National Library of Energy BETA

Sample records for original mailing totaled

  1. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  2. Electronic Mail Analysis Capability

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2001-01-08

    Establishes the pilot program to test the Department of Energy (DOE) Electronic Mail Analysis Capability (EMAC), which will be used to monitor and analyze outgoing and incoming electronic mail (e-mail) from the National Nuclear Security Administration (NNSA) and DOE laboratories that are engaged in nuclear weapons design or work involving special nuclear material. No cancellation.

  3. Mail Services User's Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2000-07-12

    This Manual provides detailed information on using the Department of Energy (DOE) mail services. Canceled by DOE G 573.1-1.

  4. mail_paycheck_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Updated:
11/16/09
 P.O Box 1663 Los Alamos, New Mexico 87544 MAIL PAYCHECK FORM TO: CRAFT PAYROLL DEPARTMENT - P238 FROM: (Please Print) Z# ORG CODE PLEASE MAIL MY PAYCHECK, TO THE ADDRESS ON FILE WITH PAYROLL, FOR THE PAY PERIOD BEGINNING: EMPLOYEE SIGNATURE Z# DATE SUPERVISOR SIGNATURE Z# DATE

  5. Request Repository Mailing List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support https://nim.nersc.gov accounts@nersc.gov 1-800-66-NERSC, option 2 or 510-486-8612 Consulting http://help.nersc.gov consult@nersc.gov 1-800-66-NERSC, option 3 or 510-486-8611 Home » For Users » Request Repository Mailing List Request Repository Mailing List Use this form to request a

  6. Mail and Distribution | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  7. By Certified Mail May

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By Certified Mail May 4,2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestLand Transfer Dear Ms. Riehle: Pursuant to the...

  8. By E-Mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By E-Mail May 29, 2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestTank Inventories Dear Ms. Riehle: Pursuant to the...

  9. Total

    U.S. Energy Information Administration (EIA) Indexed Site

    Cell shipments Total Inventory, start-of-year 328,658 Manufactured during reporting year ... Table 5. Source and disposition of photovoltaic cell shipments, 2013 (peak kilowatts) ...

  10. Mail Services | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  11. PDSF Mailing Lists

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Lists PDSF Mailing Lists pdsf-status@nersc.gov This is voluntary. You have to subscribe to it. This list can be chatty, since major and minor problems are sent to this list. Also multiple status updates will be sent for extended outages. Subscribe: Send email to pdsf-status-request@nersc.gov with subscribe in the subject of the message. Unsubscribe: Send email to pdsf-status-request@nersc.gov with unsubscribe in the subject of the message. pdsf-users@nersc.gov Users are subscribed to

  12. Total............................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    Total................................................................... 111.1 2,033 1,618 1,031 791 630 401 Total Floorspace (Square Feet) Fewer than 500............................................... 3.2 357 336 113 188 177 59 500 to 999....................................................... 23.8 733 667 308 343 312 144 1,000 to 1,499................................................. 20.8 1,157 1,086 625 435 409 235 1,500 to 1,999................................................. 15.4 1,592

  13. Mail Services User's Guide

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2005-10-03

    This Guide provides information on using Department of Energy (DOE) mail services in accordance with U.S. Postal Service, General Services Administration (GSA), and DOE regulations. Cancels DOE M 573.1-1. Canceled by DOE N 251.89.

  14. Total..........................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    14.7 7.4 12.5 12.5 18.9 18.6 17.3 9.2 Floorspace (Square Feet) Total Floorspace 1 Fewer than 500...... 3.2 0.7 Q 0.3 0.3 0.7 0.6 0.3 Q 500 to ...

  15. Total

    U.S. Energy Information Administration (EIA) Indexed Site

    Product: Total Crude Oil Liquefied Petroleum Gases Propane/Propylene Normal Butane/Butylene Other Liquids Oxygenates Fuel Ethanol MTBE Other Oxygenates Biomass-based Diesel Other Renewable Diesel Fuel Other Renewable Fuels Gasoline Blending Components Petroleum Products Finished Motor Gasoline Reformulated Gasoline Conventional Gasoline Kerosene-Type Jet Fuel Kerosene Distillate Fuel Oil Distillate Fuel Oil, 15 ppm Sulfur and Under Distillate Fuel Oil, Greater than 15 ppm to 500 ppm Sulfur

  16. Total..........................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    . 111.1 20.6 15.1 5.5 Floorspace (Square Feet) Total Floorspace 1 Fewer than 500................................................... 3.2 0.9 0.5 0.4 500 to 999........................................................... 23.8 4.6 3.6 1.1 1,000 to 1,499..................................................... 20.8 2.8 2.2 0.6 1,500 to 1,999..................................................... 15.4 1.9 1.4 0.5 2,000 to 2,499..................................................... 12.2 2.3 1.7 0.5 2,500 to

  17. Total..........................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    5.6 17.7 7.9 Floorspace (Square Feet) Total Floorspace 1 Fewer than 500................................................... 3.2 0.5 0.3 Q 500 to 999........................................................... 23.8 3.9 2.4 1.5 1,000 to 1,499..................................................... 20.8 4.4 3.2 1.2 1,500 to 1,999..................................................... 15.4 3.5 2.4 1.1 2,000 to 2,499..................................................... 12.2 3.2 2.1 1.1 2,500 to

  18. Total..........................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    0.7 21.7 6.9 12.1 Floorspace (Square Feet) Total Floorspace 1 Fewer than 500................................................... 3.2 0.9 0.6 Q Q 500 to 999........................................................... 23.8 9.0 4.2 1.5 3.2 1,000 to 1,499..................................................... 20.8 8.6 4.7 1.5 2.5 1,500 to 1,999..................................................... 15.4 6.0 2.9 1.2 1.9 2,000 to 2,499..................................................... 12.2 4.1 2.1 0.7

  19. Total..........................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    4.2 7.6 16.6 Floorspace (Square Feet) Total Floorspace 1 Fewer than 500................................................... 3.2 1.0 0.2 0.8 500 to 999........................................................... 23.8 6.3 1.4 4.9 1,000 to 1,499..................................................... 20.8 5.0 1.6 3.4 1,500 to 1,999..................................................... 15.4 4.0 1.4 2.6 2,000 to 2,499..................................................... 12.2 2.6 0.9 1.7 2,500 to

  20. Total..........................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    7.1 19.0 22.7 22.3 Floorspace (Square Feet) Total Floorspace 1 Fewer than 500................................................... 3.2 2.1 0.6 Q 0.4 500 to 999........................................................... 23.8 13.6 3.7 3.2 3.2 1,000 to 1,499..................................................... 20.8 9.5 3.7 3.4 4.2 1,500 to 1,999..................................................... 15.4 6.6 2.7 2.5 3.6 2,000 to 2,499..................................................... 12.2 5.0 2.1

  1. Total................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    .. 111.1 86.6 2,522 1,970 1,310 1,812 1,475 821 1,055 944 554 Total Floorspace (Square Feet) Fewer than 500............................. 3.2 0.9 261 336 162 Q Q Q 334 260 Q 500 to 999.................................... 23.8 9.4 670 683 320 705 666 274 811 721 363 1,000 to 1,499.............................. 20.8 15.0 1,121 1,083 622 1,129 1,052 535 1,228 1,090 676 1,500 to 1,999.............................. 15.4 14.4 1,574 1,450 945 1,628 1,327 629 1,712 1,489 808 2,000 to

  2. Total..........................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    .. 111.1 24.5 1,090 902 341 872 780 441 Total Floorspace (Square Feet) Fewer than 500...................................... 3.1 2.3 403 360 165 366 348 93 500 to 999.............................................. 22.2 14.4 763 660 277 730 646 303 1,000 to 1,499........................................ 19.1 5.8 1,223 1,130 496 1,187 1,086 696 1,500 to 1,999........................................ 14.4 1.0 1,700 1,422 412 1,698 1,544 1,348 2,000 to 2,499........................................ 12.7

  3. Total...................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    Floorspace (Square Feet) Total Floorspace 1 Fewer than 500............................................ 3.2 0.4 Q 0.6 1.7 0.4 500 to 999................................................... 23.8 4.8 1.4 4.2 10.2 3.2 1,000 to 1,499............................................. 20.8 10.6 1.8 1.8 4.0 2.6 1,500 to 1,999............................................. 15.4 12.4 1.5 0.5 0.5 0.4 2,000 to 2,499............................................. 12.2 10.7 1.0 0.2 Q Q 2,500 to

  4. Total.........................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    Floorspace (Square Feet) Total Floorspace 2 Fewer than 500.................................................. 3.2 Q 0.8 0.9 0.8 0.5 500 to 999.......................................................... 23.8 1.5 5.4 5.5 6.1 5.3 1,000 to 1,499.................................................... 20.8 1.4 4.0 5.2 5.0 5.2 1,500 to 1,999.................................................... 15.4 1.4 3.1 3.5 3.6 3.8 2,000 to 2,499.................................................... 12.2 1.4 3.2 3.0 2.3 2.3

  5. Total..........................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    25.6 40.7 24.2 Floorspace (Square Feet) Total Floorspace 1 Fewer than 500................................................... 3.2 0.9 0.5 0.9 1.0 500 to 999........................................................... 23.8 4.6 3.9 9.0 6.3 1,000 to 1,499..................................................... 20.8 2.8 4.4 8.6 5.0 1,500 to 1,999..................................................... 15.4 1.9 3.5 6.0 4.0 2,000 to 2,499..................................................... 12.2 2.3 3.2 4.1

  6. Total..........................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    7.1 7.0 8.0 12.1 Floorspace (Square Feet) Total Floorspace 1 Fewer than 500................................................... 3.2 0.4 Q Q 0.5 500 to 999........................................................... 23.8 2.5 1.5 2.1 3.7 1,000 to 1,499..................................................... 20.8 1.1 2.0 1.5 2.5 1,500 to 1,999..................................................... 15.4 0.5 1.2 1.2 1.9 2,000 to 2,499..................................................... 12.2 0.7 0.5 0.8 1.4

  7. Total...........................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    26.7 28.8 20.6 13.1 22.0 16.6 38.6 Floorspace (Square Feet) Total Floorspace 1 Fewer than 500................................... 3.2 1.9 0.9 Q Q Q 1.3 2.3 500 to 999........................................... 23.8 10.5 7.3 3.3 1.4 1.2 6.6 12.9 1,000 to 1,499..................................... 20.8 5.8 7.0 3.8 2.2 2.0 3.9 8.9 1,500 to 1,999..................................... 15.4 3.1 4.2 3.4 2.0 2.7 1.9 5.0 2,000 to 2,499..................................... 12.2 1.7 2.7 2.9 1.8 3.2 1.1 2.8

  8. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Subscription Jefferson Lab Home Search Contact JLab Descriptions A - C autocad: No description available briefs: On-Target Briefs cctest-alert: No description available clas_drift_chambers: Hall B Drift Chambers Group clas_offline: Discussion group for CLAS RECSIS group clas_slow_control: CLAS slow control working group clas_strangep: Hall B Strange Particles using CLAS discussion group clas_tof: CLAS Time of Flight Collaboration credit-card: List of JLab Credit Card buyers csc_all:

  9. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May 16, 2013 Mail discussion Joe Whitford opened the meeting by introducing Al Majors to talk about mail related items. 1) Update on the USPS mail name changes. If approved by the Postal Regulatory Commission the following name changes will go into effective July 28, 2013: a. Express Mail will be called Priority Mail Express b. Express Mail International will be Priority Mail International c. Express Mail Corporate Account will become USPS Express Corporate Account Only the names of these

  10. LLNL E-Mail Utilities

    Energy Science and Technology Software Center (OSTI)

    2005-10-31

    The LLNL E-mail Utilities software library is a Java API that simplifies the creation and delivery of email in Java business applications. It consists of a database-driven template engine, various strategies for composing, queuing, dispatching email and a Java Swing GUI for creating and editing email templates.

  11. Mail Management Memorandum, July 2, 2010 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and ...

  12. Minutes from the Print and Mail Managers Exchange Forum Teleconference...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail...

  13. Field Facilities Contacts for Printing and Mail

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Print and Mail Contacts Site Printing Contact Mail Contact NNSA, Albuquerque Deborah Miller (505) 845-6049 Thomas H. Clinkenbeard NNSA Service Center PO Box 5400 Albuquerque, NM 87185-5400 (505) 845-4602 tclinkenbeard@doeal.gov (mailto:tclinkenbeard@doeal.gov) Argonne National Laboratory Doreen Schoening Argonne National Laboratory U.S. Department of Energy 9700 South Cass Avenue Blvd 340 Lemonmt, IL 60439 (630) 840-6399 dschoening@anl.gov

  14. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 21, 2013 Mail Managers discussion Joe Whitford opened the meeting by introducing Tony Nellums to talk about mail related items. 1) Mr. Nellums introduced Derek Milner, Policy Advisor from the GSA Office of Government-wide policy. a. Mr. Milner stated that he is being replaced as primary policy contact by Linda Willoughby (Linda.Willoughby@gsa.gov) or (202) 219-1083. b. Initiatives discussed by Mr. Milner included: Upcoming mail reports. The SMART system is online and available now.

  15. Minutes from the January 10, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 10, 2013 Mail discussion Al Majors opened the meeting by discussing the Mail Management Report and latest update on status. One final report is yet to be submitted, after which close out will be accomplished. Copies will be provided to the Mail Managers once completed. Al introduced Derrick Miliner, Program Manager from the General Services Administration, Office of Government-wide Policy, and acknowledged Mr. Miliner's role in completing the Mail Management Report. Mail Security Plans A

  16. Field Facilities Contacts for Printing and Mail | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

  17. Read Your E-mail | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read Your E-mail All Argonne employees can read their e-mail through the web. Argonne E-Mail service is a robust, reliable electronic communication solution for supporting day-to-day business activities. Features include e-mail, calendar, task lists, and contact lists. While it is designed to work Microsoft Outlook, it also works with other POP- and IMAP-based clients. All employees can read their e-mail through the web. Use the login link at right to get started. Login to E-mail

  18. T-618: Debian update for exim4: Mail Transport Agent

    Broader source: Energy.gov [DOE]

    It was discovered that Exim, the default mail transport agent in Debian, uses DKIM data obtain from DNS directly in a format string, potentially allowing malicious mail senders to execute arbitrary code.

  19. Minutes from the January 19, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide FY-2010 Three-Year Plan Dallas Woodruff, Headquarters in formed the group that the Department-wide Printing and Publishing Activities is currently in the concurrence

  20. Minutes from the January 20, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    , 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Department-wide Printing and Publishing Activities Report Three-Year Plan. Dallas Woodruff,

  1. Minutes from the July 21, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    July 21, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Government Printing Office revisions to the Standard Form one (SF!), Twenty-five

  2. Minutes from the June 28, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    June 28, 2012 Mail discussion Al Majors opened the meeting by introducing United Parcel Service (UPS) Representative Shelly Scott. Ms. Scott's contact information is: Shelly Scott shellyscott@ups.com 404 402-9827 (cell) Ms. Scott discussed issues relating to various UPS services available to the department. Next Al introduced Michael R. Sanders, President and Chief Executive Officer of Intra-Mail Network, an innovative, information Technology Company that improves the delivery of mail or email

  3. Minutes from the May 26, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    26, 2010 Printing and Mail Managers Exchange Forum Teleconference Seventeen individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the FY 2010, Congressional Joint Committee on Printing Commercial Printing Report "JCP

  4. Minutes from the November 01, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 1, 2012 Mail discussion Al Majors opened the meeting by introducing Derrick Milner, Program Manager from the General Services Administration, Office of Government-wide Policy. Mr. Majors and Mr. Miliner discussed the pending Official Mail Management Report for the FY-2012. The question on where to put data relating to certified and registered mail was addressed. It should be placed under the others section or under first class, standard delivery. Mr. Majors also discussed the pending

  5. Minutes from the November 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 17, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty seven individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide "Three-Year Plan" Dallas Woodruff, Headquarters opened the meeting by thanking everyone for providing their sites Three-Year Plan data to Headquarters in

  6. Minutes from the September 15, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    September 15, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-four individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Upcoming FY 2010 Department-wide Three-Year Plan Dallas Woodruff, Headquarters informed the

  7. Headquarters Program & Staff Office Mailing Addresses | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000

  8. Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular MOF-5 Analogues Comprising Commercially Available Organic Molecules Previous Next List R. L. Martin, L.-C. Lin,...

  9. Minutes from the Print and Mail Managers Exchange Forum Teleconferences

    Broader source: Energy.gov [DOE]

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences.  Contact the Office of Administrative Management and Support at (202) 586-4318 with any questions.

  10. Minutes from the May 3, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    http:www.gsa.govmailpolicy (for training options) https:www.intra-mail.com ... discussion Brainstorming discussion on methodsapproaches to reduce printing expenses: ...

  11. Minutes from the October 26, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Woodruff also said the files are due back to Headquarters no later November 11, 2011, and the report is due to congress by February 10, 2012. Mail Agenda Items...... Fiscal ...

  12. The Future of Electric Vehicles and Arizona State University's MAIL

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  13. Minutes from the March 14, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 14, 2013 Mail discussion Al Majors is on leave today. Ellsworth Howell Jr. and Tony Nellums are sitting for Al. There are no agenda items for the Mail portion. A discussion period for questions, comments, or suggestions was opened without response Printing discussion Discussed suggestions for reducing printing expenses Presidential Executive Order 13589 and reducing hard copy printing in favor of electronic publishing Sec. 5. Printing. Agencies are encouraged to limit the publication and

  14. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    ,,," Version No: 2014.001" "ANNUAL REPORT OF THE ORIGIN OF NATURAL GAS LIQUIDS PRODUCTION" "FORM EIA-64A" "REPORT YEAR 2014" "This report is...

  15. This form may be submitted to the EIA by mail, fax, e-mail, or...

    U.S. Energy Information Administration (EIA) Indexed Site

    ...www.eia.govsurveyformeia782alist782a.pdf" "Phone No.:",,,..."Ex... you are reporting:" "Type of Report (Check One):" ,,"Original",,,..."Mo",,,"Da...

  16. Mailing Addresses and Information Numbers for Operations, Field, and Site

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Offices | Department of Energy About Energy.gov » Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Name Telephone Number U.S. Department of Energy Ames Site Office 111 TASF, Iowa State University Ames, Iowa 50011 515-294-9557 U.S. Department of Energy Argonne Site Office 9800 S. Cass Avenue Argonne, IL 60439 630-252-2000 U.S. Department of Energy Berkeley Site Office Berkeley

  17. E-mail et Web : pour une navigation sans risque

    ScienceCinema (OSTI)

    None

    2011-10-06

    Présentation orale en français, support visuel en anglais. À travers des exemples concrets, vous consoliderez vos connaissances et pourrez ainsi réajuster vos habitudes concernant l?utilisation sécurisée de votre boîte e-mail et de votre navigateur Web.

  18. V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets May 2, 2013 - 6:00am Addthis...

  19. Mail-Order Metal-Organic Frameworks (MOFs) | Center for Gas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SeparationsRelevant to Clean Energy Technologies | Blandine Jerome Mail-Order Metal-Organic Frameworks (MOFs)

  20. Minutes from the February 23, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes Printing and Mail Managers Exchange Forum Teleconference February 23, 2012 Participants: Headquarters (5) National Energy Technology Laboratory, PA National Security Complex Y-12 (2) Oak Ridge National Laboratory Y-12 Site Office (2) Hanford Site Office Oak Ridge Association University Oak Ridge Operations Office BWXT Pantex Site Office JanTec Corporation, Richland, Washington Los Alamos National Laboratory Chicago Office Bettis Atomic Power Laboratory National Security Technology C1,

  1. dynamic-origin-destination-matrix

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Dynamic Origin-Destination Matrix Estimation in TRANSIMS Using Direction-Guided Parallel Heuristic Search Algorithms Adel W. Sadek, Ph.D. Associate Professor University at Buffalo, The State University of New York 233 Ketter Hall Buffalo, NY 14260 Phone: (716) 645-4367 FAX: (716) 645-3733 E-mail: This email address is being protected from spambots. You need JavaScript enabled to view it. List of Authors ================ Adel W. Sadek, Ph.D. Shan Huang Liya Guo University at Buffalo, The State

  2. Country Total

    U.S. Energy Information Administration (EIA) Indexed Site

    Country Total Percent of U.S. total China 1,461,074 34 Republic of Korea 172,379 4 Taiwan 688,311 16 All others 1,966,263 46 Total 4,288,027 100 Note: All Others includes Canada, Czech Republic, Federal Republic of Germany, Malaysia, Mexico, Philippines and Singapore Source: U.S. Energy Information Administration, Form EIA-63B, 'Annual Photovoltaic Cell/Module Shipments Report.' Table 7 . Photovoltaic module import shipments by country, 2013 (peak kilowatts)

  3. Original Signatures on File

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Original Signatures on File

  4. U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HQ F 1410.2 (06-93) U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE (Receipt No.) MAIL STATION: DATE: TO: NAME: ROUTING SYMBOL: FROM: DOE Mail Facility, Office of Administration Services 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. ITEM NO. ITEM NO. ITEM NO. SIGN AND RETURN WITHIN 24 HOURS TO AVOID TRACER ACTION TO DOE MAIL FACILITY (Stamp Location) RECEIVED BY: DATE: Printed with soy ink on recycled paper

  5. U-157: Ruby Mail Gem Directory Traversal and Shell Command Injection Vulnerabilities

    Broader source: Energy.gov [DOE]

    Some vulnerabilities have been reported in the Mail gem for Ruby, which can be exploited by malicious people to manipulate certain data and compromise a vulnerable system.

  6. State Total

    U.S. Energy Information Administration (EIA) Indexed Site

    State Total Percent of U.S. total Alabama 1,652 0.0 Alaska 152 0.0 Arizona 912,975 19.9 Arkansas 2,724 0.1 California 2,239,983 48.8 Colorado 49,903 1.1 Connecticut 33,627 0.7 Delaware 3,080 0.1 District of Columbia 1,746 0.0 Florida 22,061 0.5 Georgia 99,713 2.2 Guam 39 0.0 Hawaii 126,595 2.8 Idaho 1,423 0.0 Illinois 8,176 0.2 Indiana 12,912 0.3 Iowa 4,480 0.1 Kansas 523 0.0 Kentucky 2,356 0.1 Louisiana 27,704 0.6 Maine 993 0.0 Maryland 30,528 0.7 Massachusetts 143,539 3.1 Michigan 3,416 0.1

  7. {open_quotes}Media-On-Demand{close_quotes} multimedia electronic mail: A tool for collaboration on the web

    SciTech Connect (OSTI)

    Tsoi, Kei Nam; Rahman, S.M.

    1996-12-31

    Undoubtedly, multimedia electronic mail has many advantages in exchanging information electronically in a collaborative work. The existing design of e-mail systems architecture is inefficient in exchanging multimedia message which has much larger volume, and requires more bandwidth and storage space than the text-only messages. This paper presents an innovative method for exchanging multimedia mail messages in a heterogeneous environment to support collaborative work over YAW on the Internet. We propose a {open_quotes}Parcel Collection{close_quotes} approach for exchanging multimedia electronic mail messages. This approach for exchanging multimedia electronic mail messages integrates the current WWW technologies with the existing electronic mail systems.

  8. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  9. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  10. Sign Up for E-mail Updates | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Sign Up for E-mail Updates Materials Sciences and Engineering (MSE) Division MSE Home About Staff What's New Research Areas Reports and Activities Science Highlights Principal Investigators' Meetings BES Home What's New Sign Up for E-mail Updates Print Text Size: A A A FeedbackShare Page The Division has a "Dear Colleague" email list, which is used to circulate general information such as funding opportunity announcements and administrative information such as position openings. To

  11. Legal and policy issues associated with monitoring employee E-mail

    SciTech Connect (OSTI)

    Segura, M.A.; Rither, A.C.

    1997-01-01

    This paper examines the legal issues involved with employer monitoring of employee e-mail. In addition to identifying pertinent legal issues, the paper provides guidelines that will help the Pacific Northwest National Laboratory (PNNL) establish a program for monitoring outgoing e-mail to insure compliance with company policies, particularly those regarding protection of trade secrets and proprietary information, and to comply with the Department of Energy`s (DOE) procedures for protecting Export Controlled Information (ECI). Electronic communication has allowed companies to enhance efficiency, responsiveness and effectiveness. E-mail allows employees to transmit all types of data to other individuals inside and outside of their companies. The ease with which information can be transmitted by e-mail has placed trade secrets, proprietary information, and other sensitive data at risk from inadvertent disclosure by employees. As employers attempt to protect their interests through measures such as monitoring e-mail, they may expose themselves to liability under federal and state laws for violating employee privacy. Business use of e-mail has proliferated so rapidly that the federal and state legal systems have not been able to adequately address the issues arising out of its use in the workplace.

  12. Barge Truck Total

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Barge Truck Total delivered cost per short ton Shipments with transportation rates over total shipments Total delivered cost per short ton Shipments with transportation rates over...

  13. ,"Total Natural Gas Consumption

    U.S. Energy Information Administration (EIA) Indexed Site

    Gas Consumption (billion cubic feet)",,,,,"Natural Gas Energy Intensity (cubic feetsquare foot)" ,"Total ","Space Heating","Water Heating","Cook- ing","Other","Total ","Space...

  14. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    June 19, 2012 By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency U.S. Department of Energy Office of the General Counsel 1000 Independence Ave., SW Washington, D.C. 20585 Regulatory.Review@hq.doe.gov Re: Regulatory Burden RFI Dear Mr. Cohen: The Association of Home Appliance Manufacturers (AHAM) respectfully submits the following comments to the Department of Energy (DOE) on its Regulatory Burden RFI, 77 Fed. Reg. 28518 (May 15, 2012). AHAM

  15. Extremely High-Frequency Holographic Radar Imaging of Personnel and Mail

    SciTech Connect (OSTI)

    McMakin, Douglas L.; Sheen, David M.; Griffin, Jeffrey W.; Lechelt, Wayne M.

    2006-08-01

    The awareness of terrorists covertly transporting chemical warfare (CW) and biological warfare (BW) agents into government, military, and civilian facilities to harm the occupants has increased dramatically since the attacks of 9/11. Government and civilian security personnel have a need for innovative surveillance technology that can rapidly detect these lethal agents, even when they are hidden away in sealed containers and concealed either under clothing or in hand-carried items such as mailed packages or handbags. Sensor technology that detects BW and CW agents in mail or sealed containers carried under the clothing are under development. One promising sensor technology presently under development to defeat these threats is active millimeter-wave holographic radar imaging, which can readily image concealed items behind paper, cardboard, and clothing. Feasibility imaging studies at frequencies greater than 40 GHz have been conducted to determine whether simulated biological or chemical agents concealed in mail packages or under clothing could be detected using this extremely high-frequency imaging technique. The results of this imaging study will be presented in this paper.

  16. By Coal Origin State

    U.S. Energy Information Administration (EIA) Indexed Site

    Table OS-1. Domestic coal distribution, by origin State, 1st Quarter 2010 Origin: Alabama (thousand short tons) Coal Destination State...

  17. By Coal Origin State

    U.S. Energy Information Administration (EIA) Indexed Site

    Table OS-1. Domestic coal distribution, by origin State, 4th Quarter 2011 Origin: Alabama (thousand short tons) Coal Destination State...

  18. By Coal Origin State

    U.S. Energy Information Administration (EIA) Indexed Site

    Table OS-1. Domestic coal distribution, by origin State, 3rd Quarter 2011 Origin: Alabama (thousand short tons) Coal Destination State...

  19. By Coal Origin State

    U.S. Energy Information Administration (EIA) Indexed Site

    Table OS-1. Domestic coal distribution, by origin State, 4th Quarter 2010 Origin: Alabama (thousand short tons) Coal Destination State...

  20. By Coal Origin State

    U.S. Energy Information Administration (EIA) Indexed Site

    Table OS-1. Domestic coal distribution, by origin State, 2nd Quarter 2011 Origin: Alabama (thousand short tons) Coal Destination State...

  1. By Coal Origin State

    U.S. Energy Information Administration (EIA) Indexed Site

    Table OS-1. Domestic coal distribution, by origin State, 3rd Quarter 2010 Origin: Alabama (thousand short tons) Coal Destination State...

  2. By Coal Origin State

    U.S. Energy Information Administration (EIA) Indexed Site

    Table OS-1. Domestic coal distribution, by origin State, 1st Quarter 2011 Origin: Alabama (thousand short tons) Coal Destination State...

  3. By Coal Origin State

    U.S. Energy Information Administration (EIA) Indexed Site

    Table OS-1. Domestic coal distribution, by origin State, 2nd Quarter 2010 Origin: Alabama (thousand short tons) Coal Destination State...

  4. Original Impact Calculations

    Broader source: Energy.gov [DOE]

    Original Impact Calculations, from the Tool Kit Framework: Small Town University Energy Program (STEP).

  5. ,"Total Fuel Oil Expenditures

    U.S. Energy Information Administration (EIA) Indexed Site

    . Fuel Oil Expenditures by Census Region for Non-Mall Buildings, 2003" ,"Total Fuel Oil Expenditures (million dollars)",,,,"Fuel Oil Expenditures (dollars)" ,,,,,"per...

  6. ,"Total Fuel Oil Consumption

    U.S. Energy Information Administration (EIA) Indexed Site

    0. Fuel Oil Consumption (gallons) and Energy Intensities by End Use for Non-Mall Buildings, 2003" ,"Total Fuel Oil Consumption (million gallons)",,,,,"Fuel Oil Energy Intensity...

  7. ,"Total Fuel Oil Expenditures

    U.S. Energy Information Administration (EIA) Indexed Site

    4. Fuel Oil Expenditures by Census Region, 1999" ,"Total Fuel Oil Expenditures (million dollars)",,,,"Fuel Oil Expenditures (dollars)" ,,,,,"per Gallon",,,,"per Square Foot"...

  8. Total Space Heat-

    Gasoline and Diesel Fuel Update (EIA)

    Commercial Buildings Energy Consumption Survey: Energy End-Use Consumption Tables Total Space Heat- ing Cool- ing Venti- lation Water Heat- ing Light- ing Cook- ing Refrig- eration...

  9. ,"Total Fuel Oil Expenditures

    U.S. Energy Information Administration (EIA) Indexed Site

    A. Fuel Oil Expenditures by Census Region for All Buildings, 2003" ,"Total Fuel Oil Expenditures (million dollars)",,,,"Fuel Oil Expenditures (dollars)" ,,,,,"per Gallon",,,,"per...

  10. ,"Total Fuel Oil Consumption

    U.S. Energy Information Administration (EIA) Indexed Site

    A. Fuel Oil Consumption (gallons) and Energy Intensities by End Use for All Buildings, 2003" ,"Total Fuel Oil Consumption (million gallons)",,,,,"Fuel Oil Energy Intensity...

  11. Total Space Heat-

    Gasoline and Diesel Fuel Update (EIA)

    Revised: December, 2008 Total Space Heat- ing Cool- ing Venti- lation Water Heat- ing Light- ing Cook- ing Refrig- eration Office Equip- ment Com- puters Other All Buildings...

  12. Total Space Heat-

    Gasoline and Diesel Fuel Update (EIA)

    Released: September, 2008 Total Space Heat- ing Cool- ing Venti- lation Water Heat- ing Light- ing Cook- ing Refrig- eration Office Equip- ment Com- puters Other All Buildings*...

  13. Parallel Total Energy

    Energy Science and Technology Software Center (OSTI)

    2004-10-21

    This is a total energy electronic structure code using Local Density Approximation (LDA) of the density funtional theory. It uses the plane wave as the wave function basis set. It can sue both the norm conserving pseudopotentials and the ultra soft pseudopotentials. It can relax the atomic positions according to the total energy. It is a parallel code using MP1.

  14. Summary Max Total Units

    Energy Savers [EERE]

    Summary Max Total Units *If All Splits, No Rack Units **If Only FW, AC Splits 1000 52 28 28 2000 87 59 35 3000 61 33 15 4000 61 33 15 Totals 261 153 93 ***Costs $1,957,500.00 $1,147,500.00 $697,500.00 Notes: added several refrigerants removed bins from analysis removed R-22 from list 1000lb, no Glycol, CO2 or ammonia Seawater R-404A only * includes seawater units ** no seawater units included *** Costs = (total units) X (estimate of $7500 per unit) 1000lb, air cooled split systems, fresh water

  15. Country/Continent Total

    U.S. Energy Information Administration (EIA) Indexed Site

    peak kilowatts) Country/Continent Total Percent of U.S. total Africa 14,279 3.7 Asia/Australia 330,200 86.2 Europe 19,771 5.1 South/Central America 7,748 2.0 Canada 5,507 1.4 Mexico 5,747 1.5 Total 383,252 100.0 Table 8. Destination of photovoltaic module export shipments, 2013 Source: U.S. Energy Information Administration, Form EIA-63B, 'Annual Photovoltaic Cell/Module Shipments Report.'

  16. Total Space Heat-

    Gasoline and Diesel Fuel Update (EIA)

    Survey: Energy End-Use Consumption Tables Total Space Heat- ing Cool- ing Venti- lation Water Heat- ing Light- ing Cook- ing Refrig- eration Office Equip- ment Com- puters Other...

  17. ARM - Measurement - Total carbon

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    carbon ARM Data Discovery Browse Data Comments? We would love to hear from you! Send us a note below or call us at 1-888-ARM-DATA. Send Measurement : Total carbon The total concentration of carbon in all its organic and non-organic forms. Categories Aerosols, Atmospheric Carbon Instruments The above measurement is considered scientifically relevant for the following instruments. Refer to the datastream (netcdf) file headers of each instrument for a list of all available measurements, including

  18. Total DOE/NNSA

    National Nuclear Security Administration (NNSA)

    8 Actuals 2009 Actuals 2010 Actuals 2011 Actuals 2012 Actuals 2013 Actuals 2014 Actuals 2015 Actuals Total DOE/NNSA 4,385 4,151 4,240 4,862 5,154 5,476 7,170 7,593 Total non-NNSA 3,925 4,017 4,005 3,821 3,875 3,974 3,826 3765 Total Facility 8,310 8,168 8,245 8,683 9,029 9,450 10,996 11,358 non-NNSA includes DOE offices and Strategic Parternship Projects (SPP) employees NNSA M&O Employee Reporting

  19. THE COSMIC ORIGINS SPECTROGRAPH

    SciTech Connect (OSTI)

    Green, James C.; Michael Shull, J.; Snow, Theodore P.; Stocke, John [Department of Astrophysical and Planetary Sciences, University of Colorado, 391-UCB, Boulder, CO 80309 (United States); Froning, Cynthia S.; Osterman, Steve; Beland, Stephane; Burgh, Eric B.; Danforth, Charles; France, Kevin [Center for Astrophysics and Space Astronomy, University of Colorado, 389-UCB, Boulder, CO 80309 (United States); Ebbets, Dennis [Ball Aerospace and Technologies Corp., 1600 Commerce Street, Boulder, CO 80301 (United States); Heap, Sara H. [NASA Goddard Space Flight Center, Code 681, Greenbelt, MD 20771 (United States); Leitherer, Claus; Sembach, Kenneth [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Linsky, Jeffrey L. [JILA, University of Colorado and NIST, Boulder, CO 80309-0440 (United States); Savage, Blair D. [Department of Astronomy, University of Wisconsin-Madison, 475 North Charter Street, Madison, WI 53706 (United States); Siegmund, Oswald H. W. [Astronomy Department, University of California, Berkeley, CA 94720 (United States); Spencer, John; Alan Stern, S. [Southwest Research Institute, 1050 Walnut Street, Suite 300, Boulder, CO 80302 (United States); Welsh, Barry [Space Sciences Laboratory, University of California, 7 Gauss Way, Berkeley, CA 94720 (United States); and others

    2012-01-01

    The Cosmic Origins Spectrograph (COS) is a moderate-resolution spectrograph with unprecedented sensitivity that was installed into the Hubble Space Telescope (HST) in 2009 May, during HST Servicing Mission 4 (STS-125). We present the design philosophy and summarize the key characteristics of the instrument that will be of interest to potential observers. For faint targets, with flux F{sub {lambda}} Almost-Equal-To 1.0 Multiplication-Sign 10{sup -14} erg cm{sup -2} s{sup -1} A{sup -1}, COS can achieve comparable signal to noise (when compared to Space Telescope Imaging Spectrograph echelle modes) in 1%-2% of the observing time. This has led to a significant increase in the total data volume and data quality available to the community. For example, in the first 20 months of science operation (2009 September-2011 June) the cumulative redshift pathlength of extragalactic sight lines sampled by COS is nine times than sampled at moderate resolution in 19 previous years of Hubble observations. COS programs have observed 214 distinct lines of sight suitable for study of the intergalactic medium as of 2011 June. COS has measured, for the first time with high reliability, broad Ly{alpha} absorbers and Ne VIII in the intergalactic medium, and observed the He II reionization epoch along multiple sightlines. COS has detected the first CO emission and absorption in the UV spectra of low-mass circumstellar disks at the epoch of giant planet formation, and detected multiple ionization states of metals in extra-solar planetary atmospheres. In the coming years, COS will continue its census of intergalactic gas, probe galactic and cosmic structure, and explore physics in our solar system and Galaxy.

  20. U.S. Domestic and Foreign Coal Distribution by State of Origin

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    (thousand short tons) Coal Exports Coal Origin State and Region Domestic Distribution By Coal Mines By Brokers & Traders* Total Exports Total Distribution Alabama 10,679.56...

  1. 21 briefing pages total

    Energy Savers [EERE]

    1 briefing pages total p. 1 Reservist Differential Briefing U.S. Office of Personnel Management December 11, 2009 p. 2 Agenda - Introduction of Speakers - Background - References/Tools - Overview of Reservist Differential Authority - Qualifying Active Duty Service and Military Orders - Understanding Military Leave and Earnings Statements p. 3 Background 5 U.S.C. 5538 (Section 751 of the Omnibus Appropriations Act, 2009, March 11, 2009) (Public Law 111-8) Law requires OPM to consult with DOD Law

  2. By Coal Origin State

    U.S. Energy Information Administration (EIA) Indexed Site

    Origin State ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ U.S. Energy Information Administration | Quarterly Coal Distribution Report 1st Quarter 2012 U.S. Energy Information Administration | Quarterly Coal Distribution Report 1st Quarter 2012 Alabama ___________________________________________________________________________________________________________________________________ Table OS-1. Domestic coal

  3. Originally Released: July 2009

    U.S. Energy Information Administration (EIA) Indexed Site

    1 0 0 * 0 * 0 * 325193 Ethyl Alcohol 3 0 * 2 * 0 0 1 325199 Other Basic ... * 0 0 * 0 0 0 0 325193 Ethyl Alcohol 0 0 0 0 0 0 0 0 Originally Released: July ...

  4. Original Workshop Proposal and Description

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Notes for Vis Requirements Original Workshop Proposal and Description Original Workshop Proposal and Description Visualization Requirements for Computational Science and ...

  5. Total Sales of Kerosene

    U.S. Energy Information Administration (EIA) Indexed Site

    End Use: Total Residential Commercial Industrial Farm All Other Period: Annual Download Series History Download Series History Definitions, Sources & Notes Definitions, Sources & Notes Show Data By: End Use Area 2009 2010 2011 2012 2013 2014 View History U.S. 269,010 305,508 187,656 81,102 79,674 137,928 1984-2014 East Coast (PADD 1) 198,762 237,397 142,189 63,075 61,327 106,995 1984-2014 New England (PADD 1A) 56,661 53,363 38,448 15,983 15,991 27,500 1984-2014 Connecticut 8,800 7,437

  6. Human Genome: DOE Origins

    Office of Scientific and Technical Information (OSTI)

    DOE Origins Resources with Additional Information Charles DeLisi Charles DeLisi The genesis of the Department of Energy (DOE) human genome project took place when "Charles DeLisi ... conceived of a concerted effort to sequence the human genome under the aegis of the ... DOE. ... In 1985, DeLisi took the reins of DOE's Office of Health and Environmental Research [OHER], the program that supported most Biology in the Department. The origins of DOE's biology program traced to the Manhattan

  7. The Origins of Mass

    SciTech Connect (OSTI)

    Lincoln, Don

    2014-07-30

    The Higgs boson was discovered in July of 2012 and is generally understood to be the origin of mass. While those statements are true, they are incomplete. It turns out that the Higgs boson is responsible for only about 2% of the mass of ordinary matter. In this dramatic new video, Dr. Don Lincoln of Fermilab tells us the rest of the story.

  8. OriginalPrototypes

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Original Prototypes (Status of detectors June, 1998) Ionization Chamber with one cell instrumented Ring 2-3 Silicon Detector Prototype CsI with dimensions approximately of Ring 2-3 Prototype CsI with PMT on Ring 2-3 prototype holder Silicon detectors also installed More Pictures: Recent data from NIMROD: Data Graph 1 Data Graph 2

  9. The Origins of Mass

    ScienceCinema (OSTI)

    Lincoln, Don

    2014-08-07

    The Higgs boson was discovered in July of 2012 and is generally understood to be the origin of mass. While those statements are true, they are incomplete. It turns out that the Higgs boson is responsible for only about 2% of the mass of ordinary matter. In this dramatic new video, Dr. Don Lincoln of Fermilab tells us the rest of the story.

  10. Determination of Total Petroleum Hydrocarbons (TPH) Using Total Carbon Analysis

    SciTech Connect (OSTI)

    Ekechukwu, A.A.

    2002-05-10

    Several methods have been proposed to replace the Freon(TM)-extraction method to determine total petroleum hydrocarbon (TPH) content. For reasons of cost, sensitivity, precision, or simplicity, none of the replacement methods are feasible for analysis of radioactive samples at our facility. We have developed a method to measure total petroleum hydrocarbon content in aqueous sample matrixes using total organic carbon (total carbon) determination. The total carbon content (TC1) of the sample is measured using a total organic carbon analyzer. The sample is then contacted with a small volume of non-pokar solvent to extract the total petroleum hydrocarbons. The total carbon content of the resultant aqueous phase of the extracted sample (TC2) is measured. Total petroleum hydrocarbon content is calculated (TPH = TC1-TC2). The resultant data are consistent with results obtained using Freon(TM) extraction followed by infrared absorbance.

  11. Original Signature on File

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Original Signature on File Page8 of 8 M. EMERGENCY PROCEDURES 1. The owner/operator must maintain an adequately trained onsite RCRA emergency coordinator to direct emergency procedures which could resultfrom fires, explosions or releases of PCB containing waste at the Facility. The owner/operator must submitthe name and qualifications of the emergency coordinator within sixty (60) daysof the effective dateof this approval. 2. The owner/operator must maintain in good working orderany equipment

  12. Originally Released: July 2009

    U.S. Energy Information Administration (EIA) Indexed Site

    Coke and Shipments Net Residual Distillate Natural Gas(e) LPG and Coal Breeze of Energy Sources NAICS Total(b) Electricity(c) Fuel Oil Fuel Oil(d) (billion NGL(f) (million (million Other(g) Produced Onsite(h) Code(a) Subsector and Industry (trillion Btu) (million kWh) (million bbl) (million bbl) cu ft) (million bbl) short tons) short tons) (trillion Btu) (trillion Btu) Total United States 311 Food 1,186 73,440 4 3 620 1 7 * 105 * 3112 Grain and Oilseed Milling 318 15,464 * * 117 * 5 0 29 *

  13. Originally Released: July 2009

    U.S. Energy Information Administration (EIA) Indexed Site

    Coke and Shipments Net Residual Distillate Natural Gas(e) LPG and Coal Breeze of Energy Sources NAICS Total(b) Electricity(c) Fuel Oil Fuel Oil(d) (billion NGL(f) (million (million Other(g) Produced Onsite(h) Code(a) Subsector and Industry (trillion Btu) (million kWh) (million bbl) (million bbl) cu ft) (million bbl) short tons) short tons) (trillion Btu) (trillion Btu) Total United States 311 Food 1,186 73,440 4 3 620 1 7 * 105 * 3112 Grain and Oilseed Milling 318 15,464 * * 117 * 5 0 29 *

  14. Originally Released: July 2009

    U.S. Energy Information Administration (EIA) Indexed Site

    1.2 First Use of Energy for All Purposes (Fuel and Nonfuel), 2006; Level: National and Regional Data; Row: NAICS Codes; Column: Energy Sources and Shipments; Unit: Trillion Btu. Shipments NAICS Net Residual Distillate LPG and Coke and of Energy Sources Code(a) Subsector and Industry Total(b) Electricity(c) Fuel Oil Fuel Oil(d) Natural Gas(e) NGL(f) Coal Breeze Other(g) Produced Onsite(h) Total United States 311 Food 1,186 251 26 16 638 3 147 1 105 * 3112 Grain and Oilseed Milling 318 53 2 1 120

  15. Originally Released: July 2009

    U.S. Energy Information Administration (EIA) Indexed Site

    2 Offsite-Produced Fuel Consumption, 2006 Level: National and Regional Data; Row: NAICS Codes; Column: Energy Sources Unit: Trillion Btu. NAICS Residual Distillate LPG and Coke Code(a) Subsector and Industry Total Electricity(b) Fuel Oil Fuel Oil(c) Natural Gas(d) NGL(e) Coal and Breeze Total United States 311 Food 1,124 251 26 16 635 3 147 1 3112 Grain and Oilseed Milling 316 53 2 1 118 * 114 0 311221 Wet Corn Milling 179 23 * * 52 * 95 0 31131 Sugar Manufacturing 67 3 9 1 18 * 31 1 3114 Fruit

  16. Total Eolica | Open Energy Information

    Open Energy Info (EERE)

    Eolica Jump to: navigation, search Name: Total Eolica Place: Spain Product: Project developer References: Total Eolica1 This article is a stub. You can help OpenEI by expanding...

  17. Total

    U.S. Energy Information Administration (EIA) Indexed Site

    Fuel Kerosene Distillate Fuel Oil Distillate Fuel Oil, 15 ppm Sulfur and Under Distillate Fuel Oil, Greater than 15 ppm to 500 ppm Sulfur Distillate Fuel Oil, Greater than 500 ppm ...

  18. Total..........................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    5 or More Units Mobile Homes Energy Information Administration 2005 Residential Energy Consumption Survey: Preliminary Housing Characteristics Tables Million U.S. Housing Units ...

  19. Total..............................................

    U.S. Energy Information Administration (EIA) Indexed Site

    111.1 86.6 2,720 1,970 1,310 1,941 1,475 821 1,059 944 554 Census Region and Division Northeast.................................... 20.6 13.9 3,224 2,173 836 2,219 1,619 583 903 830 Q New England.......................... 5.5 3.6 3,365 2,154 313 2,634 1,826 Q 951 940 Q Middle Atlantic........................ 15.1 10.3 3,167 2,181 1,049 2,188 1,603 582 Q Q Q Midwest...................................... 25.6 21.0 2,823 2,239 1,624 2,356 1,669 1,336 1,081 961 778 East North

  20. Total........................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    111.1 24.5 1,090 902 341 872 780 441 Census Region and Division Northeast............................................. 20.6 6.7 1,247 1,032 Q 811 788 147 New England.................................... 5.5 1.9 1,365 1,127 Q 814 748 107 Middle Atlantic.................................. 15.1 4.8 1,182 978 Q 810 800 159 Midwest................................................ 25.6 4.6 1,349 1,133 506 895 810 346 East North Central............................ 17.7 3.2 1,483 1,239 560 968 842 351

  1. Total...........................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    Q Table HC3.2 Living Space Characteristics by Owner-Occupied Housing Units, 2005 2 to 4 Units 5 or More Units Mobile Homes Million U.S. Housing Units Owner- Occupied Housing Units (millions) Type of Owner-Occupied Housing Unit Housing Units (millions) Single-Family Units Apartments in Buildings With-- Living Space Characteristics Detached Attached Energy Information Administration 2005 Residential Energy Consumption Survey: Preliminary Housing Characteristics Tables Table HC3.2 Living Space

  2. Total............................................................

    U.S. Energy Information Administration (EIA) Indexed Site

  3. Total.............................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    26.7 28.8 20.6 13.1 22.0 16.6 38.6 Personal Computers Do Not Use a Personal Computer........... 35.5 17.1 10.8 4.2 1.8 1.6 10.3 20.6 Use a Personal Computer....................... 75.6 9.6 18.0 16.4 11.3 20.3 6.4 17.9 Most-Used Personal Computer Type of PC Desk-top Model.................................. 58.6 7.6 14.2 13.1 9.2 14.6 5.0 14.5 Laptop Model...................................... 16.9 2.0 3.8 3.3 2.1 5.7 1.3 3.5 Hours Turned on Per Week Less than 2 Hours..............................

  4. Total..............................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    ,171 1,618 1,031 845 630 401 Census Region and Division Northeast................................................... 20.6 2,334 1,664 562 911 649 220 New England.......................................... 5.5 2,472 1,680 265 1,057 719 113 Middle Atlantic........................................ 15.1 2,284 1,658 670 864 627 254 Midwest...................................................... 25.6 2,421 1,927 1,360 981 781 551 East North Central.................................. 17.7 2,483 1,926 1,269

  5. Total..............................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    Do Not Have Cooling Equipment................ 17.8 5.3 4.7 2.8 1.9 3.1 3.6 7.5 Have Cooling Equipment............................. 93.3 21.5 24.1 17.8 11.2 18.8 13.0 31.1 Use Cooling Equipment.............................. 91.4 21.0 23.5 17.4 11.0 18.6 12.6 30.3 Have Equipment But Do Not Use it............. 1.9 0.5 0.6 0.4 Q Q 0.5 0.8 Type of Air-Conditioning Equipment 1, 2 Central System.......................................... 65.9 11.0 16.5 13.5 8.7 16.1 6.4 17.2 Without a Heat

  6. Total...............................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    20.6 25.6 40.7 24.2 Personal Computers Do Not Use a Personal Computer ........... 35.5 6.9 8.1 14.2 6.4 Use a Personal Computer......................... 75.6 13.7 17.5 26.6 17.8 Number of Desktop PCs 1.......................................................... 50.3 9.3 11.9 18.2 11.0 2.......................................................... 16.2 2.9 3.5 5.5 4.4 3 or More............................................. 9.0 1.5 2.1 2.9 2.5 Number of Laptop PCs

  7. Total...............................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    0.7 21.7 6.9 12.1 Personal Computers Do Not Use a Personal Computer ........... 35.5 14.2 7.2 2.8 4.2 Use a Personal Computer......................... 75.6 26.6 14.5 4.1 7.9 Number of Desktop PCs 1.......................................................... 50.3 18.2 10.0 2.9 5.3 2.......................................................... 16.2 5.5 3.0 0.7 1.8 3 or More............................................. 9.0 2.9 1.5 0.5 0.8 Number of Laptop PCs

  8. Total...............................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    26.7 28.8 20.6 13.1 22.0 16.6 38.6 Personal Computers Do Not Use a Personal Computer ........... 35.5 17.1 10.8 4.2 1.8 1.6 10.3 20.6 Use a Personal Computer......................... 75.6 9.6 18.0 16.4 11.3 20.3 6.4 17.9 Number of Desktop PCs 1.......................................................... 50.3 8.3 14.2 11.4 7.2 9.2 5.3 14.2 2.......................................................... 16.2 0.9 2.6 3.7 2.9 6.2 0.8 2.6 3 or More............................................. 9.0 0.4 1.2

  9. Total...............................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    Do Not Have Cooling Equipment................. 17.8 5.3 4.7 2.8 1.9 3.1 3.6 7.5 Have Cooling Equipment.............................. 93.3 21.5 24.1 17.8 11.2 18.8 13.0 31.1 Use Cooling Equipment............................... 91.4 21.0 23.5 17.4 11.0 18.6 12.6 30.3 Have Equipment But Do Not Use it............. 1.9 0.5 0.6 0.4 Q Q 0.5 0.8 Air-Conditioning Equipment 1, 2 Central System............................................ 65.9 11.0 16.5 13.5 8.7 16.1 6.4 17.2 Without a Heat

  10. Total...............................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    47.1 19.0 22.7 22.3 Personal Computers Do Not Use a Personal Computer ........... 35.5 16.9 6.5 4.6 7.6 Use a Personal Computer......................... 75.6 30.3 12.5 18.1 14.7 Number of Desktop PCs 1.......................................................... 50.3 21.1 8.3 10.7 10.1 2.......................................................... 16.2 6.2 2.8 4.1 3.0 3 or More............................................. 9.0 2.9 1.4 3.2 1.6 Number of Laptop PCs

  11. Total................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    111.1 26.7 28.8 20.6 13.1 22.0 16.6 38.6 Do Not Have Space Heating Equipment....... 1.2 0.5 0.3 0.2 Q 0.2 0.3 0.6 Have Main Space Heating Equipment.......... 109.8 26.2 28.5 20.4 13.0 21.8 16.3 37.9 Use Main Space Heating Equipment............ 109.1 25.9 28.1 20.3 12.9 21.8 16.0 37.3 Have Equipment But Do Not Use It.............. 0.8 0.3 0.3 Q Q N 0.4 0.6 Main Heating Fuel and Equipment Natural Gas.................................................. 58.2 12.2 14.4 11.3 7.1 13.2 7.6 18.3 Central

  12. Total.................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    49.2 15.1 15.6 11.1 7.0 5.2 8.0 Have Cooling Equipment............................... 93.3 31.3 15.1 15.6 11.1 7.0 5.2 8.0 Use Cooling Equipment................................ 91.4 30.4 14.6 15.4 11.1 6.9 5.2 7.9 Have Equipment But Do Not Use it............... 1.9 1.0 0.5 Q Q Q Q Q Do Not Have Cooling Equipment................... 17.8 17.8 N N N N N N Air-Conditioning Equipment 1, 2 Central System............................................. 65.9 3.9 15.1 15.6 11.1 7.0 5.2 8.0 Without a Heat

  13. Total.................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    14.7 7.4 12.5 12.5 18.9 18.6 17.3 9.2 Do Not Have Space Heating Equipment........ 1.2 N Q Q 0.2 0.4 0.2 0.2 Q Have Main Space Heating Equipment........... 109.8 14.7 7.4 12.4 12.2 18.5 18.3 17.1 9.2 Use Main Space Heating Equipment............. 109.1 14.6 7.3 12.4 12.2 18.2 18.2 17.1 9.1 Have Equipment But Do Not Use It............... 0.8 Q Q Q Q 0.3 Q N Q Main Heating Fuel and Equipment Natural Gas................................................... 58.2 9.2 4.9 7.8 7.1 8.8 8.4 7.8 4.2 Central

  14. Total.................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    26.7 28.8 20.6 13.1 22.0 16.6 38.6 Cooking Appliances Frequency of Hot Meals Cooked 3 or More Times A Day.............................. 8.2 2.9 2.5 1.3 0.5 1.0 2.4 4.6 2 Times A Day........................................... 24.6 6.5 7.0 4.3 3.2 3.6 4.8 10.3 Once a Day................................................ 42.3 8.8 9.8 8.7 5.1 10.0 5.0 12.9 A Few Times Each Week........................... 27.2 5.6 7.2 4.7 3.3 6.3 3.2 7.5 About Once a Week................................... 3.9 1.1 1.1

  15. Total..................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    78.1 64.1 4.2 1.8 2.3 5.7 Do Not Have Cooling Equipment..................... 17.8 11.3 9.3 0.6 Q 0.4 0.9 Have Cooling Equipment................................. 93.3 66.8 54.7 3.6 1.7 1.9 4.8 Use Cooling Equipment.................................. 91.4 65.8 54.0 3.6 1.7 1.9 4.7 Have Equipment But Do Not Use it................. 1.9 1.1 0.8 Q N Q Q Type of Air-Conditioning Equipment 1, 2 Central System.............................................. 65.9 51.7 43.9 2.5 0.7 1.6 3.1 Without a Heat

  16. Total..................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    . 111.1 14.7 7.4 12.5 12.5 18.9 18.6 17.3 9.2 Do Not Have Cooling Equipment..................... 17.8 3.9 1.8 2.2 2.1 3.1 2.6 1.7 0.4 Have Cooling Equipment................................. 93.3 10.8 5.6 10.3 10.4 15.8 16.0 15.6 8.8 Use Cooling Equipment.................................. 91.4 10.6 5.5 10.3 10.3 15.3 15.7 15.3 8.6 Have Equipment But Do Not Use it................. 1.9 Q Q Q Q 0.6 0.4 0.3 Q Type of Air-Conditioning Equipment 1, 2 Central

  17. Total...................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    15.2 7.8 1.0 1.2 3.3 1.9 For Two Housing Units............................. 0.9 Q N Q 0.6 N Heat Pump.................................................. 9.2 7.4 0.3 Q 0.7 0.5 Portable Electric Heater............................... 1.6 0.8 Q Q Q 0.3 Other Equipment......................................... 1.9 0.7 Q Q 0.7 Q Fuel Oil........................................................... 7.7 5.5 0.4 0.8 0.9 0.2 Steam or Hot Water System........................ 4.7 2.9 Q 0.7 0.8 N For One Housing

  18. Total....................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    14.7 7.4 12.5 12.5 18.9 18.6 17.3 9.2 Household Size 1 Person.......................................................... 30.0 4.6 2.5 3.7 3.2 5.4 5.5 3.7 1.6 2 Persons......................................................... 34.8 4.3 1.9 4.4 4.1 5.9 5.3 5.5 3.4 3 Persons......................................................... 18.4 2.5 1.3 1.7 1.9 2.9 3.5 2.8 1.6 4 Persons......................................................... 15.9 1.9 0.8 1.5 1.6 3.0 2.5 3.1 1.4 5

  19. Total.......................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    0.6 15.1 5.5 Personal Computers Do Not Use a Personal Computer ................... 35.5 6.9 5.3 1.6 Use a Personal Computer................................ 75.6 13.7 9.8 3.9 Number of Desktop PCs 1.................................................................. 50.3 9.3 6.8 2.5 2.................................................................. 16.2 2.9 1.9 1.0 3 or More..................................................... 9.0 1.5 1.1 0.4 Number of Laptop PCs

  20. Total.......................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    5.6 17.7 7.9 Personal Computers Do Not Use a Personal Computer ................... 35.5 8.1 5.6 2.5 Use a Personal Computer................................ 75.6 17.5 12.1 5.4 Number of Desktop PCs 1.................................................................. 50.3 11.9 8.4 3.4 2.................................................................. 16.2 3.5 2.2 1.3 3 or More..................................................... 9.0 2.1 1.5 0.6 Number of Laptop PCs

  1. Total.......................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    4.2 7.6 16.6 Personal Computers Do Not Use a Personal Computer ................... 35.5 6.4 2.2 4.2 Use a Personal Computer................................ 75.6 17.8 5.3 12.5 Number of Desktop PCs 1.................................................................. 50.3 11.0 3.4 7.6 2.................................................................. 16.2 4.4 1.3 3.1 3 or More..................................................... 9.0 2.5 0.7 1.8 Number of Laptop PCs

  2. Total........................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    25.6 40.7 24.2 Do Not Have Space Heating Equipment............... 1.2 Q Q Q 0.7 Have Main Space Heating Equipment.................. 109.8 20.5 25.6 40.3 23.4 Use Main Space Heating Equipment.................... 109.1 20.5 25.6 40.1 22.9 Have Equipment But Do Not Use It...................... 0.8 N N Q 0.6 Main Heating Fuel and Equipment Natural Gas.......................................................... 58.2 11.4 18.4 13.6 14.7 Central Warm-Air Furnace................................ 44.7 6.1

  3. Total........................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    15.1 5.5 Do Not Have Space Heating Equipment............... 1.2 Q Q Q Have Main Space Heating Equipment.................. 109.8 20.5 15.1 5.4 Use Main Space Heating Equipment.................... 109.1 20.5 15.1 5.4 Have Equipment But Do Not Use It...................... 0.8 N N N Main Heating Fuel and Equipment Natural Gas.......................................................... 58.2 11.4 9.1 2.3 Central Warm-Air Furnace................................ 44.7 6.1 5.3 0.8 For One Housing

  4. Total........................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    5.6 17.7 7.9 Do Not Have Space Heating Equipment............... 1.2 Q Q N Have Main Space Heating Equipment.................. 109.8 25.6 17.7 7.9 Use Main Space Heating Equipment.................... 109.1 25.6 17.7 7.9 Have Equipment But Do Not Use It...................... 0.8 N N N Main Heating Fuel and Equipment Natural Gas.......................................................... 58.2 18.4 13.1 5.3 Central Warm-Air Furnace................................ 44.7 16.2 11.6 4.7 For One Housing

  5. Total........................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    0.7 21.7 6.9 12.1 Do Not Have Space Heating Equipment............... 1.2 Q Q N Q Have Main Space Heating Equipment.................. 109.8 40.3 21.4 6.9 12.0 Use Main Space Heating Equipment.................... 109.1 40.1 21.2 6.9 12.0 Have Equipment But Do Not Use It...................... 0.8 Q Q N N Main Heating Fuel and Equipment Natural Gas.......................................................... 58.2 13.6 5.6 2.3 5.7 Central Warm-Air Furnace................................ 44.7 11.0 4.4

  6. Total........................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    4.2 7.6 16.6 Do Not Have Space Heating Equipment............... 1.2 0.7 Q 0.7 Have Main Space Heating Equipment.................. 109.8 23.4 7.5 16.0 Use Main Space Heating Equipment.................... 109.1 22.9 7.4 15.4 Have Equipment But Do Not Use It...................... 0.8 0.6 Q 0.5 Main Heating Fuel and Equipment Natural Gas.......................................................... 58.2 14.7 4.6 10.1 Central Warm-Air Furnace................................ 44.7 11.4 4.0 7.4 For One

  7. Total........................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    7.1 7.0 8.0 12.1 Do Not Have Space Heating Equipment............... 1.2 Q Q Q 0.2 Have Main Space Heating Equipment.................. 109.8 7.1 6.8 7.9 11.9 Use Main Space Heating Equipment.................... 109.1 7.1 6.6 7.9 11.4 Have Equipment But Do Not Use It...................... 0.8 N Q N 0.5 Main Heating Fuel and Equipment Natural Gas.......................................................... 58.2 3.8 0.4 3.8 8.4 Central Warm-Air Furnace................................ 44.7 1.8 Q 3.1 6.0

  8. Total........................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    7.1 19.0 22.7 22.3 Do Not Have Space Heating Equipment............... 1.2 0.7 Q 0.2 Q Have Main Space Heating Equipment.................. 109.8 46.3 18.9 22.5 22.1 Use Main Space Heating Equipment.................... 109.1 45.6 18.8 22.5 22.1 Have Equipment But Do Not Use It...................... 0.8 0.7 Q N N Main Heating Fuel and Equipment Natural Gas.......................................................... 58.2 27.0 11.9 14.9 4.3 Central Warm-Air Furnace................................ 44.7

  9. Total...........................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    0.6 15.1 5.5 Do Not Have Cooling Equipment............................. 17.8 4.0 2.4 1.7 Have Cooling Equipment.......................................... 93.3 16.5 12.8 3.8 Use Cooling Equipment........................................... 91.4 16.3 12.6 3.7 Have Equipment But Do Not Use it.......................... 1.9 0.3 Q Q Air-Conditioning Equipment 1, 2 Central System........................................................ 65.9 6.0 5.2 0.8 Without a Heat

  10. Total...........................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    4.2 7.6 16.6 Do Not Have Cooling Equipment............................. 17.8 10.3 3.1 7.3 Have Cooling Equipment.......................................... 93.3 13.9 4.5 9.4 Use Cooling Equipment........................................... 91.4 12.9 4.3 8.5 Have Equipment But Do Not Use it.......................... 1.9 1.0 Q 0.8 Air-Conditioning Equipment 1, 2 Central System........................................................ 65.9 10.5 3.9 6.5 Without a Heat

  11. Total.............................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    Do Not Have Cooling Equipment............................... 17.8 4.0 2.1 1.4 10.3 Have Cooling Equipment............................................ 93.3 16.5 23.5 39.3 13.9 Use Cooling Equipment............................................. 91.4 16.3 23.4 38.9 12.9 Have Equipment But Do Not Use it............................ 1.9 0.3 Q 0.5 1.0 Type of Air-Conditioning Equipment 1, 2 Central System........................................................ 65.9 6.0 17.3 32.1 10.5 Without a Heat

  12. Total.............................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    Cooking Appliances Frequency of Hot Meals Cooked 3 or More Times A Day......................................... 8.2 1.2 1.0 0.2 2 Times A Day...................................................... 24.6 4.0 2.7 1.2 Once a Day........................................................... 42.3 7.9 5.4 2.5 A Few Times Each Week...................................... 27.2 6.0 4.8 1.2 About Once a Week.............................................. 3.9 0.6 0.5 Q Less Than Once a

  13. Total.............................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    Cooking Appliances Frequency of Hot Meals Cooked 3 or More Times A Day......................................... 8.2 1.4 1.0 0.4 2 Times A Day...................................................... 24.6 5.8 3.5 2.3 Once a Day........................................................... 42.3 10.7 7.8 2.9 A Few Times Each Week...................................... 27.2 5.6 4.0 1.6 About Once a Week.............................................. 3.9 0.9 0.6 0.3 Less Than Once a

  14. Total.............................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    Do Not Have Cooling Equipment............................... 17.8 1.4 0.8 0.2 0.3 Have Cooling Equipment............................................ 93.3 39.3 20.9 6.7 11.8 Use Cooling Equipment............................................. 91.4 38.9 20.7 6.6 11.7 Have Equipment But Do Not Use it............................ 1.9 0.5 Q Q Q Type of Air-Conditioning Equipment 1, 2 Central System........................................................ 65.9 32.1 17.6 5.2 9.3 Without a Heat

  15. Total.............................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    Cooking Appliances Frequency of Hot Meals Cooked 3 or More Times A Day......................................... 8.2 2.6 0.7 1.9 2 Times A Day...................................................... 24.6 6.6 2.0 4.6 Once a Day........................................................... 42.3 8.8 2.9 5.8 A Few Times Each Week...................................... 27.2 4.7 1.5 3.1 About Once a Week.............................................. 3.9 0.7 Q 0.6 Less Than Once a

  16. Total.............................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    Do Not Have Cooling Equipment............................... 17.8 10.3 3.1 7.3 Have Cooling Equipment............................................ 93.3 13.9 4.5 9.4 Use Cooling Equipment............................................. 91.4 12.9 4.3 8.5 Have Equipment But Do Not Use it............................ 1.9 1.0 Q 0.8 Type of Air-Conditioning Equipment 1, 2 Central System........................................................ 65.9 10.5 3.9 6.5 Without a Heat

  17. Total.............................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    Do Not Have Cooling Equipment............................... 17.8 8.5 2.7 2.6 4.0 Have Cooling Equipment............................................ 93.3 38.6 16.2 20.1 18.4 Use Cooling Equipment............................................. 91.4 37.8 15.9 19.8 18.0 Have Equipment But Do Not Use it............................ 1.9 0.9 0.3 0.3 0.4 Type of Air-Conditioning Equipment 1, 2 Central System........................................................ 65.9 25.8 10.9 16.6 12.5 Without a Heat

  18. Total..............................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    111.1 7.1 7.0 8.0 12.1 Personal Computers Do Not Use a Personal Computer .......................... 35.5 3.0 2.0 2.7 3.1 Use a Personal Computer....................................... 75.6 4.2 5.0 5.3 9.0 Number of Desktop PCs 1......................................................................... 50.3 3.1 3.4 3.4 5.4 2......................................................................... 16.2 0.7 1.1 1.2 2.2 3 or More............................................................ 9.0 0.3

  19. Total.................................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    7.1 7.0 8.0 12.1 Do Not Have Cooling Equipment................................... 17.8 1.8 Q Q 4.9 Have Cooling Equipment................................................ 93.3 5.3 7.0 7.8 7.2 Use Cooling Equipment................................................. 91.4 5.3 7.0 7.7 6.6 Have Equipment But Do Not Use it............................... 1.9 Q N Q 0.6 Air-Conditioning Equipment 1, 2 Central System.............................................................. 65.9 1.1 6.4 6.4 5.4 Without a

  20. Total....................................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    25.6 40.7 24.2 Personal Computers Do Not Use a Personal Computer.................................. 35.5 6.9 8.1 14.2 6.4 Use a Personal Computer.............................................. 75.6 13.7 17.5 26.6 17.8 Most-Used Personal Computer Type of PC Desk-top Model......................................................... 58.6 10.4 14.1 20.5 13.7 Laptop Model............................................................. 16.9 3.3 3.4 6.1 4.1 Hours Turned on Per Week Less than 2

  1. Total....................................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    5.6 17.7 7.9 Personal Computers Do Not Use a Personal Computer.................................. 35.5 8.1 5.6 2.5 Use a Personal Computer.............................................. 75.6 17.5 12.1 5.4 Most-Used Personal Computer Type of PC Desk-top Model......................................................... 58.6 14.1 10.0 4.0 Laptop Model............................................................. 16.9 3.4 2.1 1.3 Hours Turned on Per Week Less than 2

  2. Total....................................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    Cooking Appliances Frequency of Hot Meals Cooked 3 or More Times A Day................................................. 8.2 3.0 1.6 0.3 1.1 2 Times A Day.............................................................. 24.6 8.3 4.2 1.3 2.7 Once a Day................................................................... 42.3 15.0 8.1 2.7 4.2 A Few Times Each Week............................................. 27.2 10.9 6.0 1.8 3.1 About Once a Week..................................................... 3.9

  3. Total....................................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    Personal Computers Do Not Use a Personal Computer.................................. 35.5 14.2 7.2 2.8 4.2 Use a Personal Computer.............................................. 75.6 26.6 14.5 4.1 7.9 Most-Used Personal Computer Type of PC Desk-top Model......................................................... 58.6 20.5 11.0 3.4 6.1 Laptop Model............................................................. 16.9 6.1 3.5 0.7 1.9 Hours Turned on Per Week Less than 2

  4. Total....................................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    4.2 7.6 16.6 Personal Computers Do Not Use a Personal Computer.................................. 35.5 6.4 2.2 4.2 Use a Personal Computer.............................................. 75.6 17.8 5.3 12.5 Most-Used Personal Computer Type of PC Desk-top Model......................................................... 58.6 13.7 4.2 9.5 Laptop Model............................................................. 16.9 4.1 1.1 3.0 Hours Turned on Per Week Less than 2

  5. Total....................................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    Cooking Appliances Frequency of Hot Meals Cooked 3 or More Times A Day................................................. 8.2 3.7 1.6 1.4 1.5 2 Times A Day.............................................................. 24.6 10.8 4.1 4.3 5.5 Once a Day................................................................... 42.3 17.0 7.2 8.7 9.3 A Few Times Each Week............................................. 27.2 11.4 4.7 6.4 4.8 About Once a Week.....................................................

  6. Total....................................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    111.1 47.1 19.0 22.7 22.3 Personal Computers Do Not Use a Personal Computer.................................. 35.5 16.9 6.5 4.6 7.6 Use a Personal Computer.............................................. 75.6 30.3 12.5 18.1 14.7 Most-Used Personal Computer Type of PC Desk-top Model......................................................... 58.6 22.9 9.8 14.1 11.9 Laptop Model............................................................. 16.9 7.4 2.7 4.0 2.9 Hours Turned on Per Week Less than 2

  7. Total.........................................................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    ..... 111.1 7.1 7.0 8.0 12.1 Personal Computers Do Not Use a Personal Computer...................................... 35.5 3.0 2.0 2.7 3.1 Use a Personal Computer.................................................. 75.6 4.2 5.0 5.3 9.0 Most-Used Personal Computer Type of PC Desk-top Model............................................................. 58.6 3.2 3.9 4.0 6.7 Laptop Model................................................................. 16.9 1.0 1.1 1.3 2.4 Hours Turned on Per Week Less

  8. Total

    U.S. Energy Information Administration (EIA) Indexed Site

    Administration, Form EIA-63B, 'Annual Photovoltaic CellModule Shipments Report.'rounding. ... Form EIA-63B, 'Annual Photovoltaic CellModule Shipments Report.' CellModule ...

  9. Total..........................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    ... 41.8 2,603 2,199 1,654 941 795 598 1-Car Garage...... 9.5 2,064 1,664 1,039 775 624 390 2-Car Garage......

  10. Total..........................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    ... Type of Glass in Windows Single-pane Glass...... 27.4 ... Q Q N Q N N Proportion of Windows Replaced All......

  11. Total..........................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    ... Type of Glass in Windows Single-pane Glass......Q Q Q Q Proportion of Windows Replaced All......

  12. Total..........................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    Air-Conditioning Equipment 1, 2 Central System...... 65.9 25.8 10.9 16.6 12.5 Without a Heat Pump......

  13. Total..........................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    Air-Conditioning Equipment 1, 2 Central System...... 65.9 6.0 17.3 32.1 10.5 Without a Heat Pump......

  14. Total..........................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    Air-Conditioning Equipment 1, 2 Central System...... 65.9 47.5 4.0 2.8 7.9 3.7 Without a Heat Pump...... 53.5 ...

  15. Total..........................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    Air-Conditioning Equipment 1, 2 Central System...... 65.9 32.1 17.6 5.2 9.3 Without a Heat Pump......

  16. Total..........................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    5.6 17.7 7.9 Do Not Have Cooling Equipment...... 17.8 2.1 1.8 0.3 Have Cooling Equipment...... 93.3 23.5 16.0 7.5 Use ...

  17. Total..........................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    ... 111.1 20.6 15.1 5.5 Do Not Have Cooling Equipment...... 17.8 4.0 2.4 1.7 Have Cooling Equipment...... 93.3 ...

  18. Total..........................................................

    U.S. Energy Information Administration (EIA) Indexed Site

    33.0 8.0 3.4 5.9 14.4 1.2 Do Not Have Cooling Equipment...... 17.8 6.5 1.6 0.9 1.3 2.4 0.2 Have Cooling Equipment...... 93.3 26.5 6.5 2.5 ...

  19. Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov

    National Nuclear Security Administration (NNSA)

    Site Office Contracting Officer E-mail address Ames Site Office Jackie York Jacquelyn.york@ch.doe.gov Argonne Site Office Jacquelyn York Jacquelyn.york@ch.doe.gov Brookhaven Site Office Evelyn Landini Jennifer Hartmann elandini@bnl.gov jhartmann@bnl.gov Idaho Site Office Paul Allen allenph@id.doe.gov Kansas City Site Office Ralph Tennant rtennant@kcp.gov Lawrence Livermore Site Office Homer Williamson homer.williamson@nnsa.doe.gov Los Alamos Site Office Barbara Romero Robert M. Poole

  20. Microsoft Word - WD Proposed Plan D5 R8 MASTER 10-29-14 _final with reply mail_ rev 1

    Energy Savers [EERE]

    WD-PLN-0034, Rev. 8 1 DOE/PPPO/03-0312&D5 Aerial photo of the Portsmouth Gaseous Diffusion Plant showing the three large process buildings (center of photo) and other support facilities, facing southwest PUBLIC COMMENT PERIOD NOVEMBER 12, 2014 TO JANUARY 10, 2015 HOW YOU CAN PARTICIPATE Read this Proposed Plan and review related documents in the Administrative Record. Comment on this Proposed Plan by mail, email, or fax to: Ms. Kristi Wiehle Department of Energy P.O. Box 370 Piketon, Ohio

  1. Determination of Total Solids in Biomass and Total Dissolved...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... The published moisture loss on drying for sodium tartrate is 15.62% (84.38% total solids). 14.6 Sample size: Determined by sample matrix. 14.7 Sample storage: Samples should be ...

  2. TotalView Training 2015

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TotalView Training 2015 TotalView Training 2015 NERSC will host an in-depth training course on TotalView, a graphical parallel debugger developed by Rogue Wave Software, on Thursday, March 26, 2015. This will be provided by Rogue Wave Software staff members. The training will include a lecture and demo sessions in the morning, followed by a hands-on parallel debugging session in the afternoon. Location This event will be presented online using WebEx technology and in person at NERSC Oakland

  3. ARM - Measurement - Total cloud water

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    cloud water ARM Data Discovery Browse Data Comments? We would love to hear from you Send us a note below or call us at 1-888-ARM-DATA. Send Measurement : Total cloud water The...

  4. U.S. Total Exports

    U.S. Energy Information Administration (EIA) Indexed Site

    CA Otay Mesa, CA Alamo, TX Clint, TX Del Rio, TX Eagle Pass, TX El Paso, TX Freeport, TX Hidalgo, TX Laredo, TX McAllen, TX Penitas, TX Rio Bravo, TX Rio Grande, TX Roma, TX Total ...

  5. Characteristics RSE Column Factor: Total

    U.S. Energy Information Administration (EIA) Indexed Site

    and 1994 Vehicle Characteristics RSE Column Factor: Total 1993 Family Income Below Poverty Line Eli- gible for Fed- eral Assist- ance 1 RSE Row Factor: Less than 5,000 5,000...

  6. 2014 Total Electric Industry- Customers

    U.S. Energy Information Administration (EIA) Indexed Site

    Customers (Data from forms EIA-861- schedules 4A, 4B, 4D, EIA-861S and EIA-861U) State Residential Commercial Industrial Transportation Total New England 6,243,013 862,269 28,017 8 ...

  7. "2014 Total Electric Industry- Customers"

    U.S. Energy Information Administration (EIA) Indexed Site

    Customers" "(Data from forms EIA-861- schedules 4A, 4B, 4D, EIA-861S and EIA-861U)" "State","Residential","Commercial","Industrial","Transportation","Total" "New England",6243013,8...

  8. Penser Original Contract - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Original Contract DOE-RL Contracts/Procurements RL Contracts & Procurements Home Prime Contracts Current Solicitations Other Sources DOE RL Contracting Officers DOE RL Contracting Officer Representatives Penser Original Contract Email Email Page | Print Print Page |Text Increase Font Size Decrease Font Size Original contract issued on Date June 15, 2009 The following are links to Portable Document Format (PDF) format documents. You will need the Adobe Acrobat Reader in order to view the

  9. Magnetic nematicity: A debated origin

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Vaknin, David

    2016-01-22

    Different experimental studies based on nuclear magnetic resonance and inelastic neutron scattering reach opposing conclusions in regards to the origin of magnetic nematicity in iron chalcogenides.

  10. CATEGORY Total Procurement Total Small Business Small Disadvantaged

    National Nuclear Security Administration (NNSA)

    CATEGORY Total Procurement Total Small Business Small Disadvantaged Business Woman Owned Small Business HubZone Small Business Veteran-Owned Small Business Service Disabled Veteran Owned Small Business FY 2013 Dollars Accomplished $1,049,087,940 $562,676,028 $136,485,766 $106,515,229 $12,080,258 $63,473,852 $28,080,960 FY 2013 % Accomplishment 54.40% 13.00% 10.20% 1.20% 6.60% 2.70% FY 2014 Dollars Accomplished $868,961,755 $443,711,175 $92,478,522 $88,633,031 $29,867,820 $43,719,452 $26,826,374

  11. CSC Original Contract - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Original Contract DOE-RL Contracts/Procurements RL Contracts & Procurements Home Prime Contracts Current Solicitations Other Sources DOE RL Contracting Officers DOE RL Contracting Officer Representatives CSC Original Contract Email Email Page | Print Print Page |Text Increase Font Size Decrease Font Size The following are links to Portable Document Format (PDF) format documents. You will need the Adobe Acrobat Reader in order to view the documents. The Adobe Acrobat Reader is available at no

  12. Total Adjusted Sales of Kerosene

    U.S. Energy Information Administration (EIA) Indexed Site

    End Use: Total Residential Commercial Industrial Farm All Other Period: Annual Download Series History Download Series History Definitions, Sources & Notes Definitions, Sources & Notes Show Data By: End Use Area 2009 2010 2011 2012 2013 2014 View History U.S. 269,010 305,508 187,656 81,102 79,674 137,928 1984-2014 East Coast (PADD 1) 198,762 237,397 142,189 63,075 61,327 106,995 1984-2014 New England (PADD 1A) 56,661 53,363 38,448 15,983 15,991 27,500 1984-2014 Connecticut 8,800 7,437

  13. Total Imports of Residual Fuel

    U.S. Energy Information Administration (EIA) Indexed Site

    Sep-15 Oct-15 Nov-15 Dec-15 Jan-16 Feb-16 View History U.S. Total 7,281 4,217 5,941 6,842 9,010 5,030 1936-2016 PAD District 1 4,571 2,206 2,952 3,174 3,127 2,664 1981-2016 Connecticut 1995-2015 Delaware 678 85 1995-2015 Florida 351 299 932 836 858 649 1995-2016 Georgia 120 295 210 262 1995-2016 Maine 1995-2015 Maryland 1995-2015 Massachusetts 1995-2015 New Hampshire 1995-2015 New Jersey 1,575 400 1,131 1,712 1,283 843 1995-2016 New York 1,475 998 350 322 234 824 1995-2016 North Carolina

  14. Original Workshop Proposal and Description

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Notes for Vis Requirements » Original Workshop Proposal and Description Original Workshop Proposal and Description Visualization Requirements for Computational Science and Engineering Applications Proposal for a DoE Workshop to Be Held 
at the Berkeley Marina Radisson Hotel,
Berkeley, California, June 5, 2002
(date and location are tenative) Workshop Co-organizers: Bernd Hamann 
University of California-Davis Lawrence Berkeley Nat'l Lab. E. Wes Bethel 
Lawrence Berkeley Nat'l Lab.

  15. MailedForm.pptx

    National Nuclear Security Administration (NNSA)

    Businesses using high-activity radioactive sources (Cesium-137, Cobalt-60, Americium-241, ... to: Kristina Hatcher, U.S. Department of Energy, 1000 Independence Ave., S.W., ...

  16. Total-derivative supersymmetry breaking

    SciTech Connect (OSTI)

    Haba, Naoyuki; Uekusa, Nobuhiro

    2010-05-15

    On an interval compactification in supersymmetric theory, boundary conditions for bulk fields must be treated carefully. If they are taken arbitrarily following the requirement that a theory is supersymmetric, the conditions could give redundant constraints on the theory. We construct a supersymmetric action integral on an interval by introducing brane interactions with which total-derivative terms under the supersymmetry transformation become zero due to a cancellation. The variational principle leads equations of motion and also boundary conditions for bulk fields, which determine boundary values of bulk fields. By estimating mass spectrum, spontaneous supersymmetry breaking in this simple setup can be realized in a new framework. This supersymmetry breaking does not induce a massless R axion, which is favorable for phenomenology. It is worth noting that fermions in hyper-multiplet, gauge bosons, and the fifth-dimensional component of gauge bosons can have zero-modes (while the other components are all massive as Kaluza-Klein modes), which fits the gauge-Higgs unification scenarios.

  17. ,"West Virginia Natural Gas Total Consumption (MMcf)"

    U.S. Energy Information Administration (EIA) Indexed Site

    Data for" ,"Data 1","West Virginia Natural Gas Total Consumption ... AM" "Back to Contents","Data 1: West Virginia Natural Gas Total Consumption (MMcf)" ...

  18. ,"New Mexico Natural Gas Total Consumption (MMcf)"

    U.S. Energy Information Administration (EIA) Indexed Site

    Data for" ,"Data 1","New Mexico Natural Gas Total Consumption ... AM" "Back to Contents","Data 1: New Mexico Natural Gas Total Consumption (MMcf)" ...

  19. ARM - Measurement - Shortwave broadband total downwelling irradiance

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Measurement : Shortwave broadband total downwelling irradiance The total diffuse and direct radiant energy that comes from some continuous range of directions, at wavelengths ...

  20. Total Space Heating Water Heating Cook-

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Commercial Buildings Energy Consumption Survey: Energy End-Use Consumption Tables Total Space Heating Water Heating Cook- ing Other Total Space Heating Water Heating Cook- ing...

  1. Total Space Heating Water Heating Cook-

    Gasoline and Diesel Fuel Update (EIA)

    Released: September, 2008 Total Space Heating Water Heating Cook- ing Other Total Space Heating Water Heating Cook- ing Other All Buildings* ... 1,870 1,276...

  2. Total Space Heating Water Heating Cook-

    Gasoline and Diesel Fuel Update (EIA)

    Energy Consumption Survey: Energy End-Use Consumption Tables Total Space Heating Water Heating Cook- ing Other Total Space Heating Water Heating Cook- ing Other All...

  3. Total Space Heating Water Heating Cook-

    Gasoline and Diesel Fuel Update (EIA)

    Released: September, 2008 Total Space Heating Water Heating Cook- ing Other Total Space Heating Water Heating Cook- ing Other All Buildings* ... 1,602 1,397...

  4. Total Space Heating Water Heating Cook-

    Gasoline and Diesel Fuel Update (EIA)

    Released: September, 2008 Total Space Heating Water Heating Cook- ing Other Total Space Heating Water Heating Cook- ing Other All Buildings ... 2,037...

  5. The Origin of the Elements

    ScienceCinema (OSTI)

    Murphy, Edward

    2014-08-06

    The world around us is made of atoms. Did you ever wonder where these atoms came from? How was the gold in our jewelry, the carbon in our bodies, and the iron in our cars made? In this lecture, we will trace the origin of a gold atom from the Big Bang to the present day, and beyond. You will learn how the elements were forged in the nuclear furnaces inside stars, and how, when they die, these massive stars spread the elements into space. You will learn about the origin of the building blocks of matter in the Big Bang, and we will speculate on the future of the atoms around us today.

  6. The Origin of the Elements

    SciTech Connect (OSTI)

    Murphy, Edward

    2012-11-20

    The world around us is made of atoms. Did you ever wonder where these atoms came from? How was the gold in our jewelry, the carbon in our bodies, and the iron in our cars made? In this lecture, we will trace the origin of a gold atom from the Big Bang to the present day, and beyond. You will learn how the elements were forged in the nuclear furnaces inside stars, and how, when they die, these massive stars spread the elements into space. You will learn about the origin of the building blocks of matter in the Big Bang, and we will speculate on the future of the atoms around us today.

  7. origins.indd | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    origins.indd origins.indd PDF icon origins.indd More Documents & Publications Fehner and Gosling, Origins of the Nevada Test Site Fehner and Gosling, Atmospheric Nuclear Weapons Testing, 1951-1963. Battlefield of the Cold War: The Nevada Test Site, Volume I NTS_History.indd

  8. The Origin of Cosmic Rays

    ScienceCinema (OSTI)

    Blasi, Pasquale [INAF/Arcetri-Italy and Fermilab, Italy

    2010-01-08

    Cosmic Rays reach the Earth from space with energies of up to more than 1020 eV, carrying information on the most powerful particle accelerators that Nature has been able to assemble. Understanding where and how cosmic rays originate has required almost one century of investigations, and, although the last word is not written yet, recent observations and theory seem now to fit together to provide us with a global picture of the origin of cosmic rays of unprecedented clarity. Here we will describe what we learned from recent observations of astrophysical sources (such as supernova remnants and active galaxies) and we will illustrate what these observations tell us about the physics of particle acceleration and transport. We will also discuss the ?end? of the Galactic cosmic ray spectrum, which bridges out attention towards the so called ultra high energy cosmic rays (UHECRs). At ~1020 eV the gyration scale of cosmic rays in cosmic magnetic fields becomes large enough to allow us to point back to their sources, thereby allowing us to perform ?cosmic ray astronomy?, as confirmed by the recent results obtained with the Pierre Auger Observatory. We will discuss the implications of these observations for the understanding of UHECRs, as well as some questions which will likely remain unanswered and will be the target of the next generation of cosmic ray experiments.

  9. Total Space Heating Water Heating Cook-

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Tables Total Space Heating Water Heating Cook- ing Other Total Space Heating Water Heating Cook- ing Other All Buildings* ... 634 578 46 1 Q 116.4 106.3...

  10. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    2 Alaska - Natural Gas 2014 Million Cu. Feet Percent of National Total Million Cu. Feet Percent of National Total Total Net Movements: - Industrial: Dry Production: Vehicle Fuel: Deliveries to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S2. Summary statistics for natural gas - Alaska, 2010-2014 2010 2011 2012 2013 2014 Number of Producing Gas Wells at End of Year 269 277 185 R 159 170 Production (million cubic feet) Gross Withdrawals From Gas Wells 127,417 112,268

  11. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    6 District of Columbia - Natural Gas 2014 Million Cu. Feet Percent of National Total Million Cu. Feet Percent of National Total Total Net Movements: - Industrial: Dry Production: Vehicle Fuel: Deliveries to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S9. Summary statistics for natural gas - District of Columbia, 2010-2014 2010 2011 2012 2013 2014 Number of Producing Gas Wells at End of Year 0 0 0 0 0 Production (million cubic feet) Gross Withdrawals From Gas Wells

  12. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    4 Massachusetts - Natural Gas 2014 Million Cu. Feet Percent of National Total Million Cu. Feet Percent of National Total Total Net Movements: - Industrial: Dry Production: Vehicle Fuel: Deliveries to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S23. Summary statistics for natural gas - Massachusetts, 2010-2014 2010 2011 2012 2013 2014 Number of Producing Gas Wells at End of Year 0 0 0 0 0 Production (million cubic feet) Gross Withdrawals From Gas Wells 0 0 0 0 0

  13. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    50 North Dakota - Natural Gas 2014 Million Cu. Feet Percent of National Total Million Cu. Feet Percent of National Total Total Net Movements: - Industrial: Dry Production: Vehicle Fuel: Deliveries to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S36. Summary statistics for natural gas - North Dakota, 2010-2014 2010 2011 2012 2013 2014 Number of Producing Gas Wells at End of Year 188 239 211 200 200 Production (million cubic feet) Gross Withdrawals From Gas Wells

  14. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    6 Washington - Natural Gas 2014 Million Cu. Feet Percent of National Total Million Cu. Feet Percent of National Total Total Net Movements: - Industrial: Dry Production: Vehicle Fuel: Deliveries to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S49. Summary statistics for natural gas - Washington, 2010-2014 2010 2011 2012 2013 2014 Number of Producing Gas Wells at End of Year 0 0 0 0 0 Production (million cubic feet) Gross Withdrawals From Gas Wells 0 0 0 0 0 From Oil

  15. Total System Performance Assessment Peer Review Panel

    Broader source: Energy.gov [DOE]

    Total System Performance Assessment (TSPA) Peer Review Panel for predicting the performance of a repository at Yucca Mountain.

  16. Origin of primordial magnetic fields

    SciTech Connect (OSTI)

    Souza, Rafael S. de; Opher, Reuven

    2008-02-15

    Magnetic fields of intensities similar to those in our galaxy are also observed in high redshift galaxies, where a mean field dynamo would not have had time to produce them. Therefore, a primordial origin is indicated. It has been suggested that magnetic fields were created at various primordial eras: during inflation, the electroweak phase transition, the quark-hadron phase transition (QHPT), during the formation of the first objects, and during reionization. We suggest here that the large-scale fields {approx}{mu}G, observed in galaxies at both high and low redshifts by Faraday rotation measurements (FRMs), have their origin in the electromagnetic fluctuations that naturally occurred in the dense hot plasma that existed just after the QHPT. We evolve the predicted fields to the present time. The size of the region containing a coherent magnetic field increased due to the fusion of smaller regions. Magnetic fields (MFs) {approx}10 {mu}G over a comoving {approx}1 pc region are predicted at redshift z{approx}10. These fields are orders of magnitude greater than those predicted in previous scenarios for creating primordial magnetic fields. Line-of-sight average MFs {approx}10{sup -2} {mu}G, valid for FRMs, are obtained over a 1 Mpc comoving region at the redshift z{approx}10. In the collapse to a galaxy (comoving size {approx}30 kpc) at z{approx}10, the fields are amplified to {approx}10 {mu}G. This indicates that the MFs created immediately after the QHPT (10{sup -4} s), predicted by the fluctuation-dissipation theorem, could be the origin of the {approx}{mu}G fields observed by FRMs in galaxies at both high and low redshifts. Our predicted MFs are shown to be consistent with present observations. We discuss the possibility that the predicted MFs could cause non-negligible deflections of ultrahigh energy cosmic rays and help create the observed isotropic distribution of their incoming directions. We also discuss the importance of the volume average magnetic field predicted by our model in producing the first stars and in reionizing the Universe.

  17. Nature and Origin of the Cuprate Pseudogap

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nature and Origin of the Cuprate Pseudogap Nature and Origin of the Cuprate Pseudogap Print Wednesday, 30 May 2007 00:00 The workings of high-temperature superconductive (HTSC)...

  18. Cell Total Activity Final Estimate.xls

    Office of Legacy Management (LM)

    WSSRAP Cell Total Activity Final Estimate (calculated September 2002, Fleming) (Waste streams & occupied cell volumes from spreadsheet titled "cell waste volumes-8.23.02 with ...

  19. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    0 Alabama - Natural Gas 2014 Million Cu. Feet Percent of National Total Million Cu. Feet Percent of National Total Total Net Movements: - Industrial: Dry Production: Vehicle Fuel: Deliveries to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S1. Summary statistics for natural gas - Alabama, 2010-2014 2010 2011 2012 2013 2014 Number of Producing Gas Wells at End of Year 7,026 7,063 6,327 R 6,165 6,118 Production (million cubic feet) Gross Withdrawals From Gas Wells

  20. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    0 Colorado - Natural Gas 2014 Million Cu. Feet Percent of National Total Million Cu. Feet Percent of National Total Total Net Movements: - Industrial: Dry Production: Vehicle Fuel: Deliveries to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S6. Summary statistics for natural gas - Colorado, 2010-2014 2010 2011 2012 2013 2014 Number of Producing Gas Wells at End of Year 28,813 30,101 32,000 R 32,468 38,346 Production (million cubic feet) Gross Withdrawals From Gas

  1. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    8 Florida - Natural Gas 2014 Million Cu. Feet Percent of National Total Million Cu. Feet Percent of National Total Total Net Movements: - Industrial: Dry Production: Vehicle Fuel: Deliveries to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S10. Summary statistics for natural gas - Florida, 2010-2014 2010 2011 2012 2013 2014 Number of Producing Gas Wells at End of Year 0 0 0 0 0 Production (million cubic feet) Gross Withdrawals From Gas Wells 0 0 17,182 16,459 19,742

  2. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    4 Hawaii - Natural Gas 2014 Million Cu. Feet Percent of National Total Million Cu. Feet Percent of National Total Total Net Movements: - Industrial: Dry Production: Vehicle Fuel: Deliveries to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S13. Summary statistics for natural gas - Hawaii, 2010-2014 2010 2011 2012 2013 2014 Number of Producing Gas Wells at End of Year 0 0 0 0 0 Production (million cubic feet) Gross Withdrawals From Gas Wells 0 0 0 0 0 From Oil Wells 0

  3. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    6 Idaho - Natural Gas 2014 Million Cu. Feet Percent of National Total Million Cu. Feet Percent of National Total Total Net Movements: - Industrial: Dry Production: Vehicle Fuel: Deliveries to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S14. Summary statistics for natural gas - Idaho, 2010-2014 2010 2011 2012 2013 2014 Number of Producing Gas Wells at End of Year 0 0 0 0 0 Production (million cubic feet) Gross Withdrawals From Gas Wells 0 0 0 0 0 From Oil Wells 0 0

  4. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    4 Kansas - Natural Gas 2014 Million Cu. Feet Percent of National Total Million Cu. Feet Percent of National Total Total Net Movements: - Industrial: Dry Production: Vehicle Fuel: Deliveries to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S18. Summary statistics for natural gas - Kansas, 2010-2014 2010 2011 2012 2013 2014 Number of Producing Gas Wells at End of Year 22,145 25,758 24,697 R 23,792 24,354 Production (million cubic feet) Gross Withdrawals From Gas Wells

  5. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    8 Louisiana - Natural Gas 2014 Million Cu. Feet Percent of National Total Million Cu. Feet Percent of National Total Total Net Movements: - Industrial: Dry Production: Vehicle Fuel: Deliveries to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S20. Summary statistics for natural gas - Louisiana, 2010-2014 2010 2011 2012 2013 2014 Number of Producing Gas Wells at End of Year 19,137 21,235 19,792 R 19,528 19,251 Production (million cubic feet) Gross Withdrawals From Gas

  6. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    4 New Mexico - Natural Gas 2014 Million Cu. Feet Percent of National Total Million Cu. Feet Percent of National Total Total Net Movements: - Industrial: Dry Production: Vehicle Fuel: Deliveries to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S33. Summary statistics for natural gas - New Mexico, 2010-2014 2010 2011 2012 2013 2014 Number of Producing Gas Wells at End of Year 44,748 32,302 28,206 R 27,073 27,957 Production (million cubic feet) Gross Withdrawals From

  7. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    6 Oregon - Natural Gas 2014 Million Cu. Feet Percent of National Total Million Cu. Feet Percent of National Total Total Net Movements: - Industrial: Dry Production: Vehicle Fuel: Deliveries to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S39. Summary statistics for natural gas - Oregon, 2010-2014 2010 2011 2012 2013 2014 Number of Producing Gas Wells at End of Year 26 24 27 R 26 28 Production (million cubic feet) Gross Withdrawals From Gas Wells 1,407 1,344 770 770

  8. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Net Movements: - Industrial: Dry Production: Vehicle ... due to independent rounding. Prices are in nominal dollars. ... Annual Consumption per Consumer (thousand cubic feet) ...

  9. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    from Electric Power to Industrial for years 2002 through ... Totals may not add due to independent rounding. Prices are ... Annual Consumption per Consumer (thousand cubic feet) ...

  10. Total Natural Gas Underground Storage Capacity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Storage Capacity Salt Caverns Storage Capacity Aquifers Storage Capacity Depleted Fields Storage Capacity Total Working Gas Capacity Working Gas Capacity of Salt Caverns Working...

  11. ARM - Measurement - Shortwave narrowband total downwelling irradiance

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Send Measurement : Shortwave narrowband total downwelling irradiance The rate at which radiant energy, in narrow bands of wavelengths shorter than approximately 4 mum, passes ...

  12. ARM - Measurement - Shortwave narrowband total upwelling irradiance

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Send Measurement : Shortwave narrowband total upwelling irradiance The rate at which radiant energy, in narrow bands of wavelengths shorter than approximately 4 mum, passes ...

  13. ARM - Measurement - Shortwave spectral total downwelling irradiance

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Send Measurement : Shortwave spectral total downwelling irradiance The rate at which radiant energy, at specrally-resolved wavelengths between 0.4 and 4 mum, is being emitted ...

  14. 2014 Total Electric Industry- Sales (Megawatthours

    U.S. Energy Information Administration (EIA) Indexed Site

    EIA-861U)" "State","Residential","Commercial","Industrial","Transportation","Total" "New England",47211525,53107038,19107433,557463,119983459 "Connecticut",12777579,12893531,351479...

  15. Total Supplemental Supply of Natural Gas

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Product: Total Supplemental Supply Synthetic Propane-Air Refinery Gas Biomass Other Period: Monthly Annual Download Series History Download Series History Definitions, Sources & ...

  16. Table 5.7 Petroleum Net Imports by Country of Origin, 1960-2011

    U.S. Energy Information Administration (EIA) Indexed Site

    Petroleum Net Imports by Country of Origin, 1960-2011 Year Persian Gulf 2 Selected OPEC 1 Countries Selected Non-OPEC 1 Countries Total Net Imports Total Net Imports as Share of Consumption 5 Net Imports From OPEC 1 Algeria Nigeria Saudi Arabia 3 Venezuela Total OPEC 4 Canada Mexico United Kingdom Virgin Islands and Puerto Rico Total Non-OPEC 4 Share of Total Net Imports 6 Share of Consumption 7 Thousand Barrels Percent 1960 NA [8] [9] 30,786 333,046 450,799 31,454 -620 -4,267 12,553 139,406

  17. 2009 Total Energy Production by State | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Total Energy Production by State 2009 Total Energy Production by State 2009 Total Energy Production by State...

  18. Million Cu. Feet Percent of National Total

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    8 Minnesota - Natural Gas 2014 Million Cu. Feet Percent of National Total Million Cu. Feet ... Summary statistics for natural gas - Minnesota, 2010-2014 2010 2011 2012 2013 2014 ...

  19. EQUUS Total Return Inc | Open Energy Information

    Open Energy Info (EERE)

    Jump to: navigation, search Name: EQUUS Total Return Inc Place: Houston, Texas Product: A business development company and VC investor that trades as a closed-end fund. EQUUS is...

  20. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    Totals may not add due to independent rounding. Prices are ... 250,994 253,127 Industrial 9,332 9,088 8,833 8,497 8,156 Average Annual Consumption per Consumer (thousand cubic ...

  1. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    Notes: Totals may not add due to independent rounding. Prices ... 34,078 34,283 34,339 Industrial 102 94 97 95 92 Average Annual Consumption per Consumer (thousand cubic feet) ...

  2. Million Cu. Feet Percent of National Total

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    as known volumes of natural gas that were the result of leaks, damage, accidents, migration, andor blow down. Notes: Totals may not add due to independent rounding. Prices are...

  3. TotalView Parallel Debugger at NERSC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    The performance of the GUI can be greatly improved if used in conjunction with free NX software. The TotalView documentation web page is a good resource for learning more...

  4. ARM - Measurement - Shortwave broadband total upwelling irradiance

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Send Measurement : Shortwave broadband total upwelling irradiance The rate at which radiant energy, at a wavelength between 0.4 and 4 mum, is being emitted upwards into a ...

  5. "2014 Total Electric Industry- Revenue (Thousands Dollars)"

    U.S. Energy Information Administration (EIA) Indexed Site

    EIA-861U)" "State","Residential","Commercial","Industrial","Transportation","Total" "New England",8414175.4,7806276.7,2262752.4,57837.4,18541041.8 "Connecticut",2523348.7,2004629.1...

  6. 2014 Total Electric Industry- Revenue (Thousands Dollars)

    U.S. Energy Information Administration (EIA) Indexed Site

    Revenue (Thousands Dollars) (Data from forms EIA-861- schedules 4A-D, EIA-861S and EIA-861U) State Residential Commercial Industrial Transportation Total New England 8,414,175 ...

  7. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S11. ... 2,314 764 719 180 4,046 Supplemental Gas Supplies 732 701 660 642 635 Balancing Item ...

  8. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S35. ... 3,762 7,315 10,303 Supplemental Gas Supplies 0 0 0 0 0 Balancing Item 65,897 -19,970 ...

  9. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S7. ... 473 526 484 626 1,359 Supplemental Gas Supplies 0 0 0 0 0 Balancing Item -6,645 3,976 ...

  10. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S31. ... 35 108 71 124 185 Supplemental Gas Supplies 0 0 0 0 0 Balancing Item -1,393 -3,726 ...

  11. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S51. ... 92 87 100 89 138 Supplemental Gas Supplies 0 0 0 0 0 Balancing Item -2,885 -12,890 ...

  12. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S8. ... 76 96 66 131 128 Supplemental Gas Supplies 1 0 * * 6 Balancing Item 3,249 7,362 ...

  13. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S17. ... 1,844 980 2,403 2,701 Supplemental Gas Supplies 2 1 0 0 1 Balancing Item -1,989 -7,914 ...

  14. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S32. ... 4,404 3,278 5,208 6,218 Supplemental Gas Supplies 457 392 139 255 530 Balancing Item ...

  15. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S41. ... 698 436 457 645 879 Supplemental Gas Supplies 0 0 0 0 0 Balancing Item -1,269 1,045 ...

  16. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S47. ... 0 LNG Storage 0 0 0 0 0 Supplemental Gas Supplies 1 2 3 3 5 Balancing Item -453 -1,711 ...

  17. Million Cu. Feet Percent of National Total

    U.S. Energy Information Administration (EIA) Indexed Site

    to Consumers: Residential: Electric Power: Commercial: Total Delivered: Table S30. ... 195 154 146 210 211 Supplemental Gas Supplies 0 0 0 0 0 Balancing Item 17,590 4,622 ...

  18. Nature and Origin of the Cuprate Pseudogap

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nature and Origin of the Cuprate Pseudogap Nature and Origin of the Cuprate Pseudogap Print Wednesday, 30 May 2007 00:00 The workings of high-temperature superconductive (HTSC) materials are a mystery wrapped in an enigma. However, a team of researchers from the ALS, Brookhaven National Laboratory, and Cornell University has taken a major step in understanding part of this mystery-the nature and origin of the pseudogap. Using angle-resolved photoemission spectroscopy (ARPES) and scanning

  19. Penser Original Contract (EM0003383) - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    DOE-RL Contracts/Procurements Prime Contracts Penser Original Contract (EM0003383) DOE-RL Contracts/Procurements RL Contracts & Procurements Home Prime Contracts Current Solicitations Other Sources DOE RL Contracting Officers DOE RL Contracting Officer Representatives Penser Original Contract (EM0003383) Email Email Page | Print Print Page |Text Increase Font Size Decrease Font Size Original contract issued on Date September 15, 2014 The following are links to Portable Document Format (PDF)

  20. Nature and Origin of the Cuprate Pseudogap

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nature and Origin of the Cuprate Pseudogap Print The workings of high-temperature superconductive (HTSC) materials are a mystery wrapped in an enigma. However, a team of...

  1. Nature and Origin of the Cuprate Pseudogap

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    an energy gap is already present at the Fermi surface in the normal, nonsuperconductive, state. This is known as a pseudogap, and its origin and relationship to superconductivity...

  2. Original","Revised","Data

    U.S. Energy Information Administration (EIA) Indexed Site

    ,"Original","Revised","Data" "Data Type","Product","End Use","PADD","State","Data 2003","Data 2003","Different" "Sales","No. 1 Distillate","Residential","U.S. TOTAL",,110032,110032 "Sales","No. 1 Distillate","Residential","PADD 1",,4232,4232 "Sales","No. 1

  3. Total internal reflection laser tools and methods

    DOE Patents [OSTI]

    Zediker, Mark S.; Faircloth, Brian O.; Kolachalam, Sharath K.; Grubb, Daryl L.

    2016-02-02

    There is provided high power laser tools and laser heads that utilize total internal reflection ("TIR") structures to direct the laser beam along a laser beam path within the TIR structure. The TIR structures may be a TIR prism having its hypotenuse as a TIR surface.

  4. Total pressing Indonesian gas development, exports

    SciTech Connect (OSTI)

    Not Available

    1994-01-24

    Total is on track to become Indonesia's leading gas exporter by the turn of the century. Total's aggressive development of its Mahakam Delta acreage in East Kalimantan is intended to keep pace with growing liquefied natural gas demand, mainly from Japan but also increasingly from South Korea and Taiwan. A frantic scramble is under way among natural gas suppliers in the Pacific Rim region, particularly those with current LNG export facilities, to accommodate projections of soaring natural gas demand in the region. Accordingly, Total's Indonesian gas production goal is the centerpiece of a larger strategy to become a major player in the Far East Asia gas scene. Its goals also fall in line with Indonesia's. Facing flat or declining oil production while domestic oil demand continues to soar along with a rapidly growing economy, Indonesia is heeding some studies that project the country could become a net oil importer by the turn of the century. The paper describes Total's Far East strategy, the Mahakam acreage which it operates, the shift to gas development, added discoveries, future development, project spending levels, and LNG export capacity.

  5. OriginOil Inc | Open Energy Information

    Open Energy Info (EERE)

    Inc Place: Los Angeles, California Zip: 90016 Product: California-based OTC-quoted algae-to-oil technology developer. References: OriginOil Inc1 This article is a stub. You...

  6. Nature and Origin of the Cuprate Pseudogap

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nature and Origin of the Cuprate Pseudogap Print The workings of high-temperature superconductive (HTSC) materials are a mystery wrapped in an enigma. However, a team of researchers from the ALS, Brookhaven National Laboratory, and Cornell University has taken a major step in understanding part of this mystery-the nature and origin of the pseudogap. Using angle-resolved photoemission spectroscopy (ARPES) and scanning tunneling microscopy (STM), they have determined the electronic structure of

  7. Nature and Origin of the Cuprate Pseudogap

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nature and Origin of the Cuprate Pseudogap Print The workings of high-temperature superconductive (HTSC) materials are a mystery wrapped in an enigma. However, a team of researchers from the ALS, Brookhaven National Laboratory, and Cornell University has taken a major step in understanding part of this mystery-the nature and origin of the pseudogap. Using angle-resolved photoemission spectroscopy (ARPES) and scanning tunneling microscopy (STM), they have determined the electronic structure of

  8. Nature and Origin of the Cuprate Pseudogap

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Nature and Origin of the Cuprate Pseudogap Print The workings of high-temperature superconductive (HTSC) materials are a mystery wrapped in an enigma. However, a team of researchers from the ALS, Brookhaven National Laboratory, and Cornell University has taken a major step in understanding part of this mystery-the nature and origin of the pseudogap. Using angle-resolved photoemission spectroscopy (ARPES) and scanning tunneling microscopy (STM), they have determined the electronic structure of

  9. Frustrated total internal reflection acoustic field sensor

    DOE Patents [OSTI]

    Kallman, Jeffrey S.

    2000-01-01

    A frustrated total internal reflection acoustic field sensor which allows the acquisition of the acoustic field over an entire plane, all at once. The sensor finds use in acoustic holography and acoustic diffraction tomography. For example, the sensor may be produced by a transparent plate with transparent support members tall enough to support one or more flexible membranes at an appropriate height for frustrated total internal reflection to occur. An acoustic wave causes the membrane to deflect away from its quiescent position and thus changes the amount of light that tunnels through the gap formed by the support members and into the membrane, and so changes the amount of light reflected by the membrane. The sensor(s) is illuminated by a uniform tight field, and the reflection from the sensor yields acoustic wave amplitude and phase information which can be picked up electronically or otherwise.

  10. Fractionated total body irradiation for metastatic neuroblastoma

    SciTech Connect (OSTI)

    Kun, L.E.; Casper, J.T.; Kline, R.W.; Piaskowski, V.D.

    1981-11-01

    Twelve patients over one year old with neuroblastoma (NBL) metastatic to bone and bone marrow entered a study of adjuvant low-dose, fractionated total body irradiation (TBI). Six children who achieved a ''complete clinical response'' following chemotherapy (cyclophosphamide and adriamycin) and surgical resection of the abdominal primary received TBI (10 rad/fraction to totals of 100-120 rad/10-12 fx/12-25 days). Two children received concurrent local irradiation for residual abdominal tumor. The intervals from cessation of chemotherapy to documented progression ranged from 2-16 months, not substatially different from patients receiving similar chemotherapy and surgery without TBI. Three additional children with progressive NBL received similar TBI (80-120 rad/8-12 fx) without objective response.

  11. Total Crude Oil and Petroleum Products Exports

    U.S. Energy Information Administration (EIA) Indexed Site

    Exports Product: Total Crude Oil and Petroleum Products Crude Oil Natural Gas Plant Liquids and Liquefied Refinery Gases Pentanes Plus Liquefied Petroleum Gases Ethane/Ethylene Propane/Propylene Normal Butane/Butylene Isobutane/Isobutylene Other Liquids Hydrogen/Oxygenates/Renewables/Other Hydrocarbons Oxygenates (excl. Fuel Ethanol) Methyl Tertiary Butyl Ether (MTBE) Other Oxygenates Renewable Fuels (incl. Fuel Ethanol) Fuel Ethanol Biomass-Based Diesel Unfinished Oils Naphthas and Lighter

  12. "Table A28. Total Expenditures for Purchased Energy Sources...

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Expenditures for Purchased Energy Sources by Census Region" " and Economic ... "," ","Coke"," ","Row" "Economic Characteristics(a)","Total","Electricity...

  13. Table 6a. Total Electricity Consumption per Effective Occupied...

    U.S. Energy Information Administration (EIA) Indexed Site

    a. Total Electricity Consumption per Effective Occupied Square Foot, 1992 Building Characteristics All Buildings Using Electricity (thousand) Total Electricity Consumption...

  14. Total Adjusted Sales of Distillate Fuel Oil

    U.S. Energy Information Administration (EIA) Indexed Site

    End Use: Total Residential Commercial Industrial Oil Company Farm Electric Power Railroad Vessel Bunkering On-Highway Military Off-Highway All Other Period: Annual Download Series History Download Series History Definitions, Sources & Notes Definitions, Sources & Notes Show Data By: End Use Area 2009 2010 2011 2012 2013 2014 View History U.S. 55,664,448 58,258,830 59,769,444 57,512,994 58,675,008 61,890,990 1984-2014 East Coast (PADD 1) 18,219,180 17,965,794 17,864,868 16,754,388

  15. Total Adjusted Sales of Residual Fuel Oil

    U.S. Energy Information Administration (EIA) Indexed Site

    End Use: Total Commercial Industrial Oil Company Electric Power Vessel Bunkering Military All Other Period: Annual Download Series History Download Series History Definitions, Sources & Notes Definitions, Sources & Notes Show Data By: End Use Area 2009 2010 2011 2012 2013 2014 View History U.S. 7,835,436 8,203,062 7,068,306 5,668,530 4,883,466 3,942,750 1984-2014 East Coast (PADD 1) 3,339,162 3,359,265 2,667,576 1,906,700 1,699,418 1,393,068 1984-2014 New England (PADD 1A) 318,184

  16. Total Sales of Distillate Fuel Oil

    U.S. Energy Information Administration (EIA) Indexed Site

    End Use: Total Residential Commercial Industrial Oil Company Farm Electric Power Railroad Vessel Bunkering On-Highway Military Off-Highway All Other Period: Annual Download Series History Download Series History Definitions, Sources & Notes Definitions, Sources & Notes Show Data By: End Use Area 2009 2010 2011 2012 2013 2014 View History U.S. 54,100,092 56,093,645 57,082,558 57,020,840 58,107,155 60,827,930 1984-2014 East Coast (PADD 1) 17,821,973 18,136,965 17,757,005 17,382,566

  17. Total Sales of Residual Fuel Oil

    U.S. Energy Information Administration (EIA) Indexed Site

    End Use: Total Commercial Industrial Oil Company Electric Power Vessel Bunkering Military All Other Period: Annual Download Series History Download Series History Definitions, Sources & Notes Definitions, Sources & Notes Show Data By: End Use Area 2009 2010 2011 2012 2013 2014 View History U.S. 6,908,028 7,233,765 6,358,120 6,022,115 5,283,350 4,919,255 1984-2014 East Coast (PADD 1) 2,972,575 2,994,245 2,397,932 2,019,294 1,839,237 1,724,167 1984-2014 New England (PADD 1A) 281,895

  18. State Residential Commercial Industrial Transportation Total

    U.S. Energy Information Administration (EIA) Indexed Site

    Sales (Megawatthours) (Data from forms EIA-861- schedules 4A, 4B, 4D, EIA-861S and EIA-861U) State Residential Commercial Industrial Transportation Total New England 47,211,525 53,107,038 19,107,433 557,463 119,983,459 Connecticut 12,777,579 12,893,531 3,514,798 168,552 29,354,460 Maine 4,660,605 3,984,570 3,357,486 0 12,002,661 Massachusetts 20,071,160 26,076,208 7,960,941 360,983 54,469,292 New Hampshire 4,510,487 4,464,530 1,969,064 0 10,944,081 Rhode Island 3,070,347 3,657,679 887,150 27,928

  19. Total Ore Processing Integration and Management

    SciTech Connect (OSTI)

    Leslie Gertsch; Richard Gertsch

    2006-01-30

    This report outlines the technical progress achieved for project DE-FC26-03NT41785 (Total Ore Processing Integration and Management) during the period 01 July through 30 September of 2005. This ninth quarterly report discusses the activities of the project team during the period 1 July through 30 September 2005. Richard Gertsch's unexpected death due to natural causes while in Minnesota to work on this project has temporarily slowed progress. Statistical analysis of the Minntac Mine data set for late 2004 is continuing. Preliminary results raised several questions that could be amenable to further study. Detailed geotechnical characterization is being applied to improve the predictability of mill and agglomerator performance at Hibtac Mine.

  20. Performance Period Total Fee Paid FY2001

    Office of Environmental Management (EM)

    FY2001 $4,547,400 FY2002 $4,871,000 FY2003 $6,177,902 FY2004 $8,743,007 FY2005 $13,134,189 FY2006 $7,489,704 FY2007 $9,090,924 FY2008 $10,045,072 FY2009 $12,504,247 FY2010 $17,590,414 FY2011 $17,558,710 FY2012 $14,528,770 Cumulative Fee Paid $126,281,339 Cost Plus Award Fee DE-AC29-01AL66444 Washington TRU Solutions LLC Contractor: Contract Number: Contract Type: $8,743,007 Contract Period: $1,813,482,000 Fee Information Maximum Fee $131,691,744 Total Estimated Contract Cost: $4,547,400

  1. Performance Period Total Fee Paid FY2008

    Office of Environmental Management (EM)

    FY2008 $87,580 FY2009 $87,580 FY2010 $171,763 FY2011 $1,339,286 FY 2012 $38,126 FY 2013 $42,265 Cumulative Fee Paid $1,766,600 $42,265 Cost Plus Incentive Fee/Cost Plus Fixed Fee $36,602,425 Contract Period: September 2007 - November 30, 2012 Target Fee $521,595 Total Estimated Contract Cost Contract Type: Maximum Fee $3,129,570 $175,160 $377,516 $1,439,287 Fee Available $175,160 $80,871 Accelerated Remediation Company (aRc) DE-AT30-07CC60013 Contractor: Contract Number: Minimum Fee $2,086,380

  2. EIA - Distribution of U.S. Coal by Origin State

    U.S. Energy Information Administration (EIA) Indexed Site

    Origin State Glossary Home > Coal> Distribution of U.S. Coal by Origin State Distribution of U.S. Coal by Origin State Release Date: January 2006 Next Release Date: 2006...

  3. Total least squares for anomalous change detection

    SciTech Connect (OSTI)

    Theiler, James P; Matsekh, Anna M

    2010-01-01

    A family of difference-based anomalous change detection algorithms is derived from a total least squares (TLSQ) framework. This provides an alternative to the well-known chronochrome algorithm, which is derived from ordinary least squares. In both cases, the most anomalous changes are identified with the pixels that exhibit the largest residuals with respect to the regression of the two images against each other. The family of TLSQ-based anomalous change detectors is shown to be equivalent to the subspace RX formulation for straight anomaly detection, but applied to the stacked space. However, this family is not invariant to linear coordinate transforms. On the other hand, whitened TLSQ is coordinate invariant, and furthermore it is shown to be equivalent to the optimized covariance equalization algorithm. What whitened TLSQ offers, in addition to connecting with a common language the derivations of two of the most popular anomalous change detection algorithms - chronochrome and covariance equalization - is a generalization of these algorithms with the potential for better performance.

  4. Apparatus and method for quantitatively evaluating total fissile and total fertile nuclide content in samples

    DOE Patents [OSTI]

    Caldwell, John T. (Los Alamos, NM); Kunz, Walter E. (Santa Fe, NM); Cates, Michael R. (Oak Ridge, TN); Franks, Larry A. (Santa Barbara, CA)

    1985-01-01

    Simultaneous photon and neutron interrogation of samples for the quantitative determination of total fissile nuclide and total fertile nuclide material present is made possible by the use of an electron accelerator. Prompt and delayed neutrons produced from resulting induced fissions are counted using a single detection system and allow the resolution of the contributions from each interrogating flux leading in turn to the quantitative determination sought. Detection limits for .sup.239 Pu are estimated to be about 3 mg using prompt fission neutrons and about 6 mg using delayed neutrons.

  5. Minnesota Natural Gas % of Total Residential Deliveries (Percent...

    Gasoline and Diesel Fuel Update (EIA)

    Minnesota Natural Gas % of Total Residential Deliveries (Percent) Decade Year-0 Year-1 ... Share of Total U.S. Natural Gas Residential Deliveries Minnesota Share of Total U.S. ...

  6. California Natural Gas % of Total Residential Deliveries (Percent...

    Gasoline and Diesel Fuel Update (EIA)

    California Natural Gas % of Total Residential Deliveries (Percent) Decade Year-0 Year-1 ... Share of Total U.S. Natural Gas Residential Deliveries California Share of Total U.S. ...

  7. EIA-Voluntary Reporting of Greenhouse Gases Program - Original...

    U.S. Energy Information Administration (EIA) Indexed Site

    of Greenhouse Gases Program Original 1605(b) Program Calculation Tools The workbooks below were developed to assist participants in the original Voluntary Reporting of Greenhouse ...

  8. The origin of white luminescence from silicon oxycarbide thin...

    Office of Scientific and Technical Information (OSTI)

    origin of white luminescence from silicon oxycarbide thin films Citation Details In-Document Search Title: The origin of white luminescence from silicon oxycarbide thin films ...

  9. Origins of optical absorption characteristics of Cu2+ complexes...

    Office of Scientific and Technical Information (OSTI)

    Origins of optical absorption characteristics of Cu2+ complexes in solutions Citation Details In-Document Search Title: Origins of optical absorption characteristics of Cu2+ ...

  10. Molecular origin of photovoltaic performance in donor-block-acceptor...

    Office of Scientific and Technical Information (OSTI)

    Molecular origin of photovoltaic performance in donor-block-acceptor all-conjugated block ... Title: Molecular origin of photovoltaic performance in donor-block-acceptor all-conjugated ...

  11. Toward Understanding the Microscopic Origin of Nuclear Clustering...

    Office of Scientific and Technical Information (OSTI)

    Toward Understanding the Microscopic Origin of Nuclear Clustering Citation Details In-Document Search Title: Toward Understanding the Microscopic Origin of Nuclear Clustering Open...

  12. Argonne Researchers Shine "Light" on Origins of Wind Turbine...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Researchers Shine "Light" on Origins of Wind Turbine Bearing Failures Argonne Researchers Shine "Light" on Origins of Wind Turbine Bearing Failures September 12, 2014 - 11:34am ...

  13. Structural Origins of DNA Target Selection and Nucleobase Extrusion...

    Office of Scientific and Technical Information (OSTI)

    Structural Origins of DNA Target Selection and Nucleobase Extrusion by a DNA Cytosine Methyltransferase Citation Details In-Document Search Title: Structural Origins of DNA Target ...

  14. Origin of magnetic fields in galaxies

    SciTech Connect (OSTI)

    Souza, Rafael S. de; Opher, Reuven

    2010-03-15

    Microgauss magnetic fields are observed in all galaxies at low and high redshifts. The origin of these intense magnetic fields is a challenging question in astrophysics. We show here that the natural plasma fluctuations in the primordial Universe (assumed to be random), predicted by the fluctuation -dissipation theorem, predicts {approx}0.034 {mu}G fields over {approx}0.3 kpc regions in galaxies. If the dipole magnetic fields predicted by the fluctuation-dissipation theorem are not completely random, microgauss fields over regions > or approx. 0.34 kpc are easily obtained. The model is thus a strong candidate for resolving the problem of the origin of magnetic fields in < or approx. 10{sup 9} years in high redshift galaxies.

  15. Minnesota Natural Gas Total Consumption (Million Cubic Feet)

    Gasoline and Diesel Fuel Update (EIA)

    Total Consumption (Million Cubic Feet) Minnesota Natural Gas Total Consumption (Million ... Referring Pages: Natural Gas Consumption Minnesota Natural Gas Consumption by End Use ...

  16. California Natural Gas Total Consumption (Million Cubic Feet...

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Total Consumption (Million Cubic Feet) California Natural Gas Total Consumption (Million ... Referring Pages: Natural Gas Consumption California Natural Gas Consumption by End Use ...

  17. Total Crude Oil and Petroleum Products Imports by Processing...

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Product: Total Crude Oil and Petroleum Products Crude Oil Total Products Other Liquids Unfinished Oils Naphthas and Lighter Kerosene and Light Gas Oils Heavy Gas Oils Residuum ...

  18. NREL: Building America Total Quality Management - 2015 Peer Review...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NREL: Building America Total Quality Management - 2015 Peer Review NREL: Building America Total Quality Management - 2015 Peer Review Presenter: Stacey Rothgeb, NREL View the ...

  19. Table 6b. Relative Standard Errors for Total Electricity Consumption...

    U.S. Energy Information Administration (EIA) Indexed Site

    b. Relative Standard Errors for Total Electricity Consumption per Effective Occupied Square Foot, 1992 Building Characteristics All Buildings Using Electricity (thousand) Total...

  20. ,"Total District Heat Consumption (trillion Btu)",,,,,"District...

    U.S. Energy Information Administration (EIA) Indexed Site

    Heat Consumption (trillion Btu)",,,,,"District Heat Energy Intensity (thousand Btusquare foot)" ,"Total ","Space Heating","Water Heating","Cook- ing","Other","Total ","Space...

  1. ,"Total Natural Gas Consumption (trillion Btu)",,,,,"Natural...

    U.S. Energy Information Administration (EIA) Indexed Site

    Gas Consumption (trillion Btu)",,,,,"Natural Gas Energy Intensity (thousand Btusquare foot)" ,"Total ","Space Heating","Water Heating","Cook- ing","Other","Total ","Space...

  2. Total Energy Facilities Biomass Facility | Open Energy Information

    Open Energy Info (EERE)

    Energy Facilities Biomass Facility Jump to: navigation, search Name Total Energy Facilities Biomass Facility Facility Total Energy Facilities Sector Biomass Facility Type...

  3. Table 5a. Total District Heat Consumption per Effective Occupied...

    U.S. Energy Information Administration (EIA) Indexed Site

    a. Total District Heat Consumption per Effective Occupied Square Foot, 1992 Building Characteristics All Buildings Using District Heat (thousand) Total District Heat Consumption...

  4. Webtrends Archives by Fiscal Year — EERE Totals

    Broader source: Energy.gov [DOE]

    Historical EERE office total reports include only Webtrends archives by fiscal year. EERE total reports dating after FY11 can be accessed in EERE's Google Analytics account.

  5. Estimation of Anisotoropy from Total Cross Section and Optical...

    Office of Scientific and Technical Information (OSTI)

    Conference: Estimation of Anisotoropy from Total Cross Section and Optical Model Citation Details In-Document Search Title: Estimation of Anisotoropy from Total Cross Section and ...

  6. Total lymphoid irradiation for multiple sclerosis

    SciTech Connect (OSTI)

    Devereux, C.K.; Vidaver, R.; Hafstein, M.P.; Zito, G.; Troiano, R.; Dowling, P.C.; Cook, S.D.

    1988-01-01

    Although chemical immunosuppression has been shown to benefit patients with chronic progressive multiple sclerosis (MS), it appears that chemotherapy has an appreciable oncogenic potential in patients with multiple sclerosis. Accordingly, we developed a modified total lymphoid irradiation (TLI) regimen designed to reduce toxicity and applied it to a randomized double blind trial of TLI or sham irradiation in MS. Standard TLI regimens were modified to reduce dose to 1,980 rad, lowering the superior mantle margin to midway between the thyroid cartilage and angle of the mandible (to avert xerostomia) and the lower margin of the mantle field to the inferior margin of L1 (to reduce gastrointestinal toxicity by dividing abdominal radiation between mantle and inverted Y), limiting spinal cord dose to 1,000 rad by custom-made spine blocks in the mantle and upper 2 cm of inverted Y fields, and also protecting the left kidney even if part of the spleen were shielded. Clinical efficacy was documented by the less frequent functional scale deterioration of 20 TLI treated patients with chronic progressive MS compared to to 20 sham-irradiated progressive MS patients after 12 months (16% versus 55%, p less than 0.03), 18 months (28% versus 63%, p less than 0.03), and 24 months (44% versus 74%, N.S.). Therapeutic benefit during 3 years follow-up was related to the reduction in lymphocyte count 3 months post-irradiation (p less than 0.02). Toxicity was generally mild and transient, with no instance of xerostomia, pericarditis, herpes zoster, or need to terminate treatment in TLI patients. However, menopause was induced in 2 patients and staphylococcal pneumonia in one.

  7. Integrating Total Quality Management (TQM) and hazardous waste management

    SciTech Connect (OSTI)

    Kirk, N.

    1993-11-01

    The Resource Conservation and Recovery Act (RCRA) of 1976 and its subsequent amendments have had a dramatic impact on hazardous waste management for business and industry. The complexity of this law and the penalties for noncompliance have made it one of the most challenging regulatory programs undertaken by the Environmental Protection Agency (EPA). The fundamentals of RCRA include ``cradle to grave`` management of hazardous waste, covering generators, transporters, and treatment, storage, and disposal facilities. The regulations also address extensive definitions and listing/identification mechanisms for hazardous waste along with a tracking system. Treatment is favored over disposal and emphasis is on ``front-end`` treatment such as waste minimization and pollution prevention. A study of large corporations such as Xerox, 3M, and Dow Chemical, as well as the public sector, has shown that well known and successful hazardous waste management programs emphasize pollution prevention and employment of techniques such as proactive environmental management, environmentally conscious manufacturing, and source reduction. Nearly all successful hazardous waste programs include some aspects of Total Quality Management, which begins with a strong commitment from top management. Hazardous waste management at the Rocky Flats Plant is further complicated by the dominance of ``mixed waste`` at the facility. The mixed waste stems from the original mission of the facility, which was production of nuclear weapons components for the Department of Energy (DOE). A Quality Assurance Program based on the criterion in DOE Order 5700.6C has been implemented at Rocky Flats. All of the elements of the Quality Assurance Program play a role in hazardous waste management. Perhaps one of the biggest waste management problems facing the Rocky Flats Plant is cleaning up contamination from a forty year mission which focused on production of nuclear weapon components.

  8. ORIGINAL ARTICLE Radionuclide Concentrations in Benthic Invertebrates

    Office of Legacy Management (LM)

    Environ Monit Assess (2007) 128:329-341 DO1 10.1007/~10661-006-93 I 6 4 ORIGINAL ARTICLE - Radionuclide Concentrations in Benthic Invertebrates from Amchitka and Kiska Islands in the Aleutian Chain, Alaska Joanna Burger Michael Gochfeld Stephen C. Jewett Received: 8 March 2006 /Accepted: 8 May 2006 1 Published online: 21 October 2006 0 Springer Science + Business Media B.V. 2006 Abstract Concentrations of 13 radionuclides 1291, 60co, 1 5 2 ~ ~ , 9 0 s r , 9 9 ~ ~ , 2 4 1 ~ ~ , 238pu, 239249pu, 2

  9. ORIGINAL UNITED STATES ENVIRONMENTAL PROTECTION AGENCY REGION

    Energy Savers [EERE]

    ORIGINAL UNITED STATES ENVIRONMENTAL PROTECTION AGENCY REGION III 1050 Arch Street Philadelphia, Pennsylvania 10103-2029 November 15, 2012 I 'D.J cri rn n n~ nrv I Kimberly D. Bose, Secretary Federal Energy Regulatory Commission 888 First Street NE, Room 1A Washington, DC 20426 ~s- ~l RE: EPA Region 3 Seeping Comments in Response to FERC's Netic&iklnfent ton= Prepare an Environmental Assessment (EA) for the Planned Cove Po@P " g Liquefaction Project; FERC Docket Ne. PF12-16-000

  10. Microscopic origin of volume modulus inflation

    SciTech Connect (OSTI)

    Cicoli, Michele; Muia, Francesco; Pedro, Francisco Gil

    2015-12-21

    High-scale string inflationary models are in well-known tension with low-energy supersymmetry. A promising solution involves models where the inflaton is the volume of the extra dimensions so that the gravitino mass relaxes from large values during inflation to smaller values today. We describe a possible microscopic origin of the scalar potential of volume modulus inflation by exploiting non-perturbative effects, string loop and higher derivative perturbative corrections to the supergravity effective action together with contributions from anti-branes and charged hidden matter fields. We also analyse the relation between the size of the flux superpotential and the position of the late-time minimum and the inflection point around which inflation takes place. We perform a detailed study of the inflationary dynamics for a single modulus and a two moduli case where we also analyse the sensitivity of the cosmological observables on the choice of initial conditions.

  11. New Mexico Natural Gas % of Total Residential Deliveries (Percent...

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    % of Total Residential Deliveries (Percent) New Mexico Natural Gas % of Total Residential Deliveries (Percent) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8...

  12. Connecticut Natural Gas % of Total Residential Deliveries (Percent...

    Gasoline and Diesel Fuel Update (EIA)

    % of Total Residential Deliveries (Percent) Connecticut Natural Gas % of Total Residential Deliveries (Percent) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7...

  13. Connecticut Natural Gas Total Consumption (Million Cubic Feet...

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Total Consumption (Million Cubic Feet) Connecticut Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9...

  14. Maine Natural Gas Total Consumption (Million Cubic Feet)

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Total Consumption (Million Cubic Feet) Maine Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's...

  15. Maine Natural Gas % of Total Residential Deliveries (Percent...

    Gasoline and Diesel Fuel Update (EIA)

    % of Total Residential Deliveries (Percent) Maine Natural Gas % of Total Residential Deliveries (Percent) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8...

  16. Project Functions and Activities Definitions for Total Project Cost

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    1997-03-28

    This chapter provides guidelines developed to define the obvious disparity of opinions and practices with regard to what exactly is included in total estimated cost (TEC) and total project cost (TPC).

  17. Total China Investment Co Ltd | Open Energy Information

    Open Energy Info (EERE)

    China Investment Co Ltd Jump to: navigation, search Name: Total (China) Investment Co. Ltd. Place: Beijing, China Zip: 100004 Product: Total has been present in China for about 30...

  18. Virginia Natural Gas % of Total Residential Deliveries (Percent...

    Gasoline and Diesel Fuel Update (EIA)

    % of Total Residential Deliveries (Percent) Virginia Natural Gas % of Total Residential Deliveries (Percent) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8...

  19. Washington Natural Gas % of Total Residential Deliveries (Percent...

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    % of Total Residential Deliveries (Percent) Washington Natural Gas % of Total Residential Deliveries (Percent) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8...

  20. Delaware Total Electric Power Industry Net Generation, by Energy...

    U.S. Energy Information Administration (EIA) Indexed Site

    ...e","-","-","-","-","-" "Other","-","-",11,6,"-" "Total",7182,8534,7524,4842,5628 " " "s Value is less than 0.5 of the table metric, but value is included in any associated total.

  1. Kansas Natural Gas % of Total Residential Deliveries (Percent...

    Gasoline and Diesel Fuel Update (EIA)

    % of Total Residential Deliveries (Percent) Kansas Natural Gas % of Total Residential Deliveries (Percent) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8...

  2. Arizona Natural Gas Total Consumption (Million Cubic Feet)

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Total Consumption (Million Cubic Feet) Arizona Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9...

  3. Arizona Natural Gas % of Total Residential Deliveries (Percent...

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    % of Total Residential Deliveries (Percent) Arizona Natural Gas % of Total Residential Deliveries (Percent) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8...

  4. ,"Total Crude Oil and Petroleum Products Net Receipts by Pipeline...

    U.S. Energy Information Administration (EIA) Indexed Site

    Data for" ,"Data 1","Total Crude Oil and Petroleum Products Net Receipts by ... PM" "Back to Contents","Data 1: Total Crude Oil and Petroleum Products Net Receipts by ...

  5. NREL: Building America Total Quality Management - 2015 Peer Review |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy NREL: Building America Total Quality Management - 2015 Peer Review NREL: Building America Total Quality Management - 2015 Peer Review Presenter: Stacey Rothgeb, NREL View the Presentation PDF icon NREL: Building America Total Quality Management - 2015 Peer Review More Documents & Publications Home Performance with ENERGY STAR - 2014 BTO Peer Review NREL: Building America Total Quality Management - 2015 Peer Review R25 Polyisocyanurate Composite Insulation Material

  6. The magnetized universe: its origin and dissipation through acceleration

    SciTech Connect (OSTI)

    Colgate, Stirling; Li, Hui; Kronberg, Philip

    2010-09-02

    Problems of a magnetic universe and some, possible solutions: The greater the total energy of an astrophysical phenomena, the more restricted are the possible explanations. Magnetic energy is the most challenging because its origin is still considered problematic. We suggest that it is evident that the universe is magnetized because of radio lobes, extra galactic cosmic rays, an observed Faraday rotation measure, and the polarized emission of extra galactic radio structures. The implied energies are so large that only the formation of supermassive black holes, (SMBHs) at the center of every galaxy are remotely energetic enough to supply this immense energy, {approx} (1/10)10{sup 8} M{sub {circle_dot}}c{sup 2}. (Only a galaxy cluster of 1000 galaxies has comparable energy, but is inversely rare.) Yet this energy appears to be largely transformed into accelerated relativistic particles, both electrons and ions. Only a large-scale coherent dynamo within the accretion disk forming the massive black hole makes a reasonable starting point. The subsequent winding of this dynamo derived flux by conducting, angular-momentum-dominated accreting matter produces the immense, coherent magnetic fluxes. We imbed this explanation in a list of similar phenomena at smaller scale and look for physical consistency among the various phenomena, especially the conversion of force-free magnetic energy into acceleration.

  7. Domestic Coal Distribution 2009 Q1 by Origin State: Alabama

    U.S. Energy Information Administration (EIA) Indexed Site

    Q1 by Origin State: Alabama (1000 Short Tons) 1 58 Domestic Coal Distribution 2009 Q1 by Origin State: Alabama (1000 Short Tons) Destination State Transportation Mode Electricity...

  8. Domestic Coal Distribution 2009 Q2 by Origin State: Alabama

    U.S. Energy Information Administration (EIA) Indexed Site

    Q2 by Origin State: Alabama (1000 Short Tons) 1 58 Domestic Coal Distribution 2009 Q2 by Origin State: Alabama (1000 Short Tons) Destination State Transportation Mode Electricity...

  9. The Origin of Mass (Conference) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    The Origin of Mass Citation Details In-Document Search Title: The Origin of Mass You are accessing a document from the Department of Energy's (DOE) SciTech Connect. This site is ...

  10. OpenEI:No original research | Open Energy Information

    Open Energy Info (EERE)

    No original research Jump to: navigation, search OpenEI is a platform for bringing together the world's energy information. It is not a platform for original research. This means...

  11. Space Dust Analysis Could Provide Clues to Solar System Origins

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Space Dust Analysis Could Provide Clues to Solar System Origins Space Dust Analysis Could Provide Clues to Solar System Origins Print Thursday, 18 September 2014 12:34 New studies ...

  12. Scaling properties of proton-nucleus total reaction cross sections

    SciTech Connect (OSTI)

    Abu-Ibrahim, Badawy; Kohama, Akihisa

    2010-05-15

    We study the scaling properties of proton-nucleus total reaction cross sections for stable nuclei and propose an approximate expression in proportion to Z{sup 2/3}sigma{sub pp}{sup total}+N{sup 2/3}sigma{sub pn}{sup total}. Based on this expression, we can derive a relation that enables us to predict a total reaction cross section for any stable nucleus within 10% uncertainty at most, using the empirical value of the total reaction cross section of a given nucleus.

  13. Differential total absorptivity solution to the radiative transfer equation for mixtures of combustion gases and soot

    SciTech Connect (OSTI)

    Bressloff, N.W.; Moss, J.B.; Rubini, P.A.

    1997-01-01

    The differential total absorptivity (DTA) solution to the radiative transfer equation, originally devised for combustion gases in the discrete transfer radiation model, is extended to mixtures of gaseous combustion products and soot. The method is compared to other solution techniques for representative mixtures across single lines of sight and across a layer bounded by solid walls. Intermediate soot loadings are considered such that the total radiance is not dominated by either the gaseous or soot components. The DTA solution is shown to yield excellent accuracy relative to a narrow-band solution, with a considerable saving in computational cost. Thus, explicit treatment of the source temperature dependence of absorption is successfully demonstrated without the need for spectral integration.

  14. Understanding the origins of human cancer

    SciTech Connect (OSTI)

    Alexandrov, L. B.

    2015-12-04

    All cancers originate from a single cell that starts to behave abnormally, to divide uncontrollably, and, eventually, to invade adjacent tissues (1). The aberrant behavior of this single cell is due to somatic mutations—changes in the genomic DNA produced by the activity of different mutational processes (1). These various mutational processes include exposure to exogenous or endogenous mutagens, abnormal DNA editing, the incomplete fidelity of DNA polymerases, and failure of DNA repair mechanisms (2). Early studies that sequenced TP53, the most commonly mutated gene in human cancer, provided evidence that mutational processes leave distinct imprints of somatic mutations on the genome of a cancer cell (3). For example, C:G>A:T transversions predominate in smoking-associated lung cancer, whereas C:G>T:A transitions occurring mainly at dipyrimidines and CC:GG>TT:AA double-nucleotide substitutions are common in ultraviolet light–associated skin cancers. Moreover, these patterns of mutations matched the ones induced experimentally by tobacco mutagens and ultraviolet light, respectively, the major, known, exogenous carcinogenic influences in these cancer types, and demonstrated that examining patterns of mutations in cancer genomes can yield information about the mutational processes that cause human cancer (4).

  15. Tectonic origin of Crowley's Ridge, northeastern Arkansas

    SciTech Connect (OSTI)

    VanArsdale, R.B. (Univ. of Arkansas, Fayetteville, AR (United States). Geology Dept.); Williams, R.A.; Shedlock, K.M.; King, K.W.; Odum, J.K. (Geological survey, Denver, CO (United States). Denver Federal Center); Schweig, E.S. III; Kanter, L.R. (Memphis State Univ., TN (United States))

    1992-01-01

    Crowley's Ridge is a 320 km long topographic ridge that extends from Thebes, Illinois to Helena, Arkansas. The ridge has been interpreted as an erosional remnant formed during Quaternary incision of the ancestral Mississippi and Ohio rivers; however, the Reelfoot Rift COCORP line identified a down-to-the-west fault bounding the western margin of Crowley's Ridge south of Jonesboro, Arkansas. Subsequent Mini-Sosie seismic reflection profiles confirmed the COCORP data and identified additional faults beneath other margins of the ridge. In each case the faults lie beneath the base of the ridge scarp. The Mini-Sosie data did not resolve the uppermost 150 m and so it was not possible to determine if the faults displace the near-surface Claiborne Group (middle Eocene). A shotgun source seismic reflection survey was subsequently conducted to image the uppermost 250 m across the faulted margins. The shotgun survey across the western margin of the ridge south of Jonesboro reveals displaced reflectors as shallow as 30 m depth. Claiborne Group strata are displaced approximately 6 m and it appears that some of the topographic relief of Crowley's Ridge at this location is due to post middle Eocene fault displacement. Based on the reflection data, the authors suggest that Crowley's Ridge is tectonic in origin.

  16. On the origin of porphyritic chondrules

    SciTech Connect (OSTI)

    Blander, M.; Unger, L.; Pelton, A.; Ericksson, G.

    1994-05-01

    A computer program for the complex equilibria in a cooling nebular gas was used to explore a possible origin of porphyritic chondrules, the major class of chondrules in chondritic meteorites. It uses a method of accurately calculating the thermodynamic properties of molten multicomponent aluminosilicates, which deduces the silicate condensates vs temperature and pressure of a nebular gas. This program is coupled with a chemical equilibrium algorithm for systems with at least 1000 chemical species; it has a data base of over 5000 solid, liquid, and gaseous species. Results are metastable subcooled liquid aluminoscilicates with compositions resembling types IA and II porphyritic chondrules at two different temperatures at any pressure between 10{sup {minus}2} and 1 (or possibly 10{sup {minus}3} to 5) atm. The different types of chondrules (types I, II, III) could have been produced from the same gas and do not need a different gas for each apparent oxidation state; thus, the difficulty of current models for making porphyritic chondrules by reheating different solids to just below their liquidus temperatures in different locations is not necessary. Initiation of a stage of crystallization just below liquidus is part of the natural crystallization (recalescence) process from metastable subcooled liquidus and does not require an improbably heating mechanism. 2 tabs.

  17. Understanding the origins of human cancer

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Alexandrov, L. B.

    2015-12-04

    All cancers originate from a single cell that starts to behave abnormally, to divide uncontrollably, and, eventually, to invade adjacent tissues (1). The aberrant behavior of this single cell is due to somatic mutations—changes in the genomic DNA produced by the activity of different mutational processes (1). These various mutational processes include exposure to exogenous or endogenous mutagens, abnormal DNA editing, the incomplete fidelity of DNA polymerases, and failure of DNA repair mechanisms (2). Early studies that sequenced TP53, the most commonly mutated gene in human cancer, provided evidence that mutational processes leave distinct imprints of somatic mutations on themore » genome of a cancer cell (3). For example, C:G>A:T transversions predominate in smoking-associated lung cancer, whereas C:G>T:A transitions occurring mainly at dipyrimidines and CC:GG>TT:AA double-nucleotide substitutions are common in ultraviolet light–associated skin cancers. Moreover, these patterns of mutations matched the ones induced experimentally by tobacco mutagens and ultraviolet light, respectively, the major, known, exogenous carcinogenic influences in these cancer types, and demonstrated that examining patterns of mutations in cancer genomes can yield information about the mutational processes that cause human cancer (4).« less

  18. Percentage of Total Natural Gas Industrial Deliveries included in Prices

    U.S. Energy Information Administration (EIA) Indexed Site

    Pipeline and Distribution Use Price City Gate Price Residential Price Percentage of Total Residential Deliveries included in Prices Commercial Price Percentage of Total Commercial Deliveries included in Prices Industrial Price Percentage of Total Industrial Deliveries included in Prices Vehicle Fuel Price Electric Power Price Period: Monthly Annual Download Series History Download Series History Definitions, Sources & Notes Definitions, Sources & Notes Show Data By: Data Series Area 2010

  19. Percentage of Total Natural Gas Industrial Deliveries included in Prices

    U.S. Energy Information Administration (EIA) Indexed Site

    City Gate Price Residential Price Percentage of Total Residential Deliveries included in Prices Commercial Price Percentage of Total Commercial Deliveries included in Prices Industrial Price Percentage of Total Industrial Deliveries included in Prices Electric Power Price Period: Monthly Annual Download Series History Download Series History Definitions, Sources & Notes Definitions, Sources & Notes Show Data By: Data Series Area Sep-15 Oct-15 Nov-15 Dec-15 Jan-16 Feb-16 View History U.S.

  20. Percentage of Total Natural Gas Residential Deliveries included in Prices

    U.S. Energy Information Administration (EIA) Indexed Site

    City Gate Price Residential Price Percentage of Total Residential Deliveries included in Prices Commercial Price Percentage of Total Commercial Deliveries included in Prices Industrial Price Percentage of Total Industrial Deliveries included in Prices Electric Power Price Period: Monthly Annual Download Series History Download Series History Definitions, Sources & Notes Definitions, Sources & Notes Show Data By: Data Series Area Sep-15 Oct-15 Nov-15 Dec-15 Jan-16 Feb-16 View History U.S.

  1. Percentage of Total Natural Gas Commercial Deliveries included in Prices

    U.S. Energy Information Administration (EIA) Indexed Site

    City Gate Price Residential Price Percentage of Total Residential Deliveries included in Prices Commercial Price Percentage of Total Commercial Deliveries included in Prices Industrial Price Percentage of Total Industrial Deliveries included in Prices Electric Power Price Period: Monthly Annual Download Series History Download Series History Definitions, Sources & Notes Definitions, Sources & Notes Show Data By: Data Series Area Sep-15 Oct-15 Nov-15 Dec-15 Jan-16 Feb-16 View History U.S.

  2. Table 3a. Total Natural Gas Consumption per Effective Occupied...

    Gasoline and Diesel Fuel Update (EIA)

    3a. Natural Gas Consumption per Sq Ft Table 3a. Total Natural Gas Consumption per Effective Occupied Square Foot, 1992 Building Characteristics All Buildings Using Natural Gas...

  3. Real-space formulation of the electrostatic potential and total...

    Office of Scientific and Technical Information (OSTI)

    Journal Article: Real-space formulation of the electrostatic potential and total energy of solids Citation Details In-Document Search Title: Real-space formulation of the ...

  4. Table A19. Components of Total Electricity Demand by Census...

    U.S. Energy Information Administration (EIA) Indexed Site

    Components of Total Electricity Demand by Census Region and" " Economic Characteristics of ...ansfers","Onsite","Transfers"," ","Row" "Economic Characteristics(a)","Purchases","In(b)",...

  5. Trends in Commercial Buildings--Total Primary Energy Detail

    U.S. Energy Information Administration (EIA) Indexed Site

    Energy Consumption and Graph Total Primary Energy Consumption Graph Detail and Data Table 1979 to 1992 primary consumption trend with 95% confidence ranges 1979 to 1992 primary...

  6. Trends in Commercial Buildings--Total Site Energy Detail

    U.S. Energy Information Administration (EIA) Indexed Site

    Energy Consumption and Graph Total Site Energy Consumption Graph Detail and Data Table 1979 to 1992 site consumption trend with 95% confidence ranges 1979 to 1992 site...

  7. ,"Crude Oil and Petroleum Products Total Stocks Stocks by Type...

    U.S. Energy Information Administration (EIA) Indexed Site

    Name","Description"," Of Series","Frequency","Latest Data for" ,"Data 1","Crude Oil and Petroleum Products Total Stocks Stocks by Type",6,"Monthly","82015","1151956"...

  8. ,"Other States Total Natural Gas Gross Withdrawals and Production...

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Natural Gas Gross Withdrawals and Production" ,"Click worksheet name or tab at bottom for data" ,"Worksheet Name","Description"," Of Series","Frequency","Latest Data for" ...

  9. TENESOL formerly known as TOTAL ENERGIE | Open Energy Information

    Open Energy Info (EERE)

    search Name: TENESOL (formerly known as TOTAL ENERGIE) Place: la Tour de Salvagny, France Zip: 69890 Sector: Solar Product: Makes polycrystalline silicon modules, and PV-based...

  10. Texas Natural Gas Gross Withdrawals Total Offshore (Million Cubic...

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Gross Withdrawals Total Offshore (Million Cubic Feet) Texas Natural Gas Gross Withdrawals ... Offshore Gross Withdrawals of Natural Gas Natural Gas Gross Withdrawals Texas Offshore ...

  11. National Fuel Cell and Hydrogen Energy Overview: Total Energy...

    Broader source: Energy.gov (indexed) [DOE]

    Presentation by Sunita Satyapal at the Total Energy USA 2012 meeting in Houston, Texas, on November 27, 2012. PDF icon National Fuel Cell and Hydrogen Energy Overview More ...

  12. Montana Total Maximum Daily Load Development Projects Wiki |...

    Open Energy Info (EERE)

    Wiki Jump to: navigation, search OpenEI Reference LibraryAdd to library Web Site: Montana Total Maximum Daily Load Development Projects Wiki Abstract Provides information on...

  13. ,"Motor Gasoline Sales to End Users, Total Refiner Sales Volumes...

    U.S. Energy Information Administration (EIA) Indexed Site

    Sales to End Users, Total Refiner Sales Volumes",60,"Monthly","22016","1151983" ,"Release Date:","522016" ,"Next Release Date:","612016" ,"Excel File Name:","petconsrefmg...

  14. Total Agroindustria Canavieira S A | Open Energy Information

    Open Energy Info (EERE)

    Agroindustria Canavieira S A Jump to: navigation, search Name: Total Agroindustria Canavieira SA Place: Bambui, Minas Gerais, Brazil Product: Ethanol producer in Minas Gerais,...

  15. ,"Total Fuel Oil Consumption (trillion Btu)",,,,,"Fuel Oil Energy...

    U.S. Energy Information Administration (EIA) Indexed Site

    A. Fuel Oil Consumption (Btu) and Energy Intensities by End Use for All Buildings, 2003" ,"Total Fuel Oil Consumption (trillion Btu)",,,,,"Fuel Oil Energy Intensity (thousand Btu...

  16. ,"U.S. Total Refiner Petroleum Product Prices"

    U.S. Energy Information Administration (EIA) Indexed Site

    NUSDPG","EMAEPPRPTGNUSDPG","EMAEPPRLPTGNUSDPG","EMAEPPRHPTGNUSDPG" "Date","U.S. Total Gasoline Retail Sales by Refiners (Dollars per Gallon)","U.S. Aviation Gasoline...

  17. $787 Million Total in Small Business Contract Funding Awarded...

    National Nuclear Security Administration (NNSA)

    787 Million Total in Small Business Contract Funding Awarded in FY2009 by DOE Programs in Oak Ridge | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS...

  18. ,"Conventional Gasoline Sales to End Users, Total Refiner Sales...

    U.S. Energy Information Administration (EIA) Indexed Site

    Sales to End Users, Total Refiner Sales Volumes",60,"Monthly","22016","1151994" ,"Release Date:","522016" ,"Next Release Date:","612016" ,"Excel File Name:","petconsrefmg...

  19. Space Dust Analysis Could Provide Clues to Solar System Origins

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Space Dust Analysis Could Provide Clues to Solar System Origins Space Dust Analysis Could Provide Clues to Solar System Origins Print Thursday, 18 September 2014 12:34 New studies of space dust captured by NASA's Stardust Interstellar Dust Collector have shown that interstellar particles may be much more complex in structure and composition than previously thought. -The tiny particles could give scientists chemical clues about the origins of our solar system. Amateur Enthusiasts Key to Research

  20. Pair breaking versus symmetry breaking: Origin of the Raman modes...

    Office of Scientific and Technical Information (OSTI)

    Pair breaking versus symmetry breaking: Origin of the Raman modes in superconducting cuprates Citation Details In-Document Search Title: Pair breaking versus symmetry breaking:...

  1. EIA-Voluntary Reporting of Greenhouse Gases Program - Original...

    U.S. Energy Information Administration (EIA) Indexed Site

    Program Voluntary Reporting of Greenhouse Gases Program Original 1605(b) Program Section 1605(b) of the Energy Policy Act of 1992 established the Voluntary Reporting of Greenhouse ...

  2. The Institutional Origins of the Department of Energy | Department...

    Energy Savers [EERE]

    PDF icon Origins-of-the-Department-of-Energy.pdf More Documents & Publications National Offshore Wind Energy Grid Interconnection Study (NOWEGIS) CX-007131: Categorical Exclusion...

  3. Weekly Preliminary Crude Imports by Top 10 Countries of Origin...

    U.S. Energy Information Administration (EIA) Indexed Site

    Preliminary Crude Imports by Top 10 Countries of Origin (ranking based on 2013 Petroleum Supply Monthly data) (Thousand Barrels per Day) Period: Weekly 4-Week Average Download ...

  4. Los Alamos researchers uncover new origins of radiation-tolerant...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    new origins of radiation-tolerant materials A new report this week in the journal Nature Communications provides new insight into what, exactly, makes some complex materials...

  5. Space Dust Analysis Could Provide Clues to Solar System Origins

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Space Dust Analysis Could Provide Clues to Solar System Origins Print New studies of space dust captured by NASA's Stardust Interstellar Dust Collector have shown that interstellar...

  6. Space Dust Analysis Could Provide Clues to Solar System Origins

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Space Dust Analysis Could Provide Clues to Solar System Origins Print New studies of space dust captured by NASA's Stardust Interstellar Dust Collector have shown that interstellar ...

  7. Origin invariance in vibrational resonance Raman optical activity

    SciTech Connect (OSTI)

    Vidal, Luciano N. Cappelli, Chiara; Egidi, Franco; Barone, Vincenzo

    2015-05-07

    A theoretical investigation on the origin dependence of the vibronic polarizabilities, isotropic and anisotropic rotational invariants, and scattering cross sections in Resonance Raman Optical Activity (RROA) spectroscopy is presented. Expressions showing the origin dependence of these polarizabilities were written in the resonance regime using the Franck-Condon (FC) and Herzberg-Teller (HT) approximations for the electronic transition moments. Differently from the far-from-resonance scattering regime, where the origin dependent terms cancel out when the rotational invariants are calculated, RROA spectrum can exhibit some origin dependence even for eigenfunctions of the electronic Hamiltonian. At the FC level, the RROA spectrum is completely origin invariant if the polarizabilities are calculated using a single excited state or for a set of degenerate states. Otherwise, some origin effects can be observed in the spectrum. At the HT level, RROA spectrum is origin dependent even when the polarizabilities are evaluated from a single excited state but the origin effect is expected to be small in this case. Numerical calculations performed for (S)-methyloxirane, (2R,3R)-dimethyloxirane, and (R)-4-F-2-azetidinone at both FC and HT levels using the velocity representation of the electric dipole and quadrupole transition moments confirm the predictions of the theory and show the extent of origin effects and the effectiveness of suggested ways to remove them.

  8. Origins of weak lensing systematics, and requirements on future...

    Office of Scientific and Technical Information (OSTI)

    Journal Article: Origins of weak lensing systematics, and requirements on future instrumentation (or knowledge of instrumentation) Citation Details In-Document Search Title:...

  9. Table 16. Total Energy Consumption, Projected vs. Actual Projected

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6. Total Energy Consumption, Projected vs. Actual Projected (quadrillion Btu) 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012 ...

  10. Prisms with total internal reflection as solar reflectors

    DOE Patents [OSTI]

    Rabl, Arnulf; Rabl, Veronika

    1978-01-01

    An improved reflective wall for radiant energy collection and concentration devices is provided. The wall is comprised of a plurality of prisms whose frontal faces are adjacent and which reflect the desired radiation by total internal reflection.

  11. ,"Total Fuel Oil Consumption (trillion Btu)",,,,,"Fuel Oil Energy...

    U.S. Energy Information Administration (EIA) Indexed Site

    in this table do not include enclosed malls and strip malls. In the 1999 CBECS, total fuel oil consumption in malls was not statistically significant. (*)Value rounds to zero...

  12. CIGNA Study Uncovers Relationship of Disabilities to Total Benefits Costs

    Broader source: Energy.gov [DOE]

    The findings of a new study reveal an interesting trend. Integrating disability programs with health care programs can potentially lower employers' total benefits costs and help disabled employees get back to work sooner and stay at work.

  13. ,"U.S. Total Natural Gas Underground Storage Capacity (MMcf)...

    U.S. Energy Information Administration (EIA) Indexed Site

    ...dnavnghistn5290us2m.htm" ,"Source:","Energy Information Administration" ,"For Help, ... 1: U.S. Total Natural Gas Underground Storage Capacity (MMcf)" "Sourcekey","N5290US2" ...

  14. ,"U.S. Total Natural Gas Underground Storage Capacity (MMcf)...

    U.S. Energy Information Administration (EIA) Indexed Site

    ...dnavnghistn5290us2a.htm" ,"Source:","Energy Information Administration" ,"For Help, ... 1: U.S. Total Natural Gas Underground Storage Capacity (MMcf)" "Sourcekey","N5290US2" ...

  15. AGA Producing Region Natural Gas Total Underground Storage Capacity...

    U.S. Energy Information Administration (EIA) Indexed Site

    Storage Capacity (Million Cubic Feet) AGA Producing Region Natural Gas Total Underground Storage Capacity (Million Cubic Feet) Year Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec...

  16. U.S. Total Shell Storage Capacity at Operable Refineries

    U.S. Energy Information Administration (EIA) Indexed Site

    Product Area 2010 2011 2012 2013 2014 2015 View History Total 710,413 -- -- -- -- -- 1982-2015 Crude Oil 180,846 -- -- -- -- -- 1985-2015 Liquefied Petroleum Gases 33,842 -- -- -- ...

  17. Summary and recommendations: Total fuel cycle assessment workshop

    SciTech Connect (OSTI)

    1995-08-01

    This report summarizes the activities of the Total Fuel Cycle Assessment Workshop held in Austin, Texas, during October 6--7, 1994. It also contains the proceedings from that workshop.

  18. Ultrasound image guided acetabular implant orientation during total hip replacement

    DOE Patents [OSTI]

    Chang, John; Haddad, Waleed; Kluiwstra, Jan-Ulco; Matthews, Dennis; Trauner, Kenneth

    2003-08-19

    A system for assisting in precise location of the acetabular implant during total hip replacement. The system uses ultrasound imaging for guiding the placement and orientation of the implant.

  19. Property:Building/SPElectrtyUsePercTotal | Open Energy Information

    Open Energy Info (EERE)

    PElectrtyUsePercTotal" Showing 25 pages using this property. (previous 25) (next 25) S Sweden Building 05K0001 + 100.0 + Sweden Building 05K0002 + 100.0 + Sweden Building 05K0003 +...

  20. Property:RenewableFuelStandard/Total | Open Energy Information

    Open Energy Info (EERE)

    Property Edit with form History Facebook icon Twitter icon Property:RenewableFuelStandardTotal Jump to: navigation, search This is a property of type Number. Pages using the...

  1. Gathering total items count for pagination | OpenEI Community

    Open Energy Info (EERE)

    Gathering total items count for pagination Home > Groups > Utility Rate Hi I'm using the following base link plus some restrictions to sector, utility, and locations to poll for...

  2. ,"U.S. Total Crude Oil and Products Imports"

    U.S. Energy Information Administration (EIA) Indexed Site

    10:54:24 PM" "Back to Contents","Data 1: U.S. Total Crude Oil and Products Imports" ...-NVM1","MTTIMUSVQ1","MTTIMUSYE1" "Date","U.S. Imports of Crude Oil and Petroleum Products ...

  3. AEO2011:Total Energy Supply, Disposition, and Price Summary ...

    Open Energy Info (EERE)

    case. The dataset uses quadrillion Btu and the U.S. Dollar. The data is broken down into production, imports, exports, consumption and price. Data and Resources AEO2011:Total...

  4. Estimation of Anisotoropy from Total Cross Section and Optical Model

    Office of Scientific and Technical Information (OSTI)

    (Conference) | SciTech Connect Estimation of Anisotoropy from Total Cross Section and Optical Model Citation Details In-Document Search Title: Estimation of Anisotoropy from Total Cross Section and Optical Model Authors: Kawano, Toshihiko [1] + Show Author Affiliations Los Alamos National Laboratory Publication Date: 2013-06-03 OSTI Identifier: 1082234 Report Number(s): LA-UR-13-24025 DOE Contract Number: AC52-06NA25396 Resource Type: Conference Resource Relation: Conference: Working Party

  5. Determination of ferrous and total iron in refractory spinels (Journal

    Office of Scientific and Technical Information (OSTI)

    Article) | SciTech Connect Determination of ferrous and total iron in refractory spinels Citation Details In-Document Search Title: Determination of ferrous and total iron in refractory spinels Accurate and precise determination of the redox state of iron (Fe) in spinels presents a significant challenge due to their refractory nature. The resultant extreme conditions needed to obtain complete dissolution generally oxidize some of the Fe(II) initially present and thus prevent the use of

  6. Table 7.4 Coal Imports by Country of Origin, 2000-2011 (Short Tons)

    U.S. Energy Information Administration (EIA) Indexed Site

    Coal Imports by Country of Origin, 2000-2011 (Short Tons) Year Australia New Zealand Canada Mexico Colombia Venezuela China India Indonesia Europe South Africa Other Total Norway Poland Russia Ukraine United Kingdom Other Total 2000 167,595 0 1,923,434 6,671 7,636,614 2,038,774 19,646 205 718,149 0 0 1,212 0 238 0 1,450 0 85 12,512,623 2001 315,870 24,178 2,571,415 8,325 11,176,191 3,335,258 109,877 1,169 882,455 15,933 514,166 219,077 0 75,704 12 824,892 440,408 97,261 19,787,299 2002 821,280 0

  7. Domestic Distribution of U.S. Coal by Origin State, Consumer...

    U.S. Energy Information Administration (EIA) Indexed Site

    Origin State, Consumer, Destination and Method of Transportation Home > Coal > Annual Coal Distribution > Coal Origin Map > Domestic Distribution by Origin: Alaska Data For: 2002...

  8. Total aerosol effect: forcing or radiative flux perturbation?

    SciTech Connect (OSTI)

    Lohmann, Ulrike; Storelvmo, Trude; Jones, Andy; Rotstayn, Leon; Menon, Surabi; Quaas, Johannes; Ekman, Annica; Koch, Dorothy; Ruedy, Reto

    2009-09-25

    Uncertainties in aerosol forcings, especially those associated with clouds, contribute to a large extent to uncertainties in the total anthropogenic forcing. The interaction of aerosols with clouds and radiation introduces feedbacks which can affect the rate of rain formation. Traditionally these feedbacks were not included in estimates of total aerosol forcing. Here we argue that they should be included because these feedbacks act quickly compared with the time scale of global warming. We show that for different forcing agents (aerosols and greenhouse gases) the radiative forcings as traditionally defined agree rather well with estimates from a method, here referred to as radiative flux perturbations (RFP), that takes these fast feedbacks and interactions into account. Thus we propose replacing the direct and indirect aerosol forcing in the IPCC forcing chart with RFP estimates. This implies that it is better to evaluate the total anthropogenic aerosol effect as a whole.

  9. Federal Offshore -- Gulf of Mexico Natural Gas Total Consumption (Million

    U.S. Energy Information Administration (EIA) Indexed Site

    Cubic Feet) -- Gulf of Mexico Natural Gas Total Consumption (Million Cubic Feet) Federal Offshore -- Gulf of Mexico Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 0 2000's 0 0 109,277 98,372 90,025 78,139 102,242 115,528 102,389 103,976 2010's 108,490 101,217 93,985 95,207 93,855 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data.

  10. U.S. Natural Gas % of Total Residential Deliveries (Percent)

    Gasoline and Diesel Fuel Update (EIA)

    Deliveries (Percent) U.S. Natural Gas % of Total Residential Deliveries (Percent) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 100 100 100 100 100 100 100 2000's 100 100 100 100 100 100 100 100 100 100 2010's 100 100 100 100 100 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release Date: 5/31/2016 Referring Pages: Share of Total U.S. Natural Gas

  11. Properties of solar gravity mode signals in total irradiance observations

    SciTech Connect (OSTI)

    Kroll, R.J.; Chen, J.; Hill, H.A.

    1988-01-01

    Further evidence has been found that a significant fraction of the gravity mode power density in the total irradiance observations appears in sidebands of classified eigenfrequencies. These sidebands whose amplitudes vary from year to year are interpreted as harmonics of the rotational frequencies of the nonuniform solar surface. These findings are for non axisymmetric modes and corroborate the findings of Kroll, Hill and Chen for axisymmetric modes. It is demonstrated the the generation of the sidebands lifts the usual restriction on the parity of the eigenfunctions for modes detectable in total irradiance observations. 14 refs.

  12. Flow cytometric measurement of total DNA and incorporated halodeoxyuridine

    DOE Patents [OSTI]

    Dolbeare, Frank A.; Gray, Joe W.

    1986-01-01

    A method for the simultaneous flow cytometric measurement of the total DNA content and the level of DNA synthesis in normal and malignant cells is disclosed. The sensitivity of the method allows a study of cell cycle traverse rates for large scale cell populations as well as single cell measurements. A DNA stain such as propidium iodide is used as the probe for the measurement of total DNA content and a monoclonal antibody reactive with a DNA precursor such as bromodeoxyuridine (BrdU) is used as a probe for the measurement of BrdU uptake by the cells as a measure of DNA synthesis.

  13. COLLOQUIUM: Comets and the Origin and Evolution of the Solar...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2015, 4:15pm to 6:30pm Colloquia MBG Auditorium COLLOQUIUM: Comets and the Origin and Evolution of the Solar System Professor David Jewitt University of California - Los Angeles I...

  14. Origin of banded iron formations : oceanic crust leaching & self...

    Office of Scientific and Technical Information (OSTI)

    Subject: 58 GEOSCIENCES; IRON; LEACHING; OCEANIC CRUST; ORIGIN Word Cloud More Like This Full Text Journal Articles Find in Google Scholar Find in Google Scholar Search WorldCat ...

  15. Molecular origin of photovoltaic performance in donor-block-acceptor

    Office of Scientific and Technical Information (OSTI)

    all-conjugated block copolymers (Journal Article) | SciTech Connect Molecular origin of photovoltaic performance in donor-block-acceptor all-conjugated block copolymers Citation Details In-Document Search This content will become publicly available on November 3, 2016 Title: Molecular origin of photovoltaic performance in donor-block-acceptor all-conjugated block copolymers All-conjugated block copolymers may be an effective route to self-assembled photovoltaic devices, but we lack basic

  16. Space Dust Analysis Could Provide Clues to Solar System Origins

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Space Dust Analysis Could Provide Clues to Solar System Origins Print New studies of space dust captured by NASA's Stardust Interstellar Dust Collector have shown that interstellar particles may be much more complex in structure and composition than previously thought. -The tiny particles could give scientists chemical clues about the origins of our solar system. Amateur Enthusiasts Key to Research Progress The space dust that was captured by NASA's Stardust Interstellar Dust Collector landed in

  17. Space Dust Analysis Could Provide Clues to Solar System Origins

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Space Dust Analysis Could Provide Clues to Solar System Origins Print New studies of space dust captured by NASA's Stardust Interstellar Dust Collector have shown that interstellar particles may be much more complex in structure and composition than previously thought. -The tiny particles could give scientists chemical clues about the origins of our solar system. Amateur Enthusiasts Key to Research Progress The space dust that was captured by NASA's Stardust Interstellar Dust Collector landed in

  18. Space Dust Analysis Could Provide Clues to Solar System Origins

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Space Dust Analysis Could Provide Clues to Solar System Origins Print New studies of space dust captured by NASA's Stardust Interstellar Dust Collector have shown that interstellar particles may be much more complex in structure and composition than previously thought. -The tiny particles could give scientists chemical clues about the origins of our solar system. Amateur Enthusiasts Key to Research Progress The space dust that was captured by NASA's Stardust Interstellar Dust Collector landed in

  19. Space Dust Analysis Could Provide Clues to Solar System Origins

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Space Dust Analysis Could Provide Clues to Solar System Origins Print New studies of space dust captured by NASA's Stardust Interstellar Dust Collector have shown that interstellar particles may be much more complex in structure and composition than previously thought. -The tiny particles could give scientists chemical clues about the origins of our solar system. Amateur Enthusiasts Key to Research Progress The space dust that was captured by NASA's Stardust Interstellar Dust Collector landed in

  20. Origins | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Origins Fusion Energy Sciences (FES) FES Home About Research Fusion Institutions Fusion Links International Activities Facilities Science Highlights Benefits of FES Funding Opportunities Fusion Energy Sciences Advisory Committee (FESAC) Community Resources Contact Information Fusion Energy Sciences U.S. Department of Energy SC-24/Germantown Building 1000 Independence Ave., SW Washington, DC 20585 P: (301) 903-4941 F: (301) 903-8584 E: Email Us More Information » International Activities Origins

  1. Space Dust Analysis Could Provide Clues to Solar System Origins

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Space Dust Analysis Could Provide Clues to Solar System Origins Print New studies of space dust captured by NASA's Stardust Interstellar Dust Collector have shown that interstellar particles may be much more complex in structure and composition than previously thought. -The tiny particles could give scientists chemical clues about the origins of our solar system. Amateur Enthusiasts Key to Research Progress The space dust that was captured by NASA's Stardust Interstellar Dust Collector landed in

  2. Space Dust Analysis Could Provide Clues to Solar System Origins

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Space Dust Analysis Could Provide Clues to Solar System Origins Print New studies of space dust captured by NASA's Stardust Interstellar Dust Collector have shown that interstellar particles may be much more complex in structure and composition than previously thought. -The tiny particles could give scientists chemical clues about the origins of our solar system. Amateur Enthusiasts Key to Research Progress The space dust that was captured by NASA's Stardust Interstellar Dust Collector landed in

  3. The Origin of Mass (Conference) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Origin of Mass Citation Details In-Document Search Title: The Origin of Mass Authors: Boyle, P ; Buchoff, M ; Christ, N ; Izubuchi, T ; Jung, C ; Luu, T ; Mawhinney, R ; Schroeder, C ; Soltz, R ; Vranas, P ; Wasem, J Publication Date: 2013-07-25 OSTI Identifier: 1114700 Report Number(s): LLNL-PROC-641527 DOE Contract Number: W-7405-ENG-48 Resource Type: Conference Resource Relation: Conference: Presented at: Supercomputing 2013, Denver, CO, United States, Nov 17 - Nov 22, 2013 Research Org:

  4. The origins of growth stresses in amorphous semiconductor thin films.

    Office of Scientific and Technical Information (OSTI)

    (Journal Article) | SciTech Connect Journal Article: The origins of growth stresses in amorphous semiconductor thin films. Citation Details In-Document Search Title: The origins of growth stresses in amorphous semiconductor thin films. No abstract prepared. Authors: Kotula, Paul Gabriel ; Srolovitz, David J. [1] ; Floro, Jerrold Anthony ; Seel, Steven Craig + Show Author Affiliations (Princeton University, Princeton, NJ) Publication Date: 2003-03-01 OSTI Identifier: 917484 Report Number(s):

  5. "Table A10. Total Consumption of LPG, Distillate Fuel Oil...

    U.S. Energy Information Administration (EIA) Indexed Site

    "Total",11681,21576,70668,"W",21384,80123,"W",315,0,9.3 "Employment Size" " Under 50",1824,6108,928,"W",5936,928,"Q","Q",0,37.1 " 50-99","W",2450,6052,573,"W",6052,"W","W",0,20.7 ...

  6. Broad Band Intra-Cavity Total Reflection Chemical Sensor

    DOE Patents [OSTI]

    Pipino, Andrew C. R.

    1998-11-10

    A broadband, ultrahigh-sensitivity chemical sensor is provided that allows etection through utilization of a small, extremely low-loss, monolithic optical cavity. The cavity is fabricated from highly transparent optical material in the shape of a regular polygon with one or more convex facets to form a stable resonator for ray trajectories sustained by total internal reflection. Optical radiation enters and exits the monolithic cavity by photon tunneling in which two totally reflecting surfaces are brought into close proximity. In the presence of absorbing material, the loss per pass is increased since the evanescent waves that exist exterior to the cavity at points where the circulating pulse is totally reflected, are absorbed. The decay rate of an injected pulse is determined by coupling out an infinitesimal fraction of the pulse to produce an intensity-versus-time decay curve. Since the change in the decay rate resulting from absorption is inversely proportional to the magnitude of absorption, a quantitative sensor of concentration or absorption cross-section with 1 part-per-million/pass or better sensitivity is obtained. The broadband nature of total internal reflection permits a single device to be used over a broad wavelength range. The absorption spectrum of the surrounding medium can thereby be obtained as a measurement of inverse decay time as a function of wavelength.

  7. Device for measuring the total concentration of oxygen in gases

    DOE Patents [OSTI]

    Isaacs, Hugh S.; Romano, Anthony J.

    1977-01-01

    This invention provides a CO equilibrium in a device for measuring the total concentration of oxygen impurities in a fluid stream. To this end, the CO equilibrium is produced in an electrochemical measuring cell by the interaction of a carbon element in the cell with the chemically combined and uncombined oxygen in the fluid stream at an elevated temperature.

  8. Apparatus and method for quantitatively evaluating total fissile and total fertile nuclide content in samples. [Patent application

    DOE Patents [OSTI]

    Caldwell, J.T.; Kunz, W.E.; Cates, M.R.; Franks, L.A.

    1982-07-07

    Simultaneous photon and neutron interrogation of samples for the quantitative determination of total fissile nuclide and total fertile nuclide material present is made possible by the use of an electron accelerator. Prompt and delayed neutrons produced from resulting induced fission are counted using a single detection system and allow the resolution of the contributions from each interrogating flux leading in turn to the quantitative determination sought. Detection limits for /sup 239/Pu are estimated to be about 3 mg using prompt fission neutrons and about 6 mg using delayed neutrons.

  9. Flow cytometric measurement of total DNA and incorporated halodeoxyuridine

    DOE Patents [OSTI]

    Dolbeare, F.A.; Gray, J.W.

    1983-10-18

    A method for the simultaneous flow cylometric measurement of total cellular DNA content and of the uptake of DNA precursors as a measure of DNA synthesis during various phases of the cell cycle in normal and malignant cells in vitro and in vivo is described. The method comprises reacting cells with labelled halodeoxyuridine (HdU), partially denaturing cellular DNA, adding to the reaction medium monoclonal antibodies (mabs) reactive with HdU, reacting the bound mabs with a second labelled antibody, incubating the mixture with a DNA stain, and measuring simultaneously the intensity of the DNA stain as a measure of the total cellular DNA and the HdU incorporated as a measure of DNA synthesis. (ACR)

  10. Rhode Island Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Rhode Island Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 117,707 130,751 118,001 2000's 88,419 95,607 87,805 78,456 72,609 80,764 77,204 87,972 89,256 92,743 2010's 94,110 100,455 95,476 85,537 88,673 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release Date:

  11. South Carolina Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) South Carolina Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 153,917 159,458 162,926 2000's 160,436 141,785 184,803 146,641 163,787 172,032 174,806 175,701 170,077 190,928 2010's 220,235 229,497 244,850 232,297 231,863 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next

  12. South Central Region Natural Gas Total Underground Storage Capacity

    U.S. Energy Information Administration (EIA) Indexed Site

    (Million Cubic Feet) Total Underground Storage Capacity (Million Cubic Feet) South Central Region Natural Gas Total Underground Storage Capacity (Million Cubic Feet) Year Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec 2014 2,578,946 2,577,866 2,578,498 2,578,547 2,590,575 2,599,184 2,611,335 2,616,178 2,612,570 2,613,746 2,635,148 2,634,993 2015 2,631,717 2,630,903 2,631,616 2,631,673 2,631,673 2,631,444 2,631,444 2,631,444 2,636,984 2,637,895 2,637,895 2,640,224 2016 2,634,512 2,644,516 -

  13. South Dakota Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) South Dakota Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 36,115 33,042 35,794 2000's 37,939 37,077 41,577 43,881 41,679 42,555 40,739 53,938 65,258 66,185 2010's 72,563 73,605 70,238 81,986 79,964 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release Date:

  14. Tennessee Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Tennessee Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 282,395 279,070 278,841 2000's 270,658 255,990 255,515 257,315 231,133 230,338 221,626 221,118 229,935 216,945 2010's 257,443 264,231 277,127 279,441 303,996 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next

  15. Texas Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Texas Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 4,116,722 4,205,459 4,009,689 2000's 4,421,777 4,252,152 4,303,831 4,050,632 3,908,243 3,503,636 3,432,236 3,516,706 3,546,804 3,387,341 2010's 3,574,398 3,693,905 3,850,331 4,021,851 4,088,445 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data.

  16. U.S. Natural Gas Total Liquids Extracted (Thousand Barrels)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Liquids Extracted (Thousand Barrels) U.S. Natural Gas Total Liquids Extracted (Thousand Barrels) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1980's 569,968 599,518 584,160 571,256 587,502 594,306 569,913 1990's 573,054 602,734 626,320 634,481 635,983 649,149 689,314 690,999 668,011 686,862 2000's 721,895 682,873 681,646 622,291 657,032 619,884 637,635 658,291 673,677 720,612 2010's 749,095 792,481 873,563 937,591 1,124,416 - = No Data Reported; -- = Not

  17. Utah Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Utah Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 165,253 169,776 159,889 2000's 164,557 159,299 163,379 154,125 155,891 160,275 187,399 219,700 224,188 214,220 2010's 219,213 222,227 223,039 247,285 242,457 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release

  18. Vermont Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Vermont Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 8,061 7,735 8,033 2000's 10,426 7,919 8,367 8,400 8,685 8,372 8,056 8,867 8,624 8,638 2010's 8,443 8,611 8,191 9,602 10,678 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release Date: 5/31/2016 Referring Pages:

  19. Virginia Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Virginia Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 248,960 260,332 276,793 2000's 268,770 237,853 258,202 262,970 277,434 299,746 274,175 319,913 299,364 319,134 2010's 375,421 373,444 410,106 418,506 419,615 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next

  20. Washington Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Washington Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 256,366 290,229 287,302 2000's 286,653 312,114 233,716 249,599 262,485 264,754 263,395 272,613 298,140 310,428 2010's 285,726 264,589 264,540 318,292 307,021 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next

  1. West Virginia Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) West Virginia Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 159,504 142,860 139,961 2000's 147,854 141,090 146,455 126,986 122,267 117,136 113,084 115,974 111,480 109,652 2010's 113,179 115,361 129,753 142,082 150,766 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next

  2. Wisconsin Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Wisconsin Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 400,651 368,022 380,560 2000's 393,601 359,784 385,310 394,711 383,316 410,250 372,462 398,370 409,377 387,066 2010's 372,898 393,734 402,656 442,544 462,627 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next

  3. Total System Performance Assessment - License Application Methods and Approach

    SciTech Connect (OSTI)

    J. McNeish

    2003-12-08

    ''Total System Performance Assessment-License Application (TSPA-LA) Methods and Approach'' provides the top-level method and approach for conducting the TSPA-LA model development and analyses. The method and approach is responsive to the criteria set forth in Total System Performance Assessment Integration (TSPAI) Key Technical Issues (KTIs) identified in agreements with the U.S. Nuclear Regulatory Commission, the ''Yucca Mountain Review Plan'' (YMRP), ''Final Report'' (NRC 2003 [163274]), and the NRC final rule 10 CFR Part 63 (NRC 2002 [156605]). This introductory section provides an overview of the TSPA-LA, the projected TSPA-LA documentation structure, and the goals of the document. It also provides a brief discussion of the regulatory framework, the approach to risk management of the development and analysis of the model, and the overall organization of the document. The section closes with some important conventions that are used in this document.

  4. Total System Performance Assessment-License Application Methods and Approach

    SciTech Connect (OSTI)

    J. McNeish

    2002-09-13

    ''Total System Performance Assessment-License Application (TSPA-LA) Methods and Approach'' provides the top-level method and approach for conducting the TSPA-LA model development and analyses. The method and approach is responsive to the criteria set forth in Total System Performance Assessment Integration (TSPAI) Key Technical Issue (KTI) agreements, the ''Yucca Mountain Review Plan'' (CNWRA 2002 [158449]), and 10 CFR Part 63. This introductory section provides an overview of the TSPA-LA, the projected TSPA-LA documentation structure, and the goals of the document. It also provides a brief discussion of the regulatory framework, the approach to risk management of the development and analysis of the model, and the overall organization of the document. The section closes with some important conventions that are utilized in this document.

  5. Arkansas Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Arkansas Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 260,113 266,485 252,853 2000's 251,329 227,943 242,325 246,916 215,124 213,609 233,868 226,439 234,901 244,193 2010's 271,515 284,076 296,132 282,120 268,453 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next

  6. Colorado Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Colorado Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 314,486 330,259 333,085 2000's 367,920 463,738 459,397 436,253 440,378 470,321 450,832 504,775 504,783 523,726 2010's 501,350 466,680 443,750 467,798 480,747 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next

  7. Delaware Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Delaware Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 46,511 40,809 56,013 2000's 48,387 50,113 52,216 46,177 48,057 46,904 43,190 48,155 48,162 50,148 2010's 54,825 79,715 101,676 95,978 100,776 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release Date:

  8. District of Columbia Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) District of Columbia Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 34,105 30,409 32,281 2000's 33,468 29,802 32,898 32,814 32,227 32,085 29,049 32,966 31,880 33,177 2010's 33,251 32,862 28,561 32,743 34,057 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release

  9. East Region Natural Gas Total Underground Storage Capacity (Million Cubic

    U.S. Energy Information Administration (EIA) Indexed Site

    Feet) Total Underground Storage Capacity (Million Cubic Feet) East Region Natural Gas Total Underground Storage Capacity (Million Cubic Feet) Year Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec 2014 2,200,169 2,200,169 2,200,169 2,200,169 2,200,169 2,200,169 2,200,169 2,200,169 2,200,169 2,200,169 2,200,169 2,200,169 2015 2,197,282 2,197,282 2,197,282 2,197,282 2,195,132 2,195,132 2,195,132 2,195,132 2,195,132 2,195,132 2,195,132 2,195,132 2016 2,195,132 2,195,132 - = No Data Reported; -- =

  10. Everett, MA Liquefied Natural Gas Total Imports (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Imports (Million Cubic Feet) Everett, MA Liquefied Natural Gas Total Imports (Million Cubic Feet) Year Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec 2013 2,583 2,728 2014 5,470 3,783 2,334 2,806 2,175 3,311 1,567 2,871 2,505 2,003 2015 7,729 7,623 5,521 1,673 2,557 7,133 8,237 2,563 2,653 1,541 2,452 2016 10,633 8,593 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release Date:

  11. Florida Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Florida Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 522,116 503,844 559,366 2000's 541,847 543,143 689,337 689,986 734,178 778,209 891,611 917,244 942,699 1,055,340 2010's 1,158,452 1,217,689 1,328,463 1,225,676 1,231,957 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016

  12. Georgia Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Georgia Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 371,376 368,579 337,576 2000's 413,845 351,109 383,546 379,761 394,986 412,560 420,469 441,107 425,043 462,799 2010's 530,030 522,897 615,771 625,283 652,230 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release

  13. Hawaii Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Hawaii Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 2,894 2,654 3,115 2000's 2,841 2,818 2,734 2,732 2,774 2,795 2,783 2,850 2,702 2,607 2010's 2,627 2,619 2,689 2,855 2,928 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release Date: 5/31/2016 Referring Pages:

  14. Illinois Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Illinois Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 1,077,139 957,254 1,004,281 2000's 1,030,604 951,616 1,049,878 998,486 953,207 969,642 893,997 965,591 1,000,501 956,068 2010's 966,678 986,867 940,367 1,056,826 1,092,999 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date:

  15. Indiana Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Indiana Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 556,624 521,748 556,932 2000's 570,558 501,711 539,034 527,037 526,701 531,111 496,303 535,796 551,424 506,944 2010's 573,866 630,669 649,921 672,751 710,838 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release

  16. Iowa Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Iowa Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 254,489 232,057 230,691 2000's 232,565 224,336 226,457 230,161 226,819 241,340 238,454 293,274 325,772 315,186 2010's 311,075 306,909 295,183 326,140 330,433 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release

  17. Kansas Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Kansas Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 338,231 326,674 302,932 2000's 312,369 272,500 304,992 281,346 256,779 255,123 264,253 286,538 282,904 286,973 2010's 275,184 279,724 262,316 283,177 285,969 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release

  18. Louisiana Natural Gas Gross Withdrawals Total Offshore (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Gross Withdrawals Total Offshore (Million Cubic Feet) Louisiana Natural Gas Gross Withdrawals Total Offshore (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1970's 3,838,521 4,600,197 4,750,119 1980's 4,617,585 4,584,491 4,246,464 3,635,942 4,070,279 3,542,827 3,279,165 3,610,041 3,633,594 3,577,685 1990's 3,731,764 3,550,230 3,442,437 3,508,112 3,673,494 3,554,147 3,881,697 3,941,802 3,951,997 3,896,569 2000's 3,812,991 153,871 137,192 133,456

  19. Alabama Natural Gas Gross Withdrawals Total Offshore (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Gross Withdrawals Total Offshore (Million Cubic Feet) Alabama Natural Gas Gross Withdrawals Total Offshore (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1980's 0 9 13 1990's 19,861 32,603 191,605 218,023 349,380 356,598 361,068 409,091 392,320 376,435 2000's 361,289 200,862 202,002 194,339 165,630 152,902 145,762 134,451 125,502 109,214 2010's 101,487 84,270 87,398 75,660 70,827 - = No Data Reported; -- = Not Applicable; NA = Not Available; W =

  20. Alaska Natural Gas Gross Withdrawals Total Offshore (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Gross Withdrawals Total Offshore (Million Cubic Feet) Alaska Natural Gas Gross Withdrawals Total Offshore (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1970's 72,813 71,946 1980's 63,355 71,477 66,852 68,776 68,315 62,454 63,007 69,656 101,440 122,595 1990's 144,064 171,665 216,377 233,198 224,301 113,552 126,051 123,854 133,111 125,841 2000's 263,958 262,937 293,580 322,010 334,125 380,568 354,816 374,204 388,188 357,490 2010's 370,148 364,702

  1. California Natural Gas Gross Withdrawals Total Offshore (Million Cubic

    U.S. Energy Information Administration (EIA) Indexed Site

    Feet) Gross Withdrawals Total Offshore (Million Cubic Feet) California Natural Gas Gross Withdrawals Total Offshore (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1970's 5,417 19,929 20,394 1980's 19,980 26,692 31,904 38,084 60,207 84,062 77,355 67,835 60,308 59,889 1990's 58,055 59,465 62,473 58,635 60,765 60,694 73,092 80,516 81,868 84,547 2000's 83,882 78,209 74,884 64,961 61,622 60,773 47,217 52,805 51,931 47,281 2010's 46,755 41,742

  2. New Hampshire Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) New Hampshire Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 20,848 19,127 20,313 2000's 24,950 23,398 24,901 54,147 61,172 70,484 62,549 62,132 71,179 59,950 2010's 60,378 69,978 72,032 54,028 57,017 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release Date:

  3. New Jersey Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) New Jersey Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 717,011 679,619 715,630 2000's 605,275 564,923 598,602 612,890 620,806 602,388 547,206 618,965 614,908 620,790 2010's 654,458 660,743 652,060 682,247 762,200 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next

  4. New Mexico Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) New Mexico Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 256,464 245,823 236,264 2000's 266,469 266,283 235,098 221,021 223,575 220,717 223,636 234,236 246,665 241,194 2010's 241,137 246,418 243,961 245,502 246,178 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next

  5. New York Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) New York Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 1,324,164 1,232,473 1,274,162 2000's 1,244,746 1,171,898 1,199,632 1,101,618 1,098,056 1,080,215 1,097,160 1,187,059 1,180,356 1,142,625 2010's 1,198,127 1,217,324 1,223,036 1,273,263 1,345,315 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data.

  6. North Carolina Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) North Carolina Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 215,634 214,092 217,159 2000's 233,714 207,108 235,376 218,642 224,796 229,715 223,032 237,354 243,090 247,047 2010's 304,148 307,804 363,945 440,175 453,212 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next

  7. North Dakota Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) North Dakota Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 56,179 49,541 56,418 2000's 56,528 60,819 66,726 60,907 59,986 53,050 53,336 59,453 63,097 54,564 2010's 66,395 72,463 72,740 81,593 83,330 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release Date:

  8. Ohio Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Ohio Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 897,693 811,384 841,966 2000's 890,962 804,243 830,955 848,388 825,753 825,961 742,359 806,350 792,247 740,925 2010's 784,293 823,548 842,959 912,403 1,000,231 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release

  9. Oklahoma Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Oklahoma Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 567,050 575,855 538,329 2000's 538,563 491,458 508,298 540,103 538,576 582,536 624,400 658,379 687,989 659,305 2010's 675,727 655,919 691,661 658,569 640,607 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next

  10. Oregon Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Oregon Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 185,069 229,403 235,009 2000's 224,888 229,665 202,164 212,556 234,997 232,562 222,608 251,927 268,484 248,864 2010's 239,325 199,419 215,830 240,418 220,076 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release

  11. Pacific Region Natural Gas Total Underground Storage Capacity (Million

    U.S. Energy Information Administration (EIA) Indexed Site

    Cubic Feet) Region Natural Gas Total Underground Storage Capacity (Million Cubic Feet) Pacific Region Natural Gas Total Underground Storage Capacity (Million Cubic Feet) Year Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec 2014 676,176 676,176 676,176 676,176 676,176 676,176 676,176 676,176 676,176 676,176 676,176 676,176 2015 679,477 679,477 679,477 679,477 679,477 679,477 679,477 679,477 679,477 678,273 678,273 678,273 2016 678,273 678,273 - = No Data Reported; -- = Not Applicable; NA =

  12. Pennsylvania Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Pennsylvania Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 706,230 644,017 688,740 2000's 702,847 634,794 675,583 689,992 696,175 691,591 659,754 752,401 749,884 809,707 2010's 879,365 965,742 1,037,979 1,121,696 1,203,418 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016

  13. Alaska Natural Gas % of Total Residential Deliveries (Percent)

    Gasoline and Diesel Fuel Update (EIA)

    % of Total Residential Deliveries (Percent) Alaska Natural Gas % of Total Residential Deliveries (Percent) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 0.28 0.31 0.31 0.31 0.30 0.35 0.37 2000's 0.32 0.35 0.33 0.33 0.37 0.37 0.47 0.42 0.44 0.42 2010's 0.39 0.43 0.52 0.39 0.35 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release Date: 5/31/2016

  14. Hawaii Natural Gas % of Total Residential Deliveries (Percent)

    Gasoline and Diesel Fuel Update (EIA)

    Foot) Year Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec 2013 1,056 1,055 1,057 1,043 983 983 983 983 983 983 983 983 2014 947 946 947 947 947 947 951 978 990 968 974 962 2015 968 954 947 959 990 1,005 1,011 965 989 996 996 997 2016 998 1,004

    % of Total Residential Deliveries (Percent) Hawaii Natural Gas % of Total Residential Deliveries (Percent) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 0.01 0.01 0.01 0.01 0.01 0.01 0.01 2000's 0.01 0.01 0.01

  15. Idaho Natural Gas % of Total Residential Deliveries (Percent)

    Gasoline and Diesel Fuel Update (EIA)

    Foot) Year Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec 2013 1,015 1,015 1,031 1,021 1,010 997 988 994 1,001 1,026 1,034 1,054 2014 1,048 1,036 1,030 1,022 1,006 993 984 996 1,005 1,019 1,046 1,039 2015 1,047 1,037 1,030 1,023 1,000 1,010 1,034 1,028 1,024 1,033 1,035 1,041 2016 1,034 1,038

    % of Total Residential Deliveries (Percent) Idaho Natural Gas % of Total Residential Deliveries (Percent) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 0.25

  16. Kentucky Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Kentucky Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 227,931 205,129 218,399 2000's 225,168 208,974 227,920 223,226 225,470 234,080 211,049 229,799 225,295 206,833 2010's 232,099 223,034 225,924 229,983 254,244 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next

  17. Louisiana Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Louisiana Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 1,661,061 1,569,190 1,495,478 2000's 1,536,725 1,219,013 1,341,444 1,233,505 1,281,428 1,254,370 1,217,871 1,289,421 1,238,661 1,189,744 2010's 1,354,641 1,420,264 1,482,343 1,396,261 1,460,031 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company

  18. Maryland Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Maryland Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 212,017 188,552 196,350 2000's 212,133 178,376 196,276 197,024 194,725 202,509 182,294 201,053 196,067 196,510 2010's 212,020 193,986 208,946 197,356 207,527 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next

  19. Massachusetts Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Massachusetts Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 402,629 358,846 344,790 2000's 343,314 349,103 393,194 403,991 372,532 378,068 370,664 408,704 406,719 395,852 2010's 432,297 449,194 416,350 421,001 418,526 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next

  20. Michigan Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Michigan Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 994,342 876,444 951,143 2000's 963,136 906,001 966,354 924,819 916,629 913,827 803,336 798,126 779,602 735,340 2010's 746,748 776,466 790,642 814,635 850,974 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next

  1. Midwest Region Natural Gas Total Underground Storage Capacity (Million

    U.S. Energy Information Administration (EIA) Indexed Site

    Cubic Feet) Total Underground Storage Capacity (Million Cubic Feet) Midwest Region Natural Gas Total Underground Storage Capacity (Million Cubic Feet) Year Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec 2014 2,721,231 2,721,231 2,721,231 2,721,231 2,721,231 2,721,231 2,721,231 2,721,231 2,721,231 2,723,336 2,725,497 2,725,535 2015 2,725,587 2,725,587 2,725,587 2,725,587 2,725,587 2,725,587 2,725,587 2,716,587 2,715,888 2,717,255 2,718,087 2,718,087 2016 2,718,087 2,718,087 - = No Data

  2. Mississippi Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Mississippi Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 255,475 241,342 306,733 2000's 300,652 332,589 343,890 265,842 282,051 301,663 307,305 364,067 355,006 364,323 2010's 438,733 433,538 494,016 420,594 412,979 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next

  3. Missouri Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Missouri Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 283,294 258,652 265,798 2000's 284,763 283,793 275,629 262,529 263,945 268,040 252,697 272,536 296,058 264,867 2010's 280,181 272,583 255,875 276,967 296,605 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next

  4. Montana Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Montana Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 59,851 59,840 62,129 2000's 67,955 65,051 69,532 68,473 66,829 68,355 73,879 73,822 76,422 75,802 2010's 72,025 78,217 73,399 79,670 78,010 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release Date: 5/31/2016

  5. Nebraska Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Nebraska Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 132,221 130,730 121,487 2000's 126,962 121,984 120,333 118,922 115,011 119,070 129,885 150,808 171,005 163,474 2010's 168,944 171,777 158,757 173,376 172,749 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next

  6. Nevada Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Nevada Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 132,128 148,539 154,689 2000's 189,170 176,835 176,596 185,846 214,984 227,149 249,608 254,406 264,596 275,468 2010's 259,251 249,971 273,502 272,965 252,097 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release

  7. AGA Eastern Consuming Region Natural Gas Total Underground Storage Capacity

    U.S. Energy Information Administration (EIA) Indexed Site

    (Million Cubic Feet) Total Underground Storage Capacity (Million Cubic Feet) AGA Eastern Consuming Region Natural Gas Total Underground Storage Capacity (Million Cubic Feet) Year Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec 1994 4,737,921 4,727,501 4,727,501 4,727,501 4,727,501 4,727,501 4,727,501 4,727,501 4,727,446 4,727,446 4,727,446 4,727,509 1995 4,730,109 4,647,791 4,647,791 4,647,791 4,647,791 4,647,791 4,593,948 4,593,948 4,593,948 4,593,948 4,593,948 4,593,948 1996 4,593,948

  8. Alabama Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Alabama Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 324,158 329,134 337,270 2000's 353,614 332,693 379,343 350,345 382,367 353,156 391,093 418,512 404,157 454,456 2010's 534,779 598,514 666,712 615,407 634,678 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release

  9. Alaska Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Alaska Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 425,393 434,871 422,816 2000's 427,288 408,960 419,131 414,234 406,319 432,972 373,850 369,967 341,888 342,261 2010's 333,312 335,458 343,110 332,298 327,428 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release

  10. Flow cytometric measurement of total DNA and incorporated halodeoxyuridine

    DOE Patents [OSTI]

    Dolbeare, Frank A.; Gray, Joe W.

    1988-01-01

    A method for the simultaneous flow cytometric measurement of the total DNA content and the level of DNA synthesis in normal and malignant cells is disclosed. The sensitivity of the method allows a study of cell cycle traverse rates for large scale cell populations as well as single cell measurements. A DNA stain such as propidium iodide or Hoechst 33258 is used as the probe for the measurement of total DNA content and a monoclonal antibody reactive with a DNA precursor such as halodeoxy-uridine (HdU), more specifically bromodeoxyuridine (BrdU) is used as a probe for the measurement of HdU or BrdU uptake by the cells as a measure of DNA synthesis.

  11. Wyoming Natural Gas Total Consumption (Million Cubic Feet)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Consumption (Million Cubic Feet) Wyoming Natural Gas Total Consumption (Million Cubic Feet) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's 100,950 109,188 96,726 2000's 101,314 98,569 112,872 115,358 107,060 108,314 108,481 140,912 142,705 142,793 2010's 150,106 156,455 153,333 149,820 135,678 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 4/29/2016 Next Release

  12. Table 4. Total Petroleum Consumption, Projected vs. Actual

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Petroleum Consumption, Projected vs. Actual" "Projected" " (million barrels)" ,1993,1994,1995,1996,1997,1998,1999,2000,2001,2002,2003,2004,2005,2006,2007,2008,2009,2010,2011,2012,2013 "AEO 1994",6449.55,6566.35,6643,6723.3,6810.9,6880.25,6956.9,7059.1,7124.8,7205.1,7296.35,7376.65,7446,7522.65,7595.65,7665,7712.45,7774.5 "AEO

  13. Refinery Net Production of Total Finished Petroleum Products

    U.S. Energy Information Administration (EIA) Indexed Site

    Product: Total Finished Petroleum Products Liquefied Refinery Gases Ethane/Ethylene Ethane Ethylene Propane/Propylene Propane Propylene Normal Butane/Butylene Normal Butane Butylene Isobutane/Isobutylene Isobutane Isobutylene Finished Motor Gasoline Reformulated Gasoline Reformulated Blended w/ Fuel Ethanol Reformulated Other Conventional Gasoline Conventional Blended w/ Fuel Ethanol Conventional Blended w/ Fuel Ethanol, Ed55 and Lower Conventional Blended w/ Fuel Ethanol, Greater than Ed55

  14. Multiple-channel, total-reflection optic with controllable divergence

    DOE Patents [OSTI]

    Gibson, David M.; Downing, Robert G.

    1997-01-01

    An apparatus and method for providing focused x-ray, gamma-ray, charged particle and neutral particle, including neutron, radiation beams with a controllable amount of divergence are disclosed. The apparatus features a novel use of a radiation blocking structure, which, when combined with multiple-channel total reflection optics, increases the versatility of the optics by providing user-controlled output-beam divergence.

  15. Multiple-channel, total-reflection optic with controllable divergence

    DOE Patents [OSTI]

    Gibson, D.M.; Downing, R.G.

    1997-02-18

    An apparatus and method for providing focused x-ray, gamma-ray, charged particle and neutral particle, including neutron, radiation beams with a controllable amount of divergence are disclosed. The apparatus features a novel use of a radiation blocking structure, which, when combined with multiple-channel total reflection optics, increases the versatility of the optics by providing user-controlled output-beam divergence. 11 figs.

  16. Total Energy - U.S. Energy Information Administration (EIA)

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Energy Glossary › FAQS › Overview Data Monthly Annual Analysis & Projections Major Topics Most popular Annual Monthly Projections Recurring U.S. States All reports Browse by Tag Alphabetical Frequency Tag Cloud Current Issues & Trends See more › EIA's Annual Energy Outlook is a projection, not a prediction forecastenergy EIA projects 48% increase in world energy consumption by 2040 natural gasliquid fuelsconsumptioncoalforecastrenewablenuclearenergyInternational Energy

  17. Refinery & Blender Net Production of Total Finished Petroleum Products

    U.S. Energy Information Administration (EIA) Indexed Site

    & Blender Net Production Product: Total Finished Petroleum Products Liquefied Refinery Gases Ethane/Ethylene Ethane Ethylene Propane/Propylene Propane Propylene Normal Butane/Butylene Normal Butane Butylene Isobutane/Isobutylene Isobutane Isobutylene Finished Motor Gasoline Reformulated Gasoline Reformulated Blended w/ Fuel Ethanol Reformulated Other Gasoline Conventional Gasoline Conventional Blended w/ Fuel Ethanol Conventional Blended w/ Fuel Ethanol, Ed55 and Lower Conventional Blended

  18. Table A39. Total Expenditures for Purchased Electricity and Steam

    U.S. Energy Information Administration (EIA) Indexed Site

    9. Total Expenditures for Purchased Electricity and Steam" " by Type of Supplier, Census Region, Census Division, and" " Economic Characteristics of the Establishment, 1994" " (Estimates in Million Dollars)" ," Electricity",," Steam" ,,,,,"RSE" ,"Utility","Nonutility","Utility","Nonutility","Row" "Economic

  19. " Level: National Data and Regional Totals;"

    U.S. Energy Information Administration (EIA) Indexed Site

    3. Quantity of Purchased Electricity, Natural Gas, and Steam, 1998;" " Level: National Data and Regional Totals;" " Row: NAICS Codes;" " Column: Supplier Sources of Purchased Electricity, Natural Gas, and Steam;" " Unit: Physical Units or Btu." ,,,"Electricity","Components",,"Natural Gas","Components",,"Steam","Components" " "," ",,,"Electricity",,,"Natural

  20. NAME ORGANIZATION E-MAIL PHONE

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    (865) 574-2105 (Alternate) Miller, Ruth Oak Ridge Nat'l Laboratory ... Ashley, Tom CWI, Idaho Cleanup Project thomas.ashley@icp.doe.gov (208) 360-3552 McGary, ...

  1. Mail Management Memorandum, July 2, 2010

    Energy Savers [EERE]

  2. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    New reporting due date will be October 31 of each year starting in FY-2014. On-line ... Change to Schedule 5-1. Requirement is to now enter numbers rounded to the nearest dollar ...

  3. Widget:MailChimp | Open Energy Information

    Open Energy Info (EERE)

    source History View New Pages Recent Changes All Special Pages Semantic SearchQuerying Get Involved Help Apps Datasets Community Login | Sign Up Search Widget Edit History...

  4. Experimental elucidation of the origin of the 'double spin resonances'

    Office of Scientific and Technical Information (OSTI)

    in Ba ( Fe 1 - x Co x ) 2 As 2 (Journal Article) | SciTech Connect elucidation of the origin of the 'double spin resonances' in Ba ( Fe 1 - x Co x ) 2 As 2 Citation Details In-Document Search This content will become publicly available on May 26, 2017 Title: Experimental elucidation of the origin of the 'double spin resonances' in Ba ( Fe 1 - x Co x ) 2 As 2 Authors: Wang, Meng ; Yi, M. ; Sun, H. L. ; Valdivia, P. ; Kim, M. G. ; Xu, Z. J. ; Berlijn, T. ; Christianson, A. D. ; Chi, Songxue ;

  5. Origins of optical absorption characteristics of Cu2+ complexes in

    Office of Scientific and Technical Information (OSTI)

    solutions (Journal Article) | SciTech Connect Origins of optical absorption characteristics of Cu2+ complexes in solutions Citation Details In-Document Search Title: Origins of optical absorption characteristics of Cu2+ complexes in solutions Authors: Qiu, S R ; Wood, B C ; Ehrmann, P R ; Demos, S G ; Miller, P E ; Schaffers, K I ; Suratwala, T I Publication Date: 2015-02-27 OSTI Identifier: 1234585 Report Number(s): LLNL-JRNL-668007 DOE Contract Number: AC52-07NA27344 Resource Type: Journal

  6. Scientists use world's fastest supercomputer to model origins of the

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    unseen universe Origins of the unseen universe Scientists use world's fastest supercomputer to model origins of the unseen universe The model aims to look at galaxy-scale mass concentrations above and beyond quantities seen in state-of-the-art sky surveys. October 26, 2009 Los Alamos National Laboratory sits on top of a once-remote mesa in northern New Mexico with the Jemez mountains as a backdrop to research and innovation covering multi-disciplines from bioscience, sustainable energy

  7. Development of a Total Energy, Environment and Asset Management (TE2AM tm) Curriculum

    SciTech Connect (OSTI)

    2012-12-31

    The University of Wisconsin Department of Engineering Professional Development (EPD) has completed the sponsored project entitled, Development of a Total Energy, Environment and Asset Management (TE2AM™) Curriculum. The project involved the development of a structured professional development program to improve the knowledge, skills, capabilities, and competencies of engineers and operators of commercial buildings. TE2AM™ advances a radically different approach to commercial building design, operation, maintenance, and end-­‐of-­‐life disposition. By employing asset management principles to the lifecycle of a commercial building, owners and occupants will realize improved building performance, reduced energy consumption and positive environmental impacts. Through our commercialization plan, we intend to offer TE2AM™ courses and certificates to the professional community and continuously improve TE2AM™ course materials. The TE2AM™ project supports the DOE Strategic Theme 1 -­‐ Energy Security; and will further advance the DOE Strategic Goal 1.4 Energy Productivity. Through participation in the TE2AM™ curriculum, engineers and operators of commercial buildings will be eligible for a professional certificate; denoting the completion of a prescribed series of learning activities. The project involved a comprehensive, rigorous approach to curriculum development, and accomplished the following goals: 1. Identify, analyze and prioritize key learning needs of engineers, architects and technical professionals as operators of commercial buildings. 2. Design and develop TE2AM™ curricula and instructional strategies to meet learning needs of the target learning community. 3. Establish partnerships with the sponsor and key stakeholders to enhance the development and delivery of learning programs. 4. Successfully commercialize and sustain the training and certificate programs for a substantial time following the term of the award. The project team was successful in achieving the goals and deliverables set forth in the original proposal. Though attempts were made to adhere to the original project timeline, the team requested, and was granted a 6-­‐month project extension, during which time the project was completed.

  8. Table 12. Total Coal Consumption, Projected vs. Actual

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Coal Consumption, Projected vs. Actual" "Projected" " (million short tons)" ,1993,1994,1995,1996,1997,1998,1999,2000,2001,2002,2003,2004,2005,2006,2007,2008,2009,2010,2011,2012,2013 "AEO 1994",920,928,933,938,943,948,953,958,962,967,978,990,987,992,1006,1035,1061,1079 "AEO 1995",,935,940,941,947,948,951,954,958,963,971,984,992,996,1002,1013,1025,1039 "AEO

  9. Table 12. Total Coal Consumption, Projected vs. Actual Projected

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Coal Consumption, Projected vs. Actual Projected (million short tons) 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 AEO 1994 920 928 933 938 943 948 953 958 962 967 978 990 987 992 1006 1035 1061 1079 AEO 1995 935 940 941 947 948 951 954 958 963 971 984 992 996 1002 1013 1025 1039 AEO 1996 937 942 954 962 983 990 1004 1017 1027 1033 1046 1067 1070 1071 1074 1082 1087 1094 1103 AEO 1997 948 970 987 1003 1017 1020 1025 1034 1041

  10. Table 15. Total Electricity Sales, Projected vs. Actual

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Electricity Sales, Projected vs. Actual" "Projected" " (billion kilowatt-hours)" ,1993,1994,1995,1996,1997,1998,1999,2000,2001,2002,2003,2004,2005,2006,2007,2008,2009,2010,2011,2012,2013 "AEO 1994",2843,2891,2928,2962,3004,3039,3071,3112,3148,3185,3228,3263,3298,3332,3371,3406,3433,3469 "AEO 1995",,2951,2967,2983,3026,3058,3085,3108,3134,3166,3204,3248,3285,3321,3357,3396,3433,3475 "AEO

  11. Table 15. Total Electricity Sales, Projected vs. Actual Projected

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Electricity Sales, Projected vs. Actual Projected (billion kilowatt-hours) 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 AEO 1994 2843 2891 2928 2962 3004 3039 3071 3112 3148 3185 3228 3263 3298 3332 3371 3406 3433 3469 AEO 1995 2951 2967 2983 3026 3058 3085 3108 3134 3166 3204 3248 3285 3321 3357 3396 3433 3475 AEO 1996 2973 2998 3039 3074 3106 3137 3173 3215 3262 3317 3363 3409 3454 3505 3553 3604 3660 3722 3775 AEO 1997 3075

  12. Table 4. Total Petroleum Consumption, Projected vs. Actual

    U.S. Energy Information Administration (EIA) Indexed Site

    Total Petroleum Consumption, Projected vs. Actual Projected (million barrels) 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 AEO 1994 6450 6566 6643 6723 6811 6880 6957 7059 7125 7205 7296 7377 7446 7523 7596 7665 7712 7775 AEO 1995 6398 6544 6555 6676 6745 6822 6888 6964 7048 7147 7245 7337 7406 7472 7537 7581 7621 AEO 1996 6490 6526 6607 6709 6782 6855 6942 7008 7085 7176 7260 7329 7384 7450 7501 7545 7581 7632 7676 AEO 1997 6636 6694

  13. Alaska (with Total Offshore) Crude Oil Reserves in Nonproducing Reservoirs

    U.S. Energy Information Administration (EIA) Indexed Site

    (Million Barrels) Crude Oil Reserves in Nonproducing Reservoirs (Million Barrels) Alaska (with Total Offshore) Crude Oil Reserves in Nonproducing Reservoirs (Million Barrels) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1990's NA NA 806 932 2000's 511 389 546 734 707 595 442 400 529 633 2010's 622 566 802 639 548 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company data. Release Date: 11/19/2015

  14. Alaska (with Total Offshore) Natural Gas Liquids Lease Condensate, Proved

    U.S. Energy Information Administration (EIA) Indexed Site

    Reserves (Million Barrels) Liquids Lease Condensate, Proved Reserves (Million Barrels) Alaska (with Total Offshore) Natural Gas Liquids Lease Condensate, Proved Reserves (Million Barrels) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1970's 10 1980's 0 0 0 0 19 1 0 0 0 0 1990's 0 0 0 0 0 0 0 0 0 0 2000's 0 0 0 0 0 0 0 0 0 0 2010's 0 36 16 0 2 - = No Data Reported; -- = Not Applicable; NA = Not Available; W = Withheld to avoid disclosure of individual company

  15. Alaska (with Total Offshore) Natural Gas Plant Liquids, Expected Future

    U.S. Energy Information Administration (EIA) Indexed Site

    Production (Million Barrels) Plant Liquids, Expected Future Production (Million Barrels) Alaska (with Total Offshore) Natural Gas Plant Liquids, Expected Future Production (Million Barrels) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1970's 13 1980's 11 10 9 8 0 382 381 418 401 380 1990's 340 360 347 321 301 306 337 631 320 299 2000's 277 405 405 387 369 352 338 325 312 299 2010's 288 288 288 288 241 - = No Data Reported; -- = Not Applicable; NA = Not

  16. Alaska (with Total Offshore) Natural Gas Plant Liquids, Reserves Based

    Gasoline and Diesel Fuel Update (EIA)

    Production (Million Barrels) Expected Future Production (Million Barrels) Alaska (with Total Offshore) Natural Gas Plant Liquids, Expected Future Production (Million Barrels) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9 1970's 13 1980's 11 10 9 8 0 382 381 418 401 380 1990's 340 360 347 321 301 306 337 631 320 299 2000's 277 405 405 387 369 352 338 325 312 299 2010's 288 288 288 288 241 - = No Data Reported; -- = Not Applicable; NA = Not Available; W =

  17. A total risk assessment methodology for security assessment.

    SciTech Connect (OSTI)

    Aguilar, Richard; Pless, Daniel J.; Kaplan, Paul Garry; Silva, Consuelo Juanita; Rhea, Ronald Edward; Wyss, Gregory Dane; Conrad, Stephen Hamilton

    2009-06-01

    Sandia National Laboratories performed a two-year Laboratory Directed Research and Development project to develop a new collaborative risk assessment method to enable decision makers to fully consider the interrelationships between threat, vulnerability, and consequence. A five-step Total Risk Assessment Methodology was developed to enable interdisciplinary collaborative risk assessment by experts from these disciplines. The objective of this process is promote effective risk management by enabling analysts to identify scenarios that are simultaneously achievable by an adversary, desirable to the adversary, and of concern to the system owner or to society. The basic steps are risk identification, collaborative scenario refinement and evaluation, scenario cohort identification and risk ranking, threat chain mitigation analysis, and residual risk assessment. The method is highly iterative, especially with regard to scenario refinement and evaluation. The Total Risk Assessment Methodology includes objective consideration of relative attack likelihood instead of subjective expert judgment. The 'probability of attack' is not computed, but the relative likelihood for each scenario is assessed through identifying and analyzing scenario cohort groups, which are groups of scenarios with comparable qualities to the scenario being analyzed at both this and other targets. Scenarios for the target under consideration and other targets are placed into cohort groups under an established ranking process that reflects the following three factors: known targeting, achievable consequences, and the resources required for an adversary to have a high likelihood of success. The development of these target cohort groups implements, mathematically, the idea that adversaries are actively choosing among possible attack scenarios and avoiding scenarios that would be significantly suboptimal to their objectives. An adversary who can choose among only a few comparable targets and scenarios (a small comparable target cohort group) is more likely to choose to attack the specific target under analysis because he perceives it to be a relatively unique attack opportunity. The opposite is also true. Thus, total risk is related to the number of targets that exist in each scenario cohort group. This paper describes the Total Risk Assessment Methodology and illustrates it through an example.

  18. Subtask 1: Total systems analysis, assembly and testing | Center for

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Bio-Inspired Solar Fuel Production 1: Total systems analysis, assembly and testing All papers by year Subtask 1 Subtask 2 Subtask 3 Subtask 4 Subtask 5 Gust, D., Moore, T.A., and Moore, A.L. (2013) Artificial photosynthesis, Theoretical and Experimental Plant Physiology, 25, 182-185, http://dx.doi.org/10.1590/S2197-00252013005000002"> Sherman, B.D., Vaughn, M.D., Bergkamp, J.J., Gust, D., Moore, A.L., Moore, T.A. (2014) Evolution of reaction center mimics to systems capable of

  19. Arkansas Natural Gas % of Total Residential Deliveries (Percent)

    Gasoline and Diesel Fuel Update (EIA)

    Foot) Year Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec 2013 1,015 1,016 1,016 1,016 1,017 1,018 1,016 1,016 1,014 1,012 1,012 1,015 2014 1,017 1,015 1,015 1,018 1,017 1,019 1,021 1,021 1,019 1,018 1,011 1,017 2015 1,021 1,023 1,023 1,025 1,022 1,020 1,023 1,022 1,019 1,029 1,014 1,015 2016 1,019 1,015

    % of Total Residential Deliveries (Percent) Arkansas Natural Gas % of Total Residential Deliveries (Percent) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9

  20. Colorado Natural Gas % of Total Residential Deliveries (Percent)

    Gasoline and Diesel Fuel Update (EIA)

    Foot) Year Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec 2013 1,023 1,032 1,030 1,033 1,040 1,051 1,056 1,057 1,058 1,037 1,032 1,033 2014 1,030 1,036 1,038 1,041 1,051 1,050 1,048 1,048 1,050 1,055 1,042 1,051 2015 1,046 1,044 1,051 1,059 1,059 1,070 1,073 1,069 1,076 1,069 1,060 1,051 2016 1,050 1,052

    % of Total Residential Deliveries (Percent) Colorado Natural Gas % of Total Residential Deliveries (Percent) Decade Year-0 Year-1 Year-2 Year-3 Year-4 Year-5 Year-6 Year-7 Year-8 Year-9