Powered by Deep Web Technologies
Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

Sampling box  

DOE Patents [OSTI]

An air sampling box that uses a slidable filter tray and a removable filter cartridge to allow for the easy replacement of a filter which catches radioactive particles is disclosed.

Phillips, Terrance D. (617 Chestnut Ct., Aiken, SC 29803); Johnson, Craig (100 Midland Rd., Oak Ridge, TN 37831-0895)

2000-01-01T23:59:59.000Z

2

Technology and the Box  

E-Print Network [OSTI]

its explorations of technology in partnership with radicalPadma Maitland Technology and the Box The room is thedisciplines. The theme of “Technology and the Box” emerged

Maitland, Padma

2013-01-01T23:59:59.000Z

3

Questions & Answers  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Question: Is the new SOW language the definitive management approach (short of a GOCO) that consolidates responsibility and accountability for the NSE stockpile surety into...

4

Composing questions  

E-Print Network [OSTI]

This dissertation motivates a new syntax and semantics for simplex and multiple wh-questions, concentrating on English and German data. The proposed theory combines Cable's (2007; 2010) Q-based syntax for wh-movement and ...

Kotek, Hadas

2014-01-01T23:59:59.000Z

5

BOX SPLINES Hartmut Prautzsch  

E-Print Network [OSTI]

as density functions of the shadows of higher dimensional boxes and half-boxes. Of particular in- terest and their general theory is given in the book by de Boor, H¨ollig and Riemenschneider [10] who also give valuable = ui . Then, Bk(x) represents the density of the "shadow" of k, i.e., Bk(x) = 1 volkk volk-sk(x) , (1

Prautzsch, Hartmut

6

E-Print Network 3.0 - adaptive text entry Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

9 Dialog boxesDialog boxes... - Very easy to use 12;Adapted from Richard P. Muller 3 Hello, WorldHello, World from Tkinter import * wLabel(text... . Entry - A text ......

7

Unreviewed Safety Question Requirements  

Broader source: Energy.gov (indexed) [DOE]

Unreviewed Safety Question Requirements FUNCTIONAL AREA GOAL: A fully compliant Unreviewed Safety Question (USQ) program is implemented and maintained across the site....

8

Projection optics box  

DOE Patents [OSTI]

A projection optics box or assembly for use in an optical assembly, such as in an extreme ultraviolet lithography (EUVL) system using 10-14 nm soft x-ray photons. The projection optics box utilizes a plurality of highly reflective optics or mirrors, each mounted on a precision actuator, and which reflects an optical image, such as from a mask, in the EUVL system onto a point of use, such as a target or silicon wafer, the mask, for example, receiving an optical signal from a source assembly, such as a developed from laser system, via a series of highly reflective mirrors of the EUVL system. The plurality of highly reflective optics or mirrors are mounted in a housing assembly comprised of a series of bulkheads having wall members secured together to form a unit construction of maximum rigidity. Due to the precision actuators, the mirrors must be positioned precisely and remotely in tip, tilt, and piston (three degrees of freedom), while also providing exact constraint.

Hale, Layton C. (Livermore, CA); Malsbury, Terry (Tracy, CA); Hudyma, Russell M. (San Ramon, CA); Parker, John M. (Tracy, CA)

2000-01-01T23:59:59.000Z

9

Impedance Measurement Box  

ScienceCinema (OSTI)

Energy storage devices, primarily batteries, are now more important to consumers, industries and the military. With increasing technical complexity and higher user expectations, there is also a demand for highly accurate state-of-health battery assessment techniques. IMB incorporates patented, proprietary, and tested capabilities using control software and hardware that can be part of an embedded monitoring system. IMB directly measures the wideband impedance spectrum in seconds during battery operation with no significant impact on service life. It also can be applied to batteries prior to installation, confirming health before entering active service, as well as during regular maintenance. For more information about this project, visit http://www.inl.gov/rd100/2011/impedance-measurement-box/

Christophersen, Jon

2013-05-28T23:59:59.000Z

10

On the power of non-local boxes  

E-Print Network [OSTI]

A non-local box is a virtual device that has the following property: given that Alice inputs a bit at her end of the device and that Bob does likewise, it produces two bits, one at Alice's end and one at Bob's end, such that the XOR of the outputs is equal to the AND of the inputs. This box, inspired from the CHSH inequality, was first proposed by Popescu and Rohrlich to examine the question: given that a maximally entangled pair of qubits is non-local, why is it not maximally non-local? We believe that understanding the power of this box will yield insight into the non-locality of quantum mechanics. It was shown recently by Cerf, Gisin, Massar and Popescu, that this imaginary device is able to simulate correlations from any measurement on a singlet state. Here, we show that the non-local box can in fact do much more: through the simulation of the magic square pseudo-telepathy game and the Mermin-GHZ pseudo-telepathy game, we show that the non-local box can simulate quantum correlations that no entangled pair of qubits can in a bipartite scenario and even in a multi-party scenario. Finally we show that a single non-local box cannot simulate all quantum correlations and propose a generalization for a multi-party non-local box. In particular, we show quantum correlations whose simulation requires an exponential amount of non-local boxes, in the number of maximally entangled qubit pairs.

A. Broadbent; A. A. Methot

2005-11-07T23:59:59.000Z

11

PFP: Protein Function Prediction server For any questions regarding PFP contact the administration at info@kiharalab.org  

E-Print Network [OSTI]

also click on "Load Sample" link to load this sequence in the text box and follow the next steps "Enter Query Sequence(s)". Consider the following sequence that you can enter. >sp|P56851|EP3B. Clicking on "Clear" link will clear the text box for sequence and load default ESG parameters in the boxes

Kihara, Daisuke

12

Frequently Asked Questions  

Broader source: Energy.gov [DOE]

Frequently asked questions (FAQs) and their corresponding answers regarding industrial distributed energy (DE) and combined heat and power (CHP) are provided below.

13

Problem of Questioning  

ScienceCinema (OSTI)

Le Prof.Leprince-Ringuet, chercheur sur le plan scientifique, artistique et humain, parle de la remise en question des hommes et la remise en question scientifique fondamentale ou exemplaire- plusieurs personnes prennent la parole p.ex Jeanmairet, Adam, Gregory. Le Prof.Gregory clot la soirée en remerciant le Prof.Leprince-Ringuet

None

2011-04-25T23:59:59.000Z

14

Lauren Garcia SU Box 1195  

E-Print Network [OSTI]

Lauren Garcia SU Box 1195 Geos 206 Renewable Energy and the Sustainable Campus Prof. Dethier a lot of fabric in dorms to cover furniture, but how durable is that fabric, how sustainable is it, but it could be applied to any building on campus that houses furniture. I am defining "green" as non

Aalberts, Daniel P.

15

NETL's JIC in a box  

ScienceCinema (OSTI)

The National Energy Technology Laboratory developed the idea of a portable joint information center AKA JIC in-a-box. This video discribes some of the equipment in the portable JIC as well as some of the methodology that NETL developed as a result of this portable JIC concept.

David Anna

2010-01-08T23:59:59.000Z

16

Thermohaline circulation stability : a box model  

E-Print Network [OSTI]

A thorough analysis of the stability of uncoupled and coupled versions of an inter-hemispheric 3-box model of Thermohaline Circulation (THC) is presented. The model consists of a northern high latitudes box, a tropical ...

Lucarini, Valerio

2003-01-01T23:59:59.000Z

17

Glove box for water pit applications  

DOE Patents [OSTI]

A glove box assembly that includes a glove box enclosure attached to a longitudinally extending hollow tube having an entranceway, wherein the portion of the tube is in a liquid environment. An elevator member is provided for raising an object that is introduced into the hollow tube from the liquid environment to a gas environment inside the glove box enclosure while maintaining total containment.

Mills, William C. (Richland, WA); Rabe, Richard A. (North Fork, ID)

2005-01-18T23:59:59.000Z

18

ESG: Extended Similarity Group method for protein function prediction For any questions regarding ESG contact the administration at info@kiharalab.org  

E-Print Network [OSTI]

box titled "Enter Query Sequence(s)". Consider the following sequence that you can enter. >sp|P56851 KDKSSHMFIYISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSF NYIEFHCSMDGYVDSIEDLKMVEPIGN You can also click on "Load Sample" link to load this sequence in the text box and follow the next steps. Clicking on "Clear" link will clear the text box for sequence

Kihara, Daisuke

19

Illumination box and camera system  

DOE Patents [OSTI]

A hand portable, field-deployable thin-layer chromatography (TLC) unit and a hand portable, battery-operated unit for development, illumination, and data acquisition of the TLC plates contain many miniaturized features that permit a large number of samples to be processed efficiently. The TLC unit includes a solvent tank, a holder for TLC plates, and a variety of tool chambers for storing TLC plates, solvent, and pipettes. After processing in the TLC unit, a TLC plate is positioned in a collapsible illumination box, where the box and a CCD camera are optically aligned for optimal pixel resolution of the CCD images of the TLC plate. The TLC system includes an improved development chamber for chemical development of TLC plates that prevents solvent overflow.

Haas, Jeffrey S. (San Ramon, CA); Kelly, Fredrick R. (Modesto, CA); Bushman, John F. (Oakley, CA); Wiefel, Michael H. (La Honda, CA); Jensen, Wayne A. (Livermore, CA); Klunder, Gregory L. (Oakland, CA)

2002-01-01T23:59:59.000Z

20

Some Questions About Neurocognitive  

E-Print Network [OSTI]

Some Questions About Neurocognitive Networks Steven Bressler Center for Complex Systems & Brain is a Brain Network? · A brain network is a large-scale system in the brain consisting of distributed neuronal ­ Dynamic Interdependency #12;Does The Brain Need Networks? · Serial processing, as found in the PNS, is too

Bressler, Steven L.

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

QUESTIONS ABOUT GLOBAL WARMING  

E-Print Network [OSTI]

QUESTIONS ABOUT GLOBAL WARMING ÂĄIS IT REAL? ÂĄIS IT IMPORTANT? ÂĄWHAT IS IT DUE TO? ÂĄHOW MUCH MORE in the atmosphere, giving Earth its temperate climate. Global Atmosphere, Global Warming GLOBAL TEMPERATURE TRENDĂ?t a cure for global warming! Aerosols only last a short while in the atmosphere, they would have

22

Doing Business Frequently Asked Questions  

Broader source: Energy.gov [DOE]

The following are frequently asked questions about working with in partnership with DOE laboratories.

23

ARM - Science Questions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc Documentation RUC :ProductsSCM Forcing DataScience Questions Related Links ISDAC Home AAF Home

24

ARM - Science Questions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc Documentation RUC :ProductsSCM Forcing DataScience Questions Related Links ISDAC Home AAF

25

ARM - Science Questions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc Documentation RUC :ProductsSCM Forcing DataScience Questions Related Links ISDAC Home AAFScience

26

ARM - Science Questions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc Documentation RUC :ProductsSCM Forcing DataScience Questions Related Links ISDAC Home

27

MDF Overview (Text Version)  

Broader source: Energy.gov [DOE]

This is a text version of the Manufacturing Demonstration Facilities (MDF) overview video, originally presented on March 12, 2012 at the MDF Workshop held in Chicago, Illinois.

28

Repackaging SRS Black Box TRU Waste  

SciTech Connect (OSTI)

Historically, large items of TRU Waste, which were too large to be packaged in drums for disposal have been packaged in various sizes of custom made plywood boxes at the Savannah River Site (SRS), for many years. These boxes were subsequently packaged into large steel ''Black Boxes'' for storage at SRS, pending availability of Characterization and Certification capability, to facilitate disposal of larger items of TRU Waste. There are approximately 107 Black Boxes in inventory at SRS, each measuring some 18' x 12' x 7', and weighing up to 45,000 lbs. These Black Boxes have been stored since the early 1980s. The project to repackage this waste into Standard Large Boxes (SLBs), Standard Waste Boxes (SWB) and Ten Drum Overpacks (TDOP), for subsequent characterization and WIPP disposal, commenced in FY04. To date, 10 Black Boxes have been repackaged, resulting in 40 SLB-2's, and 37 B25 overpack boxes, these B25's will be overpacked in SLB-2's prior to shipping to WIPP. This paper will describe experience to date from this project.

Swale, D. J.; Stone, K.A.; Milner, T. N.

2006-01-09T23:59:59.000Z

29

Tuesday, March 16, 2010 On Box Models  

E-Print Network [OSTI]

to illustrate some of the basics of box models that are used frequently in the field of atmospheric chemistry L". You can guess that it was named after Marie Curie, someone who studied radioactive elements. #12 to exposure to contaminants. One tool that modelers use to assess exposure to pollutants is the "box model

Toohey, Darin W.

30

INDIAN ACADEMY OF SCIENCES Text formatted by Wintecs Typesetters, Bangalore (Ph. 2332 7311).  

E-Print Network [OSTI]

YEAR BOOK 2014 INDIAN ACADEMY OF SCIENCES #12;Text formatted by Wintecs Typesetters, Bangalore (Ph Academy of Sciences C.V. Raman Avenue Post Box No. 8005 Sadashivanagar Post Bangalore 560 080 India . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 Role of the Academy . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 Statutes

Dhingra, Narender K.

31

The Question The Standard Construction  

E-Print Network [OSTI]

The Question The Standard Construction The ZFC construction Bibliography Solution to a Problem Construction The ZFC construction Bibliography Outline 1 The Question 2 The Standard Construction 3 The ZFC construction Dilip Raghavan Solution to a Problem of Van Douwen #12;The Question The Standard Construction

Raghavan, Dilip

32

P.O. Box 45339 San Francisco, CA  

E-Print Network [OSTI]

UCSF P.O. Box 45339 San Francisco, CA 94145-0339 UCSF P.O. Box 45339 San Francisco, CA 94145-0339 UCSF P.O. Box 45339 San Francisco, CA 94145-0339 UCSF P.O. Box 45339 San Francisco, CA 94145-0339 UCSF P.O. Box 45339 San Francisco, CA 94145-0339 UCSF P.O. Box 45339 San Francisco, CA 94145-0339 UCSF P

Yamamoto, Keith

33

Hydro-Balanced Stuffing Box field test  

SciTech Connect (OSTI)

The Hydro-Balanced Stuffing Box is a seal assembly for polished rod pumping installations commonly used in oil and gas pumping well installations to contain produced well fluids. The improved stuffing box was developed and patented by Harold H. Palmour of The Palmour Group of Livingston, TX. The stuffing box is designed to reduce the incidence of seal leakage and to utilize an environmentally safe fluid, so that if there is any leakage, environmental damage is reduced or eliminated. The unit was tested on two wells at the Rocky Mountain Oilfield Testing Center. During the test period, the performance of the stuffing box was measured by monitoring the pressure on the tubing and the inner chamber with a Barton Two-pen recorder. The amount of safe fluid consumed, fluid leakage at the top of the stuffing box, pressure supplied from the nitrogen bottle, ambient temperature, and polish rod temperature was recorded. The stuffing box is capable of providing a better seal between well fluids an d the environment than conventional stuffing boxes. It allows the polished rod to operate cooler and with lubrication, extending the life of the packing elements, and reducing the amount of attention required to prevent leakage.

Giangiacomo, L.A.

1999-05-28T23:59:59.000Z

34

Workers Remove Glove Boxes from Ventilation at Hanford's Plutonium...  

Office of Environmental Management (EM)

boxes inside the facility's former processing area. This work is performed inside plastic enclosures to limit the spread of contamination. Preparing the glove boxes for...

35

Austin E. Quigley Black Box Theater Proposal Form  

E-Print Network [OSTI]

-1- Austin E. Quigley Black Box Theater Proposal Form Sponsoring Organization indicate that you have read the Austin E. Quigley Black Box Theatre Policy and Procedure Guidelines

Hone, James

36

From Question Answering to Visual Exploration  

SciTech Connect (OSTI)

Research in Question Answering has focused on the quality of information retrieval or extraction using the metrics of precision and recall to judge success; these metrics drive toward finding the specific best answer(s) and are best supportive of a lookup type of search. These do not address the opportunity that users? natural language questions present for exploratory interactions. In this paper, we present an integrated Question Answering environment that combines a visual analytics tool for unstructured text and a state-of-the-art query expansion tool designed to compliment the cognitive processes associated with an information analysts work flow. Analysts are seldom looking for factoid answers to simple questions; their information needs are much more complex in that they may be interested in patterns of answers over time, conflicting information, and even related non-answer data may be critical to learning about a problem or reaching prudent conclusions. In our visual analytics tool, questions result in a comprehensive answer space that allows users to explore the variety within the answers and spot related information in the rest of the data. The exploratory nature of the dialog between the user and this system requires tailored evaluation methods that better address the evolving user goals and counter cognitive biases inherent to exploratory search tasks.

McColgin, Dave W.; Gregory, Michelle L.; Hetzler, Elizabeth G.; Turner, Alan E.

2006-08-11T23:59:59.000Z

37

Optimization Control Strategies for HVAC Terminal Boxes  

E-Print Network [OSTI]

is an important topic in today's building energy management and HVAC control field. The authors developed novel optimized control strategies and operation schedules for the terminal boxes for both occupied and non-occupied hours. The optimized control schedules...

Zhu, Y.; Batten, T.; Noboa, H.; Claridge, D. E.; Turner, W. D.; Liu, M.; Zhou, J.; Cameron, C.; Keeble, D.; Hirchak, R.

2000-01-01T23:59:59.000Z

38

General Questions | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Questions Where can I find more information regarding federal and state programs to help weatherize my home? The U.S. Department of Energy (DOE) Weatherization Assistance...

39

QuestionQuestion How does nitrogen deposition affect roadside  

E-Print Network [OSTI]

al. 2004. Concentrations of ammonia and nitrogen dioxide at roadside verges, and their contributionQuestionQuestion How does nitrogen deposition affect roadside plant community composition? 1. Is there a gradient of nitrogen deposition to freeway verges from traffic exhaust? 2. Are there other sources of N

Hall, Sharon J.

40

Glove box on vehicular instrument panel  

DOE Patents [OSTI]

A glove box for the upper surface of an automobile dashboard whereby it may be positioned close to the driver. The glove box lid is pivotally supported by arms extending down either side to swing forwardly for opening. A hook is pivotally support adjacent an arm and weighted to swing into engagement with the arm to prevent opening of the lid during abrupt deceleration. A toggle spring assists in maintaining the lid in either the open or closed position.

Atarashi, Kazuya (Saitama, JP)

1985-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

Box Splines Hartmut Prautzsch, Wolfgang Boehm  

E-Print Network [OSTI]

as density functions of the shadows of higher dimensional boxes and half­boxes. Of particular interest and their general theory is given in the book by de Boor, H¨ollig and Riemenschneider [10] who also give valuable the density of the ``shadow'' of the unit cube [0; 1) k under the affine map \\Phi(t) = [v 1 : : : v k ]t from

Liblit, Ben

42

Enhanced Stuffing Box Rubbers Test Report  

SciTech Connect (OSTI)

The Rocky Mountain Oilfield Testing Center (RMOTC) and Scott's Oil Field Service tested an enhanced stuffing box rubber at the Naval Petroleum Reserve No. 3. The enhanced stuffing box rubbers have saved money from not having to replace packing as often and not spilling valuable oil on the ground. A reduction in environmental hazards and the cost of cleaning up spilled oil have also been a benefit.

Rochelle, J.

2002-07-01T23:59:59.000Z

43

Jens Hjorth the Urbino Questions  

E-Print Network [OSTI]

reduce the effects of air pollution to human health and the environment in Europe by 2020. The strategy-DRIVEN SYNTHESIS Answers by the atmospheric chemistry and air pollution research community to questions posed Strategy on Air Pollution 5.06 #12;editors Frank Raes Jens Hjorth Answers to the Urbino Questions ACCENTs

44

TECHNICAL QUESTIONS What Every Parent ...  

Broader source: Energy.gov (indexed) [DOE]

through: & 10 Common Questions About Internet Safety 1. How and why do I check the Web browser history? 2. How and why do I review temporary Internet files? 3. How and why do...

45

Questions  

E-Print Network [OSTI]

N o t e t h a t t h e sam e p h e n o m e n o n o c c u r s w h e n t h e rea l n u m b er s are re ga r de d a s a su bfie ld o f t h e c o m p l e x fi e ld ,. a n d it a l so o ccu ...

CamScanner

2014-06-17T23:59:59.000Z

46

Questions  

E-Print Network [OSTI]

Let fbe a real function de?ned on (a, b). Prove that the set of points at which f has a simple discontinuity is at most countable. Hint: Let E be the set on which.

CamScanner

47

Questions  

E-Print Network [OSTI]

(a) Ian = Ui'=1 Ar, prove that B" = ULI 3,, for n =1, 2, 3, . (b) HR = U'iil A“ prove ... Let Kc R1 consist of 0 and the numbers 1/11, for n = 1, 2, 3, ... . Prove that K lS.

CamScanner

48

Frequently Asked Questions | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

Asked Questions Print Text Size: A A A FeedbackShare Page The U.S. Department of EnergyNational Nuclear Security Administration frequently fields questions about the...

49

Got Questions About the Higgs Boson? Ask a Scientist  

SciTech Connect (OSTI)

Ask a scientist about the Higgs boson. There's a lot of buzz this week over new data from CERN's Large Hadron Collider (LHC) and the final data from Fermilab's Tevatron about the Higgs boson. It raises questions about what scientists have found and what still remains to be found -- and what it all means. Berkeley Lab's Ian Hinchliffe invites you to send in questions about the Higgs. He'll answer a few of your questions in a follow-up video later this week. Hinchliffe is a theoretical physicist who heads Berkeley Lab's sizable contingent with the ATLAS experiment at CERN. • Post your questions in the comment box • E-mail your questions to askascientist@lbl.gov • Tweet to @BerkeleyLab • Or post on our facebook page: facebook/berkeleylab Update on July 5: Ian responds to several of your questions in this video: http://youtu.be/1BkpD1IS62g Update on 7/04: Here's CERN's press release from earlier today on the latest preliminary results in the search for the long sought Higgs particle: http://press.web.cern.ch/press/PressReleases/Releases2012/PR17.12E.htm And here's a Q&A on what the news tells us: http://cdsweb.cern.ch/journal/CERNBulletin/2012/28/News%20Articles/1459460?ln=en CERN will present the new LHC data at a seminar July 4th at 9:00 in the morning Geneva time (3:00 in the morning Eastern Daylight Time, midnight on the Pacific Coast), where the ATLAS collaboration and their rivals in the CMS experiment will announce their results. Tevatron results were announced by Fermilab on Monday morning. For more background on the LHC's search for the Higgs boson, visit http://newscenter.lbl.gov/feature-stories/2012/06/28/higgs-2012/.

Hinchliffe, Ian

2012-01-01T23:59:59.000Z

50

Got Questions About the Higgs Boson? Ask a Scientist  

ScienceCinema (OSTI)

Ask a scientist about the Higgs boson. There's a lot of buzz this week over new data from CERN's Large Hadron Collider (LHC) and the final data from Fermilab's Tevatron about the Higgs boson. It raises questions about what scientists have found and what still remains to be found -- and what it all means. Berkeley Lab's Ian Hinchliffe invites you to send in questions about the Higgs. He'll answer a few of your questions in a follow-up video later this week. Hinchliffe is a theoretical physicist who heads Berkeley Lab's sizable contingent with the ATLAS experiment at CERN. ? Post your questions in the comment box ? E-mail your questions to askascientist@lbl.gov ? Tweet to @BerkeleyLab ? Or post on our facebook page: facebook/berkeleylab Update on July 5: Ian responds to several of your questions in this video: http://youtu.be/1BkpD1IS62g Update on 7/04: Here's CERN's press release from earlier today on the latest preliminary results in the search for the long sought Higgs particle: http://press.web.cern.ch/press/PressReleases/Releases2012/PR17.12E.htm And here's a Q&A on what the news tells us: http://cdsweb.cern.ch/journal/CERNBulletin/2012/28/News%20Articles/1459460?ln=en CERN will present the new LHC data at a seminar July 4th at 9:00 in the morning Geneva time (3:00 in the morning Eastern Daylight Time, midnight on the Pacific Coast), where the ATLAS collaboration and their rivals in the CMS experiment will announce their results. Tevatron results were announced by Fermilab on Monday morning. For more background on the LHC's search for the Higgs boson, visit http://newscenter.lbl.gov/feature-stories/2012/06/28/higgs-2012/.

Hinchliffe, Ian

2013-05-29T23:59:59.000Z

51

Some open questions in hydrodynamics  

E-Print Network [OSTI]

When speaking of unsolved problems in physics, this is surprising at first glance to discuss the case of fluid mechanics. However, there are many deep open questions that come with the theory of fluid mechanics. In this paper, we discuss some of them that we classify in two categories, the long term behavior of solutions of equations of hydrodynamics and the definition of initial (boundary) conditions. The first set of questions come with the non-relativistic theory based on the Navier-Stokes equations. Starting from smooth initial conditions, the purpose is to understand if solutions of Navier-Stokes equations remain smooth with the time evolution. Existence for just a finite time would imply the evolution of finite time singularities, which would have a major influence on the development of turbulent phenomena. The second set of questions come with the relativistic theory of hydrodynamics. There is an accumulating evidence that this theory may be relevant for the description of the medium created in high energy heavy-ion collisions. However, this is not clear that the fundamental hypotheses of hydrodynamics are valid in this context. Also, the determination of initial conditions remains questionable. The purpose of this paper is to explore some ideas related to these questions, both in the non-relativistic and relativistic limits of fluid mechanics. We believe that these ideas do not concern only the theory side but can also be useful for interpreting results from experimental measurements.

Mateusz Dyndal; Laurent Schoeffel

2014-12-16T23:59:59.000Z

52

Safety evaluation for packaging CPC metal boxes  

SciTech Connect (OSTI)

This Safety Evaluation for Packaging (SEP) provides authorization for the use of Container Products Corporation (CPC) metal boxes, as described in this document, for the interarea shipment of radioactive contaminated equipment and debris for storage in the Central Waste Complex (CWC) or T Plant located in the 200 West Area. Authorization is granted until November 30, 1995. The CPC boxes included in this SEP were originally procured as US Department of Transportation (DOT) Specification 7A Type A boxes. A review of the documentation provided by the manufacturer revealed the documentation did not adequately demonstrate compliance to the 4 ft drop test requirement of 49 CFR 173.465(c). Preparation of a SEP is necessary to document the equivalent safety of the onsite shipment in lieu of meeting DOT packaging requirements until adequate documentation is received. The equivalent safety of the shipment is based on the fact that the radioactive contents consist of contaminated equipment and debris which are not dispersible. Each piece is wrapped in two layers of no less than 4 mil plastic prior to being placed in the box which has an additional 10 mil liner. Pointed objects and sharp edges are padded to prevent puncture of the plastic liner and wrapping.

Romano, T.

1995-05-15T23:59:59.000Z

53

PO Box 2349 White Salmon, WA 98672  

E-Print Network [OSTI]

PO Box 2349 White Salmon, WA 98672 509.493.4468 www.newbuildings.org COMMERCIAL ROOFTOP HVAC ENERGY from utility-sponsored field service measures on small (typically 3-10 tons) commercial rooftop unitary utility-funded RTU service programs. New Buildings Institute (NBI) staff has been managing the research

54

Text analysis methods, text analysis apparatuses, and articles of manufacture  

DOE Patents [OSTI]

Text analysis methods, text analysis apparatuses, and articles of manufacture are described according to some aspects. In one aspect, a text analysis method includes accessing information indicative of data content of a collection of text comprising a plurality of different topics, using a computing device, analyzing the information indicative of the data content, and using results of the analysis, identifying a presence of a new topic in the collection of text.

Whitney, Paul D; Willse, Alan R; Lopresti, Charles A; White, Amanda M

2014-10-28T23:59:59.000Z

55

Projected-search methods for box-constrained optimization  

E-Print Network [OSTI]

Search Methods for Unconstrained Optimization 2.1 Newton’s3 Active-Set Methods for Box-Constrained Optimization 3.1for Box-Constrained Optimization . 5.1 Converting to a

Ferry, Michael William

2011-01-01T23:59:59.000Z

56

Product realization of the 2.007 control box  

E-Print Network [OSTI]

A second generation control box using frequency hopping spread spectrum radio was designed and built for use in the Spring 2006 offering of 2.007 Design and Manufacturing I. A third generation control box that could hold ...

Lin, Wey-Jiun

2006-01-01T23:59:59.000Z

57

QUESTIONS & ANSWERS ABOUT LUNG CANCER  

E-Print Network [OSTI]

QUESTIONS & ANSWERS ABOUT LUNG CANCER Q: What are the early signs of lung cancer? How would I know I have it? A: Some of the early warning signs of lung cancer are: · A cough that doesn't go away what may be causing these symptoms. Q: How is lung cancer diagnosed? A: Your doctor may do one or more

58

10 CFR 707 Frequently Asked Questions  

Broader source: Energy.gov [DOE]

NOTE: The Questions on this site were compiled from questions asked during the four DOE complex wide tele-videos, as well as, questions submitted by e-mail and telephone. The answers provided are...

59

Text analysis devices, articles of manufacture, and text analysis methods  

DOE Patents [OSTI]

Text analysis devices, articles of manufacture, and text analysis methods are described according to some aspects. In one aspect, a text analysis device includes processing circuitry configured to analyze initial text to generate a measurement basis usable in analysis of subsequent text, wherein the measurement basis comprises a plurality of measurement features from the initial text, a plurality of dimension anchors from the initial text and a plurality of associations of the measurement features with the dimension anchors, and wherein the processing circuitry is configured to access a viewpoint indicative of a perspective of interest of a user with respect to the analysis of the subsequent text, and wherein the processing circuitry is configured to use the viewpoint to generate the measurement basis.

Turner, Alan E; Hetzler, Elizabeth G; Nakamura, Grant C

2013-05-28T23:59:59.000Z

60

ONTHEGO TEXT ENTRY: EVALUATING AND IMPROVING MOBILE TEXT INPUT ON  

E-Print Network [OSTI]

ON­THE­GO TEXT ENTRY: EVALUATING AND IMPROVING MOBILE TEXT INPUT ON MINI­QWERTY KEYBOARDS A Thesis . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . xv I INTRODUCTION . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 1.1 Thesis Statement-QWERTY KEYBOARDS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 4.1 Blind Typing in Real

Starner, Thad E.

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

Frequently Asked Questions | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

& Forms Frequently Asked Questions Frequently Asked Questions U.S. Department of Energy U.S. Nuclear Regulatory Commission Nuclear Materials Management & Safeguards...

62

Cybersecurity Capability Maturity Model - Frequently Asked Questions...  

Broader source: Energy.gov (indexed) [DOE]

- Frequently Asked Questions (February 2014) Cybersecurity Capability Maturity Model - Frequently Asked Questions (February 2014) The Cybersecurity Capability Maturity Model (C2M2)...

63

Resonantly Interacting Fermions in a Box  

SciTech Connect (OSTI)

We use two fundamental theoretical frameworks to study the finite-size (shell) properties of the unitary gas in a periodic box: (1) an ab initio quantum Monte Carlo (QMC) calculation for boxes containing 4 to 130 particles provides a precise and complete characterization of the finite-size behavior, and (2) a new density functional theory (DFT) fully encapsulates these effects. The DFT predicts vanishing shell structure for systems comprising more than 50 particles, and allows us to extrapolate the QMC results to the thermodynamic limit, providing the tightest bound to date on the ground-state energy of the unitary gas: {xi}{sub S}{<=}0.383(1). We also apply the new functional to few-particle harmonically trapped systems, comparing with previous calculations.

Forbes, Michael McNeil [Institute for Nuclear Theory, University of Washington, Seattle, Washington 98195-1560 (United States); Department of Physics, University of Washington, Seattle, Washington 98195-1560 (United States); Theoretical Division, Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States); Gandolfi, Stefano [Theoretical Division, Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States); Gezerlis, Alexandros [Department of Physics, University of Washington, Seattle, Washington 98195-1560 (United States); Theoretical Division, Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States)

2011-06-10T23:59:59.000Z

64

Nondestructive assay of boxed radioactive waste  

SciTech Connect (OSTI)

Solid radioactive waste must be classified before treatment and disposal methods can be chosen. After treatment and before disposal, the radionuclide contents of a container must be certified. This paper describes the problems related to the nondestructive assay (NDA) of boxed radioactive waste at the Hanford Site and how Westinghouse Hanford Company (WHC) is solving the problems. The waste form and radionuclide content are described. The characteristics of the combined neutron and gamma-based measurement system are described.

Gilles, W.P.; Jasen, W.G.; Roberts, R.J. [Westinghouse Hanford Co., Richland, WA (United States)

1993-12-31T23:59:59.000Z

65

ParaText : scalable text modeling and analysis.  

SciTech Connect (OSTI)

Automated processing, modeling, and analysis of unstructured text (news documents, web content, journal articles, etc.) is a key task in many data analysis and decision making applications. As data sizes grow, scalability is essential for deep analysis. In many cases, documents are modeled as term or feature vectors and latent semantic analysis (LSA) is used to model latent, or hidden, relationships between documents and terms appearing in those documents. LSA supplies conceptual organization and analysis of document collections by modeling high-dimension feature vectors in many fewer dimensions. While past work on the scalability of LSA modeling has focused on the SVD, the goal of our work is to investigate the use of distributed memory architectures for the entire text analysis process, from data ingestion to semantic modeling and analysis. ParaText is a set of software components for distributed processing, modeling, and analysis of unstructured text. The ParaText source code is available under a BSD license, as an integral part of the Titan toolkit. ParaText components are chained-together into data-parallel pipelines that are replicated across processes on distributed-memory architectures. Individual components can be replaced or rewired to explore different computational strategies and implement new functionality. ParaText functionality can be embedded in applications on any platform using the native C++ API, Python, or Java. The ParaText MPI Process provides a 'generic' text analysis pipeline in a command-line executable that can be used for many serial and parallel analysis tasks. ParaText can also be deployed as a web service accessible via a RESTful (HTTP) API. In the web service configuration, any client can access the functionality provided by ParaText using commodity protocols ... from standard web browsers to custom clients written in any language.

Dunlavy, Daniel M.; Stanton, Eric T.; Shead, Timothy M.

2010-06-01T23:59:59.000Z

66

General Questions | Department of Energy  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) " ,"ClickPipelinesProvedDecember 2005DepartmentDecember U.S.FinancialofFuelDepartment ofGeneral Questions

67

Inquiring Minds - Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFunInfrared Land Surface Emissivity inFermilab Paving the wayPowerQuestion on

68

Inquiring Minds - Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFunInfrared Land Surface Emissivity inFermilab Paving the wayPowerQuestion

69

Inquiring Minds - Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFunInfrared Land Surface Emissivity inFermilab Paving the wayPowerQuestionThe

70

Inquiring Minds - Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFunInfrared Land Surface Emissivity inFermilab Paving theIsBigQuestion: From

71

Inquiring Minds - Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFunInfrared Land Surface Emissivity inFermilab Paving theIsBigQuestion:

72

Inquiring Minds - Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFunInfrared Land Surface Emissivity inFermilabWhich AtomsHow do YouQuestion on

73

Inquiring Minds - Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsingFunInfrared Land Surface Emissivity inFermilabWhich AtomsHow do YouQuestion

74

Hadronic ?Z box corrections in Mřller scattering  

DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

The possibility of measuring the parity-violating asymmetry in Moller scattering with sufficient accuracy to determine sin2?W to 0.1% offers a complementary path to the discovery of new physics to that followed at high energy colliders. We present a new calculation of the ?Z box contribution to parity-violating electron-proton scattering, which constitutes an important uncertainty in computing the background to this process. We show that while the ?Z correction grows rapidly with energy, it can be relatively well constrained by data from parity-violating inelastic scattering and parton distribution functions.

Hall, Nathan L. [Adelaide U.; Blunden, Peter G. [Manitoba U.; Melnitchouk, Wally [JLAB; Thomas, Anthony W. [Adelaide U.; Young, Ross D. [Adelaide U.

2014-04-01T23:59:59.000Z

75

Unlocking the Mysteries of the Bounding Box  

E-Print Network [OSTI]

Service is available online at http://www.fs.fed.us/institute/ecoregions/ eco_download.html 16. The ?1:2,000,000-Scale Hydrologic Unit Boundaries? from the US Geological Survey is available online at http://water.usgs.gov/GIS/huc.html 17. Circularity...Coordinates Series A, No. 2 Unlocking the Mysteries of the Bounding Box Persistent URL for citation: http://purl.oclc.org/coordinates/a2.pdf Date of Publication: 08/29/05 Douglas R. Caldwell Douglas R. Caldwell (e-mail: Douglas.R. Caldwell...

Caldwell, Douglas R.

2005-08-29T23:59:59.000Z

76

Test procedure for boxed waste assay system  

SciTech Connect (OSTI)

This document, prepared by Los Alamos National Laboratory`s NMT-4 group, details the test methodology and requirements for Acceptance/Qualification testing of a Boxed Waste Assay System (BWAS) designed and constructed by Pajarito Scientific Corporation. Testing of the BWAS at the Plutonium Facility (TA55) at Los Alamos National Laboratory will be performed to ascertain system adherence to procurement specification requirements. The test program shall include demonstration of conveyor handling capabilities, gamma ray energy analysis, and imaging passive/active neutron accuracy and sensitivity. Integral to these functions is the system`s embedded operating and data reduction software.

Wachter, J. [Los Alamos National Lab., NM (United States)

1994-12-07T23:59:59.000Z

77

Answering Key Fuel Cycle Questions  

SciTech Connect (OSTI)

The Advanced Fuel Cycle Initiative (AFCI) program has both “outcome” and “process” goals because it must address both waste already accumulating as well as completing the fuel cycle in connection with advanced nuclear power plant concepts. The outcome objectives are waste geological repository capacity and cost, energy security and sustainability, proliferation resistance, fuel cycle economics, and safety. The process objectives are readiness to proceed and adaptability and robustness in the face of uncertainties. A classic decision-making approach to such a multi-attribute problem would be to weight individual quantified criteria and calculate an overall figure of merit. This is inappropriate for several reasons. First, the goals are not independent. Second, the importance of different goals varies among stakeholders. Third, the importance of different goals is likely to vary with time, especially the “energy future.” Fourth, some key considerations are not easily or meaningfully quantifiable at present. Instead, at this point, we have developed 16 questions the AFCI program should answer and suggest an approach of determining for each whether relevant options improve meeting each of the program goals. We find that it is not always clear which option is best for a specific question and specific goal; this helps identify key issues for future work. In general, we suggest attempting to create as many win-win decisions (options that are attractive or neutral to most goals) as possible. Thus, to help clarify why the program is exploring the options it is, and to set the stage for future narrowing of options, we have developed 16 questions, as follows: · What are the AFCI program goals? · Which potential waste disposition approaches do we plan for? · What are the major separations, transmutation, and fuel options? · How do we address proliferation resistance? · Which potential energy futures do we plan for? · What potential external triggers do we plan for? · Should we separate uranium? · If we separate uranium, should we recycle it, store it or dispose of it? · Is it practical to plan to fabricate and handle “hot” fuel? · Which transuranic elements (TRU) should be separated and transmuted? · Of those TRU separated, which should be transmuted together? · Should we separate and/or transmute Cs and Sr isotopes that dominate near-term repository heating? · Should we separate and/or transmute very long-lived Tc and I isotopes? · Which separation technology? · What mix of transmutation technologies? · What fuel technology best supports the above decisions?

Steven J. Piet; Brent W. Dixon; J. Stephen Herring; David E. Shropshire; Mary Lou Dunzik-Gougar

2003-10-01T23:59:59.000Z

78

Harmonic oscillator in a one-dimensional box  

E-Print Network [OSTI]

We study a harmonic molecule confined to a one--dimensional box with impenetrable walls. We explicitly consider the symmetry of the problem for the cases of different and equal masses. We propose suitable variational functions and compare the approximate energies given by the variation method and perturbation theory with accurate numerical ones for a wide range of values of the box length. We analyze the limits of small and large box size.

Paolo Amore; Francisco M. Fernandez

2009-07-31T23:59:59.000Z

79

Michigan Saves' New Marketing PSAs Use Boxing to Solve "Energy...  

Broader source: Energy.gov (indexed) [DOE]

Energy Drama public service announcement (PSA) features a series of boxing parody videos about a couple arguing over conflicting methods to reduce their home energy use. The...

80

A Web-based Question Answering System  

E-Print Network [OSTI]

The Web is apparently an ideal source of answers to a large variety of questions, due to the tremendous amount of information available online. This paper describes a Web-based question answering system LAMP, which is ...

Zhang, Dell

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

On the interpretation of concealed questions  

E-Print Network [OSTI]

Determiner phrases have the ability to act as "concealed questions" (CQs), embedded questions in sentences like John knows the time (i.e., John knows what time it is). The fact that know and wonder differ in their ability ...

Nathan, Lance Edward

2006-01-01T23:59:59.000Z

82

Attn Technology Transfer Questions.txt - Notepad  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Attn Technology Transfer Questions.txt From: eschaput esandc@prodigy.net Sent: Monday, January 26, 2009 10:31 PM To: GC-62 Subject: Attn: Technology Transfer Questions We have...

83

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Using an accelerator to create a new element Hello, My name is Andrew and I was wondering if this is the right email forum for my question. I am only 11 so my question is as...

84

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Hello, I am so happy to visited your site It was full of answers to my questions So, I have a question about thermal Energy...We have some kind of energy in the world. electric...

85

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Centripedal Forces Plus Relativity You wrote: Hello, I'm not sure if this address is the right one to write to asking a physics question. But I saw a list of questions and answers...

86

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

have a question, but first, thank you for the terrific new web site. You did a fantastic job. Question: Where does present theory say the energy of a red shifted photon goes? The...

87

A Question of Prosperity Poverty in Saskatchewan  

E-Print Network [OSTI]

JUNE 2008 A Question of Prosperity Poverty in Saskatchewan Garson Hunter and Fiona Douglas with Sarah Pedersen #12;A Question of Prosperity: Poverty in Saskatchewan June 2008 Hunter, G. F. Douglas & S. Pedersen. "A Question of Prosperity: Poverty in Saskatchewan." Poverty Profiles 1, 2008. Regina

Argerami, Martin

88

Meter Damage: Many customers have questions about who is responsible for repair to the electrical service at their homes. These pages may help to answer  

E-Print Network [OSTI]

Meter Damage: Many customers have questions about who is responsible for repair. weather head stack meter base connectors house knob weather head connectors mast clamp stack meter base meter meter #12; Let's start with definitions: Meter base: This is the metal box mounted

Rose, Annkatrin

89

"Black Box" EMC model for Power Electronics Converter Mikael Foissac  

E-Print Network [OSTI]

"Black Box" EMC model for Power Electronics Converter Mikael Foissac Grenoble Electrical be forecasted accurately, in order to avoid disturbance of the complete system. To quantify the EMC behaviour will then illustrate the method on a complete chopper cell. II. BLACK BOX EMC MODEL Any EMC analysis must account

Paris-Sud XI, Université de

90

Optimal Inventory Control in Cardboard Box Producing Factories  

E-Print Network [OSTI]

Optimal Inventory Control in Cardboard Box Producing Factories: A Case Study Catherine D. Black is a case study in optimal inventory control, applied to Clickabox factory, a South African cardboard box replenishment policy, based largely on experience, was implemented at the factory. The inventory model developed

van Vuuren, Jan H.

91

Measure Guideline: Optimizing the Configuration of Flexible Duct Junction Boxes  

SciTech Connect (OSTI)

This measure guideline offers additional recommendations to heating, ventilation, and air conditioning (HVAC) system designers for optimizing flexible duct, constant-volume HVAC systems using junction boxes within Air Conditioning Contractors of America (ACCA) Manual D guidance (Rutkowski, H. Manual D -- Residential Duct Systems, 3rd edition, Version 1.00. Arlington, VA: Air Conditioning Contractors of America, 2009.). IBACOS used computational fluid dynamics software to explore and develop guidance to better control the airflow effects of factors that may impact pressure losses within junction boxes among various design configurations (Beach, R., Prahl, D., and Lange, R. CFD Analysis of Flexible Duct Junction Box Design. Golden, CO: National Renewable Energy Laboratory, submitted for publication 2013). These recommendations can help to ensure that a system aligns more closely with the design and the occupants' comfort expectations. Specifically, the recommendations described herein show how to configure a rectangular box with four outlets, a triangular box with three outlets, metal wyes with two outlets, and multiple configurations for more than four outlets. Designers of HVAC systems, contractors who are fabricating junction boxes on site, and anyone using the ACCA Manual D process for sizing duct runs will find this measure guideline invaluable for more accurately minimizing pressure losses when using junction boxes with flexible ducts.

Beach, R.; Burdick, A.

2014-03-01T23:59:59.000Z

92

Page 1 of 24 Question & Answers  

E-Print Network [OSTI]

Page 1 of 24 Question & Answers Pilot-Scale and Commercial-Scale Advanced Biofuels with the California Energy Commission on biofuel production facilities important to California objectives

93

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Question About Splitting Molecules "Can you use particle accelerators to break up molecules into their elements?" The short answer is yes. The long answer is more complicated. You...

94

Program Evaluation Topics and Questions Library  

Broader source: Energy.gov [DOE]

Menu of initial questions for a program administrator to use in developing a real-time evaluation survey to collect qualitative data from program contractors.

95

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Radiation Direction Hello, What is the direction of radiation emitted from an atom ? Thanks, Bob Patton Bob, Your question has always been an area of research whenever new...

96

Safeguards Approaches for Black Box Processes or Facilities  

SciTech Connect (OSTI)

The objective of this study is to determine whether a safeguards approach can be developed for “black box” processes or facilities. These are facilities where a State or operator may limit IAEA access to specific processes or portions of a facility; in other cases, the IAEA may be prohibited access to the entire facility. The determination of whether a black box process or facility is safeguardable is dependent upon the details of the process type, design, and layout; the specific limitations on inspector access; and the restrictions placed upon the design information that can be provided to the IAEA. This analysis identified the necessary conditions for safeguardability of black box processes and facilities.

Diaz-Marcano, Helly; Gitau, Ernest TN; Hockert, John; Miller, Erin; Wylie, Joann

2013-09-25T23:59:59.000Z

97

Ballot box and tinder box : can electoral engineering save multiethnic democracy?  

E-Print Network [OSTI]

The objective of this dissertation is to systematize the existing hypotheses in the electoral engineering literature and to test them in a set of selected case studies in order to answer a central question: does the electoral ...

Liaras, Evangelos

2010-01-01T23:59:59.000Z

98

Questions and Answers March 9, 2012  

E-Print Network [OSTI]

-602 Alternative Fuels Infrastructure: Electric, Natural Gas, Propane, E85 & Diesel Substitutes Terminals 5Questions and Answers March 9, 2012 for PON-11-602 Alternative Fuels Infrastructure: Electric, Natural Gas, Propane, E85 & Diesel Substitutes Terminals General Definitions/Clarification 1. QUESTION

99

Rangeland ecology: Key global research issues & questions  

E-Print Network [OSTI]

1 Rangeland ecology: Key global research issues & questions Robin Reid1 and Maria Fernandez Ecology Lab 2Associate Professor Colorado State University, Fort Collins, Colorado, USA Global Issues and Questions in Rangeland Ecology · Despite the focus here on global issues, we need to recognize that Mongolia

100

48C Qualifying Advanced Energy Project Credit Questions | Department...  

Broader source: Energy.gov (indexed) [DOE]

48C Qualifying Advanced Energy Project Credit Questions 48C Qualifying Advanced Energy Project Credit Questions 48C Qualifying Advanced Energy Project Credit Questions More...

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

Questions and Answers for the Smart Grid Investment Grant Program...  

Energy Savers [EERE]

Questions and Answers for the Smart Grid Investment Grant Program: Frequently Asked Questions Questions and Answers for the Smart Grid Investment Grant Program: Frequently Asked...

102

Questions and Answers for the Smart Grid Investment Grant Program...  

Energy Savers [EERE]

Questions and Answers for the Smart Grid Investment Grant Program: Buy American Questions and Answers for the Smart Grid Investment Grant Program: Buy American Additional questions...

103

1 Molecular Squares, Boxes, and Cubes 2 Peter H. Dinolfo  

E-Print Network [OSTI]

include the various viologen-derived 26 cyclophanes or boxes of Stoddart and coworkers,[1] --clear 27, of course, can also 36 usefully expand the range of redox, photophysical, and 37 catalytic properties

Dinolfo, Peter H.

104

Questioning the questions that have been asked about the infant brain using near-infrared spectroscopy  

E-Print Network [OSTI]

Questioning the questions that have been asked about the infant brain using near-infrared, University of Rochester, Rochester, NY, USA Near-infrared spectroscopy (NIRS) is a noninvasive diffuse; Near-infrared spectroscopy. "Sheddinglight"onascientificquestiontookonnew meaning when

Aslin, Richard N.

105

Dr. StrangeBox or : how I learned to stop worrying and love urban big box retail  

E-Print Network [OSTI]

Over the past decade, Big Box retailers have been trying to tap into urban markets after years of explicitly avoiding them in favor of suburban environments. In the past few years, retailers have begun experimenting with ...

Press, Jared Harding

2013-01-01T23:59:59.000Z

106

Hydrogen Storage Materials Database Demonstration Webinar (Text...  

Broader source: Energy.gov (indexed) [DOE]

Database Demonstration Webinar (Text Version) Hydrogen Storage Materials Database Demonstration Webinar (Text Version) Below is the text version of the webinar titled "Hydrogen...

107

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Color of Atoms Mr. Pordes- I have a question for science. As you probably know, we have been studying all about particles and the particle model of matter and John Dalton and...

108

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Pure Antineutron Beams Hello, I am a physics student in Germany. I haven't had particle physics yet, so I'd be glad if you answered me one question: How do you create more or less...

109

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Question: How many studies have been done to figure out what escapes from the accelerators into the environment and how much of it escapes? I heard from a tour guide that...

110

Questions about Groundwater Conservation Districts in Texas  

E-Print Network [OSTI]

Groundwater conservation districts (GCDs) are being created in many parts of Texas to allow local citizens to manage and protect their groundwater. This publication answers frequently asked questions about groundwater and GCDs....

Lesikar, Bruce J.; Silvy, Valeen

2008-09-22T23:59:59.000Z

111

TECHNOLOGY TRANSFER QUESTIONS..txt - Notepad  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

rfien@campbellap.com Sent: Monday, January 26, 2009 5:34 PM To: GC-62 Subject: TECHNOLOGY TRANSFER QUESTIONS. Sensitivity: Confidential To Whom It May Concern, Campbell Applied...

112

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Higgs boson Elisabeth, You asked: Could you help me with the following question. Is there any evidense for the existence of the Higgs bosson or Higgs field? According to the New...

113

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Rotation of Black Holes Hello Alyssa -- The questions you sent to Fermilab about physics didn't get lost, they just got routed to a couple of lazy postdocs. That's why it took so...

114

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

How many neutrons? Dear Mrs. Pordes, Hello. My name is Andrew Schmidt. I am writing to you concerning a question I have. I am in your daughters science class and it would be...

115

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

be quite right. Thank you for the opportunity to ask this question. Regards, Bob Dowe Hello Bob, Let us start from the beginning. First I have to tell you that there are usually...

116

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

appreciate it if you could send it to me. That would be awesome. Thanks Luke Luke - Hello. I am a scientist here at Fermilab and your question got forwarded to me. In some...

117

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Charged Objects and Virtual Photons Hello, I am fascinated by the universe of physics, and I have a few questions. Actually, I was wondering about photons. I have come to...

118

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Why can radio waves pass through a wall but light cannot? Hello, My name is Mike P. and this is my question. If radio & light waves are both properties of the electromagnetic...

119

Fermilab | Science | Inquiring Minds | Questions About Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

proton and an anti electron (a positron, i do not know the anti particle of proton). Hello Killian, thanks for your very interesting question. When you talk about particles, the...

120

The Big Questions For Biodiversity Informatics  

E-Print Network [OSTI]

of biodiversity information. This emerging field of biodiversity informatics has been growing quickly, but without overarching scientific questions to guide its development; the result has been developments that have no connection to genuine insight and forward...

Peterson, A. Townsend; Knapp, Sandra; Guralnick, Robert P.; Soberó n, Jorge; Holder, Mark T.

2010-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

Solar Instructor Training Network Frequently Asked Questions  

Broader source: Energy.gov [DOE]

These frequently asked questions (FAQs) relate to the solar instructor training network. This project was launched by the U.S. Department of Energy (DOE) Solar Energy Technologies Program (SETP or...

122

AGREE-DISAGREE QUESTIONS: PROBLEMS AND SOME  

E-Print Network [OSTI]

AGREE-DISAGREE QUESTIONS: PROBLEMS AND SOME SOLUTIONS Allyson L. Holbrook Associate Professor that established a woman's right to an abortion?" #12;EXAMPLE SCALES: HANDBOOK OF MARKETING SCALES (2010) Ten

Illinois at Chicago, University of

123

Better Plants Look Ahead Webinar: Text Version  

Broader source: Energy.gov [DOE]

The Better Plants Program hosted a webinar on January 22, 2015 to review accomplishments to date and detail new initiatives to save partners energy and water. Question and answer session is included. Download presentation slides.

124

Ten questions and answers about superconductivity  

E-Print Network [OSTI]

This work answers the basic questions of superconductivity in a question-and-answer format. We extend a basic hypothesis to various superconductors. This hypothesis is that superconductivity requires that the pairing gap locates around the Fermi level. On the basis of this hypothesis our calculations give the so-called three factor theory with which some key problems of the high temperature superconductivity are explained.

Tian De Cao

2012-11-13T23:59:59.000Z

125

Computational Fluid Dynamics Analysis of Flexible Duct Junction Box Design  

SciTech Connect (OSTI)

IBACOS explored the relationships between pressure and physical configurations of flexible duct junction boxes by using computational fluid dynamics (CFD) simulations to predict individual box parameters and total system pressure, thereby ensuring improved HVAC performance. Current Air Conditioning Contractors of America (ACCA) guidance (Group 11, Appendix 3, ACCA Manual D, Rutkowski 2009) allows for unconstrained variation in the number of takeoffs, box sizes, and takeoff locations. The only variables currently used in selecting an equivalent length (EL) are velocity of air in the duct and friction rate, given the first takeoff is located at least twice its diameter away from the inlet. This condition does not account for other factors impacting pressure loss across these types of fittings. For each simulation, the IBACOS team converted pressure loss within a box to an EL to compare variation in ACCA Manual D guidance to the simulated variation. IBACOS chose cases to represent flows reasonably correlating to flows typically encountered in the field and analyzed differences in total pressure due to increases in number and location of takeoffs, box dimensions, and velocity of air, and whether an entrance fitting is included. The team also calculated additional balancing losses for all cases due to discrepancies between intended outlet flows and natural flow splits created by the fitting. In certain asymmetrical cases, the balancing losses were significantly higher than symmetrical cases where the natural splits were close to the targets. Thus, IBACOS has shown additional design constraints that can ensure better system performance.

Beach, R.; Prahl, D.; Lange, R.

2013-12-01T23:59:59.000Z

126

Integrated Box Interrogation System (IBIS) Preliminary Design Study  

SciTech Connect (OSTI)

Canberra Industries has won the tendered solicitation, INEEL/EST-99-00121 for boxed waste Nondestructive Assay Development and Demonstration. Canberra will provide the Integrated Box Interrogation System (IBIS) which is a suite of assay instrumentation and a data reduction system that addresses the measurement needs for Boxed Wastes identified in the solicitation and facilitates the associated experimental program and demonstration of system capability. The IBIS system will consist of the next generation CWAM system, i.e. CWAM II, which is a Scanning Passive/Active Neutron interrogation system which we will call a Box Segmented Neutron Scanner (BSNS), combined with a physically separate Box Segmented Gamma-ray Scanning (BSGS) system. These systems are based on existing hardware designs but will be tailored to the large sample size and enhanced to allow the program to evaluate the following measurement criteria:Characterization and correction for matrix heterogeneity Characterization of non-uniform radio-nuclide and isotopic compositions Assay of high density matrices (both high-Z and high moderator contents)Correction for radioactive material physical form - such as self shielding or multiplication effects due to large accumulations of radioactive materials.Calibration with a minimal set of reference standards and representative matrices.THis document summarizes the conceptual design parameters of the IBIS and indicates areas key to the success of the project where development is to be centered. The work presented here is a collaborative effort between scientific staff within Canberra and within the NIS-6 group at LANL.

DR. Stephen Croft; Mr. David Martancik; Dr. Brian Young; Dr. Patrick MJ Chard; Dr. Robert J Estop; Sheila Melton; Gaetano J. Arnone

2003-01-13T23:59:59.000Z

127

Investigating Keyphrase Indexing with Text Denoising  

E-Print Network [OSTI]

In this paper, we report on indexing performance by a state-of-the-art keyphrase indexer, Maui, when paired with a text extraction procedure called text denoising. Text denoising is a method that extracts the denoised text, comprising the content-rich sentences, from full texts. The performance of the keyphrase indexer is demonstrated on three standard corpora collected from three domains, namely food and agriculture, high energy physics, and biomedical science. Maui is trained using the full texts and denoised texts. The indexer, using its trained models, then extracts keyphrases from test sets comprising full texts, and their denoised and noise parts (i.e., the part of texts that remains after denoising). Experimental findings show that against a gold standard, the denoised-text-trained indexer indexing full texts, performs either better than or as good as its benchmark performance produced by a full-text-trained indexer indexing full texts.

Shams, Rushdi

2012-01-01T23:59:59.000Z

128

Ian Hinchliffe Answers Your Higgs Boson Questions  

SciTech Connect (OSTI)

contingent with the ATLAS experiment at CERN, answers many of your questions about the Higgs boson. Ian invited viewers to send in questions about the Higgs via email, Twitter, Facebook, or YouTube in an "Ask a Scientist" video posted July 3: http://youtu.be/xhuA3wCg06s CERN's July 4 announcement that the ATLAS and CMS experiments at the Large Hadron Collider have discovered a particle "consistent with the Higgs boson" has raised questions about what scientists have found and what still remains to be found -- and what it all means. If you have suggestions for future "Ask a Scientist" videos, post them below or send ideas to askascientist@lbl.gov

Hinchliffe, Ian

2012-01-01T23:59:59.000Z

129

Ian Hinchliffe Answers Your Higgs Boson Questions  

ScienceCinema (OSTI)

contingent with the ATLAS experiment at CERN, answers many of your questions about the Higgs boson. Ian invited viewers to send in questions about the Higgs via email, Twitter, Facebook, or YouTube in an "Ask a Scientist" video posted July 3: http://youtu.be/xhuA3wCg06s CERN's July 4 announcement that the ATLAS and CMS experiments at the Large Hadron Collider have discovered a particle "consistent with the Higgs boson" has raised questions about what scientists have found and what still remains to be found -- and what it all means. If you have suggestions for future "Ask a Scientist" videos, post them below or send ideas to askascientist@lbl.gov

Hinchliffe, Ian

2013-05-29T23:59:59.000Z

130

Experimental determination of the elastic cotunneling rate in a hybrid single-electron box  

SciTech Connect (OSTI)

We report measurements of charge configurations and charge transfer dynamics in a hybrid single-electron box composed of aluminum and copper. We used two single-electron transistors (SETs) to simultaneously read out different parts of the box, enabling us to map out stability diagrams of the box and identify various charge transfer processes in the box. We further characterized the elastic cotunneling in the box, which is an important source of error in electron turnstiles consisting of hybrid SETs, and found that the rate was as low as 1?Hz at degeneracy and compatible with theoretical estimates for electron tunneling via virtual states in the central superconducting island of the box.

Sun, Chia-Heng; Tai, Po-Chen; Chen, Yung-Fu, E-mail: yfuchen@ncu.edu.tw [Department of Physics, National Central University, Jhongli 32001, Taiwan (China); Jiang, Jheng-An; Wu, Cen-Shawn [Department of Physics, National Changhua University of Education, Changhua 500, Taiwan (China); Chen, Jeng-Chung [Department of Physics, National Tsing-Hua University, Hsinchu 30013, Taiwan (China)

2014-06-09T23:59:59.000Z

131

Questions in Cuban and CaribbeanQuestions in Cuban and Caribbean Archaeology:Archaeology  

E-Print Network [OSTI]

Questions in Cuban and CaribbeanQuestions in Cuban and Caribbean Archaeology:Archaeology: Across was not only the biggest language in the Caribbean, but was also used as lingua franca throughout the region evidence about their language, only place names · Theory: the only non-Arawak language in the Caribbean Sea

Martin, Jeff

132

Fish and Wildlife Management Questions and RM&E Strategies Key Management Questions  

E-Print Network [OSTI]

1 Fish and Wildlife Management Questions and RM&E Strategies Key Management Questions 1. Are we meeting biological and programmatic performance objectives established within the Columbia Basin Fish implemented and accomplished as proposed? Strategic Category: Fish Population Status Monitoring The following

133

Got a Question? We Have an Answer!  

Broader source: Energy.gov [DOE]

Editor's Note: This entry has been cross-posted from energysavers.gov. Ever had a question -- maybe about energy efficiency, renewable energy, the Department of Energy or the like -- and not had any idea where to find the answer? The EERE Information Center might be able to help.

134

Background Material Important Questions about Magnetism  

E-Print Network [OSTI]

Background Material Important Questions about Magnetism: 1) What is Magnetism?Magnetism is a force or repulsion due to charge is called the electric force. But what about magnetism, is there a fundamental property of some matter that makes things magnetic? The answer is: "sort of." Electric current

Mojzsis, Stephen J.

135

Student Learning Commons Questions & Answers for Faculty  

E-Print Network [OSTI]

Student Learning Commons Questions & Answers for Faculty What is the SFU Student Learning Commons? The Student Learning Commons (SLC), is an academic learning centre which provides peer-based assistance with library reference, computer assistance, and other student academic support services. SLC programs

136

CRAD, Facility Safety- Unreviewed Safety Question Requirements  

Broader source: Energy.gov [DOE]

A section of Appendix C to DOE G 226.1-2 "Federal Line Management Oversight of Department of Energy Nuclear Facilities." Consists of Criteria Review and Approach Documents (CRADs) that can be used for assessment of a contractor's Unreviewed Safety Question (USQ) process.

137

Common Questions Why should I soil test?  

E-Print Network [OSTI]

Common Questions Why should I soil test? Soil testing is an important diagnostic tool to evaluate nutrient imbalances and understand plant growth. The most important reason to soil test is to have a basis for intelligent application of fertilizer and lime. Testing also allows for growers and homeowners to maintain

Isaacs, Rufus

138

Frequently Asked Questions 1. Technology Transfer  

E-Print Network [OSTI]

Frequently Asked Questions 1. Technology Transfer 2. Patent 3. Requirements for obtaining a patent is not addressed, please contact Colleen Michael at 631-344 -4919. #12;What is Technology Transfer? Technology Transfer is the process of developing practical applications for the results of scientific research

139

Physics 321 Exam 1 Sample Questions  

E-Print Network [OSTI]

of motion. Briefly explain the meaning of each law. 4. Describe one case where Newton's third law does .T At what frequency is the response a maximum? What does FWHM mean? What is the expression we usePhysics 321 Exam 1 Sample Questions 1. Write the second order differential equation as two first

Hart, Gus

140

Rangeland ecology: Key global research issues & questions  

E-Print Network [OSTI]

1 Rangeland ecology: Key global research issues & questions Robin Reid and Maria Fernandez-Gimenez This paper discusses developments in our understanding about rangeland ecology and rangeland dynamics in the last 20 years. Before the late 1980's, the mainstream view in range ecology was that livestock

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

Question and Answers Alternative Fuel Readiness Plans  

E-Print Network [OSTI]

Question and Answers Alternative Fuel Readiness Plans PON-13-603 September 3, 2013 Eligibility Q1 to readiness plans? A1 This solicitation is limited to readiness planning only for alternative fuels. Q2 In regards to PON-13-603 - Alternative Fuel Readiness Plans, is electricity used for transportation

142

Extracting Simplified Statements for Factual Question Generation  

E-Print Network [OSTI]

Minister Vladimir V. Putin, the country's paramount leader, cut short a trip to Siberia, returning to Moscow to oversee the federal response. Mr. Putin built his reputation in part on his success set of questions:3 (2) Prime Minister Vladimir V. Putin is the country's paramount leader. (3) Prime

Eskenazi, Maxine

143

Term statistics Zipf's law text statistics  

E-Print Network [OSTI]

Term statistics Zipf's law text statistics October 20, 2014 text statistics 1 / 19 #12;Term statistics Zipf's law Overview 1 Term statistics 2 Zipf's law text statistics 2 / 19 #12;Term statistics Zipf's law Outline 1 Term statistics 2 Zipf's law text statistics 3 / 19 #12;Term statistics Zipf's law Model

Lu, Jianguo

144

Computer Science & Engineering Box 352350 Seattle, WA 98195-2350  

E-Print Network [OSTI]

Computer Science & Engineering #12;Box 352350 Seattle, WA 98195-2350 Nonprofit Org US Postage PAID in the Computer Science Department. He is a superb researcher in the design of interactive, visual data, Carnegie Mellon University's Finmeccanica Associate Professor in the School of Computer Science, is widely

Borenstein, Elhanan

145

Energy Savings Assessment for Digital-to-Analog Converter Boxes  

SciTech Connect (OSTI)

The Digital Television (DTV) Converter Box Coupon Program was administered by the U.S. government to subsidize purchases of digital-to-analog converter boxes, with up to two $40 coupons for each eligible household. In order to qualify as Coupon Eligible Converter Boxes (CECBs), these devices had to meet a number of minimum performance specifications, including energy efficiency standards. The Energy Star Program also established voluntary energy efficiency specifications that are more stringent than the CECB requirements. In this study, we measured the power and energy consumptions for a sample of 12 CECBs (including 6 Energy Star labeled models) in-use in homes and estimated aggregate energy savings produced by the energy efficiency policies. Based on the 35 million coupons redeemed through the end of the program, our analysis indicates that between 2500 and 3700 GWh per year are saved as a result of the energy efficiency policies implemented on digital-to-analog converter boxes. The energy savings generated are equivalent to the annual electricity use of 280,000 average US homes.

Cheung, Hoi Ying Iris; Meier, Alan; Brown, Richard

2011-01-18T23:59:59.000Z

146

Automated Black-Box Testing with Abstract VDM Oracles  

E-Print Network [OSTI]

as test oracles for concrete software. The automation of the resulting testing frame-work is based of a target system. For that reason, a mapping between abstract and concrete test data is requiredAutomated Black-Box Testing with Abstract VDM Oracles Bernhard K. Aichernig Technical University

147
148

From the preface of the text: ". . . The text is meant to be read by the student. We mean the whole text including examples, questions, and proofs. Mathematics is not a spectator  

E-Print Network [OSTI]

as it is presented. . . . " 1. August 22, 2013 1.1. Treasure Island. Exploring the attic of the house that has been

Kierstead, Hal

149

#AskEnergySaver: Answering Your Home Heating Questions | Department...  

Broader source: Energy.gov (indexed) [DOE]

AskEnergySaver: Answering Your Home Heating Questions AskEnergySaver: Answering Your Home Heating Questions October 16, 2014 - 4:05pm Q&A Have questions about renewable energy...

150

Optimal Terminal Box Control for Single Duct Air-Handling Units  

E-Print Network [OSTI]

Terminal boxes maintain room temperature by modulating supply air temperature and airflow in building HVAC systems. Terminal boxes with conventional control sequences often supply inadequate airflow to a conditioned space, resulting in occupant...

Cho, Y.; Vondal, J.; Wang, G.; Liu, M.

2006-01-01T23:59:59.000Z

151

University of California Response to DOE Questions Regarding...  

Broader source: Energy.gov (indexed) [DOE]

University of California Response to DOE Questions Regarding Price-Anderson Renewal University of California Response to DOE Questions Regarding Price-Anderson Renewal Comments...

152

DOE response to questions from AHAM on the supplemental proposed...  

Energy Savers [EERE]

response to questions from AHAM on the supplemental proposed test procedure for residential clothes washers DOE response to questions from AHAM on the supplemental proposed test...

153

Forty Most Asked Questions Concerning CEQ's National Environmental...  

Energy Savers [EERE]

Forty Most Asked Questions Concerning CEQ's National Environmental Policy Act Regulations Forty Most Asked Questions Concerning CEQ's National Environmental Policy Act Regulations...

154

SHEARING BOX SIMULATIONS OF THE MRI IN A COLLISIONLESS PLASMA Prateek Sharma and Gregory W. Hammett  

E-Print Network [OSTI]

of the MRI in a collision- less plasma, focusing on local simulations in the shearing box limit. Quataert et

Hammett, Greg

155

Incremental Hierarchical Clustering of Text Documents  

E-Print Network [OSTI]

distribution is demonstrated. 1 Introduction Document clustering is an effective tool to manage informationIncremental Hierarchical Clustering of Text Documents by Nachiketa Sahoo Adviser: Jamie Callan May 5, 2006 Abstract Incremental hierarchical text document clustering algorithms are important

Gordon, Geoffrey J.

156

DOCUMENTATION OF ELECTRONIC In-text Citations  

E-Print Network [OSTI]

DOCUMENTATION OF ELECTRONIC SOURCES IN MLA In-text Citations In-text citations in MLA format of the message. Other Resources about On-line Citations 1.ONLINE! - Using MLA Style to Cite and Document Sources

deYoung, Brad

157

Discordances ontologiques et questions d'interoprabilit  

E-Print Network [OSTI]

liens, et en quoi elles sont pertinentes pour les sciences sociales. Mots clés : Epistémologie, ontologie, interopérabilité, intégration de schémas, homologie structurale Summary : Beyond the search terrain d'étude ethnologique. Après avoir quelque peu précisé ces deux questions, ainsi que les liens qu

Boyer, Edmond

158

Twenty-five questions for string theorists  

SciTech Connect (OSTI)

In an effort to promote communication between the formal and phenomenological branches of the high-energy theory community, we provide a description of some important issues in supersymmetric and string phenomenology. We describe each within the context of string constructions, illustrating them with specific examples where applicable. Each topic culminates in a set of questions that we believe are amenable to direct consideration by string theorists, and whose answers we think could help connect string theory and phenomenology.

Binetruy, Pierre; /Orsay, LPT; Kane, G.L.; /Michigan U., MCTP; Lykken, Joseph D.; /Fermilab; Nelson, Brent D.; /Pennsylvania U.

2005-09-01T23:59:59.000Z

159

Controlling a Steel Mill with BOXES Michael McGarity, Claude Sammut and David Clements  

E-Print Network [OSTI]

Controlling a Steel Mill with BOXES Michael McGarity, Claude Sammut and David Clements and Chambers (1968) to a large-scale, real-world problem, namely, learning to control a steel mill. By applying BOXES to a model of a skinpass mill (a type of steel mill), we find that the BOXES algorithm can be made

Sammut, Claude

160

PO Box 6050, Irvine, CA 92616-6050 www.extension.uci.edu Accounting Courses  

E-Print Network [OSTI]

PO Box 6050, Irvine, CA 92616-6050 www.extension.uci.edu Accounting Courses (Not a Certificate Program) #12;PO Box 6050, Irvine, CA 92616-6050 www.extension.uci.edu LIST OF COURSES Course # Accounting://learn.uci.edu for more information on how the online courses work. Revised 9/27/12 #12;PO Box 6050, Irvine, CA 92616

Barrett, Jeffrey A.

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

An Area Efficien Low Power High Speed S-Box Implementation Using Power-Gated PLA  

E-Print Network [OSTI]

An Area Efficien Low Power High Speed S-Box Implementation Using Power-Gated PLA Ho Joon Lee- sign of Rijndael S-Box for the SubByte transformation using power-gating and PLA design techniques arrays,VLSI General Terms Cryptography, Power Gate, Low Power Keywords AES, PLA, Power Gate, S-Box 1

Ayers, Joseph

162

"BLUE BOX" POWER ELECTRONICS CONTROL MODULES FOR LABORATORY-BASED EDUCATION  

E-Print Network [OSTI]

"BLUE BOX" POWER ELECTRONICS CONTROL MODULES FOR LABORATORY-BASED EDUCATION R. S. BALOG, J. W of Illinois at Urbana/Champaign Urbana, Illinois 61801 #12;#12;UILU-ENG-2004-2504 "BLUE BOX" POWER ELECTRONICS of design documents detailing the design and fabrication of "blue box" power electronics control modules

Kimball, Jonathan W.

163

Can An Evolutionary Process Create English Text?  

E-Print Network [OSTI]

MD, 2002. [Foster1991] David Foster, The PhilosophicalEnglish text. For example, David Foster, in a book skeptical

Bailey, David H.

2009-01-01T23:59:59.000Z

164

matlab-help-text Inverse Secant.  

E-Print Network [OSTI]

matlab-help-text asec CSC acsc cot acot exp log logic sqrt abs angle conj imag real fix floor ceil and right. Page 2 #12;matlab-help-text axis zoom grid legend - title xiabel - ylabel - mesh surf fills. Echo commands in M-files. Control paged output in command window. Save text of MATLAB session. set

Kleinfeld, David

165

Frontiers of biomedical text mining: current progress  

E-Print Network [OSTI]

Frontiers of biomedical text mining: current progress Pierre Zweigenbaum, Dina Demner-Fushman, Hong of biomedical text mining continue to present interesting challenges and opportunities for great improvements and interesting research. In this article we review the current state of the art in biomedical text mining or `Bio

Yu, Hong

166

Queen mandibular pheromone: questions that remain to be resolved  

E-Print Network [OSTI]

Department of Zoology, University of Otago, P.O. Box 56, Dunedin 9054, New Zealand Received 11 July 2011 is an effective attractant over large distances and elicits highly predictable responses in flying drones

167

Questions for IIT Waste Diversion RFP Question: What are the recycling/waste goals of IIT?  

E-Print Network [OSTI]

for commercial weights? We cannot provide exact weights by location for commercial cans due to rear load trucks expected to haul the Black outside Hawk bins? Answer: No, this is handled by our staff. Question: Have you

Heller, Barbara

168

2013 Better Buildings Federal Award Frequently Asked Questions  

Broader source: Energy.gov [DOE]

Document answers frequently asked questions for the Federal Energy Management Program's 2013 Better Buildings Federal Award.

169

Multiple-state quantum Otto engine, 1D box system  

SciTech Connect (OSTI)

Quantum heat engines produce work using quantum matter as their working substance. We studied adiabatic and isochoric processes and defined the general force according to quantum system. The processes and general force are used to evaluate a quantum Otto engine based on multiple-state of one dimensional box system and calculate the efficiency. As a result, the efficiency depends on the ratio of initial and final width of system under adiabatic processes.

Latifah, E., E-mail: enylatifah@um.ac.id [Laboratory of Theoretical Physics and Natural Philosophy, Physics Department, Institut Teknologi Sepuluh Nopember, ITS, Surabaya, Indonesia and Physics Department, Malang State University (Indonesia); Purwanto, A. [Laboratory of Theoretical Physics and Natural Philosophy, Physics Department, Institut Teknologi Sepuluh Nopember, ITS, Surabaya (Indonesia)

2014-03-24T23:59:59.000Z

170

Black Box Approach for Energy Monitoring of Commercial Buildings  

E-Print Network [OSTI]

Page 1 of paper submitted to ICEBO 2008 Berlin Black Box Approach for Energy Monitoring of Commercial Buildings Susanne Komhard M.Sc. student Fraunhofer-Institute for Solar Energy Systems Freiburg, Germany Christian Neumann Project... leader Fraunhofer-Institute for Solar Energy Systems Freiburg, Germany ABSTRACT The potential to save energy by changing operational parameters - especially in existing commercial buildings ? is in the magnitude of 5-30%. In order to realize...

Komhard, S.; Neumann, C.

171

Opening Pandora's Box - Sovereign Bonds in International Arbitration  

E-Print Network [OSTI]

OPENING PANDORA’S BOX: SOVEREIGN BONDS IN INTERNATIONAL ARBITRATION By Michael Waibel* In recent years, sovereign debt crises have received much attention from the perspective of international public policy, but an effective legal solution... . In 1995, Mexico was unable to meet its external debt obligations. Three years later, a severe financial crisis hit East Asia. Russia defaulted in 1998. Argentina’s 2001 default on more than U.S.$100 billion in private debt was the largest in history.7...

Waibel, Michael

172

Packaging design criteria modified fuel spacer burial box. Revision 1  

SciTech Connect (OSTI)

Various Hanford facilities must transfer large radioactively contaminated items to burial/storage. Presently, there are eighteen Fuel Spacer Burial Boxes (FSBBs) available on the Hanford Site for transport of such items. Previously, the FSBBS were transported from a rail car to the burial trench via a drag-off operation. To allow for the lifting of the boxes into the burial trench, it will be necessary to improve the packagings lifting attachments and provide structural reinforcement. Additional safety improvements to the packaging system will be provided by the addition of a positive closure system and package ventilation. FSBBs that are modified in such a manner are referred to as Modified Fuel Spacer Burial Boxes (MFSBs). The criteria provided by this PDC will be used to demonstrate that the transfer of the MFSB will provide an equivalent degree of safety as would be provided by a package meeting offsite transportation requirements. This fulfills the onsite transportation safety requirements implemented in WHC-CM-2-14, Hazardous Material Packaging and Shipping. A Safety Analysis Report for Packaging (SARP) will be prepared to evaluate the safety of the transfer operation. Approval of the SARP is required to authorize transfer. Criteria are also established to ensure burial requirements are met.

Stevens, P.F.

1994-09-13T23:59:59.000Z

173

Texts and Technology DOCTOR OF PHILOSOPHY  

E-Print Network [OSTI]

Texts and Technology DOCTOR OF PHILOSOPHY Admission Deadline Each Year: January 15 To be considered)(*International students only) Inadditiontotheaboveitems,applicantsmustalsosubmitto: TEXTS AND TECHNOLOGY UCF COLLEGE I S S I O N R E Q U I R E M E N T S P R O G R A M O F S T U D Y TEXTS AND TECHNOLOGY 57 hrs Core

Wu, Shin-Tson

174

Frequently Asked Questions | ornl.gov  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest Region service area. TheEPSCI HomeTours,Frequently Asked Questions

175

Fermilab | Science | Questions for the Universe  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series toESnet4:Epitaxialtransatlantic networkHomelandWorkforceQuestions for

176

Frequently Asked Questions | DOE Data Explorer  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-SeriesFlickr Flickr Editor's note: SincePlantFreedom ofFrequently Asked Questions

177

Fuel Cell Animation- Chemical Process (Text Version)  

Broader source: Energy.gov [DOE]

This text version of the fuel cell animation demonstrates how a fuel cell uses hydrogen to produce electricity, with only water and heat as byproducts.

178

Welcome and Advanced Manufacturing Partnership (Text Version)  

Broader source: Energy.gov [DOE]

This is a text version of the Welcome and Advanced Manufacturing Partnership video, originally presented on March 12, 2012 at the MDF Workshop held in Chicago, Illinois.

179

Manufacturing Ecosystems and Keystone Technologies (Text Version)  

Broader source: Energy.gov [DOE]

This is a text version of the Manufacturing Ecosystems and Keystone Technologies video, originally presented on March 12, 2012 at the MDF Workshop held in Chicago, Illinois.

180

DOE and Critical Materials Video (Text Version)  

Broader source: Energy.gov [DOE]

This is a text version of the "DOE and Critical Materials" video presented at the Critical Materials Workshop, held on April 3, 2012 in Arlington, Virginia.

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

Secretary of Energy Moniz Keynote (Text Version)  

Broader source: Energy.gov [DOE]

Below is the text version for the Keynote: The Honorable Ernest J. Moniz, U.S. Secretary of Energy Video.

182

Constructing Information Networks from Text Documents  

E-Print Network [OSTI]

Constructing Information Networks from Text Documents Matjaz Jursic1 , Nada Lavrac1,2 , Igor representation of data/knowledge generated from text documents available on the web. The problem addressed is how of information source complexity ­ type diversity as well as volume size. Efficient management and processing

Toivonen, Hannu

183

Gene expression profiling--Opening the black box of plant ecosystem responses to global change  

SciTech Connect (OSTI)

The use of genomic techniques to address ecological questions is emerging as the field of genomic ecology. Experimentation under environmentally realistic conditions to investigate the molecular response of plants to meaningful changes in growth conditions and ecological interactions is the defining feature of genomic ecology. Since the impact of global change factors on plant performance are mediated by direct effects at the molecular, biochemical and physiological scales, gene expression analysis promises important advances in understanding factors that have previously been consigned to the 'black box' of unknown mechanism. Various tools and approaches are available for assessing gene expression in model and non-model species as part of global change biology studies. Each approach has its own unique advantages and constraints. A first generation of genomic ecology studies in managed ecosystems and mesocosms have provided a testbed for the approach and have begun to reveal how the experimental design and data analysis of gene expression studies can be tailored for use in an ecological context.

Leakey, A.D.B.; Ainsworth, E.A.; Bernard, S.M.; Markelz, R.J.C.; Ort, D.R.; Placella, S.A.P.; Rogers, A.; Smith, M.D.; Sudderth, E.A.; Weston, D.J.; Wullschleger, S.D.; Yuan, S.

2009-11-01T23:59:59.000Z

184

ATOC 3500/CHEM 3151 Spring 2014 The San Joaquin, acid rain, and using a simple "box" model  

E-Print Network [OSTI]

ATOC 3500/CHEM 3151 ­ Spring 2014 Problem 19 The San Joaquin, acid rain, and using a simple "box-called "acid fogs" in this valley. Assume a "box" of area 1 km2 (1 km x 1km) with the top of the box `box', calculate the steady-state SO2 concentration (in units of molecules cm-3 ). (c) Sulfuric acid

Toohey, Darin W.

185

Vehicle Technologies Office: Lightweighting Video Text Version  

Broader source: Energy.gov [DOE]

This is a text version of the Motorweek video segment Materials Technology / Vehicle Lightweighting, which aired on April 21, 2014. The full video is on the Lightweight Materials for Cars and...

186

MDF Form and Function (Text Version)  

Broader source: Energy.gov [DOE]

This is a text version of the Manufacturing Demonstration Facilities (MDF) Form and Function video, originally presented on March 12, 2012 at the MDF Workshop held in Chicago, Illinois.

187

Carlsbad Field Office P. O. Box 3090 Carlsbad  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

if you have any questions regarding this transmittal. cc: )6se R. al1ager ( Carlsbad Field Office S. Holmes, NMED * ED T. Kliphuis , NMED ED R. Maestas, NMED ED C....

188

An experimental investigation of a general quadrilateral torsion box  

E-Print Network [OSTI]

'10497 FC ~2 0. 1359 FC At point (46, 17) (Gage $4) o' = 0. 63127 F 2 ? -0. 3209 F At point (26, 21) (Gage $5) 0 = 0. 41414 F 1 ' C 0 2 0'20800 FC To determine the theoretical direction of the principal stresses, the bisector of angle PZQ (Fig. 1... OF FIGURES Figure Page 1. Plan View of Top Panel. Torsion-Box Loading Schematic Strain Gage Orientation 13 Load-Stress Curve Comparison, Gages 2 and 6 22 Load-Stress Curve, Gage 7. Load-Stress Curve, Gage 8. Load-Stress Curve, Gage 9. 28 29 Load...

Champlin, James Lund

2012-06-07T23:59:59.000Z

189

Box Butte County, Nebraska: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 NoPublic Utilities Address: 160Benin: EnergyBoston Area Solar Energy AssociationBowerbank, Maine:Box Butte County,

190

Box Canyon Motel Space Heating Low Temperature Geothermal Facility | Open  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 NoPublic Utilities Address: 160Benin: EnergyBoston Area Solar Energy AssociationBowerbank, Maine:Box Butte

191

Box Elder County, Utah: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 NoPublic Utilities Address: 160Benin: EnergyBoston Area Solar Energy AssociationBowerbank, Maine:Box ButteElder

192

Box Elder, Montana: Energy Resources | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 NoPublic Utilities Address: 160Benin: EnergyBoston Area Solar Energy AssociationBowerbank, Maine:Box

193

P.O. Box 117, Oak Ridge, TN 37831  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas Conchas recoveryLaboratorySpeedingOptimizing I/OP-Glycoprotein Structure and Bill Taylor,Box

194

Have a Question About Energy Efficiency or Renewable Energy?...  

Broader source: Energy.gov (indexed) [DOE]

Have a Question About Energy Efficiency or Renewable Energy? Ask Ener-Gee Whiz Have a Question About Energy Efficiency or Renewable Energy? Ask Ener-Gee Whiz May 26, 2009 -...

195

Nano Lect 1 Questions and Keypoints Key Points  

E-Print Network [OSTI]

Nano Lect 1 ­ Questions and Keypoints Key Points 1. What is nano technology: a. Very small technology with device in the 1nm to 100nm lots of useful properties Questions 1. Define nanotechnology. Is an nano

Smy, Tom

196

2015 Federal Energy and Water Management Awards: Frequently Asked Questions  

Broader source: Energy.gov [DOE]

Document answers frequently asked questions about the 2015 Federal Energy and Water Management Awards' guidelines and criteria for nominations.

197

Frequently Asked Questions: About Federal Fleet Management (Brochure)  

SciTech Connect (OSTI)

Answers to frequently asked questions about Federal fleet management, Federal requirements, reporting, advanced vehicles, and alternative fuels.

Not Available

2009-10-01T23:59:59.000Z

198

Questions about? Needing help wards? Worried about? Who can  

E-Print Network [OSTI]

Questions about? Needing help wards? Worried about? Who can bout? Needing help with? Headi can help? Questio g towards? Worrie elp? Questions about? Needing he bout? Needing help with? Headi ed about? Who can help? Quest ng help with? Heading towards? W an help? Questions about? Needin ng towards? Worried

Netoff, Theoden

199

Improved Answer Ranking in Social Question-Answering Portals  

E-Print Network [OSTI]

@cl.uni-heidelberg.de ABSTRACT Community QA portals provide an important resource for non-factoid question; Community question answering; Query expansion 1. INTRODUCTION Community Question-Answering (QA) portals can more recent work deploys Yahoo! Answers data for complete QA [24, 25], we focus on the aspect of answer

Riezler, Stefan

200

E-Print Network 3.0 - airport strainer box Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

installations - Big box retailers - Grocery Stores - Car Dealerships One Megawatt of CHP Power Source: DOE Office of Energy Efficiency and Renewable Energy, Hydrogen, Fuel...

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

E-Print Network 3.0 - automobile black boxes Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Search Powered by Explorit Topic List Advanced Search Sample search results for: automobile black boxes Page: << < 1 2 3 4 5 > >> 1 Detecting Automobiles and People for...

202

E-Print Network 3.0 - asus eee box Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Information Sciences 6 PhD QUALIFYING EXAM STUDY GUIDE Solid State Devices Summary: -wave duality The Bohr model Particle in a box Suggested Reference Materials Ben...

203

Standardization of corpus texts for the NEID  

E-Print Network [OSTI]

Standardization of corpus texts for the NEID Kevin P. Scannell Saint Louis University May 22, 2009, on paper Entries drafted between Mar. '50 ­ Aug. '56 Standard reference since its publication in 1959 Oifigiúil "The Official Standard" for Irish spelling and grammar, laid out in the 1940's and 1950's

Scannell, Kevin Patrick

204

DESCRIPTIVE TEXT SEA WATER INORGANIC CARBON DATABASE  

E-Print Network [OSTI]

DESCRIPTIVE TEXT SEA WATER INORGANIC CARBON DATABASE for the CARBON DIOXIDE INFORMATION OF OCEANOGRAPHY (SIO) I. GENERAL DESCRIPTION The database consists of tables presenting oceanic inorganic carbon, titration (total) alkalinity (database abbreviation: "ALK"), and the 13 C / 12 C isotopic ratio

205

WEB SEARCH TECHNOLOGIES FOR TEXT DOCUMENTS  

E-Print Network [OSTI]

, and metasearch engines. Key Words: search engine, Web, Surface Web, Deep Web, Web crawler, text retrieval, Vector and the Deep Web (or Hidden Web) (Bergman 2000). The former refers to the collection of web pages) it has more than 45 billion web pages according to www.worldwidewebsize.com. The Deep Web contains web

Meng, Weiyi

206

Guided Text Search Using Adaptive Visual Analytics  

SciTech Connect (OSTI)

This research demonstrates the promise of augmenting interactive visualizations with semi- supervised machine learning techniques to improve the discovery of significant associations and insights in the search and analysis of textual information. More specifically, we have developed a system called Gryffin that hosts a unique collection of techniques that facilitate individualized investigative search pertaining to an ever-changing set of analytical questions over an indexed collection of open-source documents related to critical national infrastructure. The Gryffin client hosts dynamic displays of the search results via focus+context record listings, temporal timelines, term-frequency views, and multiple coordinate views. Furthermore, as the analyst interacts with the display, the interactions are recorded and used to label the search records. These labeled records are then used to drive semi-supervised machine learning algorithms that re-rank the unlabeled search records such that potentially relevant records are moved to the top of the record listing. Gryffin is described in the context of the daily tasks encountered at the US Department of Homeland Security s Fusion Center, with whom we are collaborating in its development. The resulting system is capable of addressing the analysts information overload that can be directly attributed to the deluge of information that must be addressed in the search and investigative analysis of textual information.

Steed, Chad A [ORNL; Symons, Christopher T [ORNL; Senter, James K [ORNL; DeNap, Frank A [ORNL

2012-10-01T23:59:59.000Z

207

Questions? Contact Nate Patrick: Patrick.148@buckeyemail.osu.edu  

E-Print Network [OSTI]

. For Macs 1. Launch Disk Utility (Applications > Utilities). 2. Insert your blank DVD. 3. Drag and drop the .iso file you downloaded to the left pane in Disk Utility. Now both the blank disk and the .iso should be listed. 4. Select the .iso file you downloaded, and click on the Burn button. A dialogue box confirming

Howat, Ian M.

208

Can An Evolutionary Process Create English Text?  

SciTech Connect (OSTI)

Critics of the conventional theory of biological evolution have asserted that while natural processes might result in some limited diversity, nothing fundamentally new can arise from 'random' evolution. In response, biologists such as Richard Dawkins have demonstrated that a computer program can generate a specific short phrase via evolution-like iterations starting with random gibberish. While such demonstrations are intriguing, they are flawed in that they have a fixed, pre-specified future target, whereas in real biological evolution there is no fixed future target, but only a complicated 'fitness landscape'. In this study, a significantly more sophisticated evolutionary scheme is employed to produce text segments reminiscent of a Charles Dickens novel. The aggregate size of these segments is larger than the computer program and the input Dickens text, even when comparing compressed data (as a measure of information content).

Bailey, David H.

2008-10-29T23:59:59.000Z

209

TEXT KLAUS WILHELM ones are associated with hard-  

E-Print Network [OSTI]

fractures arising from serious in- jury, bone cancer and chronic condi- tions like osteoporosis. TISSUE ENGINEERING HAS YET TO MEET EXPECTATIONS Apropos osteoporosis (see box on page 53): Peter Fratzl reports with osteoporosis stand to gain just as much from artificial bone as those with serious injuries and bone cancer

210

How to search USPTO 9/2010 SEARCHING THE USPTO PATENT FULL TEXT DATABASE  

E-Print Network [OSTI]

applications (AppFT). In either database, select Quick Search. 2. Enter the first search term in "Term 1" box. Select the field to search. 3. Enter the second term, if any, in the "Term 2" box. Select the field 1. In the Quick Search "Term 1" box, enter the main class/subclass. Select the field: "Current US

Liblit, Ben

211

The Planck/LFI Radiometer Electronics Box Assembly  

E-Print Network [OSTI]

The Radiometer Electronics Box Assembly (REBA) is the control and data processing on board computer of the Low Frequency Instrument (LFI) of the Planck mission (ESA). The REBA was designed and built incorporating state of the art processors, communication interfaces and real time operating system software in order to meet the scientific performance of the LFI. We present a technical summary of the REBA, including a physical, functional, electrical, mechanical and thermal description. Aspects of the design and development, the assembly, the integration and the verification of the equipment are provided. A brief description of the LFI on board software is given including the Low-Level Software and the main functionalities and architecture of the Application Software. The compressor module, which has been developed as an independent product, later integrated in the application, is also described in this paper. Two identical engineering models EM and AVM, the engineering qualification model EQM, the flight model ...

Herreros, J M; Rebolo, R; Chulani, H; Rubino-Martin, J A; Hildebrandt, S R; Bersanelli, M; Butler, R C; Miccolis, M; Pena, A; Pereira, M; Torrero, F; Franceschet, C; Lopez, M; Alcala, C; 10.1088/1748-0221/4/12/T12008

2010-01-01T23:59:59.000Z

212

Widget:AnchorText | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 NoPublic Utilities Address: 160 East 300 South Place: SaltTroyer &AnchorText Jump to: navigation, search This

213

Solar Webinar Text Version | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarlyEnergyDepartment of Energy U.S. DepartmentCommitmentGovernmentSmartDay 7Solarthe text version of

214

1Black Box Software Testing Copyright 2003 Cem Kaner The Role of Testers in XP  

E-Print Network [OSTI]

1Black Box Software Testing Copyright © 2003 Cem Kaner The Role of Testers in XP Cem Kaner August reflect the views of the National Science Foundation (NSF). #12;2Black Box Software Testing Copyright © 2003 Cem Kaner Testing: The Traditional View · Many years ago, the software development community

215

EnergyBox: A Trace-driven Tool for Data Transmission Energy Consumption Studies  

E-Print Network [OSTI]

EnergyBox: A Trace-driven Tool for Data Transmission Energy Consumption Studies Ekhiotz Jon Vergara-awareness and propose EnergyBox, a tool that provides accurate and repeatable en- ergy consumption studies for 3G and WiFi transmissions at the user end. We recognize that the energy consumption of data transmission is highly

216

Evaluation of the Effect of Different Modified Atmosphere Packaging Box Liners on the  

E-Print Network [OSTI]

) after 45 days of cold storage. However, after 60 days of cold storage, fruit from the MAP box liners cold storage to limit water loss, delay ripening, and suppress diseases (Beaudry, 1999; Smith et al that the use of MAP box liners is recommended to improve market life of `Friar' plums up to 45 days cold

Crisosto, Carlos H.

217

Fractal characterization of fracture networks: An improved box-counting technique  

E-Print Network [OSTI]

Fractal characterization of fracture networks: An improved box-counting technique Ankur Roy,1 fracture networks as fractals and estimating their fractal dimensions (D). If this analysis yields a power and r is the box size, then the network is considered to be fractal. However, researchers are divided

Perfect, Ed

218

The F-box-containing protein UFO and AGAMOUS participate in antagonistic pathways governing  

E-Print Network [OSTI]

The F-box-containing protein UFO and AGAMOUS participate in antagonistic pathways governing early 20, 2003 The UNUSUAL FLORAL ORGANS (UFO) gene is required for multiple processes in the developing an F-box-containing protein, UFO, which interacts physically and genetically with the Skp1 homolog, ASK

Weigel, Detlef

219

Regulating the ethylene response of a plant by modulation of F-box proteins  

SciTech Connect (OSTI)

The invention relates to transgenic plants having reduced sensitivity to ethylene as a result of having a recombinant nucleic acid encoding a F-box protein, and a method of producing a transgenic plant with reduced ethylene sensitivity by transforming the plant with a nucleic acid sequence encoding a F-box protein.

Guo, Hongwei (La Jolla, CA); Ecker, Joseph R. (Carlsbad, CA)

2010-02-02T23:59:59.000Z

220

Box: Interdependent Modes of Binding in a Two-Nanometer-Long Synthetic Receptor  

E-Print Network [OSTI]

,6-dinitrotoluene, 1,2,4- trichlorobenzene, and both the 9,10- and 1,4-anthraquinone molecules. Moreover, Ex2 Box4 the different modes of binding of Ex2 Box4+ with anthracene, 9,10-anthraquinone, and 1,4-anthraquinone in order

Goddard III, William A.

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

Questions and Answers about National Environmental Policy Act...  

Energy Savers [EERE]

(DOE) State Energy Program (SEP) in the DOE Office of Energy Efficiency and Renewable Energy. sepnepafaqs.pdf More Documents & Publications Questions and Answers on the...

222

Sample Questions | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

Regionals Middle School Rules, Forms, and Resources Sample Questions National Science Bowl (NSB) NSB Home About High School Middle School Middle School Students Middle...

223

Sample Questions | U.S. DOE Office of Science (SC)  

Office of Science (SC) Website

Regionals High School Rules, Forms, and Resources Sample Questions National Science Bowl (NSB) NSB Home About High School High School Students High School Coaches High...

224

University of California Response to DOE Questions Regarding...  

Broader source: Energy.gov (indexed) [DOE]

Response to DOE Questions Regarding Price-Anderson Renewal January 30, 1998 -1- Q 1. Should the DOE Price-Anderson indemnification be continued without modification? Answer:...

225

Council on Environmental Quality - Forty Most Asked Questions...  

Open Energy Info (EERE)

navigation, search OpenEI Reference LibraryAdd to library Memorandum: Council on Environmental Quality - Forty Most Asked Questions Concerning CEQ's NEPA Regulations Abstract...

226

Electric Vehicle Deployment: Policy Questions and Impacts to...  

Energy Savers [EERE]

regarding policy questions and impacts to the electric grid from the energy demands of electric vehicles. EAC - Electric Vehicle Deployment - Impacts to the US Electric Grid -...

227

FW Response to Notice of Inquire on Questions Concerning Technology...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

esponse to Notice of Inquire on Questions Concerning Technology Transfer Tractices at DOE Laboratories. From: Malozemoff, Alex AMalozemoff@amsc.com Sent: Tuesday, January 27,...

228

Questions and Answers for the Smart Grid Investment Grant Program...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Questions and Answers for the Smart Grid Investment Grant Program: Applicability of Buy American Provision of Section 1605 of the Recovery Act to Projects Under the Smart Grid...

229

Frequently Asked Questions about the CALiPER Program  

Broader source: Energy.gov [DOE]

This page addresses many of the questions manufacturers, testing laboratories, consumers, retailers, and energy efficiency program sponsors may have about the DOE SSL Commercially Available LED...

230

Questions and Answers For PON-10-604  

E-Print Network [OSTI]

Questions and Answers For PON-10-604 Buy Down Incentives for Natural Gas and Propane Vehicles May Vehicles 2. QUESTION: Are vehicles that are retrofitted with after-market CNG and propane conversion kits-road natural gas and propane vehicles that meet all emission requirements of the Air Resources Board (ARB

231

Sulfate Aerosol Geoengineering: The Question of Justice Toby Svoboda1,*  

E-Print Network [OSTI]

Sulfate Aerosol Geoengineering: The Question of Justice Toby Svoboda1,* , Klaus Keller2 , Marlos of geoengineering as a means to address global climate change. This paper focuses on the question of whether a particular form of geoengineering, namely deploying sulfate aerosols in the stratosphere to counteract some

232

antibody test questions: Topics by E-print Network  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

antibody test questions First Page Previous Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 Next Page Last Page Topic Index 1 Common Questions Why should I...

233

Questions and Answers For PON-10-604  

E-Print Network [OSTI]

Questions and Answers For PON-10-604 Buy Down Incentives for Natural Gas and Propane Vehicles. Individuals may purchase eligible natural gas and propane vehicles from participating OEMs include heavy-duty vehicles powered by ARB-certified natural gas or propane engines. 1 #12;Questions

234

2Name ________________________________ Question 1: What is the usable area  

E-Print Network [OSTI]

the area of a satellite solar panel and estimate the total electrical power that can be generated. Students, the maximum panel area is 12,240 sq. cm, so (8100/12240)x100% = 66% of the panel is covered by solar cells shown below? Question 2: What electrical power can be generated by the panel? Question 3: If there are 8

235

ME/AE/CompE/EE 378 Mechatronics Questions: Actuators  

E-Print Network [OSTI]

frequency plots. QUESTION 5 For a permanent magnet DC motor, explain how the bandwidth changes to an inertial load through a long thin shaft as shown in the Figure below. The shaft may be modeled as a viscous angular velocity, and load angular position. Va La Ra Vb Jm,Bm m, m + - L, L + - Ia JL,BL shaft QUESTION 2

Landers, Robert G.

236

Regulating the ethylene response of a plant by modulation of F-box proteins  

DOE Patents [OSTI]

The relationship between F-box proteins and proteins invovled in the ethylene response in plants is described. In particular, F-box proteins may bind to proteins involved in the ethylene response and target them for degradation by the ubiquitin/proteasome pathway. The transcription factor EIN3 is a key transcription factor mediating ethylne-regulated gene expression and morphological responses. EIN3 is degraded through a ubiquitin/proteasome pathway mediated by F-box proteins EBF1 and EBF2. The link between F-box proteins and the ethylene response is a key step in modulating or regulating the response of a plant to ethylene. Described herein are transgenic plants having an altered sensitivity to ethylene, and methods for making transgenic plant haing an althered sensitivity to ethylene by modulating the level of activity of F-box proteins. Methods of altering the ethylene response in a plant by modulating the activity or expression of an F-box protein are described. Also described are methods of identifying compounds that modulate the ethylene response in plants by modulating the level of F-box protein expression or activity.

Guo, Hongwei [Beijing, CN; Ecker, Joseph R [Carlsbad, CA

2014-01-07T23:59:59.000Z

237

Transuranic and Low-Level Boxed Waste Form Nondestructive Assay Technology Overview and Assessment  

SciTech Connect (OSTI)

The Mixed Waste Focus Area (MWFA) identified the need to perform an assessment of the functionality and performance of existing nondestructive assay (NDA) techniques relative to the low-level and transuranic waste inventory packaged in large-volume box-type containers. The primary objectives of this assessment were to: (1) determine the capability of existing boxed waste form NDA technology to comply with applicable waste radiological characterization requirements, (2) determine deficiencies associated with existing boxed waste assay technology implementation strategies, and (3) recommend a path forward for future technology development activities, if required. Based on this assessment, it is recommended that a boxed waste NDA development and demonstration project that expands the existing boxed waste NDA capability to accommodate the indicated deficiency set be implemented. To ensure that technology will be commercially available in a timely fashion, it is recommended this development and demonstration project be directed to the private sector. It is further recommended that the box NDA technology be of an innovative design incorporating sufficient NDA modalities, e.g., passive neutron, gamma, etc., to address the majority of the boxed waste inventory. The overall design should be modular such that subsets of the overall NDA system can be combined in optimal configurations tailored to differing waste types.

G. Becker; M. Connolly; M. McIlwain

1999-02-01T23:59:59.000Z

238

Winning strategies for pseudo-telepathy games using single non-local box  

E-Print Network [OSTI]

Using a single NL-box, a winning strategy is given for the impossible colouring pseudo-telepathy game for the set of vectors having Kochen-Specker property in four dimension. A sufficient condition to have a winning strategy for the impossible colouring pseudo-telepathy game for general $d$-dimension, with single use of NL-box, is then described. It is also shown that the magic square pseudo-telepathy game of any size can be won by using just two ebits of entanglement -- for quantum strategy, and by a single NL-box -- for non-local strategy.

Samir Kunkri; Guruprasad Kar; Sibasish Ghosh; Anirban Roy

2006-02-20T23:59:59.000Z

239

Regulating the ethylene response of a plant by modulation of F-box proteins  

SciTech Connect (OSTI)

The invention relates to transgenic plants having reduced sensitivity to ethylene as a result of having a recombinant nucleic acid encoding an F-box protein that interacts with a EIN3 involved in an ethylene response of plants, and a method of producing a transgenic plant with reduced ethylene sensitivity by transforming the plant with a nucleic acid sequence encoding an F-box protein. The inventions also relates to methods of altering the ethylene response in a plant by modulating the activity or expression of an F-box protein.

Guo, Hongwei (Beijing, CN); Ecker, Joseph R. (Carlsbad, CA)

2011-03-08T23:59:59.000Z

240

Proposed Junction-Box Stress Test (Using an Added Weight) for Use During the Module Qualification (Presentation)  

SciTech Connect (OSTI)

Engineering robust adhesion of the junction-box (j-box) is a hurdle typically encountered by photovoltaic (PV) module manufacturers during product development. Furthermore, there are historical incidences of adverse effects (e.g., fires) caused when the j-box/adhesive/module system has failed in the field. The addition of a weight to the j-box during the 'damp heat' IEC qualification test is proposed to verify the basic robustness of the j-box adhesion system. The details of the proposed test are described, in addition to the preliminary results conducted using representative materials and components.

Miller, D. C.; Wohlgemuth, J. H.; Kurtz, S. R.

2012-02-01T23:59:59.000Z

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

DOE Challenge Home Comprehensive Building Science Webinar (Text...  

Broader source: Energy.gov (indexed) [DOE]

Comprehensive Building Science Webinar (Text Version) DOE Challenge Home Comprehensive Building Science Webinar (Text Version) Below is the text version of the webinar, DOE Zero...

242

Wind Vision Testimonials (Text Version) | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Wind Vision Testimonials (Text Version) Wind Vision Testimonials (Text Version) Below is the text version for the Wind Vision Testimonials video. The video opens with the "Wind...

243

Electricity Grid Basics Webinar Presentation Slides and Text...  

Broader source: Energy.gov (indexed) [DOE]

Electricity Grid Basics Webinar Presentation Slides and Text Version Electricity Grid Basics Webinar Presentation Slides and Text Version Download presentation slides and a text...

244

Design and manufacture of the 2003 2.007 wireless control boxes  

E-Print Network [OSTI]

A new smaller, lighter, and more durable wireless control box was designed and built for use in the 2.007 Design Contest. The new units can also be commanded by an external controller via a standard serial interface.

Varady, Eric, 1980-

2003-01-01T23:59:59.000Z

245

Development and analysis of a simple grey-box model of central sleep apnea  

E-Print Network [OSTI]

In this thesis, we develop and analyze a simple grey-box model that describes the pathophysiology of central sleep apnea (CSA). We construct our model following a thorough survey of published approaches. Special attention ...

Kazerani, Ali

2013-01-01T23:59:59.000Z

246

BOX: Browsing Objects in XML Christian Nentwich, Wolfgang Emmerich, Anthony Finkelstein and Andrea Zisman  

E-Print Network [OSTI]

BOX: Browsing Objects in XML Christian Nentwich, Wolfgang Emmerich, Anthony Finkelstein and Andrea|W.Emmerich|A.Finkelstein|A.Zismang@cs.ucl.ac.uk Abstract The latest Internet markup languages

Finkelstein, Anthony

247

E-Voting and Forensics: Prying Open the Black Box Matt Bishop and Sean Peisert  

E-Print Network [OSTI]

E-Voting and Forensics: Prying Open the Black Box Matt Bishop and Sean Peisert Department of Computer Science University of California, Davis {bishop, peisert}@cs.ucdavis.edu Candice Hoke Cleveland

Bishop, Matt

248

EVoting and Forensics: Prying Open the Black Box Matt Bishop and Sean Peisert  

E-Print Network [OSTI]

E­Voting and Forensics: Prying Open the Black Box Matt Bishop and Sean Peisert Department of Computer Science University of California, Davis {bishop, peisert}@cs.ucdavis.edu Candice Hoke Cleveland

Bishop, Matt

249

Carlsbad Field Orfice P. O. Box 3090 Carlsbad, New Mexico 88221  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Orfice P. O. Box 3090 Carlsbad, New Mexico 88221 APR 2 4 2 012 Mr. John Kieling , Acting Bureau Chief Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive...

250

The Energy Box : comparing locally automated control strategies of residential electricity consumption under uncertainty  

E-Print Network [OSTI]

The Energy Box is an always-on background processor automating the temporal management of one's home or small business electrical energy usage. Cost savings are achieved in a variety of environments, ranging from at pricing ...

Livengood, Daniel James

2011-01-01T23:59:59.000Z

251

E-Print Network 3.0 - air box model Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

gas-phase photochemistry and with plume... on the rate and on the mass of ambient air entrainment into the plume are studied also by com- paring the box... ). These...

252

Application of the vortex-box method to the unsteady incompressible flow over finite wings  

E-Print Network [OSTI]

APPLICATION OP THE VORTEX-BOX MRTHOD TO THE UNSTEADT INCOMPRESSIBLE FLOW OVER FINITE WINGS A Thesis by CHARLES UPTON SONCRANT Submitted to the Graduate College of Texas AAM University in partial fulfillment of the requirement for the degree... of MASTER OF SCIENCE May 1973 Major Subject: Aerospace Engineering APPLICATION OF THE VORTEX-BOX METHOD TO THE UNSTEADY INCOMPRESSIBLE FLOW OVER FINITE WINGS A Thesis by CHARLES UPTON SONCRANT Approved as to style and content by: (Chairman...

Soncrant, Charles Upton

2012-06-07T23:59:59.000Z

253

LBNL/ PUB 3000 Chapter 8 Questions on Electrical Cords 2010 Questions have been asked about electrical safety that includes extension cords,  

E-Print Network [OSTI]

LBNL/ PUB 3000 Chapter 8 ­ Questions on Electrical Cords 2010 Questions have been asked about at the Laboratory. #12;LBNL/ PUB 3000 Chapter 8 ­ Questions on Electrical Cords 2010 Avoiding Misuse of Extension

Knowles, David William

254

Aspects of spatial thinking in geography textbook questions  

E-Print Network [OSTI]

This study examined questions embedded in four high school world geography textbooks to evaluate the degree to which the three components of spatial thinking were incorporated: concepts of space, tools of representation, and processes of reasoning...

Jo, Injeong

2009-05-15T23:59:59.000Z

255

Postgraduate Diploma in Social Work/MSW Frequently Asked Questions  

E-Print Network [OSTI]

Postgraduate Diploma in Social Work/MSW Frequently Asked Questions Educational Qualifications Q 1 I months full-time equivalent relevant experience always required of applicants to the MSW at the point

Mottram, Nigel

256

Microsoft Word - Frequently_Asked_Questions_7_20_2011  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

3 Question: I was certified before the electronic profile in the Employee Self Service (ESS) System was implemented. When coming forward for a higher level of certification, do I...

257

Microsoft Word - Response to DOEs Questions.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Goodyear Tire & Rubber Company Response to DOE's Questions Technology Transfer Practices at DOE Laboratories March 24, 2009 Submitted to GC-62@hq.doe.gov Office of the Assistant...

258

Questions concerning Technology Transfer Practices at DOE Labs...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

concerning Technology Transfer Practices at DOE Labs.txt From: Gary S. Selwyn gary.selwyn@apjet.com Sent: Tuesday, February 10, 2009 7:00 PM To: GC-62 Subject: Questions...

259

Questions and answers based on revised 10 CFR Part 20  

SciTech Connect (OSTI)

NUREG/CR-6204 is a collection of questions and answers that were originally issued in seven sets and which pertain to revised 10 CFR Part 20. The questions came from both outside and within the NRC. The answers were compiled and provided by NRC staff within the offices of Nuclear Reactor Regulation, Nuclear Material Safety and Safeguards, Nuclear Regulatory Research, the Office of State Programs, and the five regional offices. Although all of the questions and answers have been reviewed by attorneys in the NRC Office of the General Counsel, they do not constitute official legal interpretations relevant to revised 10 CFR Part 20. The questions and answers do, however, reflect NRC staff decisions and technical options on aspects of the revised 10 CFR Part 20 regulatory requirements. This NUREG is being made available to encourage communication among the public, industry, and NRC staff concerning the major revisions of the NRC`s standards for protection against radiation.

Borges, T.; Stafford, R.S.; Lu, P.Y. [Oak Ridge National Lab., TN (United States); Carter, D. [Nuclear Regulatory Commission, Washington, DC (United States)

1994-05-01T23:59:59.000Z

260

The Export Question: Designing Policy for British Columbia Electricity Trade  

E-Print Network [OSTI]

The Export Question: Designing Policy for British Columbia Electricity Trade Dr. George Hoberg..........................................................................................................................................5 2 BC's Electricity Trade Picture: Context and Trends........................................................................6 2.1 How electricity trading works

Pedersen, Tom

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

Question of the Week: Do Energy-Related Financial Incentives...  

Broader source: Energy.gov (indexed) [DOE]

Do Energy-Related Financial Incentives Prompt You to Be More Energy Efficient? Question of the Week: Do Energy-Related Financial Incentives Prompt You to Be More Energy Efficient?...

262

Question of the Week: How Does Your Community Encourage Energy...  

Broader source: Energy.gov (indexed) [DOE]

sumer.webmaster@nrel.gov. Addthis Related Articles Question of the Week: How Will You Landscape for Energy Efficiency? What Steps Do You Take to Improve Your Fuel Economy? How Are...

263

Examination of a Junction-Box Adhesion Test for Use in Photovoltaic Module Qualification (Presentation)  

SciTech Connect (OSTI)

Engineering robust adhesion of the junction-box (j-box) is a hurdle typically encountered by photovoltaic (PV) module manufacturers during product development. There are historical incidences of adverse effects (e.g., fires) caused when the j-box/adhesive/module system has failed in the field. The addition of a weight to the j-box during the 'damp heat' IEC qualification test is proposed to verify the basic robustness of its adhesion system. The details of the proposed test will be described, in addition to the preliminary results obtained using representative materials and components. The described discovery experiments examine moisture-cured silicone, foam tape, and hot-melt adhesives used in conjunction with PET or glass module 'substrates.' To be able to interpret the results, a set of material-level characterizations was performed, including thermogravimetric analysis, differential scanning calorimetry, and dynamic mechanical analysis. PV j-boxes were adhered to a substrate, loaded with a prescribed weight, and then placed inside an environmental chamber (at 85C, 85% relative humidity). Some systems did not remain attached through the discovery experiments. Observed failure modes include delamination (at the j-box/adhesive or adhesive/substrate interface) and phase change/creep. The results are discussed in the context of the application requirements, in addition to the plan for the formal experiment supporting the proposed modification to the qualification test.

Miller, D. C.; Wohlgemuth, J. H.

2012-08-01T23:59:59.000Z

264

Examination of a Junction-Box Adhesion Test for Use in Photovoltaic Module Qualification: Preprint  

SciTech Connect (OSTI)

Engineering robust adhesion of the junction-box (j-box) is a hurdle typically encountered by photovoltaic (PV) module manufacturers during product development. There are historical incidences of adverse effects (e.g., fires) caused when the j-box/adhesive/module system has failed in the field. The addition of a weight to the j-box during the 'damp heat' IEC qualification test is proposed to verify the basic robustness of its adhesion system. The details of the proposed test will be described, in addition to the preliminary results obtained using representative materials and components. The described discovery experiments examine moisture-cured silicone, foam tape, and hot-melt adhesives used in conjunction with PET or glass module 'substrates.' To be able to interpret the results, a set of material-level characterizations was performed, including thermogravimetric analysis, differential scanning calorimetry, and dynamic mechanical analysis. PV j-boxes were adhered to a substrate, loaded with a prescribed weight, and then placed inside an environmental chamber (at 85C, 85% relative humidity). Some systems did not remain attached through the discovery experiments. Observed failure modes include delamination (at the j-box/adhesive or adhesive/substrate interface) and phase change/creep. The results are discussed in the context of the application requirements, in addition to the plan for the formal experiment supporting the proposed modification to the qualification test.

Miller, D. C.; Wohlgemuth, J. H.

2012-08-01T23:59:59.000Z

265

MDF Form and Function (Text Version) | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

out. And I would invite the people on the Web to submit their questions as we go along. Kelly.... KELLY VISCONTI: Good morning, I think we're still in the morning time. Leo talked...

266

Quality Assurance for Residential Retrofit Programs (Text Version...  

Broader source: Energy.gov (indexed) [DOE]

with the contractor. So the next question is what's your opinion of the Home Performance Resource Center from Efficiency First. And I have to say I think highly of Efficiency...

267

Berkeley Lab Answers Your Home Energy Efficiency Questions  

ScienceCinema (OSTI)

In this follow-up "Ask Berkeley Lab" video, energy efficiency expert Iain Walker answers some of your questions about home energy efficiency. How do you monitor which appliances use the most energy? Should you replace your old windows? Are photovoltaic systems worth the cost? What to do about a leaky house? And what's the single biggest energy user in your home? Watch the video to get the answers to these and more questions.

Walker, Iain

2013-11-14T23:59:59.000Z

268

Berkeley Lab Answers Your Home Energy Efficiency Questions  

SciTech Connect (OSTI)

In this follow-up "Ask Berkeley Lab" video, energy efficiency expert Iain Walker answers some of your questions about home energy efficiency. How do you monitor which appliances use the most energy? Should you replace your old windows? Are photovoltaic systems worth the cost? What to do about a leaky house? And what's the single biggest energy user in your home? Watch the video to get the answers to these and more questions.

Walker, Iain

2013-02-14T23:59:59.000Z

269

Edgar_Answers to student questions 414.pdf Student questions: Lauren Edgar colloquium on "Martian Sedimentology as Revealed by the  

E-Print Network [OSTI]

Sedimentology as Revealed by the Curiosity Rover" 3/26/14 Question 1: How are the studies that you've done of the same kinds of instruments to investigate the sedimentology and stratigraphy at each landing site

Rhoads, James

270

Energy 101: Home Energy Checkup (Text Version) | Department of...  

Energy Savers [EERE]

Energy 101: Home Energy Checkup (Text Version) Energy 101: Home Energy Checkup (Text Version) April 2, 2012 - 5:25pm Addthis Energy 101: Home Energy Checkup (Text Version) Below is...

271

Gas Storage Potential of Li-decorated ExBox4+  

E-Print Network [OSTI]

The newly developed compound ExBox4+ is explored to check whether it is a proficient hydrogen storage material. Both exoherdal and endohedral hydrogen adsorption on ExBox4+ are studied. Endohedral hydrogen molecules interact strongly than exohedral ones. The hydrogen adsorption energy is as good as the recently studied charged fullerenes. The hydrogen storage capacity appears to be ~4.3 wt%. The endohedral CO sorption is also analysed with the help of DFT. The first principle DFT calculation and MD simulation are performed to investigate the effect of lithium doping on the gas adsorbing capacity and adsorption enthalpy as well as adsorption energy of ExBox4+.The metal atom interaction with ExBox4+is found to be pretty strong, and the interaction energy appears to be higher than the metal cohesive energy.The thermodynamic parameters suggest that metal doping method is spontaneous in nature. The analysis of adsorption energy, thermodynamic properties and MD simulation results suggest that Li doped ExBox4+ can b...

Das, Ranjita

2014-01-01T23:59:59.000Z

272

New Insights for Improving the Designs of Flexible Duct Junction Boxes (Fact Sheet)  

SciTech Connect (OSTI)

IBACOS explored the relationships between pressure and physical configurations of flexible duct junction boxes by using computational fluid dynamics (CFD) simulations to predict individual box parameters and total system pressure, thereby ensuring improved HVAC performance. Current Air Conditioning Contractors of America (ACCA) guidance (Group 11, Appendix 3, ACCA Manual D, Rutkowski 2009) allows for unconstrained variation in the number of takeoffs, box sizes, and takeoff locations. The only variables currently used in selecting an equivalent length (EL) are velocity of air in the duct and friction rate, given the first takeoff is located at least twice its diameter away from the inlet. This condition does not account for other factors impacting pressure loss across these types of fittings. For each simulation, the IBACOS team converted pressure loss within a box to an EL to compare variation in ACCA Manual D guidance to the simulated variation. IBACOS chose cases to represent flows reasonably correlating to flows typically encountered in the field and analyzed differences in total pressure due to increases in number and location of takeoffs, box dimensions, and velocity of air, and whether an entrance fitting is included. The team also calculated additional balancing losses for all cases due to discrepancies between intended outlet flows and natural flow splits created by the fitting. In certain asymmetrical cases, the balancing losses were significantly higher than symmetrical cases where the natural splits were close to the targets. Thus, IBACOS has shown additional design constraints that can ensure better system performance.

Not Available

2014-01-01T23:59:59.000Z

273

Trial Run of a Junction-Box Attachment Test for Use in Photovoltaic Module Qualification (Presentation)  

SciTech Connect (OSTI)

Engineering robust adhesion of the junction-box (j-box) is a hurdle typically encountered by photovoltaic (PV) module manufacturers during product development and manufacturing process control. There are historical incidences of adverse effects (e.g., fires), caused when the j-box/adhesive/module system has failed in the field. The addition of a weight to the j-box during the 'damp-heat', 'thermal-cycle', or 'creep' tests within the IEC qualification protocol is proposed to verify the basic robustness of the adhesion system. The details of the proposed test are described, in addition to a trial run of the test procedure. The described experiments examine 4 moisture-cured silicones, 4 foam tapes, and a hot-melt adhesive used in conjunction with glass, KPE, THV, and TPE substrates. For the purpose of validating the experiment, j-boxes were adhered to a substrate, loaded with a prescribed weight, and then subjected to aging. The replicate mock-modules were aged in an environmental chamber (at 85 deg C/85% relative humidity for 1000 hours; then 100 degrees C/<10% relative humidity for 200 hours) or fielded in Golden, Miami, and Phoenix for 1 year. Attachment strength tests, including pluck and shear test geometries, were also performed on smaller component specimens.

Miller, D.; Deibert, S.; Wohlgemuth, J.

2014-06-01T23:59:59.000Z

274

Building 400B P.O. Box 5000  

E-Print Network [OSTI]

Care Reform), the text that follows is information on "New Health Insurance Marketplace Coverage years, you likely have been hearing about National Health Care Reform and health insurance coverage subject: Affordable Care Act As required by the Affordable Care Act - ACA (also known as National Health

275

Energy Code Compliance and Enforcement Best Practices (Text Version...  

Broader source: Energy.gov (indexed) [DOE]

Energy Code Compliance and Enforcement Best Practices (Text Version) Energy Code Compliance and Enforcement Best Practices (Text Version) Curtis Framel: Good afternoon, and good...

276

Energy Saving Performance Contracting (ESPC) Basics (Text Version...  

Broader source: Energy.gov (indexed) [DOE]

Saving Performance Contracting (ESPC) Basics (Text Version) Energy Saving Performance Contracting (ESPC) Basics (Text Version) Chani Vines: Hello. We'll be starting in five...

277

Application of black-box models to HVAC systems for fault detection  

SciTech Connect (OSTI)

This paper describes the application of black-box models for fault detection and diagnosis (FDD) in heating, ventilating, and air-conditioning (HVAC) systems. In this study, multiple-input/single-output (MISO) ARX models and artificial neural network (ANN) models are used. The ARX models are examined for different processes and subprocesses and compared with each other. Two types of models are established--system models and component models. In the case of system models, the HVAC system as a whole is regarded as a black box instead of as a collection of component models. With the component model type, the components of the HVAC system are regarded as separate black boxes.

Peitsman, H.C. [TNO Building and Construction Research, Delft (Netherlands). Dept. of Indoor Environment, Building Physics and Systems; Bakker, V.E. [Univ. of Twente, Enschede (Netherlands). Dept. of Computer Science

1996-11-01T23:59:59.000Z

278

November 21, 2000 PV Lesson Plan 2 Sample Questions & Answers  

E-Print Network [OSTI]

November 21, 2000 PV Lesson Plan 2 ­ Sample Questions & Answers Prepared for the Oregon Million Solar Roofs Coalition By Frank Vignola ­ University of Oregon Solar Radiation Monitoring Lab John Hocken your understanding: 1. The typical voltage of a silicon solar cell is about 0.5 volts; where does

Oregon, University of

279

Usability testing: some current practices and research questions  

E-Print Network [OSTI]

applications. Keywords User centered design, user testing, usability testing, empirical user test, users for which the system was design), and favors positive attitudes and responses from the intended users [131 Usability testing: some current practices and research questions J.M. Christian Bastien

Paris-Sud XI, Université de

280

Implementation Guide for Use in Addressing Unreviewed Safety Question Requirements  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

This Guide provides information to assist in the implementation and interpretation of Title 10 Code of Federal Regulations (CFR) Part 830.203, Unreviewed Safety Question Process, of the Nuclear Safety Management Rules for applicable nuclear facilities owned or operated by the Department of Energy (DOE), including the National Nuclear Security Administration (NNSA). Canceled by DOE N 251.93.

2001-10-24T23:59:59.000Z

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

Implementation Guide for Use in Addressing Unreviewed Safety Question Requirements  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

This Guide provides information to assist in implementation of Title 10 Code of Federal Regulations Part 830.203, "Unreviewed Safety Question Process," of the Nuclear Safety Management Rules for Category 1, 2, and 3 nuclear facilities owned or operated by the Department of Energy, including the National Nuclear Security Administration. Cancels DOE G 424.1-1.

2006-07-24T23:59:59.000Z

282

Questions I will answer What is a solar cell?  

E-Print Network [OSTI]

grid 4 #12;5 #12;Solar panels on the Interna9onal Space Sta9on 6 #12;Area#12;Questions I will answer · What is a solar cell? · How are solar cells are solar cells made? · How do they work? · How efficient can they be? · How

McGehee, Michael

283

Impact of Syrian Refugees on Jordan's Water Management Research Questions  

E-Print Network [OSTI]

: -Water management in Jordan -Environmental impact assessments of refugee camps -Water resourceImpact of Syrian Refugees on Jordan's Water Management Research Questions: What impact has the influx of 590,000 refugees had on water resources? How can Jordan improve refugee and water management

284

Questions and Issues on Hydrogen Pipeline Transmission of Hydrogen  

E-Print Network [OSTI]

Questions and Issues on Hydrogen Pipelines Pipeline Transmission of Hydrogen Doe Hydrogen Pipeline Working Group Meeting August 31, 2005 #12;Pipeline Transmission of Hydrogen --- 2 Copyright: Air Liquide Transmission of Hydrogen --- 3 Copyright: #12;Pipeline Transmission of Hydrogen --- 4 Copyright: 3. Special

285

Existing Analyses Our Proposal: A Typology of Questions  

E-Print Network [OSTI]

and Ramifications References Sorting Out the Implications of Questions Aviad Eilam and Catherine Lai University of Pennsylvania CONSOLE XVIII, December 17-19, 2009 Aviad Eilam and Catherine Lai Sorting Out the Implications Intervention Effects 4 Remaining Issues and Ramifications Aviad Eilam and Catherine Lai Sorting Out

Pennsylvania, University of

286

Responses to Questions and Answers Advanced Vehicle Technology Manufacturing Solicitation  

E-Print Network [OSTI]

1 Responses to Questions and Answers Advanced Vehicle Technology Manufacturing Solicitation PON successful applicants after the Notice of Proposed Awards to confirm this role and obtain any additional definition of "manufacturing equipment?" For example, would purchases of tooling or assembly line equipment

287

Questioning Inevitability of Energy Pathways: Alternative Energy Scenarios for California  

E-Print Network [OSTI]

Questioning Inevitability of Energy Pathways: Alternative Energy Scenarios for California May 21.6.4 Alternative Scenario 3 ­ Patriotic Energy Independence Section 3: Developing the Scenario Model and Examining, 2002 by Rebecca Ghanadan rebeccag@socrates.berkeley.edu The Energy and Resources Group University

Kammen, Daniel M.

288

Event Logistics Checklist and Contacts Questions to consider  

E-Print Network [OSTI]

will my space need to include? 4. How many people will be attending? a. For every 250 people, one security/Chairs/Tents Questions to Consider: 1. Will people be sitting at your event? 2. How many people are attending? 3. Do you people, an EMT is expected. GTPD can provide contacts for EMTs. Relevant Contacts: 1. Beverly Peace

Sherrill, David

289

Questions and Answers About Drainage Water Management for the Midwest  

E-Print Network [OSTI]

WQ-44 Questions and Answers About Drainage Water Management for the Midwest Jane Frankenberger Nelson, Larry Brown Drainage Water Management Introduction Subsurface tile drainage is an essential water, and modifying drainage system design and operation. Drainage water management is one of these practices

Holland, Jeffrey

290

State DOT: Colorado State Report Questions on MEPDG Implementation  

E-Print Network [OSTI]

State DOT: Colorado State Report Questions on MEPDG Implementation 1. Summarize your state's status as far as MEPDG Implementation. Currently, CDOT is in the process of validating the MEPDG in Colorado and calibrating it to Colorado performance data. 2. What efforts have been made toward local calibration? CDOT has

291

State DOT: PENNSYLVANIA State Report Questions on NDT Testing  

E-Print Network [OSTI]

capacity surveys, management of load restrictions, fatigue tests and compaction control. On concreteState DOT: PENNSYLVANIA State Report Questions on NDT Testing 1. What NDT testing methods for concrete materials, concrete pavements, and overlays are you trying? PennDOT performs Falling Weight

292

Alabama DOT: Alabama Report Questions on NDT Testing  

E-Print Network [OSTI]

Alabama DOT: Alabama Report Questions on NDT Testing 1. What NDT testing methods for concrete materials, concrete pavements, and overlays are you trying? · We perform pavement smoothness testing, pavement friction testing and FWD testing · We are currently using GPR on the I-59 project to locate voids

293

State DOT: Missouri State Report Questions on NDT Testing  

E-Print Network [OSTI]

State DOT: Missouri State Report Questions on NDT Testing 1. What NDT testing methods for concrete maturity meter MoDOT has utilized the rebound hammer to evaluate in-place concrete when cylinder testing materials, concrete pavements, and overlays are you trying? a) Maturity Method b) Rebound Hammer c) Cover

294

State DOT: California State Report Questions on NDT Testing  

E-Print Network [OSTI]

test for this purpose. For concrete pavement, California has used falling weight deflectometer (FWD locations within concrete pavement. 2. In your experience, how does the reliability of NDT testing methodsState DOT: California State Report Questions on NDT Testing 1. What NDT testing methods

295

State DOT: Louisiana State Report Questions on NDT Testing  

E-Print Network [OSTI]

State DOT: Louisiana State Report Questions on NDT Testing 1. What NDT testing methods for concrete materials, concrete pavements, and overlays are you trying? LADOTD does not test concrete pavements or overlays non-destructively. We do use the surface resistivity meter for non-destructive testing

296

Boosting Chinese Question Answering with Two Lightweight Methods  

E-Print Network [OSTI]

Question Answering (QA) research has been conducted in many languages. Nearly all the top performing-limited situations. In this article, we describe how a top- performing Chinese QA system can be designed by using, Academia Sinica, and the thematic program of Academia Sinica under Grant No. AS 95ASIA02. We wish to thank

Chu, Hao-hua

297

Text-Alternative Version: LED Essentials- Technology, Applications, Advantages, Disadvantages  

Broader source: Energy.gov [DOE]

Below is the text-alternative version of the LED Essentials - Technology, Applications, Advantages, Disadvantages webcast.

298

Visual Text Features for Image Matching Sam S. Tsai1  

E-Print Network [OSTI]

Visual Text Features for Image Matching Sam S. Tsai1 , Huizhong Chen1 , David Chen1 , Vasu features that are based on text in cameraphone images. A robust text detection algorithm locates individual the visual text features in a way that resembles image features. We calculate their location, scale

Girod, Bernd

299

Enriched Protein-Protein Interactions from Biomedical Text  

E-Print Network [OSTI]

Enriched Protein-Protein Interactions from Biomedical Text Barry Haddow, Michael Matthews from Biomedical Text #12;Overview The TXM Project Protein-Protein Interactions Enriched Protein Protein-Protein Interactions from Biomedical Text #12;Project Information Text Mining Programme funded (3

Edinburgh, University of

300

Tracking Factual Information in Evolving Text: An Empirical Study  

E-Print Network [OSTI]

, Dragomir Radev1,2 , and Yang Ye3 1 School of Information 2 Department of Electrical Engineering stories about emergency events. While previous approaches have focused on finding new information" system, that when given a user's factual question of interest, returns a matrix displaying the extracted

Radev, Dragomir R.

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

Tracking Factual Information in Evolving Text: An Empirical Study  

E-Print Network [OSTI]

Engineering and Computer Science 2 Department of Linguistics University of Michigan Ann Arbor, MI 48109 {jahna stories about emergency events. While previous approaches have focused on finding new information'' system, that when given a user's factual question of interest, returns a matrix displaying the extracted

Radev, Dragomir R.

302

Widget:ExpandableBoxStart | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 NoPublic Utilities Address: 160 East 300 South Place: SaltTroyer &AnchorText JumpDisplayForGroupDocumentURL

303

E-Print Network 3.0 - asked questions faqs Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

directly... Frequently Asked Questions Frequently Asked Question 1.3 What is the Greenhouse Effect? The ... Source: National Oceanic and Atmospheric Administration, Pacific Marine...

304

E-Print Network 3.0 - architecture unanswered questions Sample...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

architecture unanswered questions Search Powered by Explorit Topic List Advanced Search Sample search results for: architecture unanswered questions Page: << < 1 2 3 4 5 > >> 1...

305

Blackboard Learning Services V-F1 Page 1 Blackboard Inc. Digital Drop Box vs. Assignment Manager Tip Sheet  

E-Print Network [OSTI]

Blackboard Learning Services V-F1 Page 1 Blackboard Inc. Digital Drop Box vs. Assignment Manager Tip Sheet Blackboard Best Practices: Digital Drop Box vs. Assignment Manager A Blackboard Learning causes confusion for students and instructors alike. Adding a File When a user elects to Add File

306

ATOC/CHEM 5151 Fall 2014 The San Joaquin Valley, acid rain, and a simple "box" model  

E-Print Network [OSTI]

ATOC/CHEM 5151 ­ Fall 2014 Problem 26 The San Joaquin Valley, acid rain, and a simple "box" model. In this problem, use a simple box model to estimate the formation of so-called "acid fogs" in this valley. Assume the steady-state SO2 concentration (in units of molecules cm-3 ). (2) Sulfuric acid is produced from

Toohey, Darin W.

307

Low-Power Side-Channel Attack-Resistant Asynchronous S-Box Design for AES Cryptosystems  

E-Print Network [OSTI]

function with an invertible affine transformation in order to avoid attacks based on mathematics. A block combinational S-Box (substitution box) design for AES (Advanced Encryption Standard) cryptosystems is proposed less in- formation against side-channel attacks such as differential power/noise analysis. Functional

Ayers, Joseph

308

National Residential Efficiency Measures Database Unveiled (text version)  

Broader source: Energy.gov [DOE]

Below is the text version of the Webinar titled "National Residential Efficiency Measures Database Unveiled," originally presented on January 18, 2011. In addition to this text version of the audio...

309

CREF: An Editing Facility for Managing Structured Text  

E-Print Network [OSTI]

This paper reports work in progress on an experimental text editor called CREF, the Cross Referenced Editing Facility. CREF deals with chunks of text, called segments, which may have associated features such as keywords ...

Pitman, Kent M.

1985-02-01T23:59:59.000Z

310

Advanced Text Searching of Electronic Information Related to Forensic Discovery  

E-Print Network [OSTI]

and electronic Boolean text searches. Text searching technology has been studied for over fifty years generating literally thousands of documents and books for a literature review. The focus of the literature includes accuracy of searching, optimization...

Haenchen, Steven L.

2009-12-07T23:59:59.000Z

311

On the Representation of Physical Quantities in Natural Language Text  

E-Print Network [OSTI]

On the Representation of Physical Quantities in Natural Language Text Sven E. Kuehne (skuehne processes from natural language text. In an earlier analysis (Kuehne & Forbus, 2002) we presented a scheme

Forbus, Kenneth D.

312

DOE Challenge Home Better Business for Builders Webinar (Text Version)  

Broader source: Energy.gov [DOE]

Below is a text version of the webinar titled "DOE Challenge Home: Better Business for Builders," originally presented in May 2012. In addition to this text version of the audio, you can access the...

313

Further Decline in nest-box use by Vaux's Swifts in Northeastern Oregon  

E-Print Network [OSTI]

... ebull@fs.fed.us Charles T. Collins, Department of Biological Sciences, California State University, Long Beach, California ... during the longer 1999–2002 study period. During that time, the percentage of the 58 swift nests that fledged young was 63% in boxes ...

314

Greenland Ice Sheet Surface Air Temperature Variability: 18402007* JASON E. BOX  

E-Print Network [OSTI]

Greenland Ice Sheet Surface Air Temperature Variability: 1840­2007* JASON E. BOX Byrd Polar, seasonal, and annual mean Greenland ice sheet near- surface air temperatures. Independent observations Greenland in autumn and southern Greenland in winter. Spring trends marked the 1920s warming onset, while

Howat, Ian M.

315

Upper-air temperatures around Greenland: 19642005 Jason E. Box1,2  

E-Print Network [OSTI]

Upper-air temperatures around Greenland: 1964­2005 Jason E. Box1,2 and Ariel E. Cohen2 Received 15 of 12h balloon soundings from six sites surrounding Greenland reveal distinct patterns of tropospheric-air temperatures around Greenland: 1964­ 2005, Geophys. Res. Lett., 33, L12706, doi:10.1029/ 2006GL025723. 1

Howat, Ian M.

316

TECHNICALPAPER Society of Manufacturing Engineers One SME Drive P.O. Box 930  

E-Print Network [OSTI]

TECHNICALPAPER 2005 Society of Manufacturing Engineers One SME Drive P.O. Box 930 Dearborn, MI 48121 Phone (313) 271-1500 www.sme.org TP05PUB25 Segmentation of Colour Images Using Variational Training Color Image Segmentation Bayesian Interference Maximum Log Likelihood Gaussian Mixtures #12;SME

Bors, Adrian

317

Air and water flows in a large sand box with a two-layer aquifer system  

E-Print Network [OSTI]

Air and water flows in a large sand box with a two-layer aquifer system Xingxing Kuang & Jiu Jimmy negative air pressure can be generated in the vadose zone during pumping. The negative air pressure. The initial water-table depth has a significant effect on the generated negative air pressure. The shallower

Jiao, Jiu Jimmy

318

INTERNATIONAL ATOMIC ENERGY AGENCY Wagramer Strasse 5, P.O. Box 100  

E-Print Network [OSTI]

INTERNATIONAL ATOMIC ENERGY AGENCY Wagramer Strasse 5, P.O. Box 100 A-1400 Vienna, Austria www always driven human development. New technologies in energy production, starting from the use of fire for an abundant source of that energy for the world. To promote this groundbreaking technology, and to host

319

Uranium Watch 76 South Main Street, # 7 | P.O. Box 344  

E-Print Network [OSTI]

Uranium Watch 76 South Main Street, # 7 | P.O. Box 344 Moab, Utah 84532 435-26O-8384, May 2, 2014. Dear Mr. Rosnick: REQUEST FOR EXTENSION OF TIME TO SUBMIT COMMENTS Uranium Watch requests Rosnick/EPA 2 June 10, 2014 1 http://www.radiationcontrol.utah.gov/Uranium_Mills/uraniumone/docs/2012

320

The School of Information Studies The ICE Box, a space for  

E-Print Network [OSTI]

The School of Information Studies #12;The ICE Box, a space for innovation, collaboration, and entrepreneurship. #12;Syracuse University's School of Information Studies (iSchool), ranked No. 1 in information and prefigures industry trends and incorporates rapidly changing and emerging technologies. The iSchool

Mather, Patrick T.

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

System vendor Contents Type Location Removal of Misc Cable, Conduit and Junction Boxes  

E-Print Network [OSTI]

System vendor Contents Type Location Removal of Misc Cable, Conduit and Junction Boxes in the NCSX;System vendor Contents Type Location Installation for NCSX Power Cables Procedure Procedure Files IP Procedure Procedure Files IP-NCSX-2972 #12;System vendor Contents Type Location Coils NCSX Coil System DC

Princeton Plasma Physics Laboratory

322

Renewable Forest Energy P.O. Box 4490, Pagosa Springs, CO 81157  

E-Print Network [OSTI]

Renewable Forest Energy P.O. Box 4490, Pagosa Springs, CO 81157 Phone: 970-264-5000 Fax: 970 to all ­ Depth of chips we left on the forest floor · Turkey Springs Biofuels Demonstration Future · 4MWe the Forest Service · July 2010 ­ If Turkey Springs is successful then we will proceed with the construction

323

Design and Fabrication of a High Voltage Distribution Box Michael Barnett  

E-Print Network [OSTI]

of paint. This ensured that the lock washers for the BNC plugs made solid electrical contacts with the box the shielding of the coaxial RG47 cable continuous, which helped to reduce noise injection into the lines. The BNC ports were manufactured by KINGS, part no. 1704-1. They used a lock washer and a threaded nut

Saskatchewan, University of

324

Towards Black-Box Accountable Authority IBE with Short Ciphertexts and Private Keys  

E-Print Network [OSTI]

Towards Black-Box Accountable Authority IBE with Short Ciphertexts and Private Keys Beno^it Libert1 in Identity-Based Encryption. In this model, if the Private Key Generator (PKG) maliciously re' public keys are public identifiers (e.g. email addresses) and the matching private keys are derived

Paris-Sud XI, Université de

325

University Library Box 19497 817-272-3000 www.uta.edu/library/  

E-Print Network [OSTI]

University Library Box 19497 · 817-272-3000 · www.uta.edu/library/ The UT Arlington Library includes the Central Library, two branch libraries (Architecture and Fine Arts, Science and Engineering) two electronic libraries (Business and Social Work) and the Library Collection Depository

Texas at Arlington, University of

326

BLACK-BOX MODELLING OF HVAC SYSTEM: IMPROVING THE PERFORMANCES OF NEURAL NETWORKS  

E-Print Network [OSTI]

BLACK-BOX MODELLING OF HVAC SYSTEM: IMPROVING THE PERFORMANCES OF NEURAL NETWORKS Eric FOCK Ile de La RĂ©union - FRANCE ABSTRACT This paper deals with neural networks modelling of HVAC systems of HVAC system can be modelled using manufacturer design data presented as derived performance maps

Boyer, Edmond

327

The Garden of the Coastal Plain P. O. Box 8039, 1505 Bland Avenue  

E-Print Network [OSTI]

The Garden of the Coastal Plain P. O. Box 8039, 1505 Bland Avenue Statesboro, Georgia 30460 912.871 Cottage and an open-air Heritage Pavilion. CALL. Contact the Garden (912-871-1149) after your visit, 1505 Bland Avenue Statesboro, Georgia 30460 912.871.1149 I have read and understand the Facility Rental

Hutcheon, James M.

328

Hanford Workers Achieve Success in Difficult Glove Box Project at Plutonium Finishing Plant  

Broader source: Energy.gov [DOE]

RICHLAND, Wash. – EM’s Richland Operations Office and contractor CH2M HILL Plateau Remediation Company (CH2M HILL) recently finished safely separating three glove boxes for removal from Hanford’s Plutonium Finishing Plant (PFP) after months of planning and preparation.

329

Randomly accelerated particle in a box: Mean absorption time for partially absorbing and inelastic boundaries  

E-Print Network [OSTI]

Randomly accelerated particle in a box: Mean absorption time for partially absorbing and inelastic which is randomly accelerated by Gaussian white noise on the line segment 0 x 1 and is absorbed as soon accelerated particle which moves on the half line x 0 with an absorbing boundary at x=0. The motion

330

Improved Load Distribution for Load Rating of Low-Fill Box Structures  

E-Print Network [OSTI]

. The distribution of live loads on the top slab of a box culvert plays a major role in determining the rating factor of the culvert. The current AASHTO guidelines do not consider the effects of pavements present above the fill while determining the load distribution...

Acharya, Raju

2012-12-31T23:59:59.000Z

331

On the Occurrence of Thermal Runaway in Diode in the J-Box  

Broader source: Energy.gov [DOE]

This PowerPoint presentation, focused on the environmental testing of diodes, was originally presented at the International PV Module Quality Assurance Forum on Feb. 26-27, 2013 in Denver, CO. It details the thermal runaway tests of J-boxes and discusses the Tj measurement method for bypass diodes. The presentation wraps up with a discussion of the team's anticipated next steps.

332

Cavity-nesting Bird Use of Nest Boxes in Vineyards of Central-Coast California1  

E-Print Network [OSTI]

Cavity-nesting Bird Use of Nest Boxes in Vineyards of Central-Coast California1 Daniel P. Mummert,2 by vineyards in many areas of central- coastal California. Oak woodlands are home to many insectivorous, cavity-nesting birds that would be beneficial in and around vineyards. During March to June 2001, we used bluebird nest

Standiford, Richard B.

333

MSU Human Resources 19 Montana Hall ~ PO Box 172520 ~ Bozeman, MT 59717-2520  

E-Print Network [OSTI]

MSU Human Resources 19 Montana Hall ~ PO Box 172520 ~ Bozeman, MT 59717-2520 Tel (406) 994 with the Social Security Administration and State policies, the Human Resources procedure for Name and Address changes has been modified. The Human Resources Department uses two separate forms ­ one for name changes

Dyer, Bill

334

Office of the General Counsel Building 460 P.O. Box 5000  

E-Print Network [OSTI]

Office of the General Counsel Building 460 P.O. Box 5000 Upton. NY 11973-5000 Phone 516 344-8629 EN of Energy WY;'W.bnl.gov Memo Date: September 30, 1999 To: George Malosh From: Gregory Fes~ Subject: DOE Te: As above stated #12;DEPARTMENT OF ENERGY TECHNOLOGY PARTNERSHIP 0!\\-1BUDS INTTIATIVE C01\\rf

335

SOUTHEASTERN NATURALIST2006 5(2):191204 Natural History of Terrapene carolina (Box Turtles)  

E-Print Network [OSTI]

) in an Urbanized Landscape Sarah A. Budischak1,2 , Joy M. Hester1,3 , Steven J. Price1 , and Michael E. Dorcas1 (Eastern Box Turtles), we conducted a mark-recapture study in the vicinity of Davidson, NC, from 1999

Dorcas, Michael E.

336

ASFAW ADUGNA AGERU Melkassa Agricultural Research Center, P.O. Box 436, Nazareth, Ethiopia, Mob. 251-  

E-Print Network [OSTI]

ASFAW ADUGNA AGERU Melkassa Agricultural Research Center, P.O. Box 436, Nazareth, Ethiopia, Mob of Biology, Faculty of Sciences, Addis Ababa University, Ethiopia; Current: Post-Doctoral Researcher Farming, Awassa College of Agriculture, Ethiopia o 1988-1989, Certificate in Primary School Teaching

Snow, Allison A.

337

Full Scale Test of a SSP 34m box girder 2. Data report  

E-Print Network [OSTI]

DTU - Wind Energy Department Malcolm McGugan Risř DTU - Materials Research Department Carsten Skamris 2. Data report Department: Wind Energy Department Risř-R-1588(EN) May 2008 1 Risř ­ Materials of the reinforced glass fiber/epoxy box girder used in a 34m wind turbine blade. One test was without reinforcement

338

Black-Box Identification for PLC based MPC of a Binary Distillation Column  

E-Print Network [OSTI]

Black-Box Identification for PLC based MPC of a Binary Distillation Column B. Huyck ,, F. Logist J is to upgrade the control system with a linear MPC running on a PLC. However, before a model based controller can be used on a PLC, an accurate (but simple) process model has to be constructed. Hence, the aim

339

Environmental & Waste Management Services Division Bldg. 120 P. O. Box 5000  

E-Print Network [OSTI]

Environmental & Waste Management Services Division Bldg. 120 P. O. Box 5000 Upton, NY 11973.S. Department of Energy MMeemmooDate: August 5, 2008 To: N. Gmur From: Mark C. Davis, NEPA/NHPA Coordinator Synchrotron Light Source-II (NSLS-II) Environmental Assessment (EA) Vs Title II Design Specifications, dated 6

Ohta, Shigemi

340

An Analysis of Bicycle-Vehicle Interactions at Signalized Intersections with Bicycle Boxes  

E-Print Network [OSTI]

An Analysis of Bicycle-Vehicle Interactions at Signalized Intersections with Bicycle Boxes. To develop the conflict data, a log was created of each motor vehicle and bicycle passing through,849 bicycles. A total of 19 conflicts were observed during the after period. Total exposure was 42,381 motor

Bertini, Robert L.

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

The DEAD Box RNA Helicase VBH-1 Is Required for Germ Cell Function in C. elegans  

E-Print Network [OSTI]

Salinas,1 Ernesto Maldonado,2 Marina Maci´as-Silva,1 T. Keith Blackwell,3,4 and Rosa E. Navarro1 * 1; Lasko and Ashburner, 1988; Navarro et al., 2001). DEAD box RNA helicases belong to a conserved family

Blackwell, Keith

342

Assignment 3 MECH 421/6511 Solutions Question 1  

E-Print Network [OSTI]

and length = 12 ft. The extruder screw rotates at 50 rev/min; it has channel depth = 0.30 in and flight angle (given) curves with the calculated ones. Question 4: An extruder has a barrel diameter = 5.0 inch = 17.7°. The plastic melt has a shear viscosity = 100 x 10-4 lb- sec/in2 . Find: (a) the extruder

Medraj, Mamoun

343

Implementation Guide for Use in Addressing Unreviewed Safety Question Requirements  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

This Guide, including its attachments, provides information to assist in the implementation of Title 10 Code of Federal Regulations (CFR) Section 830.203, “Unreviewed Safety Question Process,” of the Nuclear Safety Management Rules for Category 1, 2, and 3 nuclear facilities owned or operated by the Department of Energy (DOE), including the National Nuclear Security Administration (NNSA). Cancels DOE G 424.1-1A. Admin Chg 1 dated 4-12-13.

2010-04-08T23:59:59.000Z

344

EECBG Strategies and Considerations Approaching Lenders Webcast (Text Version)  

Broader source: Energy.gov [DOE]

Below is a text version of the December 3, 2009 What Drives Consumer Borrowing for Energy Efficiency?

345

Structuring Credit Enhancements for Clean Energy Finance Programs (Text Version)  

Broader source: Energy.gov [DOE]

Below is a text version of the January 15, 2010 Structuring Loan Loss Reserve Funds for Clean Energy Finance Programs.

346

Text-Alternative Version: Evaluating LED Street Lighting Solutions  

Broader source: Energy.gov [DOE]

Below is the text-alternative version of the Evaluating LED Street Lighting Solutions webcast, held July 20, 2010.

347

Text-Alternative Version: Pedestrian-Friendly Nighttime Lighting Webinar  

Broader source: Energy.gov [DOE]

Below is the text-alternative version of the "Pedestrian-Friendly Nighttime Lighting" webcast, held November 19, 2013.

348

EECLP Webinar #1: Overview and Cost Effectiveness-- Text Version  

Broader source: Energy.gov [DOE]

Below is the text version of the webinar, EECLP Webinar #1: Overview and Cost Effectiveness, presented in December 2014.

349

Text-Alternative Version: LEDs for Interior Office Applications  

Broader source: Energy.gov [DOE]

Below is the text-alternative version of the LEDs for Interior Office Applications webcast, held March 18, 2010.

350

Text-Alternative Version: LED Replacements for Linear Fluorescent Lamps  

Broader source: Energy.gov [DOE]

Below is the text-alternative version of the "LED Replacements for Linear Fluorescent Lamps" webcast, held June 20, 2011.

351

Text-Alternative Version: Smithsonian GATEWAY Demonstration Video  

Broader source: Energy.gov [DOE]

Following is a text version of a video about the GATEWAY demonstration project at the Smithsonian American Art Museum.

352

Can An Evolutionary Process Create English Text? David H. Bailey*  

E-Print Network [OSTI]

to English text. For example, David Foster, in a book skeptical of evolution, discusses and then ref

Bailey, David H.

353

EECLP Webinar #6: Solar Program Overview-- Text Version  

Broader source: Energy.gov [DOE]

Below is the text version of the EECLP Webinar 6: Solar Program Overview, presented in January 2015.

354

SB 4 Well Stimulation Treatment Regulations Text of Proposed Regulations  

E-Print Network [OSTI]

surveys; routine activities that do not affect the integrity of the well or the formation; the removal SB 4 Well Stimulation Treatment Regulations Text of Proposed Regulations Page 1 of 13 SB 4 WELL STIMULATION TREATMENT REGULATIONS TEXT OF PROPOSED REGULATIONS Added text is shown in underline

355

GPU-Accelerated Text Mining Yongpeng Zhang, Frank Mueller  

E-Print Network [OSTI]

GPU-Accelerated Text Mining Yongpeng Zhang, Frank Mueller North Carolina State University of parallelism and novel programming environ- ments. This present work assesses the viability of text mining on CUDA. Text mining is one of the key concepts that has become prominent as an effective means to index

Mueller, Frank

356

A SIMPLE ALGORITHM FOR IDENTIFYING ABBREVIATION DEFINITIONS IN BIOMEDICAL TEXT  

E-Print Network [OSTI]

A SIMPLE ALGORITHM FOR IDENTIFYING ABBREVIATION DEFINITIONS IN BIOMEDICAL TEXT ARIEL S. SCHWARTZ of biomedical text is growing at a fast rate, creating challenges for humans and computer systems alike. One of these challenges arises from the frequent use of novel abbreviations in these texts, thus requiring that biomedical

Hearst, Marti

357

MA 220 Lesson 4 Notes, Section 5.4 (algebra part of text) You will ...  

E-Print Network [OSTI]

An open-topped box is made by taking a rectangular piece of light card stock that is 24 inches by 36 inches and cutting equal squares from each corner and ...

Bailey, Charlotte M

2012-05-17T23:59:59.000Z

358

CINAHL with Full Text is the world's most comprehensive source of full text for nursing & allied health journals, providing full text for more than 600 journals indexed in CINAHL. This authoritative file  

E-Print Network [OSTI]

for appropriate subject terms. Example: Click on CINAHL Heading, then enter Migraine in the search box and click mode than for the Basic search mode. CINAHL Headings Searching for subject terms (controlled vocabulary Ranked. Note that your search term appears at the bottom of the list with the option to search

359

Building America Technology Solutions for New and Existing Homes: New Insights for Improving the Designs of Flexible Duct Junction Boxes (Fact Sheet)  

Broader source: Energy.gov [DOE]

IBACOS explored the relationships between pressure and physical configurations of flexible duct junction boxes by using computational fluid dynamics simulations to predict individual box parameters and total system pressure, thereby ensuring improved HVAC performance.

360

Nanoclustering of hydrogen in ion-implanted and plasma-grown amorphous silicon Debye Institute, Utrecht University, P.O. Box 80000, 3508 TA Utrecht, The Netherlands  

E-Print Network [OSTI]

Institute, Utrecht University, P.O. Box 80000, 3508 TA Utrecht, The Netherlands D. L. Williamson Department. van der Weg Debye Institute, Utrecht University, P.O. Box 80000, 3508 TA Utrecht, The Netherlands A

Polman, Albert

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

New Text New Text  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmosphericNuclear Security Administration the Contributions andDataNational Library of1, 2007TransmissiontoSystem |Nevis

362

Index to the monthly hotline report questions (June 1982 to December 1991)  

SciTech Connect (OSTI)

The document provides four indices to the question and answer sections of the RCRA/Superfund/Oust Monthly Hotline Reports from June 1982 through December 1991. The first index is an alphabetical listing of question titles by year and month. The second index organizes the questions by regulatory citation, beginning with 40 CFR 257. The third index organizes the questions by statuatory citation. Finally, the fourth index references the questions by key word or subject heading.

Not Available

1992-12-01T23:59:59.000Z

363

Implementation Guide for Use in Addressing Unreviewed Safety Question Requirements  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

This Guide, including its attachments, provides information to assist in the implementation of Title 10 Code of Federal Regulations (CFR) Section 830.203, “Unreviewed Safety Question Process,” of the Nuclear Safety Management Rules for Category 1, 2, and 3 nuclear facilities owned or operated by the Department of Energy (DOE), including the National Nuclear Security Administration (NNSA). Cancels DOE G 424.1-1A. Admin Chg 1 dated 4-12-13. Admin Chg 2, dated 6-12-13, cancels DOE G 424.1-1B Admin Chg 1.

2010-04-08T23:59:59.000Z

364

Unreviewed Disposal Question Evaluation: Waste Disposal In Engineered Trench #3  

SciTech Connect (OSTI)

Because Engineered Trench #3 (ET#3) will be placed in the location previously designated for Slit Trench #12 (ST#12), Solid Waste Management (SWM) requested that the Savannah River National Laboratory (SRNL) determine if the ST#12 limits could be employed as surrogate disposal limits for ET#3 operations. SRNL documented in this Unreviewed Disposal Question Evaluation (UDQE) that the use of ST#12 limits as surrogates for the new ET#3 disposal unit will provide reasonable assurance that Department of Energy (DOE) 435.1 performance objectives and measures (USDOE, 1999) will be protected. Therefore new ET#3 inventory limits as determined by a Special Analysis (SA) are not required.

Hamm, L. L.; Smith, F. G. III; Flach, G. P.; Hiergesell, R. A.; Butcher, B. T.

2013-07-29T23:59:59.000Z

365

Research questions reality of 'supersolid' in helium-4  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsrucLas ConchasPassive Solar HomePromisingStories »Submitter A B C D E F G H IResearch questions

366

5 Questions for a Scientist: Materials Engineer David Forrest | Department  

Office of Environmental Management (EM)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "of EnergyEnergy Cooperation |South Valley ResponsibleSubmissionof Energy 5 Questions for a Scientist:

367

Fermilab Office of General Counsel - Ethics Program - Submit a Question  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: Vegetation ProposedUsing ZirconiaPolicyFeasibility ofSmall Works: 2008Submit a Question Ask the Ethicist

368

Question about Map of Wind Farms | OpenEI Community  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 No revisionEnvReviewNonInvasiveExploration JumpSanyalTempWellheadWahkiakum CountyPzero JumpQuestion about Map of Wind

369

Questions about OpenEI? | OpenEI Community  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 No revisionEnvReviewNonInvasiveExploration JumpSanyalTempWellheadWahkiakum CountyPzero JumpQuestion about Map of

370

Questions Asked during the Financing Residential Energy Efficiency with  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion | Department ofT ib l L dDepartment ofList? | Department of Energy Question of thein

371

Questions and Answers about National Environmental Policy Act (NEPA) Compliance  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion | Department ofT ib l L dDepartment ofList? | Department of Energy Question of theinabout

372

Fermilab | Science | Questions for the Universe | Einstein's Dream of  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May JunDatastreamsmmcrcalgovInstrumentsruc DocumentationP-Series toESnet4:Epitaxialtransatlantic networkHomelandWorkforceQuestions

373

Fermilab | Science | Particle Physics 101 | Questions for the Universe  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary)morphinanInformation Desert Southwest Region service area. TheEPSCI Home ItDark EnergyFermilab'sParticleQuestions

374

Microsoft Word - Amendment 000002 - Question & Answers.docx  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr MayAtmospheric Optical Depth7-1D: VegetationEquipment Surfaces andMappingENVIRONMENTAL IMPACT STATEMENTbelow).A3PM-10978, Alcoa 1Question:

375

Critical Materials Research in DOE Video (Text Version)  

Broader source: Energy.gov [DOE]

This is a text version of the "Critical Materials Research in DOE" video presented at the Critical Materials Workshop, held on April 3, 2012 in Arlington, Virginia.

376

BENEFIT 2015 Funding Opportunity Announcement Webinar 1 (Text Version)  

Broader source: Energy.gov [DOE]

Below is the text version of the webinar, BENEFIT 2015 Funding Opportunity Announcement, presented in October 2014 by Antonio Bouza, technology manager, and Pat Phelan, program manager, Building...

377

National Academies Criticality Methodology and Assessment Video (Text Version)  

Broader source: Energy.gov [DOE]

This is a text version of the "National Academies Criticality Methodology and Assessment" video presented at the Critical Materials Workshop, held on April 3, 2012 in Arlington, Virginia.

378

Text-Alternative Version: Philadelphia Market Introduction Workshop Video  

Broader source: Energy.gov [DOE]

Following is a text version of Jim Brodrick's opening presentation video from the July 2010 DOE SSL Market Introduction Workshop in Philadelphia, Pennsylvania.

379

Text-Alternative Version: Seattle Market Introduction Workshop Video  

Broader source: Energy.gov [DOE]

Following is a text version of Jim Brodrick's welcome presentation video from the July 2011 DOE SSL Market Introduction Workshop in Seattle, Washington.

380

Text-Alternative Version: Raleigh R&D Workshop Video  

Broader source: Energy.gov [DOE]

Following is a text version of Jim Brodrick's opening presentation video from the February 2010 DOE SSL R&D Workshop in Raleigh, North Carolina.

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

Department of Energy Critical Materials Strategy Video (Text Version)  

Broader source: Energy.gov [DOE]

This is a text version of the "Department of Energy Critical Materials Strategy" video presented at the Critical Materials Workshop, held on April 3, 2012 in Arlington, Virginia.

382

Assistant Secretary for EERE Danielson Keynote (text version)  

Broader source: Energy.gov [DOE]

Below is the text version for the Keynote: The Honorable David T. Danielson, Assistant Secretary for Energy Efficiency and Renewable Energy, U.S. Department of Energy Video.

383

automatic text summarization: Topics by E-print Network  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

(i.e., figures) are important experimental evidence that are typically Yu, Hong 10 A Maximum Entropy Approach to Text Summarization Computer Technologies and Information...

384

Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Should you have any questions concerning this audit report, please contact the Carlsbad Field Office Quality Assurance Director, Ava L. Holland , at (575) 234-7423 ....

385

Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

have any questions regarding this transmittal . cc: Edward Ziemianski, Acting Manager Carlsbad Field Office J. Kieling , NMED S. Zappe, NMED C. Walker, Trinity Engineering CBFO...

386

Using Text Animated Transitions to Support Navigation in Document Histories  

E-Print Network [OSTI]

of an animated transition between two revisions of the Wikipedia article User interfaces. ABSTRACT This article examines the benefits of using text animated transitions for navigating in the revision history of textual documents. We propose an animation technique for smoothly transitioning between different text revisions

Toronto, University of

387

Experiments with a Block Sorting Text Compression Algorithm  

E-Print Network [OSTI]

compressors. The original paper did little more than present the algorithm, with strong advice for efficient on aspects of its operation. Consideration of the possible efficiency of text compression leads to the revival of ideas by Shannon as the basis of a text compressor and then to the classification of the Block

Fenwick, Peter

388

A fast, constantorder, symbol ranking text Peter Fenwick  

E-Print Network [OSTI]

capable of efficient hardware implementation. The compressor is based on a conventional setA fast, constant­order, symbol ranking text compressor Peter Fenwick Technical Report 145 ISSN 1173, New Zealand peter­f@cs.auckland.ac.nz Abstract Recent work on ``symbol ranking'' text compressors

Fenwick, Peter

389

Biomedical Text Disambiguation using UMLS Wessam Gad El-Rab  

E-Print Network [OSTI]

Biomedical Text Disambiguation using UMLS Wessam Gad El-Rab University of Alberta Edmonton, Canada from biomedical documents has increased significantly in recent years but has always been challenged to disambiguate biomedical text. In this study we propose a word sense disambiguation algorithm focused

Zaiane, Osmar R.

390

Higgs boson production in association with top quarks in the POWHEG BOX  

E-Print Network [OSTI]

We present results from the analytic calculation of top+antitop+Higgs hadronic production at Next-to-Leading Order in QCD interfaced with parton-shower Monte Carlo event generators in the POWHEG BOX framework. We consider kinematic distributions of the top quark and Higgs boson at the 8 TeV Large Hadron Collider and study the theoretical uncertainties due to specific choices of renormalization/factorization scales and parton-showering algorithms, namely PYTHIA and HERWIG. The importance of spin-correlations in the production and decay stages of a top/antitop quark is discussed on the example of kinematic distributions of leptons originating from the top/antitop decays. The corresponding code is now part of the public release of the POWHEG BOX.

Hartanto, Heribertus B; Reina, Laura; Wackeroth, Doreen

2015-01-01T23:59:59.000Z

391

Using exploratory data analysis modified Box Plots to enhance Monte Carlo simulated Range Estimating Decision Technology  

E-Print Network [OSTI]

of the thesis is written with the intent of reviewing some of the significant pieces of literature relating to Monte Carlo simulated REDT and exploratory data analysis Box Plots. In 1964 David Hertz published an article in the Harvard Business Review... entitled, "Risk Analysis in Capital Investment" (Hertz 1964). While this article does not directly discuss range estimating, it is the foundation for the current REDT theory. In his atticle, Hertz discussed the problems associated with estimating...

Clutter, David John

1992-01-01T23:59:59.000Z

392

Structure of the Yeast DEAD Box Protein Mss116p Reveals Two Wedges that Crimp RNA  

SciTech Connect (OSTI)

The yeast DEAD box protein Mss116p is a general RNA chaperone that functions in mitochondrial group I and II intron splicing, translational activation, and RNA end processing. Here we determined high-resolution X-ray crystal structures of Mss116p complexed with an RNA oligonucleotide and ATP analogs AMP-PNP, ADP-BeF{sub 3}, or ADP-AlF{sub 4}{sup -}. The structures show the entire helicase core acting together with a functionally important C-terminal extension. In all structures, the helicase core is in a closed conformation with a wedge {alpha} helix bending RNA 3' of the central bound nucleotides, as in previous DEAD box protein structures. Notably, Mss116p's C-terminal extension also bends RNA 5' of the central nucleotides, resulting in RNA crimping. Despite reported functional differences, we observe few structural changes in ternary complexes with different ATP analogs. The structures constrain models of DEAD box protein function and reveal a strand separation mechanism in which a protein uses two wedges to act as a molecular crimper.

Del Campo, Mark; Lambowitz, Alan M.; (Texas)

2010-01-12T23:59:59.000Z

393

A Linear Algorithm for Compact Box-Drawings of Trees Masud Hasan , Md. Saidur Rahman y , and Takao Nishizeki z  

E-Print Network [OSTI]

A Linear Algorithm for Compact Box-Drawings of Trees Masud Hasan #3; , Md. Saidur Rahman y, Bangladesh. Email: m2hasan@hopper.math.uwaterloo.ca y Graduate School of Information Sciences, Tohoku Univer

Wismath, Stephen

394

A Tutorial on Text-Independent Speaker Verification  

E-Print Network [OSTI]

This paper presents an overview of a state-of-the-art text-independent speaker verification system. First, an introduction proposes a modular scheme of the training and test phases of a speaker verification system. Then, ...

Bimbot, Frederic

395

Models of Authorship and Text-making in Early China  

E-Print Network [OSTI]

the seven texts Classics. See Ma Heng 1957, 1. Hou Han shu “Lü Zhenduan 1975, 1—13. Ma Heng 1957, 56; Lü Zhenduan 1975,of the Lunyu. Finally, Ma Heng observes that one of the

Zhang, Hanmo

2012-01-01T23:59:59.000Z

396

Text-Alternative Version: Understanding and Evaluating LM-79 Reports  

Broader source: Energy.gov [DOE]

Below is the text-alternative version of Day 1 of the three-part TINSSL Webinar Series "Understanding and Evaluating LM-79 & LM-80 Reports for SSL Technology," held August 10, 2010.

397

Syntactic tools for text watermarking Hasan M. Meral1  

E-Print Network [OSTI]

1 Syntactic tools for text watermarking Hasan M. Meral1 , Emre Sevinç3 , Ersin �nkar2 , Bülent, stanbul, Turkey Corresponding author: Hasan Mesut Meral ABSTRACT This paper explores the morphosyntactic

Güngör, Tunga

398

Project Profile: Helios: Understanding Solar Evolution through Text Analytics  

Broader source: Energy.gov [DOE]

SRI International, under the Solar Energy Evolution and Diffusion Studies (SEEDS) program, is developing a new system for large-scale text analytics, called Helios, to isolate and map recurring...

399

BENEFIT 2015 Funding Opportunity Announcement Webinar 2 (Text Version)  

Broader source: Energy.gov [DOE]

Below is the text version of the webinar, BENEFIT 2015 Funding Opportunity Announcement 2, presented in October 2014 by Antonio Bouza and Jim Payne of the Building Technologies Office.

400

Hypertextual Ultrastructures: Movement and Containment in Texts and Hypertexts  

E-Print Network [OSTI]

The surface-level experience of hypertextuality as formless and unbounded, blurring boundaries among texts and between readers and writers, is created by a deep structure which is not normally presented to readers and which, like the ultrastructure...

Coste, Rosemarie L.

2010-01-14T23:59:59.000Z

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

Control for nematodes in cotton DNA story text  

E-Print Network [OSTI]

IMPACTS Control for nematodes in cotton DNA story text Studies help plants survive Battling opens in May By Donna Bowen Photo by Clemson University Site-specific controls for nematodes in cotton

Bolding, M. Chad

402

Study of e$^+$e$^-$ $\\rightarrow \\text{p} \\overline{\\text{p}}?^0$ in the Vicinity of the $?\\text{(3770)}$  

E-Print Network [OSTI]

The process $e^+e^-\\rightarrow p\\overline{p}\\pi^0$ has been studied by analyzing data collected at $\\sqrt{s}=3.773$ GeV, at $\\sqrt{s}=3.650$ GeV, and during a $\\psi(3770)$ line shape scan with the BESIII detector at the BEPCII collider. The Born cross section of $p \\overline{p} \\pi^0$ in the vicinity of the $\\psi(3770)$ is measured and the Born cross section of $\\psi(3770)\\rightarrow p \\overline{p} \\pi^0$ is extracted considering interference between resonant and continuum production amplitudes. Two solutions with the same probability and a significance of 1.5$\\sigma$ are found, and the Born cross section of $\\psi(3770)\\rightarrow p \\overline{p} \\pi^0$ is determined to be less than 0.22 pb at 90% confidence level and $33.8\\pm1.8\\pm2.1$ pb, respectively. Using the estimated cross section and a constant decay amplitude approximation, the cross section $\\sigma(p\\overline{p} \\rightarrow \\psi(3770) \\pi^0)$ is calculated for the kinematic situation of the planned $\\overline{\\text{P}}\\text{ANDA}$ experiment. The maximum cross section corresponding to the two solutions is expected to be less than $0.79$ nb at 90% confidence level and $122\\pm10$ nb at a center of mass energy of 5.26 GeV.

M. Ablikim; M. N. Achasov; X. C. Ai; O. Albayrak; M. Albrecht; D. J. Ambrose; F. F. An; Q. An; J. Z. Bai; R. Baldini Ferroli; Y. Ban; J. V. Bennett; M. Bertani; J. M. Bian; E. Boger; O. Bondarenko; I. Boyko; S. Braun; R. A. Briere; H. Cai; X. Cai; O. Cakir; A. Calcaterra; G. F. Cao; S. A. Cetin; J. F. Chang; G. Chelkov; G. Chen; H. S. Chen; J. C. Chen; M. L. Chen; S. J. Chen; X. Chen; X. R. Chen; Y. B. Chen; H. P. Cheng; X. K. Chu; Y. P. Chu; D. Cronin-Hennessy; H. L. Dai; J. P. Dai; D. Dedovich; Z. Y. Deng; A. Denig; I. Denysenko; M. Destefanis; W. M. Ding; Y. Ding; C. Dong; J. Dong; L. Y. Dong; M. Y. Dong; S. X. Du; J. Z. Fan; J. Fang; S. S. Fang; Y. Fang; L. Fava; C. Q. Feng; C. D. Fu; O. Fuks; Q. Gao; Y. Gao; C. Geng; K. Goetzen; W. X. Gong; W. Gradl; M. Greco; M. H. Gu; Y. T. Gu; Y. H. Guan; A. Q. Guo; L. B. Guo; T. Guo; Y. P. Guo; Y. L. Han; F. A. Harris; K. L. He; M. He; Z. Y. He; T. Held; Y. K. Heng; Z. L. Hou; C. Hu; H. M. Hu; J. F. Hu; T. Hu; G. M. Huang; G. S. Huang; H. P. Huang; J. S. Huang; L. Huang; X. T. Huang; Y. Huang; T. Hussain; C. S. Ji; Q. Ji; Q. P. Ji; X. B. Ji; X. L. Ji; L. L. Jiang; L. W. Jiang; X. S. Jiang; J. B. Jiao; Z. Jiao; D. P. Jin; S. Jin; T. Johansson; N. Kalantar-Nayestanaki; X. L. Kang; X. S. Kang; M. Kavatsyuk; B. Kloss; B. Kopf; M. Kornicer; W. Kühn; A. Kupsc; W. Lai; J. S. Lange; M. Lara; P. Larin; M. Leyhe; C. H. Li; Cheng Li; Cui Li; D. Li; D. M. Li; F. Li; G. Li; H. B. Li; J. C. Li; K. Li; K. Li; Lei Li; P. R. Li; Q. J. Li; T. Li; W. D. Li; W. G. Li; X. L. Li; X. N. Li; X. Q. Li; Z. B. Li; H. Liang; Y. F. Liang; Y. T. Liang; D. X. Lin; B. J. Liu; C. L. Liu; C. X. Liu; F. H. Liu; Fang Liu; Feng Liu; H. B. Liu; H. H. Liu; H. M. Liu; J. Liu; J. P. Liu; K. Liu; K. Y. Liu; P. L. Liu; Q. Liu; S. B. Liu; X. Liu; Y. B. Liu; Z. A. Liu; Zhiqiang Liu; Zhiqing Liu; H. Loehner; X. C. Lou; G. R. Lu; H. J. Lu; H. L. Lu; J. G. Lu; X. R. Lu; Y. Lu; Y. P. Lu; C. L. Luo; M. X. Luo; T. Luo; X. L. Luo; M. Lv; F. C. Ma; H. L. Ma; Q. M. Ma; S. Ma; T. Ma; X. Y. Ma; F. E. Maas; M. Maggiora; Q. A. Malik; Y. J. Mao; Z. P. Mao; J. G. Messchendorp; J. Min; T. J. Min; R. E. Mitchell; X. H. Mo; Y. J. Mo; H. Moeini; C. Morales Morales; K. Moriya; N. Yu. Muchnoi; H. Muramatsu; Y. Nefedov; I. B. Nikolaev; Z. Ning; S. Nisar; X. Y. Niu; S. L. Olsen; Q. Ouyang; S. Pacetti; M. Pelizaeus; H. P. Peng; K. Peters; J. L. Ping; R. G. Ping; R. Poling; N. Q.; M. Qi; S. Qian; C. F. Qiao; L. Q. Qin; X. S. Qin; Y. Qin; Z. H. Qin; J. F. Qiu; K. H. Rashid; C. F. Redmer; M. Ripka; G. Rong; X. D. Ruan; A. Sarantsev; K. Schoenning; S. Schumann; W. Shan; M. Shao; C. P. Shen; X. Y. Shen; H. Y. Sheng; M. R. Shepherd; W. M. Song; X. Y. Song; S. Spataro; B. Spruck; G. X. Sun; J. F. Sun; S. S. Sun; Y. J. Sun; Y. Z. Sun; Z. J. Sun; Z. T. Sun; C. J. Tang; X. Tang; I. Tapan; E. H. Thorndike; D. Toth; M. Ullrich; I. Uman; G. S. Varner; B. Wang; D. Wang; D. Y. Wang; K. Wang; L. L. Wang; L. S. Wang; M. Wang; P. Wang; P. L. Wang; Q. J. Wang; S. G. Wang; W. Wang; X. F. Wang; Y. D. Wang; Y. F. Wang; Y. Q. Wang; Z. Wang; Z. G. Wang; Z. H. Wang; Z. Y. Wang; D. H. Wei; J. B. Wei; P. Weidenkaff; S. P. Wen; M. Werner; U. Wiedner; M. Wolke; L. H. Wu; N. Wu; Z. Wu; L. G. Xia; Y. Xia; D. Xiao; Z. J. Xiao; Y. G. Xie; Q. L. Xiu; G. F. Xu; L. Xu; Q. J. Xu; Q. N. Xu; X. P. Xu; Z. Xue; L. Yan; W. B. Yan; W. C. Yan; Y. H. Yan; H. X. Yang; L. Yang; Y. Yang; Y. X. Yang; H. Ye; M. Ye; M. H. Ye; B. X. Yu; C. X. Yu; H. W. Yu; J. S. Yu; S. P. Yu; C. Z. Yuan; W. L. Yuan; Y. Yuan; A. Yuncu; A. A. Zafar; A. Zallo; S. L. Zang; Y. Zeng; B. X. Zhang; B. Y. Zhang; C. Zhang; C. B. Zhang; C. C. Zhang; D. H. Zhang; H. H. Zhang; H. Y. Zhang; J. J. Zhang; J. Q. Zhang; J. W. Zhang; J. Y. Zhang; J. Z. Zhang; S. H. Zhang; X. J. Zhang; X. Y. Zhang; Y. Zhang; Y. H. Zhang; Z. H. Zhang; Z. P. Zhang; Z. Y. Zhang; G. Zhao; J. W. Zhao; Lei Zhao; Ling Zhao; M. G. Zhao; Q. Zhao; Q. W. Zhao; S. J. Zhao; T. C. Zhao; X. H. Zhao; Y. B. Zhao; Z. G. Zhao; A. Zhemchugov; B. Zheng; J. P. Zheng; Y. H. Zheng; B. Zhong; L. Zhou; Li Zhou; X. Zhou; X. K. Zhou; X. R. Zhou; X. Y. Zhou; K. Zhu; K. J. Zhu; X. L. Zhu; Y. C. Zhu; Y. S. Zhu; Z. A. Zhu; J. Zhuang; B. S. Zou; J. H. Zou

2014-08-11T23:59:59.000Z

403

5 Questions about the SunShot Prize for Minh Le - Solar Program...  

Office of Environmental Management (EM)

5 Questions about the SunShot Prize for Minh Le - Solar Program Manager at the U.S. Energy Department 5 Questions about the SunShot Prize for Minh Le - Solar Program Manager at the...

404

H.D. Cochran, Questions for the Workshop | U.S. DOE Office of...  

Office of Science (SC) Website

DeSoto Hilton, Savannah, Georgia May 12-14, 1999 Questions for the Workshop H. D. Cochran Oak Ridge National Laboratory Dr. Cochran took the approach of asking questions of the...

405

Question of the Week: Do You Use Renewable Energy in Your Home...  

Broader source: Energy.gov (indexed) [DOE]

Energy-Saving Improvements are on Your To-Do List? Question of the Week: How Will You Landscape for Energy Efficiency? Question of the Week: Are You Considering an Energy-Related...

406

Question of the Week: How Do You Reduce the Energy Used by Computers...  

Broader source: Energy.gov (indexed) [DOE]

Question of the Week: How Do You Reduce the Energy Used by Computers and Office Electronics? Question of the Week: How Do You Reduce the Energy Used by Computers and Office...

407

Using JavaScript to simulate formative assessment questioning in web-based open learning materials   

E-Print Network [OSTI]

This paper provides the JavaScript code for asking questions in web-based learning materials. The paper situates the setting of formative assessment exercises and questioning in the tradition of open learning materials design. Re-usable examples...

Bowerman, Chris; Mansfield, Charlie; Sewell, Keith

1997-12-19T23:59:59.000Z

408

Question of the Week: What are Your Strategies for Saving Money...  

Energy Savers [EERE]

Question of the Week: What are Your Strategies for Saving Money and Energy in the Winter? Question of the Week: What are Your Strategies for Saving Money and Energy in the Winter?...

409

From the Mailbag: Questions and Comments on the New Energy.gov  

Broader source: Energy.gov [DOE]

You asked, we answered! Check out some frequently asked questions on the new and improved Energy.gov.

410

Information Gain Based Dimensionality Selection for Classifying Text Documents  

SciTech Connect (OSTI)

Selecting the optimal dimensions for various knowledge extraction applications is an essential component of data mining. Dimensionality selection techniques are utilized in classification applications to increase the classification accuracy and reduce the computational complexity. In text classification, where the dimensionality of the dataset is extremely high, dimensionality selection is even more important. This paper presents a novel, genetic algorithm based methodology, for dimensionality selection in text mining applications that utilizes information gain. The presented methodology uses information gain of each dimension to change the mutation probability of chromosomes dynamically. Since the information gain is calculated a priori, the computational complexity is not affected. The presented method was tested on a specific text classification problem and compared with conventional genetic algorithm based dimensionality selection. The results show an improvement of 3% in the true positives and 1.6% in the true negatives over conventional dimensionality selection methods.

Dumidu Wijayasekara; Milos Manic; Miles McQueen

2013-06-01T23:59:59.000Z

411

ES2A7 -Fluid Mechanics Example Classes Model Answers to Example Questions (Set III)  

E-Print Network [OSTI]

ES2A7 - Fluid Mechanics Example Classes Model Answers to Example Questions (Set III) Question 1 10610 40031.8 -- Ă?=Ă?= Ă? Ă? == APN RT d Question 2: Type of Fluid #12;Consider 2 identical vertical tubes are filled with the same height of fluid: A Newtonian fluid is used with tube X whereas a non-Newtonian fluid

Thomas, Peter J.

412

ES2A7 -Fluid Mechanics Example Classes Example Questions (Set III)  

E-Print Network [OSTI]

ES2A7 - Fluid Mechanics Example Classes Example Questions (Set III) Question 1: Distance between.mol- = - Perfect Gas constant: 1 1 R 8.31J.K .mol- - = Question 2: Type of Fluid Consider 2 identical vertical are filled with the same height of fluid: A Newtonian fluid is used with tube X whereas a non-Newtonian fluid

Thomas, Peter J.

413

Some issues in dialogue-based question-answering Arne Jnsson & Magnus Merkel  

E-Print Network [OSTI]

questions, but the Q&A approach has yet not reached the level of sophistication for handling connected. The challenge is to combine the IE techniques and some of the features of Q&A approaches with dialogue systems programs on TV, can ask questions related to the TV program, in this case questions on Nordic birds

Merkel, Magnus

414

Widget:ExpandableTextStart | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 NoPublic Utilities Address: 160 East 300 South Place: SaltTroyer &AnchorTextExpandableTextStart Jump to:

415

Awakening Seed Pond Water ChemistryAwakening Seed Pond Water Chemistry Our Question: Is our pond polluted?Our Question: Is our pond polluted?  

E-Print Network [OSTI]

Awakening Seed Pond Water ChemistryAwakening Seed Pond Water Chemistry Our Question: Is our pond polluted?Our Question: Is our pond polluted? Our InvestigationOur Investigation We discussed what kinds of pollutants we should look for. We narrowed down the aspects of pond chemistry that we would investigate

Hall, Sharon J.

416

Bell_Colloquium (4412)_student questions JB.pdf Student questions: Jim Bell colloquium on "Red Rover(s), Red Rover(s): Update on Mars  

E-Print Network [OSTI]

to their solar panels (and the dust that eventually built up on them), but seeing as how MSL is nuclear powered collect any samples of these, if this hasn't already been done? 8) Question 2: What is the difference between a Mars year and an Earth year? 9) Question 1: Which type of properties do you look for in rocks

Elser, Jim

417

Transporting radioactive materials: Q & A to your questions  

SciTech Connect (OSTI)

Over 2 million packages of radioactive materials are shipped each year in the United States. These shipments are carried by trucks, trains, ships, and airplanes every day just like other commodities. Compliance with Federal regulations ensures that radioactive materials are transported safely. Proper packaging is the key to safe shipment. Package designs for radioactive materials must protect the public and the environment even in case of an accident. As the level of radioactivity increases, packaging design requirements become more stringent. Radioactive materials have been shipped in this country for more than 40 years. As with other commodities, vehicles carrying these materials have been involved in accidents. However, no deaths or serious injuries have resulted from exposure to the radioactive contents of these shipments. People are concerned about how radioactive shipments might affect them and the environment. This booklet briefly answers some of the commonly asked questions about the transport of radioactive materials. More detailed information is available from the sources listed at the end of this booklet.

Not Available

1993-04-01T23:59:59.000Z

418

Braking index of isolated pulsars: open questions and ways forward  

E-Print Network [OSTI]

Isolated pulsars are rotating neutron stars with accurately measured angular velocities $\\Omega$, and their time derivatives which show unambiguously that the pulsars are slowing down. Although the exact mechanism of the spin-down is a question of debate, the commonly accepted view is that it arises either through emission of magnetic dipole radiation (MDR) from a rotating magnetized body, through emission of a relativistic particle wind, or via higher order magnetic multipole or gravitational quadrupole radiation. The calculated energy loss by a rotating pulsar is model dependent and leads to the power law $\\dot{\\Omega}$ = -K $\\Omega^{\\rm n}$ where $n$ is called the braking index. The theoretical value for braking index is $n = 1, 3, 5$ for wind, MDR, quadrupole radiation respectively. The accepted view is that pulsar braking is strongly dominated by MDR. Highly precise observations of isolated pulsars yield braking index values in the range $1 < n < 2.8$ which are consistently less than the value pred...

Hamil, Oliver

2015-01-01T23:59:59.000Z

419

Simplify or Help? Text Simplification Strategies for People with Dyslexia  

E-Print Network [OSTI]

Simplify or Help? Text Simplification Strategies for People with Dyslexia Luz Rello Ricardo Baeza content for people with dyslexia. The strategies considered are the standard one (replacing a com plex and to a gold standard man ually built. The study was undertook by 96 participants, 47 with dyslexia plus

420

Elenco dei periodici elettronici in Ovid Full text Academic Medicine  

E-Print Network [OSTI]

& Their Treatment Advances in Anatomic Pathology Age & Ageing AIDS AIDS Patient Care & Stds AJN, American JournalElenco dei periodici elettronici in Ovid ­ Full text Academic Medicine Addictive Disorders Care Current Opinion in Critical Care Current Opinion in Endocrinology & Diabetes Current Opinion

Malerba, Donato

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

High-Order Entropy-Compressed Text Indexes  

E-Print Network [OSTI]

We present a novel implementation of compressed su~x arrays exhibiting new tradeoffs between search time and space occupancy for a given text (or sequence) of n symbols over an alphabet E, where each symbol is encoded by lg ]E I bits. We show...

Grossi, Roberto; Gupta, Ankur; Vitter, Jeffrey Scott

2003-01-01T23:59:59.000Z

422

Interactive Dimensions in the Construction of Mental Representations for Text  

E-Print Network [OSTI]

Interactive Dimensions in the Construction of Mental Representations for Text David N. Rapp be as critical to the construction of complex mental models as the discrete dimensions themselves. In the present a bead on Specify again. Incredibly, the horse was still rolling along. A pang of fear went through Woolf

Patel, Aniruddh D.

423

Text Summarization by Sentence Extraction and Syntactic Pruning Michel Gagnon  

E-Print Network [OSTI]

disposal, namely a broad- coverage grammar for French, we developed a sys- tem for summarization of French of sentences, performed by the grammar developed within a com- mercial French grammar checking soft- ware texts (and the evaluation thereof), equivalent systems for French are scarce. Given resources at our

Gagnon, Michel

424

Oxford University Press 2005 1 Text Mining and Information Extraction  

E-Print Network [OSTI]

© Oxford University Press 2005 1 Text Mining and Information Extraction Novel Unsupervised Feature Filtering of Biological Data Roy Varshavsky1,* , Assaf Gottlieb2 , Michal Linial3 and David Horn2 1 School developed for selecting small informative feature subsets in large noisy data. However, unsuper- vised

Horn, David

425

Integrating Biomedical Text Mining Services into a Distributed Workflow Environment  

E-Print Network [OSTI]

the workflow. While many scientific workflows primarily involve operations on struc- tured or numerical dataIntegrating Biomedical Text Mining Services into a Distributed Workflow Environment Rob Gaizauskas they are distributed, i.e., where some of the data or processing resources are remote from the scientist initiating

Gaizauskas, Rob

426

Bell's inequality and extremal nonlocal box from Hardy's test for nonlocality  

E-Print Network [OSTI]

Bell showed 50 years ago that quantum theory is nonlocal via his celebrated inequalities, turning the issue of quantum nonlocality from a matter of taste into a matter of test. Years later, Hardy proposed a test for nonlocality without inequality, which is a kind of "something-versus-nothing" argument. Hardy's test for $n$ particles induces an $n$-partite Bell's inequality with two dichotomic local measurements for each observer, which has been shown to be violated by all entangled pure states. Our first result is to show that the Bell-Hardy inequality arising form Hardy's nonlocality test is tight for an arbitrary number of parties, i.e., it defines a facet of the Bell polytope in the given scenario. On the other hand quantum theory is not that nonlocal since it forbids signaling and even not as nonlocal as allowed by non-signaling conditions, i.e., quantum mechanical predictions form a strict subset of the so called non-signaling polytope. In the scenario of each observer measuring two dichotomic observables, Fritz established a duality between the Bell polytope and the non-signaling polytope: tight Bell's inequalities, the facets of the Bell polytope, are in a one-to-one correspondence with extremal non-signaling boxes, the vertices of the non-signaling polytope. Our second result is to provide an alternative and more direct formula for this duality. As an example, the tight Bell-Hardy inequality gives rise to an extremal non-signaling box that serves as a natural multipartite generalization of Popescu-Rohrlich box.

Sixia Yu

2014-03-04T23:59:59.000Z

427

Inferring Group Processes from Computer-Mediated Affective Text Analysis  

SciTech Connect (OSTI)

Political communications in the form of unstructured text convey rich connotative meaning that can reveal underlying group social processes. Previous research has focused on sentiment analysis at the document level, but we extend this analysis to sub-document levels through a detailed analysis of affective relationships between entities extracted from a document. Instead of pure sentiment analysis, which is just positive or negative, we explore nuances of affective meaning in 22 affect categories. Our affect propagation algorithm automatically calculates and displays extracted affective relationships among entities in graphical form in our prototype (TEAMSTER), starting with seed lists of affect terms. Several useful metrics are defined to infer underlying group processes by aggregating affective relationships discovered in a text. Our approach has been validated with annotated documents from the MPQA corpus, achieving a performance gain of 74% over comparable random guessers.

Schryver, Jack C [ORNL; Begoli, Edmon [ORNL; Jose, Ajith [Missouri University of Science and Technology; Griffin, Christopher [Pennsylvania State University

2011-02-01T23:59:59.000Z

428

ECOLE PRATIQUE DES HAUTES ETUDES Mention Histoire, textes et documents  

E-Print Network [OSTI]

Etude diachronique du système verbal persan (Xe -XVIe siècles) : d'un équilibre à l'autre ? Agnès changements morphologiques et syntaxiques du système verbal persan entre les Xe et XVIe siècles. Dix textes en prose représentatifs (régions et dialectes, judéo-persan compris) ont pu faire apparaître les évolutions

Paris-Sud XI, Université de

429

Cross-Language Text Classification J. Scott Olsson  

E-Print Network [OSTI]

word cj . That is, Ei,j P(ei|cj ), 1 i Ne, 1 j Nc E = 0 B @ P(e1|c1) · · · P(e1|cCross-Language Text Classification J. Scott Olsson Dept. of Mathematics University of Maryland their Czech counterparts (e.g., to discuss London more than Prague), so that, having only documents in English

Oard, Doug

430

Widget:ExpandableTextEnd | Open Energy Information  

Open Energy Info (EERE)

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home5b9fcbce19 NoPublic Utilities Address: 160 East 300 South Place: SaltTroyer &AnchorText

431

Finding Text Information in the Ocean of Electronic Documents  

SciTech Connect (OSTI)

Information management in natural resources has become an overwhelming task. A massive amount of electronic documents and data is now available for creating informed decisions. The problem is finding the relevant information to support the decision-making process. Determining gaps in knowledge in order to propose new studies or to determine which proposals to fund for maximum potential is a time-consuming and difficult task. Additionally, available data stores are increasing in complexity; they now may include not only text and numerical data, but also images, sounds, and video recordings. Information visualization specialists at Pacific Northwest National Laboratory (PNNL) have software tools for exploring electronic data stores and for discovering and exploiting relationships within data sets. These provide capabilities for unstructured text explorations, the use of data signatures (a compact format for the essence of a set of scientific data) for visualization (Wong et al 2000), visualizations for multiple query results (Havre et al. 2001), and others (http://www.pnl.gov/infoviz ). We will focus on IN-SPIRE, a MS Windows vision of PNNL’s SPIRE (Spatial Paradigm for Information Retrieval and Exploration). IN-SPIRE was developed to assist information analysts find and discover information in huge masses of text documents.

Medvick, Patricia A.; Calapristi, Augustin J.

2003-02-05T23:59:59.000Z

432

t:\\patent services\\handouts\\current paper\\how to search uspto rev sep 2013.docx 9/16/13 SEARCHING THE USPTO PATENT FULL TEXT DATABASE  

E-Print Network [OSTI]

Search. 2. Enter the first search term in "Term 1" box. Select the field (part of the patent) to search Search "Term 1" box, enter the class number. Select the field: "Current US Classification. 3. Enter the second term, if any, in the "Term 2" box. Select the field for that term. NOTE

Liblit, Ben

433

Trial-Run of a Junction-Box Attachment Test for Use in Photovoltaic Module Qualification: Preprint  

SciTech Connect (OSTI)

Engineering robust adhesion of the junction box (j-box) is a hurdle typically encountered by photovoltaic module manufacturers during product development and manufacturing process control. There are historical incidences of adverse effects (e.g., fires) caused when the j-box/adhesive/module system has failed in the field. The addition of a weight to the j-box during the 'damp-heat,' 'thermal-cycle,' or 'creep' tests within the IEC qualification protocol is proposed to verify the basic robustness of the adhesion system. The details of the proposed test are described, in addition to a trial-run of the test procedure. The described experiments examine four moisture-cured silicones, four foam tapes, and a hot-melt adhesive used in conjunction with glass, KPE, THV, and TPE substrates. For the purpose of validating the experiment, j-boxes were adhered to a substrate, loaded with a prescribed weight, and then subjected to aging. The replicate mock-modules were aged in an environmental chamber (at 85 degrees C/85% relative humidity for 1000 hours; then 100 degrees C/<10% relative humidity for 200 hours) or fielded in Golden (CO), Miami (FL), and Phoenix (AZ) for one year. Attachment strength tests, including pluck and shear test geometries, were also performed on smaller component specimens.

Miller, D. C.; Deibert, S. L.; Wohlgemuth, J. H.

2014-06-01T23:59:59.000Z

434

Doping optimization of polypyrrole with toluenesulfonic acid using Box-Behnken design  

SciTech Connect (OSTI)

A three-level Box-Behnken design was employed in doping optimization of polypyrrole with toluenesulfonic acid (TSA-doped PPy). The material was synthesized via chemical oxidative polymerization using pyrrole, toluenesulfonic acid (TSA) and ammonium persulfate (APS) as monomer, dopant and oxidant, respectively. The critical factors selected for this study were concentration of dopant, molar ratio between dopant to monomer (pyrrole) and concentration of oxidant. Obtaining adequate doping level of TSA-doped PPy is crucial because it affects the charge carriers for doped PPy and usually be responsible for electronic mobility along polymeric chain. Furthermore, the doping level also affects other properties such as electrical and thermal conductivity. Doping level was calculated using elemental analysis. SEM images shows that the prepared TSA-doped PPy particles are spherical in shape with the diameters of about. The range of nanoparticles size is around 80-100 nm. The statistical analysis based on a Box–Behnken design showed that 0.01 mol of TSA, 1:1 mole ratio TSA to pyrrole and 0.25 M APS were the optimum conditions for sufficient doping level.

Syed Draman, Sarifah Fauziah; Daik, Rusli [School of Chemical Sciences and Food Technology, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor (Malaysia); El-Sheikh, Said M. [Nanostructured Materials and Nanotechnology Division, Central Metallurgical Research and Development Institute,11421 Cairo (Egypt); Latif, Famiza Abdul [Faculty of Applied Sciences, Universiti Teknologi MARA Malaysia 40450 Shah Alam, Selangor (Malaysia)

2013-11-27T23:59:59.000Z

435

Charge-insensitive qubit design derived from the Cooper pair box  

SciTech Connect (OSTI)

Short dephasing times pose one of the main challenges in realizing a quantum computer. Different approaches have been devised to cure this problem for superconducting qubits, a prime example being the operation of such devices at optimal working points, so-called 'sweet spots.' This latter approach led to significant improvement of T{sub 2} times in Cooper pair box qubits [D. Vion et al., Science 296, 886 (2002)]. Here, we introduce a new type of superconducting qubit called the 'transmon'. Unlike the charge qubit, the transmon is designed to operate in a regime of significantly increased ratio of Josephson energy and charging energy E{sub J}/E{sub C}. The transmon benefits from the fact that its charge dispersion decreases exponentially with E{sub J}/E{sub C}, while its loss in anharmonicity is described by a weak power law. As a result, we predict a drastic reduction in sensitivity to charge noise relative to the Cooper pair box and an increase in the qubit-photon coupling, while maintaining sufficient anharmonicity for selective qubit control. Our detailed analysis of the full system shows that this gain is not compromised by increased noise in other known channels.

Koch, Jens; Yu, Terri M.; Gambetta, Jay; Houck, A. A.; Schuster, D. I.; Majer, J.; Devoret, M. H.; Girvin, S. M.; Schoelkopf, R. J. [Departments of Physics and Applied Physics, Yale University, New Haven, Connecticut 06520 (United States); Blais, Alexandre [Departement de Physique et Regroupement Quebecois sur les Materiaux de Pointe, Universite de Sherbrooke, Sherbrooke, Quebec, J1K 2R1 (Canada)

2007-10-15T23:59:59.000Z

436

Performance Demonstration Program Plan for Nondestructive Assay of Boxed Wastes for the TRU Waste Characterization Program  

SciTech Connect (OSTI)

The Performance Demonstration Program (PDP) for nondestructive assay (NDA) consists of a series of tests to evaluate the capability for NDA of transuranic (TRU) waste throughout the Department of Energy (DOE) complex. Each test is termed a PDP cycle. These evaluation cycles provide an objective measure of the reliability of measurements obtained from NDA systems used to characterize the radiological constituents of TRU waste. The primary documents governing the conduct of the PDP are the Waste Acceptance Criteria for the Waste Isolation Pilot Plant (WAC; DOE 1999a) and the Quality Assurance Program Document (QAPD; DOE 1999b). The WAC requires participation in the PDP; the PDP must comply with the QAPD and the WAC. The WAC contains technical and quality requirements for acceptable NDA. This plan implements the general requirements of the QAPD and applicable requirements of the WAC for the NDA PDP for boxed waste assay systems. Measurement facilities demonstrate acceptable performance by the successful testing of simulated waste containers according to the criteria set by this PDP Plan. Comparison among DOE measurement groups and commercial assay services is achieved by comparing the results of measurements on similar simulated waste containers reported by the different measurement facilities. These tests are used as an independent means to assess the performance of measurement groups regarding compliance with established quality assurance objectives (QAO’s). Measurement facilities must analyze the simulated waste containers using the same procedures used for normal waste characterization activities. For the boxed waste PDP, a simulated waste container consists of a modified standard waste box (SWB) emplaced with radioactive standards and fabricated matrix inserts. An SWB is a waste box with ends designed specifically to fit the TRUPACT-II shipping container. SWB’s will be used to package a substantial volume of the TRU waste for disposal. These PDP sample components are distributed to the participating measurement facilities that have been designated and authorized by the Carlsbad Field Office (CBFO). The NDA Box PDP materials are stored at these sites under secure conditions to protect them from loss, tampering, or accidental damage. Using removable PDP radioactive standards, isotopic activities in the simulated waste containers are varied to the extent possible over the range of concentrations anticipated in actual waste characterization situations. Manufactured matrices simulate expected waste matrix configurations and provide acceptable consistency in the sample preparation process at each measurement facility. Analyses that are required by the Waste Isolation Pilot Plant (WIPP) to demonstrate compliance with various regulatory requirements and that are included in the PDP may only be performed by measurement facilities that demonstrate acceptable performance in the PDP. These analyses are referred to as WIPP analyses, and the wastes on which they are performed are referred to as WIPP wastes in this document.

Carlsbad Field Office

2001-01-31T23:59:59.000Z

437

Solar Energy Education. Renewable energy: a background text. [Includes glossary  

SciTech Connect (OSTI)

Some of the most common forms of renewable energy are presented in this textbook for students. The topics include solar energy, wind power hydroelectric power, biomass ocean thermal energy, and tidal and geothermal energy. The main emphasis of the text is on the sun and the solar energy that it yields. Discussions on the sun's composition and the relationship between the earth, sun and atmosphere are provided. Insolation, active and passive solar systems, and solar collectors are the subtopics included under solar energy. (BCS)

Not Available

1985-01-01T23:59:59.000Z

438

Home Energy Score Update (text version) | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE:1 First Use of Energy for All Purposes (Fuel and Nonfuel),Feet) Year Jan Feb Mar Apr May Jun Jul(Summary) "ofEarly Career Scientists'Montana.ProgramJulietip sheetK-4In 2013 many|Humans haveVersion) | Department ofa text

439

DTE Energy Video (Text Version) | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious Rank EERE:YearRound-UpHeat Pump Models | Department1 Prepared by:DTE Energy Video (Text Version) DTE Energy

440

lynda.com Video (Text Version) | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion |Energy Usage »of|Energy 1.xlsEnergyPRESERVE THE KNOWLEDGE BASElynda.com Video (Text

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

Schneider Electric Video 1 (Text Version) | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion | Department ofT ib l LPROJECTS IN7 RoadmapProgram| Department1 (Text Version) Schneider

442

Schneider Electric Video 2 (Text Version) | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion | Department ofT ib l LPROJECTS IN7 RoadmapProgram| Department1 (Text Version) Schneider2

443

Nissan Video 1 (Text Version) | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion | Department ofT ib l L d F S iPartnership Program |MillionNextNick Sinai About Us1 (Text

444

Nissan Video 2 (Text Version) | Department of Energy  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page on Delicious RankCombustion | Department ofT ib l L d F S iPartnership Program |MillionNextNick Sinai About Us1 (Text2

445

International Amaldi Conferences of Academies of Sciences and National Scientific Societies on Scientific Questions of Global Security  

E-Print Network [OSTI]

advice in questions of security policy, x the role of the nuclear option in regional conflicts, x methods on Scientific Questions of Global Security on Scientific Questions of Global Security 14-16 March 2008, DESY, Hamburg

446

Frequently Asked Questions Regarding DOE-STD-1195-2011, Design...  

Office of Environmental Management (EM)

Design of Safety Significant Safety Instrumented Systems Used at DOE Non-Reactor Nuclear Facilities Frequently Asked Questions Regarding DOE-STD-1195-2011, Design...

447

To Refseq or ReSeq Oryza - That is the Question (2009 JGI User Meeting)  

ScienceCinema (OSTI)

Rod Wing from the University of Arizona asked, "To Refseq or Reseq Oryza - That is the Question" on March 27, 2009 at the 4th Annual User Meeting

Wing, Rod [Arizona Genomics Institute, University of Tennessee

2011-04-25T23:59:59.000Z

448

Controlled Hydrogen Fleet and Infrastructure Demonstration and Validation Project Pre-Solicitation Meeting: Questions and Answers  

Broader source: Energy.gov [DOE]

Questions and answers from the pre-solicitation meeting for the Controlled Hydrogen Fleet and Infrastructure Demonstration and Validation Project held March 19, 2003, in Southfield, Michigan.

449

Middle School Academic Question Resources | U.S. DOE Office of...  

Office of Science (SC) Website

Academic Question Resources National Science Bowl (NSB) NSB Home About High School Middle School Middle School Students Middle School Coaches Middle School Regionals Middle...

450

The question of faith : U.S.-based religious NGOs in international relief and development  

E-Print Network [OSTI]

(cont.) humanitarian role? (4) How do these organizations deal with the ICRC's humanitarian principles of neutrality, impartiality and independence? To answer these questions, I analyze organizational documents, examine ...

Emmert, Mark David, 1971-

2004-01-01T23:59:59.000Z

451

To Refseq or ReSeq Oryza - That is the Question (2009 JGI User Meeting)  

SciTech Connect (OSTI)

Rod Wing from the University of Arizona asked, "To Refseq or Reseq Oryza - That is the Question" on March 27, 2009 at the 4th Annual User Meeting

Wing, Rod [Arizona Genomics Institute, University of Tennessee] [Arizona Genomics Institute, University of Tennessee

2009-03-27T23:59:59.000Z

452

Ten Frequently Asked Questions and Answers About Wind Energy Grid Integration  

Broader source: Energy.gov [DOE]

First presented to the Kansas State Legislature in 2008, these slides present 10 questions and answers regarding basic wind power issues including technology, transmission, and integration.

453

NSS 18.4 Unreviewed Safety Questions 12/8/04  

Broader source: Energy.gov [DOE]

The objective of this surveillance is to examine the contractor's implementation of the Unreviewed Safety Question (USQ) Process.  The surveillance focuses on verifying that the contractor has...

454

Clean Transportation | Campus Box 7409, Raleigh, NC 27695 | 919-513-7831 | www.cleantransportation.org North Carolina State University, Campus Box 7409, Raleigh, NC 27695 | 919-513-7831 | www.cleantransportation.org 8/7/12  

E-Print Network [OSTI]

through sub- Advancing Clean Energy for a Sustainable Economy Clean Fuel Advanced Technology (CFAT) 2010Clean Transportation | Campus Box 7409, Raleigh, NC 27695 | 919-513-7831 | www.cleantransportation.org 8/7/12 Clean Fuel Advanced Technology (CFAT) Project 2006-20012: Administered by the NC Solar Center

455

Clean Transportation | Campus Box 7409, Raleigh, NC 27695 | 919-513-7831 | www.cleantransportation.org North Carolina State University, Campus Box 7409, Raleigh, NC 27695 | 919-513-7831 | www.cleantransportation.org 9/17/12  

E-Print Network [OSTI]

in an liquefied petroleum gas (LPG) sub-award with the Iredell Advancing Clean Energy for a Sustainable EconomyClean Transportation | Campus Box 7409, Raleigh, NC 27695 | 919-513-7831 | www.cleantransportation.org 9/17/12 Clean Fuel Advanced Technology (CFAT) Project 2006-20012: Administered by the NC Solar

456

Feasibility of white-rot fungi for biodegradation of PCP-treated ammunition boxes. Final report  

SciTech Connect (OSTI)

Millions of pounds of wood ammunition boxes treated with the wood preservative pentachiorophenol (PCP) are being stockpiled at military installations, primarily depots, because cost-effective disposal is not readily available. The Army needs cost-effective and environmentally benign treatment methods for destruction and disposal of PCP-treated wood products. This research investigated the use of white-rot fungi to biodegrade PCP-treated wood. Results showed that white-rot fungi effectively decreased the PCP concentration in contaminated hardwood and softwood chips. Under ideal laboratory conditions the fungi reduced the PCP concentration by 80 percent; a field study showed only a 30 percent decrease in PCP concentration. Despite this disparity, this study demonstrated the feasibility of using white-rot fungi to reduce PCP in treated wood.

Scholze, R.J.; Lamar, R.T.; Bolduc, J.; Dietrich, D.

1995-01-01T23:59:59.000Z

457

REDUCTIONS WITHOUT REGRET: AVOIDING WRONG TURNS, ROACH MOTELS, AND BOX CANYONS  

SciTech Connect (OSTI)

This is the third of three papers (in addition to an introductory summary) aimed at providing a framework for evaluating future reductions or modifications of the U.S. nuclear force, first by considering previous instances in which nuclear-force capabilities were eliminated; second by looking forward into at least the foreseeable future at the features of global and regional deterrence (recognizing that new weapon systems currently projected will have expected lifetimes stretching beyond our ability to predict the future); and third by providing examples of past or possible undesirable outcomes in the shaping of the future nuclear force, as well as some closing thoughts for the future. In this paper, we provide one example each of our judgments on what constitutes a box canyon, a roach motel, and a wrong turn: ? Wrong Turn: The Reliable Replacement Warhead ? Roach Motel: SRAM T vs the B61 ? A Possible Box Canyon: A Low-Yield Version of the W76 SLBM Warhead Recognizing that new nuclear missions or weapons are not demanded by current circumstances ? a development path that yields future capabilities similar to those of today, which are adequate if not always ideal, and a broader national-security strategy that supports nonproliferation and arms control by reducing the role for, and numbers, of nuclear weapons ? we briefly consider alternate, less desirable futures, and their possible effect on the complex problem of regional deterrence. In this regard, we discuss the issues posed by, and possible responses to, three example regional deterrence challenges: in-country defensive use of nuclear weapons by an adversary; reassurance of U.S. allies with limited strategic depth threatened by an emergent nuclear power; and extraterritorial, non-strategic offensive use of nuclear weapons by an adversary in support of limited military objectives against a U.S. ally.

Swegle, J.; Tincher, D.

2013-09-11T23:59:59.000Z

458

Simulating infiltration tests in fractured basalt at the Box Canyon Site, Idaho  

SciTech Connect (OSTI)

The results of a series of ponded infiltration tests in variably saturated fractured basalt at Box Canyon, Idaho, were used to build confidence in conceptual and numerical modeling approaches used to simulate infiltration in fractured rock. Specifically, we constructed a dual-permeability model using TOUGH2 to represent both the matrix and fracture continua of the upper basalt flow at the Box Canyon site. A consistent set of hydrogeological parameters was obtained by calibrating the model to infiltration front arrival times in the fracture continuum as inferred from bromide samples collected from fracture/borehole intersections observed during the infiltrating tests. These parameters included the permeability of the fracture and matrix continua, the interfacial area between the fracture and matrix continua, and the porosity of the fracture continuum. To calibrate the model, we multiplied the fracture-matrix interfacial area by a factor between 0.1 and 0.01 to reduce imbibition of water from the fracture continuum into the matrix continuum during the infiltration tests. Furthermore, the porosity of the fracture continuum, as calculated using the fracture aperture inferred from pneumatic-test permeabilities, was increased by a factor of 50 yielding porosity values for the upper basalt flow in the range of 0.01 to 0.02. The fracture-continuum porosity was a highly sensitive parameter controlling the arrival times of the simulated infiltration fronts. Porosity values are consistent with those determined during the Large-Scale Aquifer Pumping and Infiltration Test at the Idaho National Engineering and Environmental Laboratory.

Unger, Andre J.A.; Faybishenko, Boris; Bodvarsson, Gudmundur S.; Simmons, Ardyth M.

2003-04-01T23:59:59.000Z

459

A Single Tower Configuration of the Modular Gamma Box Counter System - 13392  

SciTech Connect (OSTI)

Canberra's Standard Gamma Box Counter System is designed to perform accurate quantitative assays of gamma emitting nuclides for a wide range of large containers including B-25 crates and ISO shipping containers. Using a modular building-block approach, the system offers tremendous flexibility for a variety of measurement situations with wide ranges of sample activities and throughput requirements, as well as the opportunity to modify the configuration for other applications at a later date. The typical configuration consists of two opposing towers each equipped with two high purity germanium detectors, and an automated container trolley. This paper presents a modified configuration, consisting of a single tower placed inside a measurement trailer with three detector assemblies, allowing for additional vertical segmentation as well as a viewing a container outside the trailer through the trailer wall. An automatic liquid nitrogen fill system is supplied for each of the detectors. The use of a forklift to move the container for horizontal segmentation is accommodated by creating an additional operational and calibration set-up in the NDA 2000 software to allow for the operator to rotate the container and assay the opposite side, achieving the same sensitivity as a comparable two-tower system. This Segmented Gamma Box Counter System retains the core technologies and design features of the standard configuration. The detector assemblies are shielded to minimize interference from environmental and plant background, and are collimated to provide segmentation of the container. The assembly positions can also be modified in height and distance from the container. The ISOCS calibration software provides for a flexible approach to providing the calibrations for a variety of measurement geometries. The NDA 2000 software provides seamless operation with the current configuration, handling the data acquisition and analysis. In this paper, an overview of this system is discussed, along with the measured performance results, calibration methodology and verification, and minimum detectable activity levels. (authors)

Morris, K.; Nakazawa, D.; Francalangia, J.; Gonzalez, H. [Canberra Industries Inc., 800 Research Parkway, Meriden, CT, 06450 (United States)] [Canberra Industries Inc., 800 Research Parkway, Meriden, CT, 06450 (United States)

2013-07-01T23:59:59.000Z

460

NCSU Box 7401 Raleigh, NC 27695 (919) 515-3480 Toll Free 1-800-33-NC SUN SOLAR CENTER INFORMATION  

E-Print Network [OSTI]

Solar Home #12;NorthCarolinaSolarCenter EnergyDivision,NCDepartmentofCommerce Box 7401, NCSU, Raleigh. At North Carolinas latitudes, this means that the area extending from 45o east of south to 45o westNCSU Box 7401 Raleigh, NC 27695 (919) 515-3480 Toll Free 1-800-33-NC SUN SOLAR CENTER

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

Figure 1. The dataset for the running example is excerpted at left, arranged in the typical manner for MVPA. The boxes at right introduce the dataset  

E-Print Network [OSTI]

Figure 1. The dataset for the running example is excerpted at left, arranged in the typical manner for MVPA. The boxes at right introduce the dataset representation used in later figures. In these boxes the "dataset-wise" scheme, the examples are relabeled prior to conducting the cross- validation, while

462

Author Addresses: J.A. van Biljon, School of Computing, University of South Africa, P O Box 392, UNISA, 0003, South Africa; vbiljja@unisa.ac.za  

E-Print Network [OSTI]

Addresses: J.A. van Biljon, School of Computing, University of South Africa, P O Box 392, UNISA, 0003, South Africa; vbiljja@unisa.ac.za P Kotze, School of Computing, University of South Africa, P O Box 392, UNISA, 0003, South Africa; kotzep@unisa.ac.za K. V. Renaud, Department of Computing Science, The University

Williamson, John

463

P.O. Box 2078 Carlsbad, New Mexico USA 88221-2078 Phone: (505) 234-7200 Fax: (505) 234-7083  

E-Print Network [OSTI]

P.O. Box 2078 Carlsbad, New Mexico USA 88221-2078 Phone: (505) 234-7200 Fax: (505) 234-7083 TP TS:02018 P.O. Box 2078 Carlsbad, New Mexico USA 88221-2078 Phone: (505) 234-7200 Fax: (505) 234

464

W. K. Edwards et al.: An Extensible Set-Top Box Platform for Home Media Applications Contributed Paper  

E-Print Network [OSTI]

of this platform is that it can dynamically exchange code with other devices on the home network, allowing that allows control over a variety of home devices.1 Index Terms -- set-top box, home network, mobile code@cc.gatech.edu). He was previously at the Palo Alto Research Center (PARC). Mark W. Newman and Trevor Smith

Edwards, Keith

465

Hydrogen Concentration in the Inner-Most Container within a Pencil Tank Overpack Packaged in a Standard Waste Box Package  

SciTech Connect (OSTI)

The purpose of this report is to evaluate hydrogen generation within Pencil Tank Overpacks (PTO) in a Standard Waste Box (SWB), to establish plutonium (Pu) limits for PTOs based on hydrogen concentration in the inner-most container and to establish required configurations or validate existing or proposed configurations for PTOs. The methodology and requirements are provided in this report.

Marusich, Robert M.

2013-08-15T23:59:59.000Z

466

Sycamore Cogeneration Company Box 80598, Bakersfield, CA 93380 (661) 615-4630 Neil E. Burgess, Executive Director  

E-Print Network [OSTI]

Sycamore Cogeneration Company Box 80598, Bakersfield, CA 93380 (661) 615-4630 Neil E. Burgess Commission 1516 Ninth Street Sacramento, CA 95814 Re: Sycamore Cogeneration Company (84-AFC-6C) Petition of the combustion gas turbine units at Sycamore Cogeneration Company in an extended startup mode. The petition

467

Green Supply Chain: Thinking Outside the (Cardboard) Box Published on GreenBizSite (http://www.greenbiz.com)  

E-Print Network [OSTI]

plastic totes to transport their premium chocolate squares inside the plant and to outside packagers savings over the course of five years, the assumed life span of the containers and washing equipment. Like boxes and wood pallets, reusable containers and pallets are made of durable materials and designed

468

Division of Student Services 514 Gruening Building, P.O. Box 756340, Fairbanks, Alaska 99775-6340  

E-Print Network [OSTI]

Division of Student Services 514 Gruening Building, P.O. Box 756340, Fairbanks, Alaska 99775 AGREEMENT for the Review of Infrastructure, Sustainability and Energy Board Between the Associated Students of Sustainability, Faculty Senate, and Staff Council March 2011 Preamble In order to promote investment in energy

Ickert-Bond, Steffi

469

The Center for Business and Economic Research Box 456002 4505 South Maryland Parkway Las Vegas, Nevada 89154-6002  

E-Print Network [OSTI]

The Center for Business and Economic Research Box 456002 · 4505 South Maryland Parkway · Las Vegas of Pages Including Cover: Date: CBER Announces Its 2014 Midyear Southern Nevada Economic Update Conference The Center for Business and Economic Research (CBER) will host its 2014 Midyear Southern Nevada Economic

Hemmers, Oliver

470

Black-box System Testing of Real-Time Embedded Systems Using Random and Search-based Testing  

E-Print Network [OSTI]

of nuclear reactors and flying systems). Testing RTES is particularly chal- lenging since they operateBlack-box System Testing of Real-Time Embedded Systems Using Random and Search-based Testing Andrea. Testing real-time embedded systems (RTES) is in many ways chal- lenging. Thousands of test cases can

Boyer, Edmond

471

HumanWildlife Interactions 5(1):100105, Spring 2011 A rat-resistant artificial nest box for  

E-Print Network [OSTI]

Human­Wildlife Interactions 5(1):100­105, Spring 2011 A rat-resistant artificial nest box for cavity-nesting birds WILLIAM C. PITT, USDA/APHIS/Wildlife Services' National Wildlife Research Center elevation areas of the Alakai Plateau. Puaiohi nest primarily on steep streamside cliffs

472

Lavender Foal Syndrome Hair Sample Sheet Please tape hair samples within boxed area as illustrated and place in individual envelope.  

E-Print Network [OSTI]

Lavender Foal Syndrome Hair Sample Sheet Please tape hair samples within boxed area as illustrated and place in individual envelope. *Pull 50 hairs from the tail or mane (do not use hairs shed on brush) #Hairs must be pulled, not cut #Hairs must contain hair root *Align the "roots" of the hairs and trim

Keinan, Alon

473

Climate Insights 101 Questions and Discussion Points: Module 1, Lesson 4: An Introduction to Climate Modelling  

E-Print Network [OSTI]

Climate Insights 101 Questions and Discussion Points: Module 1, Lesson 4: An Introduction to Climate Modelling 1 Climate Insights 101 Questions and Discussion Points Module 1, Lesson 4: An Introduction to Climate Modelling Available at http://pics.uvic.ca/education/climate-insights-101 Updated May

Pedersen, Tom

474

Detecting API Usage Obstacles: A Study of iOS and Android Developer Questions  

E-Print Network [OSTI]

Detecting API Usage Obstacles: A Study of iOS and Android Developer Questions Wei Wang and Michael, they often encounter obstacles in finding the correct usage of the API, let alone to employ best practices. Previous research addresses this line of questions by mining API usage patterns to induce API usage

Godfrey, Michael W.

475

Liquified Natural Gas (LNG) for Hawaii: Policy, Economic, and Technical Questions  

E-Print Network [OSTI]

Liquified Natural Gas (LNG) for Hawaii: Policy, Economic, and Technical Questions This report Natural Gas for Hawai`i: Policy Economic and Technical Questions Prepared for the U.S. Department Hawai`i Energy Sustainability Program Task 4: Deliverable on Liquefied Natural Gas Prepared by FACTS

476

QUESTIONS ON WILD Z/pZ-QUOTIENT SINGULARITIES IN DIMENSION 2  

E-Print Network [OSTI]

QUESTIONS ON WILD Z/pZ-QUOTIENT SINGULARITIES IN DIMENSION 2 DINO LORENZINI 1. Some questions Let A is called a wild cyclic quotient singularity. Let f : X Z be a resolution of the singularity, minimal a terminal chain. Wild Z/pZ-quotient singularities of surfaces are expected to have resolution graphs which

Lorenzini, Dino J.

477

Building a Foundation System for Producing Short Answers to Factual Questions  

E-Print Network [OSTI]

. As newcomers to the TREC Q&A task, our goal was not to compete with the best systems, but rather to implement at Boulder as part of ARDA's AQUAINT program. As a foundation for targeting complex questions involving questions. We submitted results from the two systems to TREC's Q&A track, and the bulk of this paper

Yu, Hong

478

Fast and Effective Kernels for Relational Learning from Texts Alessandro Moschitti MOSCHITTI@DIT.UNITN.IT  

E-Print Network [OSTI]

to the question are retrieved Appearing in Proceedings of the 24th International Conference on Machine Learning and provide an optimization for its computation which greatly reduces the learning and testing time. Our and Question An- swering. 1. Introduction Statistical relational learning is a wide research area that includes

Moschitti, Alessandro

479

Confirming sound absorption characteristics of box absorbers that utilize laser-cut micro-slits on the top surface as the means of sound absorption, with an exploration of different architectural installations  

E-Print Network [OSTI]

It is believed that the box absorber utilizes viscous forces present in micro-slits on their surfaces to absorb sound [8]. These box absorbers were developed through research at SINTEF and the Norwegian University of Science ...

Matlack, Kathryn H

2008-01-01T23:59:59.000Z

480

Jennifer Learned, Dana Nakase, Enrique Vivoni, and Sharon J . Hall. Arizona State University, PO Box 874501, Tempe AZ 85287-4501. Background: Plant growth in arid ecosystems is water limited. Soil water  

E-Print Network [OSTI]

Box 874501, Tempe AZ 85287-4501. Background: Plant growth in arid ecosystems is water limited. Soil and temperature sensors were installed at 7 cm. · Atmospheric temperature & humidity sensors were deployed in the soil box via sensors. · Simulations in Hydrus 2D were run to match soil box experiments. · Model output

Hall, Sharon J.

Note: This page contains sample records for the topic "question text box" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

Energy efficiency standards for eight consumer products: public meeting clarification, questions and answers  

SciTech Connect (OSTI)

Eighteen corporations and manufacturers provided answers to many questions posed at a public meeting on energy efficiency standards for eight consumer products. Questions on the regulations concerning the manufacturing standards, performance standards, and testing standards are included. Questions were posed about air conditioners, refrigerators, refrigerator-freezers, stoves (ranges), ovens, clothes dryers, oil fired burners, water heaters, furnaces, etc. A presentation containing information pertaining to the values of average annual energy consumption per unit used by DOE in its analysis leading to proposed energy efficiency standards for nine types of consumer products is included. (MCW)

None

1980-08-01T23:59:59.000Z

482

Results of the DF-4 BWR (boiling water reactor) control blade-channel box test  

SciTech Connect (OSTI)

The DF-4 in-pile fuel damage experiment investigated the behavior of boiling water reactor (BWR) fuel canisters and control blades in the high temperature environment of an unrecovered reactor accident. This experiment, which was carried out in the Annular Core Research Reactor (ACRR) at Sandia National Laboratories, was performed under the USNRC's internationally sponsored severe fuel damage (SFD) program. The DF-4 test is described herein and results from the experiment are presented. Important findings from the DF-4 test include the low temperature melting of the stainless steel control blade caused by reaction with the B{sub 4}C, and the subsequent low temperature attack of the Zr-4 channel box by the relocating molten blade components. Hydrogen generation was found to continue throughout the experiment, diminishing slightly following the relocation of molten oxidizing zircaloy to the lower extreme of the test bundle. A large blockage which was formed from this material continued to oxidize while steam was being fed into the the test bundle. The results of this test have provided information on the initial stages of core melt progression in BWR geometry involving the heatup and cladding oxidation stages of a severe accident and terminating at the point of melting and relocation of the metallic core components. The information is useful in modeling melt progression in BWR core geometry, and provides engineering insight into the key phenomena controlling these processes. 12 refs., 12 figs.

Gauntt, R.O.; Gasser, R.D.

1990-10-01T23:59:59.000Z

483

The Ends of Islamic Fundamentalism: Hegemonic Discourse and the Islamic Question in Egypt  

E-Print Network [OSTI]

AND THE ISLAMIC QUESTION IN EGYPT JUAN E D U A R D O C A M PGermany. Israel, and Egypt. Besides Piscatori*s editedIslamic 'Awakening' in Egypt," Arabic Studies Quarterly 9 (

Campo, Juan E.

1995-01-01T23:59:59.000Z

484

Question of the Week: How Do You Feel About the Extended Daylight...  

Broader source: Energy.gov (indexed) [DOE]

Feel About the Extended Daylight Saving Time? Question of the Week: How Do You Feel About the Extended Daylight Saving Time? March 12, 2009 - 6:00am Addthis Have you been drinking...

485

will help to address these questions. A more practical concern is what happens  

E-Print Network [OSTI]

will help to address these questions. A more practical concern is what happens next. Eutrophication, in the most polluted lakes. This finding is consistent with the hypothesis that eutrophication reduced eco

Lee, Cin-Ty Aeolus

486

Question of the Week: How Do You Reduce Your Water Heating Costs...  

Broader source: Energy.gov (indexed) [DOE]

Reduce Your Water Heating Costs Question of the Week: How Do You Reduce Your Water Heating Costs February 19, 2009 - 1:39pm Addthis Water heating can account for a significant...

487

Question of the Week: What Kind of Heating System Do You Have...  

Broader source: Energy.gov (indexed) [DOE]

Kind of Heating System Do You Have in Your Home? Question of the Week: What Kind of Heating System Do You Have in Your Home? November 20, 2008 - 8:39am Addthis As we note on...

488

CONFERENCE REPORT Open Questions on the Origin of Life at Anoxic  

E-Print Network [OSTI]

concentrations of Zn, Mn and phosphorous compounds. Geochemical reconstruction shows that the ionic composition and enriched in K+ ions and phosphorous compounds. Here we address some questions that have appeared in print

Steinhoff, Heinz-JĂĽrgen

489

Surveillance Guide - NSS 18.4 Un-reviewed Safety Questions  

Broader source: Energy.gov (indexed) [DOE]

controls to ensure compliance with USQ requirements. 2.0 References 2.1 10 CFR 830.203, Unreviewed Safety Question Process 2.2 DOE Guide 424.1-1, Implementation Guide...

490

Methods for Automatically Evaluating Answers to Complex Questions Jimmy Lin1,2,3  

E-Print Network [OSTI]

Methods for Automatically Evaluating Answers to Complex Questions Jimmy Lin1,2,3 and Dina Demner to synonymy, name variations, etc.). Please cite as: Jimmy Lin and Dina Demner-Fushman. Methods

Lin, Jimmy

491

Answering Questions about Moving Objects in Videos Boris Katz, Jimmy Lin, Chris Stauffer, and Eric Grimson  

E-Print Network [OSTI]

Chapter 12 Answering Questions about Moving Objects in Videos Boris Katz, Jimmy Lin, Chris Stauffer in The final version of this book chapter appears as: Boris Katz, Jimmy Lin, Chris Stauffer and Eric Grimson

Stauffer, Christopher

492

Question of the Week: How Will You Landscape for Energy Efficiency...  

Broader source: Energy.gov (indexed) [DOE]

Will You Landscape for Energy Efficiency? Question of the Week: How Will You Landscape for Energy Efficiency? April 9, 2009 - 11:31am Addthis On Tuesday, Elizabeth wrote about some...

493

The Relationship Between Leadership Level and Preference for Administrative Interview Questions  

E-Print Network [OSTI]

The purpose of this study was to determine whether administrators at differing levels (elementary, secondary and central office) had a preference for interview questions and composite scales designed to identify effective ...

Tulipana, Teresa Marie

2010-05-31T23:59:59.000Z

494

Text-Alternative Version of TAP Webinar: High Performance Outdoor Lighting Accelerator  

Broader source: Energy.gov [DOE]

Nebiat Solomon ? We are going to give other attendees a few minutes to get on, and then we’ll be ready to start.  Just so you know, if you have questions along the way, just type them into the...

495

Answers to questions about updated estimates of occupational radiation doses at Three Mile Island, Unit 2  

SciTech Connect (OSTI)

The purpose of this question and answer report is to provide a clear, easy-to-understand explanation of revised radiation dose estimates which workers are likely to receive over the course of the cleanup at Three Mile Island, Unit 2, and of the possible health consequences to workers of these new estimates. We will focus primarily on occupational dose, although pertinent questions about public health and safety will also be answered.

Not Available

1983-12-01T23:59:59.000Z

496

Review of Literature on Terminal Box Control, Occupancy Sensing Technology and Multi-zone Demand Control Ventilation (DCV)  

SciTech Connect (OSTI)

This report presents an overall review of the standard requirement, the terminal box control, occupancy sensing technology and DCV. There is system-specific guidance for single-zone systems, but DCV application guidance for multi-zone variable air volume (VAV) systems is not available. No real-world implementation case studies have been found using the CO2-based DCV. The review results also show that the constant minimum air flow set point causes excessive fan power consumption and potential simultaneous heating and cooling. Occupancy-based control (OBC) is needed for the terminal box in order to achieve deep energy savings. Key to OBC is a technology for sensing the actual occupancy of the zone served in real time. Several technologies show promise, but none currently fully meets the need with adequate accuracy and sufficiently low cost.

Liu, Guopeng; Dasu, Aravind R.; Zhang, Jian

2012-03-01T23:59:59.000Z

497

Field testing of component-level model-based fault detection methods for mixing boxes and VAV fan systems  

SciTech Connect (OSTI)

An automated fault detection and diagnosis tool for HVAC systems is being developed, based on an integrated, life-cycle, approach to commissioning and performance monitoring. The tool uses component-level HVAC equipment models implemented in the SPARK equation-based simulation environment. The models are configured using design information and component manufacturers' data and then fine-tuned to match the actual performance of the equipment by using data measured during functional tests of the sort using in commissioning. This paper presents the results of field tests of mixing box and VAV fan system models in an experimental facility and a commercial office building. The models were found to be capable of representing the performance of correctly operating mixing box and VAV fan systems and detecting several types of incorrect operation.

Xu, Peng; Haves, Philip

2002-05-16T23:59:59.000Z

498

New features of Wehrl entropy and Wehrl PD of a single Cooper-pair box placed inside a dissipative cavity  

SciTech Connect (OSTI)

In this paper, we discuss the coherence of a single Cooper-pair box irradiated by a single-mode quantized field in a coherent state inside a phase-damped cavity. Analytic results under certain parametric conditions are obtained, by means of which we analyze the influence of dissipation on the Wehrl entropy and Wehrl phase distribution. An interesting relation between the coherence and the dissipation effect is observed.

Abdel-Khalek, S., E-mail: sayedquantum@yahoo.co.u [Mathematics Department, Faculty of Science, Sohag University, 82524 Sohag (Egypt); Obada, A.-S.F. [Mathematics Department, Faculty of Science, Al-Azhar University, Cairo (Egypt)

2010-11-15T23:59:59.000Z

499

Priority Questions  

Broader source: Energy.gov (indexed) [DOE]

condensing vs. non-condensing furnaces. That is, consumers who have good payback economics for condensing furnaces are actually less likely to be affected by a rule than those...

500

QUESTION RESPONSE  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

can be mitigated? 2019 was chosen based on DOE's estimation of the impact to the domestic uranium mining, conversion, and enrichment industries from other uranium transactions...