene action-box proteins, EBF1 and -2, that work coordinately in SCF complexes to repress ethylene action. Mutations in either gene cause hypersensitivity to exogenous ethylene and its precursor 1-aminocyclopropane-1

Sheen, Jen


Office of the General Counsel Building 460 P.O. Box 5000  

E-Print Network [OSTI]

Office of the General Counsel Building 460 P.O. Box 5000 Upton. NY 11973-5000 Phone 516 344-8629 EN of Energy WY;'W.bnl.gov Memo Date: September 30, 1999 To: George Malosh From: Gregory Fes~ Subject: DOE Te: As above stated #12;DEPARTMENT OF ENERGY TECHNOLOGY PARTNERSHIP 0!\\-1BUDS INTTIATIVE C01\\rf


SOUTHEASTERN NATURALIST2006 5(2):191204 Natural History of Terrapene carolina (Box Turtles)  

E-Print Network [OSTI]

) in an Urbanized Landscape Sarah A. Budischak1,2 , Joy M. Hester1,3 , Steven J. Price1 , and Michael E. Dorcas1 (Eastern Box Turtles), we conducted a mark-recapture study in the vicinity of Davidson, NC, from 1999

Dorcas, Michael E.


Philadelphia University P.O. Box (1) Philadelphia University 19392 Jordan  

E-Print Network [OSTI]

[1/3] Philadelphia University P.O. Box (1) Philadelphia University 19392 Jordan Fax Number: +962 in Computer Science Personal Information Date of Birth : April 7, 1961 Place of Birth : Irbid, Jordan of Science (With Honor) Computer Science Department, The Yarmouk University, Ibid, Jordan. 1980 Secondary


Black-Box Identification for PLC based MPC of a Binary Distillation Column  

E-Print Network [OSTI]

Black-Box Identification for PLC based MPC of a Binary Distillation Column B. Huyck ,, F. Logist J is to upgrade the control system with a linear MPC running on a PLC. However, before a model based controller can be used on a PLC, an accurate (but simple) process model has to be constructed. Hence, the aim

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Engineering safety evaluation for 22 ton steel disposal box lifting bail design  

SciTech Connect (OSTI)

The objective of this analysis is to design and analyze the lifting bail of the 22 Ton Steel Waste Disposal Box (SWDB). The new design takes the original lifting bail and adds a hinge allowing the top portion of the bail to fold over towards the lid.





E-Print Network [OSTI]

Page 1 LCA AND THE X-DEVELOPMENT METHOD, THE CASE STUDY OF A TRANSPORT BOX Jean Vareille (1), Mehdi consequence is the reduction of the iterations during the design, especially in a LCA. Keywords design, the thickness, the ribs, etc. hal-00763821,version1-11Dec2012 Author manuscript, published in "LCA Conference

Paris-Sud XI, Université de


Protein arginine methyltransferase 1 regulates herpes simplex virus replication through ICP27 RGG-box methylation  

SciTech Connect (OSTI)

Protein arginine methylation is involved in viral infection and replication through the modulation of diverse cellular processes including RNA metabolism, cytokine signaling, and subcellular localization. It has been suggested previously that the protein arginine methylation of the RGG-box of ICP27 is required for herpes simplex virus type-1 (HSV-1) viral replication and gene expression in vivo. However, a cellular mediator for this process has not yet been identified. In our current study, we show that the protein arginine methyltransferase 1 (PRMT1) is a cellular mediator of the arginine methylation of ICP27 RGG-box. We generated arginine substitution mutants in this domain and examined which arginine residues are required for methylation by PRMT1. R138, R148 and R150 were found to be the major sites of this methylation but additional arginine residues serving as minor methylation sites are still required to sustain the fully methylated form of ICP27 RGG. We also demonstrate that the nuclear foci-like structure formation, SRPK interactions, and RNA-binding activity of ICP27 are modulated by the arginine methylation of the ICP27 RGG-box. Furthermore, HSV-1 replication is inhibited by hypomethylation of this domain resulting from the use of general PRMT inhibitors or arginine mutations. Our data thus suggest that the PRMT1 plays a key role as a cellular regulator of HSV-1 replication through ICP27 RGG-box methylation.

Yu, Jungeun; Shin, Bongjin; Park, Eui-Soon; Yang, Sujeong; Choi, Seunga [Department of Microbiology, Chungnam National University, 220 Gung-dong, Yuseong-gu, Daejon 305-764 (Korea, Republic of) [Department of Microbiology, Chungnam National University, 220 Gung-dong, Yuseong-gu, Daejon 305-764 (Korea, Republic of); BK21 Bio Brain Center, Chungnam National University, 220 Gung-dong, Yuseong-gu, Daejon 305-764 (Korea, Republic of); Kang, Misun [Department of Microbiology, Chungnam National University, 220 Gung-dong, Yuseong-gu, Daejon 305-764 (Korea, Republic of)] [Department of Microbiology, Chungnam National University, 220 Gung-dong, Yuseong-gu, Daejon 305-764 (Korea, Republic of); Rho, Jaerang, E-mail: jrrho@cnu.ac.kr [Department of Microbiology, Chungnam National University, 220 Gung-dong, Yuseong-gu, Daejon 305-764 (Korea, Republic of) [Department of Microbiology, Chungnam National University, 220 Gung-dong, Yuseong-gu, Daejon 305-764 (Korea, Republic of); BK21 Bio Brain Center, Chungnam National University, 220 Gung-dong, Yuseong-gu, Daejon 305-764 (Korea, Republic of); GRAST, Chungnam National University, 220 Gung-dong, Yuseong-gu, Daejon 305-764 (Korea, Republic of)



The Department of Marketing 234 Business Bldg. Box 19469 817-272-2876  

E-Print Network [OSTI]

The Department of Marketing 234 Business Bldg. · Box 19469 · 817-272-2876 wweb.uta.edu/marketing/ Requirements for a Bachelor of Business Administration Degree (Marketing Option) See the College of Business: · BCOM 3360 - Effective Business Communications · MARK 3321 - Principles of Marketing The University

Texas at Arlington, University of


Design and Fabrication of a High Voltage Distribution Box Michael Barnett  

E-Print Network [OSTI]

of paint. This ensured that the lock washers for the BNC plugs made solid electrical contacts with the box the shielding of the coaxial RG47 cable continuous, which helped to reduce noise injection into the lines. The BNC ports were manufactured by KINGS, part no. 1704-1. They used a lock washer and a threaded nut

Saskatchewan, University of



E-Print Network [OSTI]

BLACK-BOX MODELLING OF HVAC SYSTEM: IMPROVING THE PERFORMANCES OF NEURAL NETWORKS Eric FOCK Ile de La Réunion - FRANCE ABSTRACT This paper deals with neural networks modelling of HVAC systems of HVAC system can be modelled using manufacturer design data presented as derived performance maps

Boyer, Edmond


The Garden of the Coastal Plain P. O. Box 8039, 1505 Bland Avenue  

E-Print Network [OSTI]

The Garden of the Coastal Plain P. O. Box 8039, 1505 Bland Avenue Statesboro, Georgia 30460 912.871 Cottage and an open-air Heritage Pavilion. CALL. Contact the Garden (912-871-1149) after your visit, 1505 Bland Avenue Statesboro, Georgia 30460 912.871.1149 I have read and understand the Facility Rental

Hutcheon, James M.


Randomly accelerated particle in a box: Mean absorption time for partially absorbing and inelastic boundaries  

E-Print Network [OSTI]

Randomly accelerated particle in a box: Mean absorption time for partially absorbing and inelastic which is randomly accelerated by Gaussian white noise on the line segment 0 x 1 and is absorbed as soon accelerated particle which moves on the half line x 0 with an absorbing boundary at x=0. The motion


On the Occurrence of Thermal Runaway in Diode in the J-Box  

Broader source: Energy.gov [DOE]

This PowerPoint presentation, focused on the environmental testing of diodes, was originally presented at the International PV Module Quality Assurance Forum on Feb. 26-27, 2013 in Denver, CO. It details the thermal runaway tests of J-boxes and discusses the Tj measurement method for bypass diodes. The presentation wraps up with a discussion of the team's anticipated next steps.


Cavity-nesting Bird Use of Nest Boxes in Vineyards of Central-Coast California1  

E-Print Network [OSTI]

Cavity-nesting Bird Use of Nest Boxes in Vineyards of Central-Coast California1 Daniel P. Mummert,2 by vineyards in many areas of central- coastal California. Oak woodlands are home to many insectivorous, cavity-nesting birds that would be beneficial in and around vineyards. During March to June 2001, we used bluebird nest

Standiford, Richard B.



E-Print Network [OSTI]

Princeton Plasma Physics Laboratory, Princeton University, Princeton, NJ 08543; psharma@pppl.gov, hammettSHEARING BOX SIMULATIONS OF THE MRI IN A COLLISIONLESS PLASMA Prateek Sharma and Gregory W. Hammett@astron.berkeley.edu and James M. Stone Department of Astrophysical Sciences, Princeton University, Princeton, NJ 08544; jstone@astro.princeton

Hammett, Greg


Alameda Creek Alliance P.O. Box 2626 Niles, CA 94536 (510) 499-9185  

E-Print Network [OSTI]

Alameda Creek Alliance P.O. Box 2626 · Niles, CA · 94536 · (510) 499-9185 e-mail: alamedacreek@hotmail.com web site: www.alamedacreek.org Alameda Creek Alliance Annual Membership Dinner Presentation Alliance. Join the Alameda Creek Alliance for a presentation by Robin Grossinger of the San Francisco


An Analysis of Bicycle-Vehicle Interactions at Signalized Intersections with Bicycle Boxes  

E-Print Network [OSTI]

An Analysis of Bicycle-Vehicle Interactions at Signalized Intersections with Bicycle Boxes. To develop the conflict data, a log was created of each motor vehicle and bicycle passing through,849 bicycles. A total of 19 conflicts were observed during the after period. Total exposure was 42,381 motor

Bertini, Robert L.


The DEAD Box RNA Helicase VBH-1 Is Required for Germ Cell Function in C. elegans  

E-Print Network [OSTI]

Salinas,1 Ernesto Maldonado,2 Marina Maci´as-Silva,1 T. Keith Blackwell,3,4 and Rosa E. Navarro1 * 1; Lasko and Ashburner, 1988; Navarro et al., 2001). DEAD box RNA helicases belong to a conserved family

Blackwell, Keith


Box Elder, Montana: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

Montana: Energy Resources Montana: Energy Resources Jump to: navigation, search Equivalent URI DBpedia Coordinates 48.3172085°, -110.0132634° Loading map... {"minzoom":false,"mappingservice":"googlemaps3","type":"ROADMAP","zoom":14,"types":["ROADMAP","SATELLITE","HYBRID","TERRAIN"],"geoservice":"google","maxzoom":false,"width":"600px","height":"350px","centre":false,"title":"","label":"","icon":"","visitedicon":"","lines":[],"polygons":[],"circles":[],"rectangles":[],"copycoords":false,"static":false,"wmsoverlay":"","layers":[],"controls":["pan","zoom","type","scale","streetview"],"zoomstyle":"DEFAULT","typestyle":"DEFAULT","autoinfowindows":false,"kml":[],"gkml":[],"fusiontables":[],"resizable":false,"tilt":0,"kmlrezoom":false,"poi":true,"imageoverlays":[],"markercluster":false,"searchmarkers":"","locations":[{"text":"","title":"","link":null,"lat":48.3172085,"lon":-110.0132634,"alt":0,"address":"","icon":"","group":"","inlineLabel":"","visitedicon":""}]}


Text-Alternative Version: LED Essentials- Technology, Applications, Advantages, Disadvantages  

Broader source: Energy.gov [DOE]

Below is the text-alternative version of the LED Essentials - Technology, Applications, Advantages, Disadvantages webcast.



E-Print Network [OSTI]

: principles and practice 1st Cavanagh, Fairbrother, Palmer, Skelton AP 62000 No text required Wirth 62200

Ginzel, Matthew


Enriched Protein-Protein Interactions from Biomedical Text  

E-Print Network [OSTI]

Enriched Protein-Protein Interactions from Biomedical Text Barry Haddow, Michael Matthews from Biomedical Text #12;Overview The TXM Project Protein-Protein Interactions Enriched Protein Protein-Protein Interactions from Biomedical Text #12;Project Information Text Mining Programme funded (3

Edinburgh, University of


Fuel Cell Technologies Office: Hydrogen Refueling Protocols Webinar (Text  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Hydrogen Refueling Hydrogen Refueling Protocols Webinar (Text Version) to someone by E-mail Share Fuel Cell Technologies Office: Hydrogen Refueling Protocols Webinar (Text Version) on Facebook Tweet about Fuel Cell Technologies Office: Hydrogen Refueling Protocols Webinar (Text Version) on Twitter Bookmark Fuel Cell Technologies Office: Hydrogen Refueling Protocols Webinar (Text Version) on Google Bookmark Fuel Cell Technologies Office: Hydrogen Refueling Protocols Webinar (Text Version) on Delicious Rank Fuel Cell Technologies Office: Hydrogen Refueling Protocols Webinar (Text Version) on Digg Find More places to share Fuel Cell Technologies Office: Hydrogen Refueling Protocols Webinar (Text Version) on AddThis.com... Publications Program Publications Technical Publications Educational Publications


Fuel Cell Technologies Office: Hydrogen Delivery and Fueling (Text  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Delivery and Delivery and Fueling (Text Alternative Version) to someone by E-mail Share Fuel Cell Technologies Office: Hydrogen Delivery and Fueling (Text Alternative Version) on Facebook Tweet about Fuel Cell Technologies Office: Hydrogen Delivery and Fueling (Text Alternative Version) on Twitter Bookmark Fuel Cell Technologies Office: Hydrogen Delivery and Fueling (Text Alternative Version) on Google Bookmark Fuel Cell Technologies Office: Hydrogen Delivery and Fueling (Text Alternative Version) on Delicious Rank Fuel Cell Technologies Office: Hydrogen Delivery and Fueling (Text Alternative Version) on Digg Find More places to share Fuel Cell Technologies Office: Hydrogen Delivery and Fueling (Text Alternative Version) on AddThis.com... Publications Program Publications

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Frequently Asked Questions About the Municipal Solid-State Street Lighting Consortium  

Broader source: Energy.gov [DOE]

This page addresses many of the questions about the Municipal Solid-State Street Lighting Consortium.


Questions and Answers for the Smart Grid Investment Grant Program: Grant  

Broader source: Energy.gov (indexed) [DOE]

Grant and Award-Related Frequently Asked Questions Grant and Award-Related Frequently Asked Questions Questions and Answers for the Smart Grid Investment Grant Program: Grant and Award-Related Frequently Asked Questions Additional questions and answers from recipients on various grant and award related issues relative to the Smart Grid Investment Grant Program of the American Recovery and Reinvestment Act. Questions and Answers for the Smart Grid Investment Grant Program: Grant and Award-Related Frequently Asked Questions More Documents & Publications Questions and Answers for the Smart Grid Investment Grant Program: Grant and Award-Related Issues Questions and Answers for the Smart Grid Investment Grant Program: Reporting Webinar Questions and Answers for the Smart Grid Investment Grant Program: Confidentiality (Revised Answer)


Building America Technology Solutions for New and Existing Homes: New Insights for Improving the Designs of Flexible Duct Junction Boxes (Fact Sheet)  

Broader source: Energy.gov [DOE]

IBACOS explored the relationships between pressure and physical configurations of flexible duct junction boxes by using computational fluid dynamics simulations to predict individual box parameters and total system pressure, thereby ensuring improved HVAC performance.


Unreviewed Disposal Question Evaluation: Waste Disposal In Engineered Trench #3  

SciTech Connect (OSTI)

Because Engineered Trench #3 (ET#3) will be placed in the location previously designated for Slit Trench #12 (ST#12), Solid Waste Management (SWM) requested that the Savannah River National Laboratory (SRNL) determine if the ST#12 limits could be employed as surrogate disposal limits for ET#3 operations. SRNL documented in this Unreviewed Disposal Question Evaluation (UDQE) that the use of ST#12 limits as surrogates for the new ET#3 disposal unit will provide reasonable assurance that Department of Energy (DOE) 435.1 performance objectives and measures (USDOE, 1999) will be protected. Therefore new ET#3 inventory limits as determined by a Special Analysis (SA) are not required.

Hamm, L. L.; Smith, F. G. III; Flach, G. P.; Hiergesell, R. A.; Butcher, B. T.



Implementation Guide for Use in Addressing Unreviewed Safety Question Requirements  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

This Guide, including its attachments, provides information to assist in the implementation of Title 10 Code of Federal Regulations (CFR) Section 830.203, Unreviewed Safety Question Process, of the Nuclear Safety Management Rules for Category 1, 2, and 3 nuclear facilities owned or operated by the Department of Energy (DOE), including the National Nuclear Security Administration (NNSA). Cancels DOE G 424.1-1A. Admin Chg 1 dated 4-12-13. Admin Chg 2, dated 6-12-13, cancels DOE G 424.1-1B Admin Chg 1.



Calhouns Attitude on the Oregon Question  

E-Print Network [OSTI]

, provided for joint occupation of the country west of the Rocky Mountains. This agreement was to last for ten years and was "not to be construed to the prejudice of any claim" that either party had to the territory in question. In 1819 Spain surrendered... to the United states her claiin to all territory north of the forty-second parallel. In a treaty with Russia, 1824, it was provided that "no settlement shall be made hereafter on the northwest coast of America , north of fifty- four degrees, forty minutes...

Morgan, Joseph Clifford



SciTech Connect Full-Text MARC Records FAQ | OSTI, US Dept of Energy,  

Office of Scientific and Technical Information (OSTI)

SciTech Connect Full-Text MARC Records FAQ SciTech Connect Full-Text MARC Records FAQ If your questions are not answered here, please contact us at MARCrecords@osti.gov. What are the options for downloading records? How do I get new records after my initial download? How can I download a record for a specific title that I want? What types of full-text information are linked to in the MARC records? When older AEC and DOE reports are digitized by OSTI and added to SciTech Connect, will MARC records be made available? How often are records added to the collection? Is there a way libraries can be notified if new records are added? How are the SciTech Connect Full-Text MARC records created? Is there a file of these records? What do the SciTech Connect Full-Text MARC records need for them to be loaded in my library's catalog?


Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

violations. Should you have questions concerning this report, please contact the Carlsbad Field Office Quality Assurance Director, Ava L. Holland , at (575) 234-7423....


Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Should you have any questions concerning this audit report, please contact the Carlsbad Field Office Quality Assurance Director, Ava L. Holland , at (575) 234-7423 ....


Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

have any questions regarding this transmittal . cc: Edward Ziemianski, Acting Manager Carlsbad Field Office J. Kieling , NMED S. Zappe, NMED C. Walker, Trinity Engineering CBFO...


Clean Cities: Clean Cities 20th Anniversary Capabilities Video (Text  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Anniversary Anniversary Capabilities Video (Text Version) to someone by E-mail Share Clean Cities: Clean Cities 20th Anniversary Capabilities Video (Text Version) on Facebook Tweet about Clean Cities: Clean Cities 20th Anniversary Capabilities Video (Text Version) on Twitter Bookmark Clean Cities: Clean Cities 20th Anniversary Capabilities Video (Text Version) on Google Bookmark Clean Cities: Clean Cities 20th Anniversary Capabilities Video (Text Version) on Delicious Rank Clean Cities: Clean Cities 20th Anniversary Capabilities Video (Text Version) on Digg Find More places to share Clean Cities: Clean Cities 20th Anniversary Capabilities Video (Text Version) on AddThis.com... Goals & Accomplishments Clean Cities 20th Anniversary Partnerships Hall of Fame Contacts Clean Cities 20th Anniversary Capabilities Video (Text Version)


National Residential Efficiency Measures Database Unveiled (text version)  

Broader source: Energy.gov [DOE]

Below is the text version of the Webinar titled "National Residential Efficiency Measures Database Unveiled," originally presented on January 18, 2011. In addition to this text version of the audio...


Advanced Text Searching of Electronic Information Related to Forensic Discovery  

E-Print Network [OSTI]

and electronic Boolean text searches. Text searching technology has been studied for over fifty years generating literally thousands of documents and books for a literature review. The focus of the literature includes accuracy of searching, optimization...

Haenchen, Steven L.



Frequently Asked Questions about Tax Incentives for Hybrid and Alternative  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Tax Incentives: Frequently Asked Questions Tax Incentives: Frequently Asked Questions What's the difference between a deduction and a credit? A tax deduction reduces the amount of income for which you are taxed. For example, if your taxable income were $50,000, a $2,000 deduction would reduce it to $48,000. So, you would pay taxes on an income of $48,000 instead of $50,000. This means your actual savings would be a fraction of the $2,000 deduction. A tax credit reduces the total amount of income tax you owe. So, if you owed $10,000 in federal income tax, a $2,000 credit would reduce the amount you owed to $8,000. With a credit, your actual savings would be $2,000. Where can I find information on State incentives? The U.S. Department of Energy's (DOE's) Alternative Fuels and Advanced Vehicles Data Center (AFDC) maintains a list of State & Federal Incentives


Can An Evolutionary Process Create English Text? David H. Bailey*  

E-Print Network [OSTI]

to English text. For example, David Foster, in a book skeptical of evolution, discusses and then ref

Bailey, David H.


Home Energy Score Post-Pilot Update Webinar (Text Version)  

Broader source: Energy.gov [DOE]

Below is the text version of the webinar, Home Energy Score Post-Pilot Update, presented in September 2011.


EECBG Strategies and Considerations Approaching Lenders Webcast (Text Version)  

Broader source: Energy.gov [DOE]

Below is a text version of the December 3, 2009 What Drives Consumer Borrowing for Energy Efficiency?


Structuring Credit Enhancements for Clean Energy Finance Programs (Text Version)  

Broader source: Energy.gov [DOE]

Below is a text version of the January 15, 2010 Structuring Loan Loss Reserve Funds for Clean Energy Finance Programs.


Strengthening the Workforce in Better Buildings Neighborhoods (Text Version)  

Broader source: Energy.gov [DOE]

Below is a text version of the Better Buildings Neighborhood Program "Strengthening the Workforce in Better Buildings Neighborhoods" video.


Text-Alternative Version: LEDs for Interior Office Applications  

Broader source: Energy.gov [DOE]

Below is the text-alternative version of the LEDs for Interior Office Applications webcast, held March 18, 2010.