Powered by Deep Web Technologies
Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

OMB Circular A-76 (Revised)  

Broader source: Energy.gov (indexed) [DOE]

EXECUTIVE OFFICE OF THE PRESIDENT EXECUTIVE OFFICE OF THE PRESIDENT OFFICE OF MANAGEMENT AND BUDGET WASHINGTON, DC 20503 May 29, 2003 CIRCULAR NO. A-76 (REVISED) TO THE HEADS OF EXECUTIVE DEPARTMENTS AND ESTABLISHMENTS SUBJECT: Performance of Commercial Activities 1. Purpose. This circular establishes federal policy for the competition of commercial activities. 2. Supersession. This circular supersedes Office of Management and Budget (OMB) Circular No. A-76 (Revised 1999), August 4, 1983; Circular No. A-76 Revised Supplemental Handbook (Revised 2000), March 1996; Office of Federal Procurement Policy Letter 92-1, "Inherently Governmental Functions," September 23, 1992; and OMB Transmittal Memoranda 1 through 25, Performance of Commercial Activities. 3. Authority. Reorganization Plan No. 2 of 1970 (31 U.S.C. § 1111); Executive Order 11541; the Office

2

Revised OMB Circular A-76 (Revised November 14, 2002)  

Broader source: Energy.gov (indexed) [DOE]

OMB Circular A-76 Revision Comments OMB Circular A-76 Revision Comments DRAFT OMB CIRCULAR A-76 (NOVEMBER 14, 2002) REVIEW COMMENTS AND RECOMMENDATIONS GENERAL COMMENTS: The Department of Energy (DOE) supports the overarching goal of OMB Circular A-76 that agencies should obtain "the best deal to the Taxpayer." We also support revisions to the Circular that "Keep the Process Moving" with the end result being: Faster/Cheaper Competitions; Improved Performance and Measures; Enhanced/Expanded Competition; Fairness; Realizing Significant Savings; and the Redirection of Resources to Mission Critical Requirements. Upon review of the draft Circular, the Department believes the proposed changes to Circular reflect a general improvement over the current version. The Department does, however, have

3

OMB Circular A-123, Appendix B  

Broader source: Energy.gov (indexed) [DOE]

T H E D I R E C T O R January 15, 2009 CIRCULAR NO. A-123, Appendix B Revised TO THE HEADS OF EXECUTIVE DEPARTMENTS AND ESTABLISHMENTS SUBJECT: Improving the Management of Government Charge Card Programs Appendix B of OMB Circular A-123 prescribes policies and procedures to agencies regarding how to maintain internal controls that reduce the risk of fraud, waste, and error in government charge card programs. This revision responds to recommendations made by the Government Accountability Office (GAO) regarding the Federal purchase card program as well as agency comments and suggestions made by Agency/Organization Program Coordinators. These revisions replace and rescind all previously issued OMB Circular A-123 Appendix B policy dated February 2006 and August 2005. Significant updates to Appendix B are as follows:

4

Date: January 16, 2014 Subject: OMB Omni-Circular  

E-Print Network [OSTI]

) on December 26, 2013. The Omni-Circular consolidates, streamlines and supersedes eight existing Circulars, including Circulars A-21, A-110 and A-133. The new regulations will not take effect until December 26, 2014

Grishok, Alla

5

Technical Standards, OMB Circular A-119 - May 14, 1998 | Department...  

Broader source: Energy.gov (indexed) [DOE]

in order to make the terminology of the Circular consistent with the National Technology Transfer and Advancement Act of 1995, to issue guidance to the agencies on making their...

6

OMB Circular A-119 Federal Participation in the Development and Use of Voluntary Consensus Standards and in Conformity Assessment Activities; Notice  

Broader source: Energy.gov (indexed) [DOE]

8545 8545 Thursday February 19, 1998 Part IV Executive Office of the President Office of Management and Budget OMB Circular A-119; Federal Participation in the Development and Use of Voluntary Consensus Standards and in Conformity Assessment Activities; Notice 8546 Federal Register / Vol. 63, No. 33 / Thursday, February 19, 1998 / Notices EXECUTIVE OFFICE OF THE PRESIDENT Office of Management and Budget OMB Circular A-119; Federal Participation in the Development and Use of Voluntary Consensus Standards and in Conformity Assessment Activities AGENCY: Office of Management and Budget, EOP. ACTION: Final Revision of Circular A- 119. SUMMARY: The Office of Management and Budget (OMB) has revised Circular A-119 on federal use and development of voluntary standards. OMB has revised this Circular in order to make

7

OMB Requirements | Department of Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

OMB Requirements OMB Requirements OMB Requirements Acquisitions OMB Circular A-109, Acquisition of Major Systems (04-05-76) (Available in hard copy only) OMB M-04-08, Maximizing Use of SmartBuy and Avoiding Duplication of Agency Activities with with the President's 24 E-Gov Initiatives (02-25-2004) (pdf) OMB M-04-16, Software Acquisition (07-01-2004) Budget/Capital Planning OMB Circular A-11 OMB M-05-23, Improving Informational Technology (IT) Project Planning and Execution (8-04-2005) (pdf) Cyber Security & Privacy OMB M-00-07, Incorporating and Funding Security in Information Systems Investments (02-28-2000) OMB M-02-01, Guidance for Preparing and Submitting Security Plans of Action and Milestones(10-19-2001) OMB M-02-09, Reporting Instructions for the Government Information

8

2004 OMB Annual Report  

Broader source: Energy.gov (indexed) [DOE]

FISCAL YEAR 2004 FISCAL YEAR 2004 ANNUAL REPORT TO THE OFFICE OF MANAGEMENT AND BUDGET - STANDARDS USE AND PARTICIPATION - U. S. DEPARTMENT OF ENERGY Standards Management: The Department of Energy (DOE) implements the federal guidance and requirements of OMB Circular A-119 (OMB A-119) and the statutory requirements of Public Law (PL) 104-113 (15 USC 272) regarding the use of voluntary consensus standards (VCSs) through specific Departmental directives (policies, orders, requirements, guides, and technical standards) and supporting programs and management systems. The Department's overall standards activities are managed through the DOE-wide Technical Standards Program (TSP), established under the DOE Standards Executive within the Office of Environment, Safety and Health. (The TSP Internet address is http://www.eh.doe.gov/techstds/).

9

Status of DOE A-76 Studies  

Broader source: Energy.gov (indexed) [DOE]

DOE A-76 Studies DOE A-76 Studies (A/O July 15, 2008) Function Competition Affected FTE Status Savings RESL FY 07 Standard 19 Completed-Decision Jan. 2008 (MEO win) $4.9M Albany Research Center FY 06 Standard 74 Cancelled June 2007 Legacy Management FY 06 HPO 58 OMB approved HPO-June 2006 $16.5 DOE Logistics FY 02/03 Standard 144 Completed-Decision March 2006 (Contractor win) $1.6M New Brunswick Lab FY 04/05 Standard 40 Completed-Decision March 2006 (MEO win) $2.6M Environmental Engineering Services FY 04/05 Standard 684 CANCELLED September 2005 Information Technology FY 02/03 Standard 642 1000+ Contractors Completed-Decision July 2005 (MEO win) $456M ARC Logistics Standard 8 Completed-Decision March 2005 (MEO win) $0.8M Human Resources FY 02/03 Standard 146 Completed-Decision September

10

OMB 83 C | Department of Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

OMB 83 C OMB 83 C omb83-c.pdf More Documents & Publications EERE Program Management Guide - Chapter 5 EERE Program Management Guide - Appendices A-Q OMB83 D Discontinuance Form...

11

OMB Policies | Department of Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

OMB Policies OMB Policies OMB Policies Cybersecurity & Privacy OMB M-00-07, Incorporating and Funding Security in Information Systems Investments (02-28-2000) OMB M-02-01, Guidance for Preparing and Submitting Security Plans of Action and Milestones(10-19-2001) OMB M-02-09, Reporting Instructions for the Government Information Security Reform Act and Updated Guidance on Security Plans of Action and Milestones (07-02-2002) (pdf) OMB M-03-04, Determination Orders Organizing the Department of Homeland Security (01-07-2003) OMB M-03-17, Program Assessment Rating Tool (PART) Update (07-16-2003) (pdf) OMB M-03-19, Reporting Instructions for the Federal Information Security Management Act and Updated Guidance on Quarterly IT Security Reporting (08-06-2003) (pdf) OMB M-04-04, E-Authentication Guidance (12-06-2003)

12

OMB Burden Disclosure Statement  

Broader source: Energy.gov (indexed) [DOE]

71.1 OMB Control Number 71.1 OMB Control Number (09/2012) (Classification) OMB Burden Disclosure Statement 1910-1800 Public reporting burden for this collection of information is estimated to average 10 (minutes) per response, including the time for reviewing instructions, searching exist ing data sources, gathering and maintaining the data needed, and completing and reviewing the collection of information. Send comme nts regarding this estimate or any other aspect of this information, including suggestions for reducing this burden, to Information, Records, and Resource Management, MA-41-GTN, Paperwork Reduction Project (1910-1800), U.S. Department of Energy, Washington, DC 20874-1290; and to the Office of Management and Budget (OMB), Paperwork Reduction Project (1910-1800),Washington, DC 20503.

13

OMB Control No.  

Broader source: Energy.gov (indexed) [DOE]

7 7 (02-94) OMB Control No. 1910-0600 U.S. Department of Energy APPLICANT DISABILITY, RACE/NATIONAL ORIGIN AND SEX IDENTIFICATION (Please read the Instructions and Privacy Act Statement before completing this form) Vacancy Announcement Number Name (Last, First, Middle Initial) Position Title, Series, Grade Social Security Number Sex Male Female OMB Burden Disclosure Statement Public reporting burden for this collection of information is estimated to average 10 minutes per response, including the time for reviewing instructions, searching existing data sources, gathering and maintaining the data needed, and completing and reviewing the collection of information. Send comments regarding this burden estimate or any other aspect of this collection of information, including

14

OMB Control No.  

Broader source: Energy.gov (indexed) [DOE]

300.3 300.3 (09-93) (All other editions are obsolete) OMB Control No. 1910-0500 OMB Burden Disclosure Statement on Page 4 U.S. Department of Energy Semi-Annual Summary Report of DOE-Owned Plant and Capital Equipment (P&CE) Contractor Name Address Location of Property (City, State) Contracting Office Contract No. Asset Type Code Beginning Balance As of No. of Items $ Acquisitions No. of Items $ Dispositions No. of Items $ Ending Balance As of No. of Items $ Total Plant and Capital Equipment 1 2 3 4 5 6 7 8 9 Prepared By name (printed), title, telephone number, signature Date of Last Physical Inventory of Capital Equipment Contracting Officer Representative Signature

15

OMB Control No.  

Broader source: Energy.gov (indexed) [DOE]

3A 3A (03-94) OMB Control No. 1910-0400 Public reporting burden for this collection of information is estimated to average 10 minutes per response, including the time for reviewing instructions, searching existing data sources, gathering and maintaining the data needed, and completing and reviewing the collection of information. Send comments regarding this burden estimate or any other aspect of this collection of information, including suggestions for reducing this burden, to Office of Information Resources Management Policy, Plans, and Oversight, Records Management Division, HR-422 - GTN, Paperwork Reduction Project (1910-0400), U.S. Department of Energy, 1000 Independence Avenue, S.W., Washington, DC 20585; and to the Office of Management and Budget (OMB), Paperwork

16

Department of Energy FY 2012 OMB Scorecard  

Office of Energy Efficiency and Renewable Energy (EERE)

Office of Management and Budget (OMB) Scorecard reporting Department of Energy sustainability achievements for fiscal year (FY) 2012.

17

Department of Energy FY 2011 OMB Scorecard  

Office of Energy Efficiency and Renewable Energy (EERE)

Office of Management and Budget (OMB) Scorecard reporting Department of Energy sustainability achievements for fiscal year (FY) 2011.

18

Department of Energy FY 2010 OMB Scorecard  

Office of Energy Efficiency and Renewable Energy (EERE)

Office of Management and Budget (OMB) Scorecard reporting Department of Energy sustainability achievements for fiscal year (FY) 2010.

19

2011 OMB Annual Report  

Broader source: Energy.gov (indexed) [DOE]

2011 Annual Report for The Department of Energy 1. Please describe the importance of standards in the achievement of your agency's mission, how your agency uses standards to deliver its primary services in support of its mission, and provide any examples or case studies of standards success. Please include relevant Internet links and links to your agency's standards website. In accordance with the 2011 OMB Report data call, the Department of Energy (DOE) Technical Standards Program (TSP) asked for input from all DOE organizations. The request included a documentation of new case studies involving the benefits of non- government voluntary consensus standards in DOE work. Based on the input received,

20

A-76 QUESTIONS AND ANSWERS  

Broader source: Energy.gov (indexed) [DOE]

SOURCING/A-76 SOURCING/A-76 QUESTIONS AND ANSWERS COMPETITIVE SOURCING What is the President's Competitive Sourcing Initiative? The President stated, as part of his Management Agenda, that "Government should be market- based - we should not be afraid of competition, innovation, and choice. I will open government to the discipline of competition." He charged each agency with conducting a review of at least fifty percent of its federal workforce performing commercial activities to determine if any of the activities being performed could be provided by the private sector at less cost to the government. Agencies are being asked to study fifteen percent of their commercial activity inventories by the end of FY 2003. President Bush's mandate follows the enactment of the Federal Activities Inventory Reform Act

Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

RFQ DE-RQ01-04ME90001.doc  

Broader source: Energy.gov (indexed) [DOE]

June 16, 2004 June 16, 2004 1 Department of Energy Washington, DC 20585 REQUEST FOR QUOTATION RFQ No. DE-RQ01-04ME90001 To: Invited Service Providers The Department of Energy (DOE) is conducting an A-76 Study using the standard competition process under OMB Circular No. A-76 (Revised) dated, May 29, 2003. A copy of the Circular is available for downloading at the OMB website at: http://www.whitehouse.gov/omb/procurement/comp_sourcing_init.html The DOE requested and received a deviation from the OMB Circular No. A-76 (Revised), dated May 29, 2003, to permit the use of FAR Part 8.4, GSA Federal Supply Schedule (FSS) under a standard competition. The OMB deviation approval is dated May 6, 2004. The A-76 Study is for Logistics Services. The DOE will be using the procedures under FAR Part

22

Notice of OMB Action Approving DOE Submission to Extend Information  

Broader source: Energy.gov (indexed) [DOE]

OMB Action Approving DOE Submission to Extend Information OMB Action Approving DOE Submission to Extend Information Collection Request Title: OE Recovery Act Financial Assistance Grants Notice of OMB Action Approving DOE Submission to Extend Information Collection Request Title: OE Recovery Act Financial Assistance Grants The Office of Management and Budget (OMB) has issued a Notice of OMB Action approving the Department of Energy's request to extend for three years the Information Collection Request Title: OE Recovery Act Financial Assistance Grants, OMB Control No. 1910-5149 that DOE is developing for submission to OMB pursuant to the Paperwork Reduction Act of 1995. Supporting documentation for the request was submitted in September and October, 2011. Comments were due on or before November 7, 2011. ICR Supporting Statement (PDF). OMB Form 83-I (PDF). SGIG Reporting Guidance

23

E-Print Network 3.0 - activity seeking omb Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

The OMB proposal redefined the criteria... for selection of experts to serve on fed- eral peer review panels and provided OMB with the authority Source: Koppes, Michele -...

24

Circular free-electron laser  

DOE Patents [OSTI]

A high efficiency, free electron laser utilizing a circular relativistic electron beam accelerator and a circular whispering mode optical waveguide for guiding optical energy in a circular path in the circular relativistic electron beam accelerator such that the circular relativistic electron beam and the optical energy are spatially contiguous in a resonant condition for free electron laser operation. Both a betatron and synchrotron are disclosed for use in the present invention. A free electron laser wiggler is disposed around the circular relativistic electron beam accelerator for generating a periodic magnetic field to transform energy from the circular relativistic electron beam to optical energy.

Brau, Charles A. (Los Alamos, NM); Kurnit, Norman A. (Santa Fe, NM); Cooper, Richard K. (Los Alamos, NM)

1984-01-01T23:59:59.000Z

25

A-76 QUESTIONS AND ANSWERS | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

ANSWERS More Documents & Publications gaoconflict.pdf O:A76Post Award AccountabilityPCA Handbook.prn.pdf&0; Microsoft Word - Graphics A-76 Post - MEO VV Review Report F.doc...

26

OMB and CEQ Joint Memorandum on Environmental Collaboration and...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Memorandum on Environmental Collaboration and Conflict Resolution This Office of Management and Budget (OMB) and Council on Environmental Quality (CEQ) joint memorandum expands...

27

OMB and CEQ Memorandum on Environmental Collaboration and Conflict...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

and Conflict Resolution September 18, 2012 - 3:01pm Addthis The Office of Management and Budget (OMB) and the Council on Environmental Quality (CEQ) on September 7,...

28

DOE Supplemental Instructions for OMB Section 1512 Reporting...  

Energy Savers [EERE]

Section 1512 Reporting - For Grant and Loan Recipients More Documents & Publications DOE Supplemental Instructions for OMB Section 1512 Reporting - For Contractors Slide 1 Slide 1...

29

Registration Overview for OMB Section 1512 Reporting for DOE...  

Energy Savers [EERE]

FederalReporting.gov Registration Overview for OMB Section 1512 Reporting for DOE Prime Recipients More Documents & Publications Slide 1 Instructions for Grant and Loan Recipients...

30

OMB and CEQ Memorandum on Environmental Collaboration and Conflict  

Broader source: Energy.gov (indexed) [DOE]

OMB and CEQ Memorandum on Environmental Collaboration and Conflict OMB and CEQ Memorandum on Environmental Collaboration and Conflict Resolution OMB and CEQ Memorandum on Environmental Collaboration and Conflict Resolution September 18, 2012 - 3:01pm Addthis The Office of Management and Budget (OMB) and the Council on Environmental Quality (CEQ) on September 7, 2012, issued a joint memorandum calling for department and agency commitment to the goals identified in the Memorandum on Environmental Collaboration and Conflict Resolution, and the goals identified in related policy guidance. This memorandum supersedes an OMB/CEQ joint memorandum issued in November 28, 2005, on Environmental Conflict Resolution. It broadens the efforts called for under the 2005 memorandum by explicitly encouraging appropriate and effective upfront environmental collaboration to minimize or prevent

31

OMB and CEQ Memorandum on Environmental Collaboration and Conflict  

Broader source: Energy.gov (indexed) [DOE]

OMB and CEQ Memorandum on Environmental Collaboration and Conflict OMB and CEQ Memorandum on Environmental Collaboration and Conflict Resolution OMB and CEQ Memorandum on Environmental Collaboration and Conflict Resolution September 18, 2012 - 3:01pm Addthis The Office of Management and Budget (OMB) and the Council on Environmental Quality (CEQ) on September 7, 2012, issued a joint memorandum calling for department and agency commitment to the goals identified in the Memorandum on Environmental Collaboration and Conflict Resolution, and the goals identified in related policy guidance. This memorandum supersedes an OMB/CEQ joint memorandum issued in November 28, 2005, on Environmental Conflict Resolution. It broadens the efforts called for under the 2005 memorandum by explicitly encouraging appropriate and effective upfront environmental collaboration to minimize or prevent

32

Supporting Statement: OE Recovery Act Financial Assistance Grants OMB  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Supporting Statement: OE Recovery Act Financial Assistance Grants Supporting Statement: OE Recovery Act Financial Assistance Grants OMB Control Number 1910-5149 Supporting Statement: OE Recovery Act Financial Assistance Grants OMB Control Number 1910-5149 Supporting Statement: OE Recovery Act Financial Assistance Grants OMB Control Number 1910-5149. This statement provides additional informaton regarding the DOE request for processing of the renewal of the proposed information collection, OE Recovery Act Financial Assistance Grants. Supporting Statement: OE Recovery Act Financial Assistance Grants OMB Control Number 1910-5149 More Documents & Publications Notice of OMB Action Approving DOE Submission to Extend Information Collection Request Title: OE Recovery Act Financial Assistance Grants Notice of Office of Management and Budget Action to Approve with Change the

33

Replaces EIA-459E OMB Control No.  

Broader source: Energy.gov (indexed) [DOE]

5 5 (04-94) Replaces EIA-459E OMB Control No. 1910-0400 U.S. DEPARTMENT OF ENERGY FEDERAL ASSISTANCE MANAGEMENT SUMMARY REPORT Page of Public reporting burden for this collection of information is estimated to average 3.38 hours per response, including the time for reviewing instructions, search- ing existing data sources, gathering and maintaining the data needed, and completing and reviewing the collection of information. Send comments regarding this burden estimate or any other aspect of this collection of information, including suggestions for reducing this burden, to Office of Information Resources Management Policy, Plans, and Oversight, Records Management Division, HR-422 - GTN, Paperwork Reduction Project (1910-0400), U.S. Department of Energy, 1000 Independence Avenue, S.W., Washington, DC 20585; and to the Office of Management and Budget (OMB), Paperwork Reduction Project

34

Microsoft Word - GRS Review_OMB White Paper - Real Property Right...  

Broader source: Energy.gov (indexed) [DOE]

GRS ReviewOMB White Paper - Real Property Right-sizing and Carbon Reduction August 7 2009 2.docx Microsoft Word - GRS ReviewOMB White Paper - Real Property Right-sizing and...

35

Circular chemiresistors for microchemical sensors  

DOE Patents [OSTI]

A circular chemiresistor for use in microchemical sensors. A pair of electrodes is fabricated on an electrically insulating substrate. The pattern of electrodes is arranged in a circle-filling geometry, such as a concentric, dual-track spiral design, or a circular interdigitated design. A drop of a chemically sensitive polymer (i.e., chemiresistive ink) is deposited on the insulating substrate on the electrodes, which spreads out into a thin, circular disk contacting the pair of electrodes. This circularly-shaped electrode geometry maximizes the contact area between the pair of electrodes and the polymer deposit, which provides a lower and more stable baseline resistance than with linear-trace designs. The circularly-shaped electrode pattern also serves to minimize batch-to-batch variations in the baseline resistance due to non-uniform distributions of conductive particles in the chemiresistive polymer film.

Ho, Clifford K. (Albuquerque, NM)

2007-03-13T23:59:59.000Z

36

OMB and CEQ Joint Memorandum on Environmental Collaboration and Conflict  

Broader source: Energy.gov (indexed) [DOE]

OMB and CEQ Joint Memorandum on Environmental Collaboration and OMB and CEQ Joint Memorandum on Environmental Collaboration and Conflict Resolution OMB and CEQ Joint Memorandum on Environmental Collaboration and Conflict Resolution This Office of Management and Budget (OMB) and Council on Environmental Quality (CEQ) joint memorandum expands and builds on the November 28, 2005, Environmental Conflict Resolution (ECR) Memorandum, directing departments and agencies to increase the appropriate and effective use of third-party assisted environmental collaboration as well as environmental conflict resolution to resolve problems and conflicts that arise in the context of environmental, public lands, or natural resources issues, including matters related to energy, transportation, and water and land management. This memorandum supersedes and broadens the 2005 memorandum on ECR by

37

Nuclear spin circular dichroism  

SciTech Connect (OSTI)

Recent years have witnessed a growing interest in magneto-optic spectroscopy techniques that use nuclear magnetization as the source of the magnetic field. Here we present a formulation of magnetic circular dichroism (CD) due to magnetically polarized nuclei, nuclear spin-induced CD (NSCD), in molecules. The NSCD ellipticity and nuclear spin-induced optical rotation (NSOR) angle correspond to the real and imaginary parts, respectively, of (complex) quadratic response functions involving the dynamic second-order interaction of the electron system with the linearly polarized light beam, as well as the static magnetic hyperfine interaction. Using the complex polarization propagator framework, NSCD and NSOR signals are obtained at frequencies in the vicinity of optical excitations. Hartree-Fock and density-functional theory calculations on relatively small model systems, ethene, benzene, and 1,4-benzoquinone, demonstrate the feasibility of the method for obtaining relatively strong nuclear spin-induced ellipticity and optical rotation signals. Comparison of the proton and carbon-13 signals of ethanol reveals that these resonant phenomena facilitate chemical resolution between non-equivalent nuclei in magneto-optic spectra.

Vaara, Juha, E-mail: juha.vaara@iki.fi [NMR Research Group, Department of Physics, University of Oulu, P.O. Box 3000, FIN-90014 Oulu (Finland)] [NMR Research Group, Department of Physics, University of Oulu, P.O. Box 3000, FIN-90014 Oulu (Finland); Rizzo, Antonio [Istituto per i Processi Chimico-Fisici del Consiglio Nazionale delle Ricerche (IPCF-CNR), Area della Ricerca, via G. Moruzzi 1, I-56124 Pisa (Italy)] [Istituto per i Processi Chimico-Fisici del Consiglio Nazionale delle Ricerche (IPCF-CNR), Area della Ricerca, via G. Moruzzi 1, I-56124 Pisa (Italy); Kauczor, Joanna; Norman, Patrick [Department of Physics, Chemistry and Biology, Linköping University, S-58183 Linköping (Sweden)] [Department of Physics, Chemistry and Biology, Linköping University, S-58183 Linköping (Sweden); Coriani, Sonia, E-mail: coriani@units.it [Dipartimento di Scienze Chimiche e Farmaceutiche, Università degli Studi di Trieste, Via L. Giorgieri 1, I-34127 Trieste (Italy)] [Dipartimento di Scienze Chimiche e Farmaceutiche, Università degli Studi di Trieste, Via L. Giorgieri 1, I-34127 Trieste (Italy)

2014-04-07T23:59:59.000Z

38

Microsoft Word - Graphics A-76 Post - MEO VV Review Report _F...  

Broader source: Energy.gov (indexed) [DOE]

- MEO VV Review Report F.doc More Documents & Publications Microsoft Word - NNSA Logistics A-76 Post - MEO VV Review Report 111.doc A-76 QUESTIONS AND ANSWERS...

39

Notices OMB Control Number: 1850-0803.  

Broader source: Energy.gov (indexed) [DOE]

870 Federal Register 870 Federal Register / Vol. 78, No. 140 / Monday, July 22, 2013 / Notices OMB Control Number: 1850-0803. Type of Review: Extension without change of an existing collection of information. Respondents/Affected Public: Individuals or households. Total Estimated Number of Annual Responses: 135,000. Total Estimated Number of Annual Burden Hours: 27,000. Abstract: This is a request for a 3-year renewal of the generic clearance to allow the National Center for Education Statistics (NCES) to continue to develop, test, and improve its survey and assessment instruments and methodologies. The procedures utilized to this effect include but are not limited to experiments with levels of incentives for various types of survey operations, focus groups, cognitive laboratory

40

Form Approval: OMB No. 1905-0129  

U.S. Energy Information Administration (EIA) Indexed Site

Due Date: 2013 Due Date: 2013 Form Approval: OMB No. 1905-0129 Approval Expires: 12/31/2015 Burden hours: 0.75 SCHEDULE 1. IDENTIFICATION Contact Information Form EIA-861S ANNUAL ELECTRIC POWER INDUSTRY REPORT (Short Form) NOTICE: This report is mandatory under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other sanctions as provided by law. For further information concerning sanctions and data protections see the provisions on sanctions and the provisions concerning the confidentiality of information in the instructions. Title 18 U.S.C. 1001 makes it a criminal offense for any person knowingly and willingly to make to any Agency or Department of the United States any false, fictitious, or fraudulent statements as to any matter within its jurisdiction. Entities that report using the Form EIA-861 do

Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc  

Broader source: Energy.gov (indexed) [DOE]

Circular A-76 (2003) Roles and Responsibilities Circular A-76 (2003) Roles and Responsibilities Title of Official Qualifications of Individual Responsibilities References Competitive Sourcing Official (CSO) * Designated by the agency * Assistant Secretary or equivalent level official * Implement the circular * Delegate, in writing, specified responsibilities to senior-level officials in the agency or agency components except as otherwise provided in this circular * Exempt a commercial activity performed by government personnel from performance by the private sector * Obtain prior written OMB approval before deviating from this Circular (without delegation) * Identify savings resulting from competitions in accordance with OMB Circular No. A- 11 * Determine if this circular applies to the Department of Defense during times of war or

42

All Other Editions Are Obsolete OMB Control No.  

Broader source: Energy.gov (indexed) [DOE]

(10/92) All Other Editions Are Obsolete OMB Control No. 1910-1800 OMB Burden Disclosure Statement below U.S. Department of Energy (Facility or Installation Where Terminated) SECURITY TERMINATION STATEMENT NAME AND TITLE (Print all blocks) EMPLOYER YOU ARE LEAVING FUTURE RESIDENCE NAME AND ADDRESS OF FUTURE EMPLOYER REASON FOR TERMINATION SOCIAL SECURITY NUMBER DATE OF BIRTH DATE OF TERMINATION DOE NUMBER (IF KNOWN) I make the following statement in connection with the forthcoming termination of my access authorization (security clearance) granted by the U.S. Department of Energy (DOE). 1. In accordance with DOE security regulations, I have destroyed or transferred to persons designated

43

Microsoft Word - NNSA Logistics A-76 Post - MEO VV Review Report...  

Broader source: Energy.gov (indexed) [DOE]

Microsoft Word - NNSA Logistics A-76 Post - MEO VV Review Report 111.doc Microsoft Word - NNSA Logistics A-76 Post - MEO VV Review Report 111.doc Microsoft Word - NNSA...

44

Circular permutant GFP insertion folding reporters  

SciTech Connect (OSTI)

Provided are methods of assaying and improving protein folding using circular permutants of fluorescent proteins, including circular permutants of GFP variants and combinations thereof. The invention further provides various nucleic acid molecules and vectors incorporating such nucleic acid molecules, comprising polynucleotides encoding fluorescent protein circular permutants derived from superfolder GFP, which polynucleotides include an internal cloning site into which a heterologous polynucleotide may be inserted in-frame with the circular permutant coding sequence, and which when expressed are capable of reporting on the degree to which a polypeptide encoded by such an inserted heterologous polynucleotide is correctly folded by correlation with the degree of fluorescence exhibited.

Waldo, Geoffrey S. (Santa Fe, NM); Cabantous, Stephanie (Los Alamos, NM)

2011-06-14T23:59:59.000Z

45

Circular permutant GFP insertion folding reporters  

SciTech Connect (OSTI)

Provided are methods of assaying and improving protein folding using circular permutants of fluorescent proteins, including circular permutants of GFP variants and combinations thereof. The invention further provides various nucleic acid molecules and vectors incorporating such nucleic acid molecules, comprising polynucleotides encoding fluorescent protein circular permutants derived from superfolder GFP, which polynucleotides include an internal cloning site into which a heterologous polynucleotide may be inserted in-frame with the circular permutant coding sequence, and which when expressed are capable of reporting on the degree to which a polypeptide encoded by such an inserted heterologous polynucleotide is correctly folded by correlation with the degree of fluorescence exhibited.

Waldo, Geoffrey S. (Santa Fe, NM); Cabantous, Stephanie (Los Alamos, NM)

2008-06-24T23:59:59.000Z

46

Circular permutant GFP insertion folding reporters  

DOE Patents [OSTI]

Provided are methods of assaying and improving protein folding using circular permutants of fluorescent proteins, including circular permutants of GFP variants and combinations thereof. The invention further provides various nucleic acid molecules and vectors incorporating such nucleic acid molecules, comprising polynucleotides encoding fluorescent protein circular permutants derived from superfolder GFP, which polynucleotides include an internal cloning site into which a heterologous polynucleotide may be inserted in-frame with the circular permutant coding sequence, and which when expressed are capable of reporting on the degree to which a polypeptide encoded by such an inserted heterologous polynucleotide is correctly folded by correlation with the degree of fluorescence exhibited.

Waldo, Geoffrey S.; Cabantous, Stephanie

2013-04-16T23:59:59.000Z

47

Circular permutant GFP insertion folding reporters  

SciTech Connect (OSTI)

Provided are methods of assaying and improving protein folding using circular permutants of fluorescent proteins, including circular permutants of GFP variants and combinations thereof. The invention further provides various nucleic acid molecules and vectors incorporating such nucleic acid molecules, comprising polynucleotides encoding fluorescent protein circular permutants derived from superfolder GFP, which polynucleotides include an internal cloning site into which a heterologous polynucleotide may be inserted in-frame with the circular permutant coding sequence, and which when expressed are capable of reporting on the degree to which a polypeptide encoded by such an inserted heterologous polynucleotide is correctly folded by correlation with the degree of fluorescence exhibited.

Waldo, Geoffrey S; Cabantous, Stephanie

2013-02-12T23:59:59.000Z

48

All Other Editions Are Obsolete OMB Control No.  

Broader source: Energy.gov (indexed) [DOE]

5.9 5.9 (06-97) All Other Editions Are Obsolete OMB Control No. 1910-1800 OMB Burden Disclosure Statement on Reverse U.S. DEPARTMENT OF ENERGY RECORD OF DESTRUCTION See DOE Manual 471.2-1 Manual for Classified Matter Protection and Control for Instructions UNCLASSIFIED DESCRIPTION OF MATTER (Subject or title and originator) UNIQUE IDENTIFICATION NUMBER (If none, omit) DATE OF MATTER CLASSIFICATION LEVEL AND CATEGORY (Include any caveats) NUMBER of PAGES Signature, Organization, and Title of person witnessing destruction (if required) Date of Destruction Printed with soy ink on recycled paper Signature, Organization, and Title of person destroying matter Date of Destruction I CERTIFY THAT THE MATTER LISTED ABOVE HAVE BEEN DESTROYED IN ACCORDANCE WITH CURRENT SECURITY REGULATIONS.

49

Gene synthesis by circular assembly amplification  

E-Print Network [OSTI]

Gene synthesis by circular assembly amplification Duhee Bang & George M Church Here we report the development of a gene-synthesis technology, circular assembly amplification. In this approach, we first error-rich products, thereby substantially improving gene-synthesis quality. We used this method

Church, George M.

50

Policy Flash 2013-37 Federal Acquisition Circular (FAC) 2005...  

Energy Savers [EERE]

37 Federal Acquisition Circular (FAC) 2005-66 Policy Flash 2013-37 Federal Acquisition Circular (FAC) 2005-66 Attached is Policy Flash 2013-37 Federal Acquisition Circular (FAC)...

51

Policy Flash 2013-27 Federal Acquisition Circular (FAC) 2005...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

27 Federal Acquisition Circular (FAC) 2005-65 Policy Flash 2013-27 Federal Acquisition Circular (FAC) 2005-65 Attached is Policy Flash 2013-27 Federal Acquisition Circular (FAC)...

52

Microsoft Word - GRS Review_OMB White Paper - Real Property Right...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Document - Submitted to OMB August 7th, 2009 1 Whitepaper on Real Property Right-Sizing and Carbon Footprint Reduction Purpose: 1. The team (identified at the end of this document)...

53

OMB Approval No. 0348-0041 BUDGET INFORMATION - Construction Programs  

Broader source: Energy.gov (indexed) [DOE]

OMB Approval No. 0348-0041 BUDGET INFORMATION - Construction Programs NOTE: Certain Federal assistance programs require additional computations to arrive at the Federal share of project costs eligible for participation. If such is the case, you will be notified. COST CLASSIFICATION a. Total Cost b. Costs Not Allowable for Participation c. Total Allowable Costs (Columns a-b) 1 Administrative and legal expenses $0.00 $0.00 $0.00 2 Land, structures, rights-of-way, appraisals, etc. $0.00 $0.00 $0.00 3 Relocation expenses and payments

54

Spectroscopy 16 (2002) 121125 121 Synchrotron radiation circular dichroism  

E-Print Network [OSTI]

undamaged even after long periods of exposure in the Synchroton Radiation Circular Dichroism (SRCD) beam [2

Wallace, Bonnie Ann

55

Federal Acquisition Circular 2005-60  

Broader source: Energy.gov (indexed) [DOE]

Circular 2005-60 Circular 2005-60 SUMMARY: This document summarizes the Federal Acquisition Regulation (FAR) rules agreed to by the Civilian Agency Acquisition Council and the Defense Acquisition Regulations Council (Councils) in this Federal Acquisition Circular (FAC) 2005-60. Item Subject FAR Case I Reporting Executive Compensation and First-Tier Subcontract Awards 2008-039 II Payments Under Time-and- Materials and Labor-Hour Contracts 2011-003 III Extension of Sunset Date for Protests of Task and Delivery Orders 2012-007 IV DARPA-New Mexico Tax Agreement 2012-019 V Clarification of Standards for Computer Generation of Forms 2011-022 VI Technical Amendments Item I Reporting Executive Compensation and First-Tier Subcontract Awards (FAR Case

56

Federal Acquisition Circular 2005-36  

Broader source: Energy.gov (indexed) [DOE]

Federal Acquisition Circular 2005-36 Federal Acquisition Circular 2005-36 Item Subject FAR case I.............. Federal Technical Data Solution (FedTeDS) 2008-038 II............. Fair Labor Standards Act and Service Contract 2007-021 Act Price Adjustment Clauses. III............ New Designated Country-Taiwan 2009-014 IV............. Prohibition on Restricted Business Operations 2008-004 in Sudan and Imports from Burma. V.............. List of Approved Attorneys, Abstractors, and 2006-013 Title Companies. VI............. Cost Accounting Standards (CAS) 2007-002 Administration and Associated Federal Acquisition Regulation Clauses. VII............ Technical Amendments

57

All Other Editions Are Obsolete OMB Control No.  

Broader source: Energy.gov (indexed) [DOE]

18 18 (11-94) All Other Editions Are Obsolete OMB Control No. 1910-1800 BOTH SIDES OF THIS FORM MUST BE READ AND SIGNED U.S. DEPARTMENT OF ENERGY Public reporting burden for this collection of information is estimated to average 15 minutes per response, including the time for reviewing instructions, searching existing data sources, gathering and maintaining the data needed, and completing and reviewing the collection of information. Send comments regarding this burden estimate or any other aspect of this collection of information, including suggestions for reducing this burden, to Office of Information Resources Management Policy, Plans, and Oversight, Records Management Division, HR-422 - GTN, Paperwork Reduction Project (1910-1800), U.S. Department of Energy, 1000 Independence Avenue, S.W., Washington, DC 20585; and

58

Draft ERUS 2014 OMB Supporting Statement, Part B  

Gasoline and Diesel Fuel Update (EIA)

NUMBER 1905-0129 SUPPORTING STATEMENT, PART B NUMBER 1905-0129 SUPPORTING STATEMENT, PART B i Supporting Statement for Survey Clearance: Electric Power and Renewable Surveys Part B: Collection of Information Employing Statistical Methods Assistant Administrator for Energy Statistics | Office of Electricity, Renewables & Uranium Statistics OMB Number 1905-0129 Independent Statistics & Analysis www.eia.gov U.S. Department of Energy Washington, DC 20585 FORM EIA-63B, Annual Photovoltaic Cell/Module Shipments Report FORM EIA-411, Coordinated Bulk Power Supply Program Report FORM EIA-826, Monthly Electric Utility Sales and Revenue Report with State Distributions FORM EIA-860, Annual Electric Generator Report FORM EIA-860M, Monthly Update to the Annual Electric Generator Report

59

Attachment 14 Sample LOO.doc  

Broader source: Energy.gov (indexed) [DOE]

4 4 DRAFT MASTER LOO Page 1 of 3 LETTER OF OBLIGATION DEPARMENT OF ENERGY This LETTER OF OBLIGATION (LOO) establishes the requirements for performance by a Most Efficient Organization (MEO) within the Department of Energy (DOE or Department). DOE competed the performance of a commercial activity, [insert RFP# and title], under the standard competition procedures of Office of Management and Budget (OMB) Circular A-76 (Revised), Performance of Commercial Activities, dated May 29, 2003. OMB Circular A-76 is hereby incorporated by reference. All actions taken under this Agreement shall be in accordance with the requirements of the Circular. The agency tender, dated [insert date], was selected to be the service provider under said competition and is incorporated by reference to this LOO.

60

On the properties of Circular-Beams  

E-Print Network [OSTI]

Circular-Beams were introduced as a very general solution of the paraxial wave equation carrying Orbital Angular Momentum. Here we study their properties, by looking at their normalization and their expansion in terms of Laguerre-Gauss modes. We also study their far-field divergence and, for particular cases of the beam parameters, their possible experimental generation.

Giuseppe Vallone

2015-01-28T23:59:59.000Z

Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

Policy Flash 2014-38 Federal Acquisition Circular (FAC) 2005...  

Energy Savers [EERE]

4-38 Federal Acquisition Circular (FAC) 2005-76 Policy Flash 2014-38 Federal Acquisition Circular (FAC) 2005-76 Questions concerning this policy flash should be directed to Jason...

62

POLICY FLASH 2014-31 Federal Acquisition Circulars (FACs) 2005...  

Energy Savers [EERE]

POLICY FLASH 2014-31 Federal Acquisition Circulars (FACs) 2005-73 and 2005-74 POLICY FLASH 2014-31 Federal Acquisition Circulars (FACs) 2005-73 and 2005-74 Questions concerning...

63

Policy Flash 2014-11 Federal Acquisition Circular (FAC) 2005...  

Broader source: Energy.gov (indexed) [DOE]

1 Federal Acquisition Circular (FAC) 2005-71 Policy Flash 2014-11 Federal Acquisition Circular (FAC) 2005-71 Questions concerning this policy flash should be directed to Barbara...

64

NOAA Technical Report NMFS Circular 450 The Utility of Developmental  

E-Print Network [OSTI]

#12;450 NOAA Technical Report NMFS Circular 450 The Utility of Developmental Osteology in Taxonomic Report NMFS Circular 450 The Utility of Developmental Osteology in Taxonomic and Systematic Studies .................................................................. .... 13 Scales and lateral line pores

65

Lines of Circular Polarization in Electromagnetic Wave Fields  

Science Journals Connector (OSTI)

8 October 1983 research-article Lines of Circular Polarization in Electromagnetic Wave Fields J...free space possesses, in general, two families of singular lines ( lines) on which the transverse field is circularly polarized. The...

1983-01-01T23:59:59.000Z

66

Microsoft Word - 06-22-09 FINAL ECAT Comments on OMB Recovery Act Guidance.doc  

Broader source: Energy.gov (indexed) [DOE]

EMERGENCY COMMITTEE FOR AMERICAN TRADE EMERGENCY COMMITTEE FOR AMERICAN TRADE ________________________________________________________________________________________________________ 900 17 th St., N.W., Suite 1150, Washington, D.C. 20006 Phone 202.659.5147 Fax 202.659.1347 www.ecattrade.com June 22, 2009 Ms. Marguerite Pridgen Office of Federal Financial Management Submitted via www.regulations.gov Office of Management and Budget Executive Office of the President New Executive Office Building, Washington, DC 20503 Re: Comments on OMB's Interim Final Recovery Act Guidance Dear Ms. Pridgen: Please find below comments submitted on behalf of the Emergency Committee for American Trade (ECAT) on OMB's Interim Final Guidance regarding implementation of Section 1605 of the American

67

Circular zig-zag scan video format  

DOE Patents [OSTI]

A circular, ziz-zag scan for use with vidicon tubes. A sine wave is generated, rectified and its fourth root extracted. The fourth root, and its inverse, are used to generate horizontal ramp and sync signals. The fourth root is also used to generate a vertical sync signal, and the vertical sync signal, along with the horizontal sync signal, are used to generate the vertical ramp signal. Cathode blanking and preamplifier clamp signals are also obtained from the vertical sync signal.

Peterson, C. Glen (Los Alamos, NM); Simmons, Charles M. (Los Alamos, NM)

1992-01-01T23:59:59.000Z

68

Program and Project Management Policy for the Planning, Programming, Budgeting, and Acquisition of Capital Assets  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

To establish Department of Energy (DOE) program and project management policy for the planning, programming, budgeting, and acquisition of capital assets consistent with the following Office of Management and Budget (OMB) circulars: OMB Circular A-11, Part 3, Planning, Budgeting, and Acquisition of Capital Assets, and the supplement to Part 3, Capital Programming Guide; OMB Circular A-123; OMB Circular A-127; and OMB Circular A-130. Does not cancel other directives. Canceled by DOE N 251.99

2000-06-10T23:59:59.000Z

69

Notice and Request for OMB Review and Comment: Federal Register Notice, Volume 79, No. 250- Dec. 31, 2014  

Broader source: Energy.gov [DOE]

The Office of Electricity Delivery and Energy Reliability has submitted an information collection request to the OMB for extension under the provisions of the Paperwork Reduction Act of 1995.

70

Circular zig-zag scan video format  

DOE Patents [OSTI]

A circular, ziz-zag scan for use with vidicon tubes is disclosed. A sine wave is generated, rectified and its fourth root extracted. The fourth root, and its inverse, are used to generate horizontal ramp and sync signals. The fourth root is also used to generate a vertical sync signal, and the vertical sync signal, along with the horizontal sync signal, are used to generate the vertical ramp signal. Cathode blanking and preamplifier clamp signals are also obtained from the vertical sync signal. 10 figs.

Peterson, C.G.; Simmons, C.M.

1992-06-09T23:59:59.000Z

71

A Family of Circular Bargmann Transforms  

E-Print Network [OSTI]

When considering a charged particle evolving in the Poincar\\'e disk under influence of a uniform magnetic field with a strength proportional to +1, we construct for all hyperbolic Landau level \\epsilon^\\gamma_$m$ m = 4m(-m), m 2 Z+ \\[0, /2] a family of coherent states transforms labeled by (,m) and mapping isometrically square integrable functions on the unit circle with respect to the measure sin^\\gamma-2m (\\theta/2) d\\theta onto spaces of bound states of the particle. These transforms are called circular Bargmann transforms.

Zouhair Mouayn

2011-05-24T23:59:59.000Z

72

Microsoft PowerPoint - DOE PCA Training (Executive Overview) 10-31-06 Final.ppt  

Broader source: Energy.gov (indexed) [DOE]

October 31, 2006 October 31, 2006 Department of Energy Post Competition Accountability (PCA) Training Module 1: Executive PCA Training Opening Remarks Opening Remarks 3 Post Competition Accountability (PCA) Training Module 1: Executive PCA Training Module 2: PCA Practitioner's Training Module 3: Quality Assurance Surveillance Training Module 4: Quality Control Evaluator Training Module 5: Service Provider (SP) PCA Toolkit 4 Training Objectives Understand OMB PCA Requirements Understand DOE PCA Roles and Responsibilities Understand the Execution of PCA 5 PCA Training Agenda PCA Overview OMB Circular A-76 PCA Requirements Roles and Responsibilities Requirements for Measuring Cost & Performance How do we Measure Cost & Performance? Independent Validation and Verification (IV&V)

73

The Effect of Circularly Polarized Light on the Photosynthesis and ...  

Science Journals Connector (OSTI)

The net photosynthesis and chlorophyll a synthesis of certain marine algae show a gra- dation in response to various types of polarized light. Right circularly.

1999-12-14T23:59:59.000Z

74

Federal Acquisition Regulation; Federal Acquisition Circular  

Broader source: Energy.gov (indexed) [DOE]

2005-37; Introduction Federal Acquisition Circular (FAC) 2005-37 List of Rules in FAC 2005-37 Item Subject I. Registry of Disaster Response Contractors II. Limiting Length of Noncompetitive Contracts in "Unusual and Compelling Urgency" Circumstances III. GAO Access to Contractor Employees IV. Use of Commercial Services Item Authority V. Limitations on Pass-Through Charges VI. Award Fee Language Revision VII. National Response Framework VIII. Technical Amendments SUPPLEMENTARY INFORMATION: Summaries for each FAR rule follow. Item I-Registry of Disaster Response Contractors (FAR Case 2008-035) This interim rule amends the FAR at parts 2, 4, 7, 10, 13, 18, 26, and 52 to implement the Registry of Disaster Response Contractors provision, section 697 of the Department of

75

Federal Acquisition Circular WAC) 2001-24  

Broader source: Energy.gov (indexed) [DOE]

FLASH 2004-20 July 12, 2004 Federal Acquisition Circular WAC) 2001-24 1. Incentives for Use of Performance-Based Contracting for Services (Interim) (FAR Case 2004-004) Effective Date: June 18, 2004 What is the purpose of this FAR Case? This interim rule amends the FAR providing authority to treat perfonnance-based contract or task orders for services as commercial items if specific conditions are met. It also requires agencies to report on perfonnance-based contracts or task orders awarded using this authority. This rulemaking affects FAR Parts 2, Definitions, 12, Acquisition of Commercial Items, 37, Service Contracting, and 52, Solicitation Provisions and Contract Clauses. ~ Provides that performance-based contracts and task orders for services with an estimated value not to exceed $25,000,000, be treated as

76

Federal Acquisition Regulation; Federal Acquisition Circular  

Broader source: Energy.gov (indexed) [DOE]

0 0 Federal Acquisition Circular (FAC) 2005-40 Federal Register /Vol. 75, No. 55 /Tuesday, March 23, 2010 /page 14059 A summary for the FAR rule follows. Federal Awardee Performance and Integrity Information System (FAPIIS) (FAR case 2008-027) Effective Date: April 22, 2010. This final rule amends the FAR to implement section 872 of the Duncan Hunter National Defense Authorization Act for Fiscal Year 2009. Section 872 requires the establishment of a data system, Federal Awardee Performance and Integrity Information System (FAPIIS), containing specific information on the integrity and performance of covered Federal agency contractors and grantees. FAPIIS is available for use in award decisions at www.ppirs.gov. Government input to FAPIIS is accomplished at www.cpars.csd.disa.mil.

77

Simplified expansions for radiation from a baffled circular piston  

E-Print Network [OSTI]

Simplified expansions for radiation from a baffled circular piston T. Douglas Mast Department from a baffled circular piston continues be an active area of investigation, both as a canonical computations of piston fields in lossless and attenuative fluid media. For the region r a, where

Mast, T. Douglas

78

Circularization of Tidally Disrupted Stars around Spinning Supermassive Black Holes  

E-Print Network [OSTI]

We study the circularization of tidally disrupted stars on bound orbits around spinning supermassive black holes by performing three-dimensional smoothed particle hydrodynamic simulations with Post-Newtonian corrections. Our simulations reveal that debris circularization depends sensitively on the efficiency of radiative cooling. There are two stages in debris circularization if radiative cooling is inefficient: first, the stellar debris streams self-intersect due to relativistic apsidal precession; shocks at the intersection points thermalize orbital energy and the debris forms a geometrically thick, ring-like structure around the black hole. The ring rapidly spreads via viscous diffusion, leading to the formation of a geometrically thick accretion disk. In contrast, if radiative cooling is efficient, the stellar debris circularizes due to self-intersection shocks and forms a geometrically thin ring-like structure. In this case, the dissipated energy can be emitted during debris circularization as a precurso...

Hayasaki, Kimitake; Loeb, Abraham

2015-01-01T23:59:59.000Z

79

OMB Memorandum No. 95-18--Agency Plans for Operations During Funding Hiatus  

Broader source: Energy.gov (indexed) [DOE]

EXECUTIVE EXECUTIVE OFFICE OF THE PRESIDENT OFFICE OF MANAGEMENT AND BUDGET WASHINGTON, D.C. 20503 THE DIRECTOR August 22, 1995 M-95-l8 MEMORANDUM FOR HEADS OF FROM: Alice M. Director EXECUTIVE DEPARTMENTS RiVli~ AND AGENCIES SUBJECT: Agency Plans for Operations During Funding Hiatus OMB Bulletin 80-14, dated August 28, 1980 (and amended by the OMB Director's memorandum of November 17, 1981) requires all agencies to maintain contingency plans to deal with a possible appropriations hiatus. The bulletin requires agency plans to be consistent with the January 16, 1981 opinion of the Attorney General on this subject. The Office of Legal Counsel of the Department of Justice has issued an opinion dated August 16, 1995 that updates the 1981 opinion. A copy of the August 16th opinion is attached. You should review your plans in light of this opinion, make any changes necessary to conform to the opinion,

80

Microsoft Word - OE Monthly Reporting Request OMB 83I Renewal 2011 09282011.doc  

Broader source: Energy.gov (indexed) [DOE]

Department of Energy 2. OMB control number b. __ None a. 1910-5149 3. Type of information collection (check one) a. New Collection b. Revision of a currently approved collection c. X Extension of a currently approved collection d. Reinstatement, without change, of a previously approved collection for which approval has expired. e. Reinstatement, with change, of a previously approved collection for which approval has expired f. Existing collection in use without OMB control number For b-f, note item A2 of Supporting Statement instructions 4. Type of review requested (check one) a. X Regular b. Emergency c. Delegated 5. Small entities Will this information collection have a significant economic impact on a substantial

Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

Replaces EIA-459C All Other Editions Are Obsolete OMB Control No.  

Broader source: Energy.gov (indexed) [DOE]

4600.4 4600.4 (04-94) Replaces EIA-459C All Other Editions Are Obsolete OMB Control No. 1910-0400 U.S. Department of Energy Federal Assistance Budget Information Public reporting burden for this collection of information is estimated to average 1.87 hours per response, including the time for reviewing instructions, searching existing data sources, gathering and maintaining the data needed, and completing and reviewing the collection of information. Send comments regarding this burden estimate or any other aspect of this collection of information, including suggestions for reducing this burden, to Office of Information Resources Management Policy, Plans, and Oversight, Records Management Division, HR-422 - GTN, Paperwork Reduction Project (1910-0400), U.S. Department of Energy, 1000 Independence Avenue, S.W., Washington, DC 20585; and to the Office of Management and Budget (OMB), Paperwork

82

Previously DOE F 5635.11 All Other Editions Are Obsolete OMB Control No.  

Broader source: Energy.gov (indexed) [DOE]

9.2 9.2 (08-93) Previously DOE F 5635.11 All Other Editions Are Obsolete OMB Control No. 1910-1800 U.S. DEPARTMENT OF ENERGY REPORTING UNACCOUNTED FOR DOCUMENTS OMB Burden Disclosure Statement Public reporting burden for this collection of information is estimated to average 24.3 hours per response, including the time for reviewing instructions, searching existing data sources, gathering and maintaining the data needed, and completing and reviewing the collection of information. Send comments regarding this burden estimate or any other aspect of this collection of information, including suggestions for reducing this burden, to Office of Information Resources Management Policy, Plans, and Oversight, AD-244 - GTN, Paperwork Reduction Project (1910-1800), U.S. Department of Energy, 1000

83

OMB Form 83-C, Paperwork Reduction Act Change Worksheet, October 1995  

Broader source: Energy.gov (indexed) [DOE]

CHANGE WORKSHEET CHANGE WORKSHEET Agency/Subagency OMB control number Enter only items that change Current record New record Agency form number(s) Annual reporting and recordkeeping hour burden Number of respondents Total annual responses Percent of these responses collected electronically Total annual hours Difference Explanation of difference Program change Adjustment % % Other changes** For OIRA Use Date: **This form cannot be used to extend an expiration date. OMB FORM 83-C, 10/95 Signature of Senior Official or designee: Annual reporting and recordkeeping cost burden (in thousands of dollars) Total annualized Capital/Startup costs Total annual costs (O&M) Total annualized cost requested Difference Explanation of difference Program change Adjustment

84

Microsoft Word - NNSA Logistics A-76 Post - MEO VV Review Report _11_1.doc  

Broader source: Energy.gov (indexed) [DOE]

National Nuclear Security Agency Logistics Services Most Efficient Organization A-76 Post-Award Validation and Verification Review DECEMBER 2005 Office of Security and Safety Performance Assurance NNSA Logistics MEO Post-Award Validation and Verification Review December 2005 Page 2 of 16 Table of Contents 1.0 INTRODUCTION 2.0 RESULTS 3.0 CONCLUSIONS Appendix A: Supplemental Information Appendix B: Lexicon Appendix C: Documentation Matrix Attachment 1: A-76 Cost Comparison: In-House vs. Contract or ISSA Performance NNSA Logistics MEO Post-Award Validation and Verification Review December 2005 Page 3 of 16 1.0 INTRODUCTION The President has tasked all government operations with creating the most efficient and effective

85

IAEA Information Circular 225 Revision 5: Fact Sheet | National Nuclear  

National Nuclear Security Administration (NNSA)

IAEA Information Circular 225 Revision 5: Fact Sheet | National Nuclear IAEA Information Circular 225 Revision 5: Fact Sheet | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Home > Media Room > Fact Sheets > IAEA Information Circular 225 Revision 5: Fact Sheet Fact Sheet IAEA Information Circular 225 Revision 5: Fact Sheet Mar 23, 2012 The Department of Energy's National Nuclear Security Administration

86

Scour around a circular pile due to oscillatory wave motion  

E-Print Network [OSTI]

SCOUR AROUND A CIRCULAR PILE DUE TO OSCILLATORY WAVE MOTION A Thesis by DONALD RAYMOND WELLS Submitted to the Graduate College of Texas A&M University in partial fulfillment of the requirement for the degree of MASTER OF SCIENCE January... 1970 Major Subject: Civil Engineering SCOUR AROUND A CIRCULAR PILE DUE TO OSCILLATORY WAVE MOTION A Thesis by DONALD RAYMOND WELLS Approved as to style and content by: hairman of Committee) (Head of Department) ember) . (Member) (Member...

Wells, Donald Raymond

2012-06-07T23:59:59.000Z

87

Electronic Circular Dichroism of Proteins from First-Principles Calculations  

Science Journals Connector (OSTI)

Electronic Circular Dichroism of Proteins from First-Principles Calculations ... The circular dichroism (CD) spectra of 47 proteins in the far-ultraviolet have been calculated from first principles, using a parameter set derived from ab initio calculations on N-methylacetamide. ... An important aspect of calculating protein CD spectra is the accurate parametrization of the ground and excited electronic states of the amide chromophore. ...

Jonathan D. Hirst; Karl Colella; Andrew T. B. Gilbert

2003-09-30T23:59:59.000Z

88

Microsoft Word - Graphics A-76 Post - MEO VV Review Report _F_.doc  

Broader source: Energy.gov (indexed) [DOE]

Visual Information Services Most Efficient Organization Post-Award Validation and Verification Review DECEMBER 2004 Office of Security and Safety Performance Assurance Visual Information Services MEO Post-Award Validation and Verification Review December 2004 Page 2 of 21 Table of Contents 1.0 INTRODUCTION 2.0 RESULTS 3.0 CONCLUSIONS Appendix A: Supplemental Information Appendix B: Lexicon Appendix C: Documentation Matrix Attachment 1.: A-76 Cost Comparison: In-House vs. Contract or ISSA Performance 1.0 INTRODUCTION The Office of Security and Safety Performance and Assurance conducted a post-award validation and verification review of the Department of Energy (DOE) Visual Information Services - Most

89

DOE F 473.2 U.S. DEPARTMENT OF ENERGY OMB Control No.  

Broader source: Energy.gov (indexed) [DOE]

(Administrative Update: 03/2013) SECURITY BADGE REQUEST 1910-1800 All Other Editions Are Obsolete OMB Burden Disclosure Statement on Reverse TO: Headquarters Physical Protection Team (J) Date: (K) U.S. CITIZEN? YES NO IF NO, COUNTRY (A) FROM: NAME (printed) AND SIGNATURE OF DOE SPONSOR HAVING LIAISON WITH APPLICANT (L) REQUEST APPLICANT BE ISSUED: DOE HEADQUARTERS SITE-SPECIFIC SECURITY BADGE (USED AT HQ ONLY) (CHECK ONE): "BAO" TO HQ Facilities "FOREIGN NATIONAL" (B) TITLE DIVISION/OFFICE DOE STANDARD SECURITY BADGE (Used at HQ AND Other DOE Sites): (CHECK ONE): "Q" "L" "BAO" (Also Check): OGA IPA

90

Equal distribution of satellite constellations on circular target orbits  

Science Journals Connector (OSTI)

Abstract This paper addresses the problem of equal distribution of satellite constellations on circular target orbits. The control goal is to make the constellation converge to a circular target orbit, while spatially distributing the satellites at equal inter-satellite distances. The solution is defined in the port-Hamiltonian framework, which gives a clear physical interpretation of the obtained control laws, insight into the energy consumption and complete stability proofs. The controller consists of two parts: the internal control system steers each individual satellite to the target orbit, the external control system equally distributes the satellite constellation. Numerical simulation results are given to illustrate the effectiveness of the approach.

Ewoud Vos; Jacquelien M.A. Scherpen; Arjan J. van der Schaft

2014-01-01T23:59:59.000Z

91

How to project `circular' manifolds using geodesic distances?  

E-Print Network [OSTI]

How to project `circular' manifolds using geodesic distances? John Aldo Lee, Michel Verleysen,verleysen}@dice.ucl.ac.be Abstract. Recent papers have clearly shown the advantage of using the geodesic distance instead strongly crumpled manifolds have to be un- folded. Nevertheless, neither the Euclidean nor the geodesic

Verleysen, Michel

92

The First International Workshop on Synchrotron Radiation Circular Dichroism  

E-Print Network [OSTI]

The First International Workshop on Synchrotron Radiation Circular Dichroism (SRCD) Spectroscopy and biochemists and has been operational for about a year. Drs. Kunihiko Gekko (HiSOR, Japan) and Ye Tao (BSRF REPORTS SYNCHROTRON RADIATION NEWS, Vol. 15, No. 1, 2002 33 1st International Workshop on SRCD

Wallace, Bonnie Ann

93

Development of a circularly polarizing microscope with a polarizing undulator  

Science Journals Connector (OSTI)

A circularly polarizing microscope by which we intend to obtain images with CD (circular dichroism) or CIDS (circular intensity differential scattering) in order to observe the structure and distribution of biomolecules has been constructed by using a polarizing undulator as the polarizing light source. The polarizing undulator with crossed and retarded magnetic field having fifteen periods was installed in the electron storage ring NIJI?II in the Electrotechnical Laboratory. A Schwarzschild?type mirror system combined with a convex mirror was developed in order to focus the undulator radiation to a microbeam keeping the quality of polarization of the radiation from the undulator. The beam size was from 0.66 ?m (at wavelength 200 nm) to 0.96 ?m (at 400 nm). Using a scanning sample stage and a photomultiplier which was positioned in the back of the sample some images with transmitted and scattered light from fibrous DNA have been obtained. Attempts have also been made at obtaining images with CD and CIDS from the alternation between right? and left?handed circularly polarized radiation from the undulator.

Toru Yamada; Masatada Yuri; Hideo Onuki; Shozo Ishizaka

1995-01-01T23:59:59.000Z

94

Policy Flash 2014-03 Federal Acquisition Circular 2005-70 | Department...  

Energy Savers [EERE]

3 Federal Acquisition Circular 2005-70 Policy Flash 2014-03 Federal Acquisition Circular 2005-70 Questions concerning this policy flash should be directed to Barbara Binney, of the...

95

CASING EFFECTS ON THE RADIATION PERFORMANCE OF A CIRCULARLY POLARIZED PATCH ANTENNA  

E-Print Network [OSTI]

CASING EFFECTS ON THE RADIATION PERFORMANCE OF A CIRCULARLY POLARIZED PATCH ANTENNA K. Rambabu, H on the radiation characteristics of a miniaturized patch antenna for circular polarization. Different scenarios DESIGN Using a multiple resonance technique [4] for broadband performance, a circularly polarized patch

Bornemann, Jens

96

Federal Acquisition Circular 2005-52 Item Subject FAR case  

Broader source: Energy.gov (indexed) [DOE]

Circular 2005-52 Circular 2005-52 Item Subject FAR case I Sustainable Acquisition 2010-001 II Contract Closeout 2008-020 III Prohibition on Contracting with Inverted Domestic Corporations 2008-009 IV Buy American Exemption for Commercial Information Technology - Construction Material 2009-039 V Oversight of Contractor Ethics Programs 2010-017 VI Technical Amendments N/A Item I--Sustainable Acquisition (FAR Case 2010-001) (Interim) This interim rule amends the FAR to implement Executive Order 13514, Federal Leadership in Environmental, Energy, and Economic Performance, and Executive Order 13423, Strengthening Federal Environmental, Energy, and Transportation Management. It requires Federal agencies to leverage agency acquisitions to foster markets for

97

Circular polarization in the optical afterglow of GRB 121024A  

E-Print Network [OSTI]

Gamma-ray bursts (GRBs) are most probably powered by collimated relativistic outflows (jets) from accreting black holes at cosmological distances. Bright afterglows are produced when the outflow collides with the ambient medium. Afterglow polarization directly probes the magnetic properties of the jet, when measured minutes after the burst, and the geometric properties of the jet and the ambient medium when measured hours to days after the burst. High values of optical polarization detected minutes after burst in GRB 120308A indicate the presence of large-scale ordered magnetic fields originating from the central engine (the power source of the GRB). Theoretical models predict low degrees of linear polarization and negligable circular polarization at late times, when the energy in the original ejecta is quickly transferred to the ambient medium and propagates farther into the medium as a blastwave. Here we report the detection of circularly polarized optical light in the afterglow of GRB 121024A, measured 0.1...

Wiersema, K; Toma, K; van der Horst, A J; Varela, K; Min, M; Greiner, J; Starling, R L C; Tanvir, N R; Wijers, R A M J; Campana, S; Curran, P A; Fan, Y; Fynbo, J P U; Gorosabel, J; Gomboc, A; Gotz, D; Hjorth, J; Jin, Z P; Kobayashi, S; Kouveliotou, C; Mundell, C; O'Brien, P T; Pian, E; Rowlinson, A; Russell, D M; Salvaterra, R; Alighieri, S di Serego; Tagliaferri, G; Vergani, S D; Elliott, J; Farina, C; Hartoog, O E; Karjalainen, R; Klose, S; Knust, F; Levan, A J; Schady, P; Sudilovski, V; Willingale, R

2014-01-01T23:59:59.000Z

98

Replaces EIA-459F All Other Editions Are Obsolete OMB Control No.  

Broader source: Energy.gov (indexed) [DOE]

6 6 (10-94) Replaces EIA-459F All Other Editions Are Obsolete OMB Control No. 1910-0400 U.S. DEPARTMENT OF ENERGY FEDERAL ASSISTANCE PROGRAM/PROJECT STATUS REPORT Public reporting burden for this collection of information is estimated to average 47.5 hours per response, including the time for reviewing instructions, search- ing existing data sources, gathering and maintaining the data needed, and completing and reviewing the collection of information. Send comments regarding this burden estimate or any other aspect of this collection of information, including suggestions for reducing this burden, to Office of Information Resources Management Policy, Plans, and Oversight, Records Management Division, HR-422 - GTN, Paperwork Reduction Project (1910-0400), U.S. Department of

99

DOE F 473.2 U.S. DEPARTMENT OF ENERGY OMB Control No.  

Broader source: Energy.gov (indexed) [DOE]

(01/2006) 1910-1800 All Other Editions Are Obsolete SECURITY BADGE REQUEST OMB Burden Disclosure Statement on Reverse TO: Headquarters Physical Protection Team (J) DATE: (K) U.S. CITIZEN? O YES O NO IF NO, COUNTRY (A) FROM: NAME (printed) AND SIGNATURE OF DOE SPONSOR ( U.S. C EN Y N I N HAVING LIAISON WITH APPLICANT (L) REQUEST APPLICANT BE ISSUED: 0 DOE HEADQUARTERS SITE-SPECIFIC SECURITY BADGE iUsed at HO ONLY) (Check One): 0 "BAO" TO HQ Facilities O "FOREIGN NATIONAL' El DOE STANDARD SECURITY BADGE (Used at HQ AND Other DOE Sites): (B) TITLE DIVISION/OFFICE (Check One): 0 "0" 0"L' 0 "BAO" (Also Check): 0 OGA OIPA I certify that the applicant requires access to a DOE HQS facility to (M) BADGE AT: l FORSTL [ GTN

100

Microsoft Word - OMB_300_AA Test Invest _Rev 4_ 10-14-2010[1]  

Broader source: Energy.gov (indexed) [DOE]

Exhibit 300: Capital Asset Plan and Business Case Summary Exhibit 300: Capital Asset Plan and Business Case Summary Part I: Summary Information And Justification (All Capital Assets) Section A: Overview 1. Date of Submission: 2. Agency: 3. Bureau: 4. Name of this Investment: 5. Unique Project (Investment) Identifier (UPI) For IT investment only, see section 53.9. For all other, use agency ID if applicable. 6. What kind of investment will this be in FY 2012? (Please NOTE: Investments with Planning/Acquisition activities in FY 2011 should not select O&M.) 7. What was the first budget year this investment was submitted to OMB? (YYYY) 8. a) Provide a brief summary of the investment and justification, including a brief description of how this closes in part or in whole an identified agency performance gap, specific accomplishments expected by the budget year and the related benefit to

Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

3-Year Renewal Request of OMB 1910-0818, Security, Information Request  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

HSS Topical Areas HSS Topical Areas Quality Assurance Enforcement / Oversight Environment HSS Outreach and Communications HSPD-12 Nuclear Materials Management & Safeguards System (NMMSS) HSS Internal Operations Council on Environmental Quality (CEQ) Office of Health, Safety and Security Collection Package Human Reliability Program OMB 1910-5122 Description of Collections 1. Human Reliability Program Certification (DOE F 470.3). Under the Department of Energy Human Reliability Program (HRP), individuals who are applicants for or incumbents in designated positions must be evaluated to ensure that they meet the requirements for certification in the program. This form documents that each part of the evaluation has been completed and records the determination by the HRP Certifying Official. The collection and documentation of this information is required by the HRP regulation found in the Code of Federal Regulations at 10 CFR 712. Form may be viewed at: http://energy.gov/cio/downloads/doe-f-4703

102

Microsoft Word - OMB_300_CF iManage _Rev 11_ 9-17-2009.doc  

Broader source: Energy.gov (indexed) [DOE]

Exhibit 300: Capital Asset Plan and Business Case Summary Exhibit 300: Capital Asset Plan and Business Case Summary Part I: Summary Information And Justification (All Capital Assets) Section A: Overview (All Capital Assets) 1. Date of Submission: 2. Agency: 3. Bureau: 4. Name of this Investment: 5. Unique Project (Investment) Identifier: (For IT investment only, see section 53.9. For all other, use agency ID system.) 6. What kind of investment will this be in FY 2011? (Please NOTE: Investments moving to O&M in FY 2011, with Planning/Acquisition activities prior to FY 2011 should not select O&M. These investments should indicate their current status.) 7. What was the first budget year this investment was submitted to OMB? 8. Provide a brief summary and justification for this investment, including a brief description of how this closes in part or in

103

Federal Acquisition Regulation; Federal Acquisition Circular 2005-47; Summary  

Broader source: Energy.gov (indexed) [DOE]

7; Summary 7; Summary This document summarizes the Federal Acquisition Regulation (FAR) rules agreed to by the Civilian Agency Acquisition Council and the Defense Acquisition Regulations Council (Councils) in this Federal Acquisition Circular (FAC) 2005-47. All were effective December 13, 2010 except Items II, HUB Zone, and VI, Pass Through, which will be effective January 12, 2011. List of Rules in FAC 2005-47 Item Subject FAR case Analyst ------------------------------------------------------------------------------------------------------------ ---- I..................................... Notification of Employee 2010-006 McFadden.

104

Circular polarization of obliquely propagating whistler wave magnetic field  

SciTech Connect (OSTI)

The circular polarization of the magnetic field of obliquely propagating whistler waves is derived using a basis set associated with the wave partial differential equation. The wave energy is mainly magnetic and the wave propagation consists of this magnetic energy sloshing back and forth between two orthogonal components of magnetic field in quadrature. The wave electric field energy is small compared to the magnetic field energy.

Bellan, P. M. [Applied Physics, Caltech, Pasadena California 91125 (United States)] [Applied Physics, Caltech, Pasadena California 91125 (United States)

2013-08-15T23:59:59.000Z

105

Circular hydraulic jump in generalized-Newtonian fluids  

E-Print Network [OSTI]

We carry out an analytical study of laminar circular hydraulic jumps, in generalized-Newtonian fluids obeying the two-parametric power-law model of Ostwald-de Waele. Under the boundary-layer approximation we obtained exact expressions determining the flow, an implicit relation for the jump radius is derived. Corresponding results for Newtonian fluids can be retrieved as a limiting case for the flow behavior index n=1, predictions are made for fluids deviating from Newtonian behavior.

Rai, Ashutosh; Poria, Swarup

2008-01-01T23:59:59.000Z

106

Friction (Chapter 5, section 8) & Circular Motion (Chapter 6,  

E-Print Network [OSTI]

1 Week 5 Friction (Chapter 5, section 8) & Circular Motion (Chapter 6, sections 1-2) Lecture Quiz 1 travels in time t is: A. x B. 1.5x C. 3x D. 4.5x E. 9x Forces of Friction When an object to the interactions between the object and its environment This resistance is called the force of friction Forces

107

Circular modes for flat beams in the LHC  

DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

Typically x/y optical coupling is considered as unwanted and thus suppressed; particular exclusions are electron and ionization coolers. Could some special coupled modes be effectively applied for the LHC complex? Perhaps, the answer is positive: use of the circular modes in the injectors with their transformation into planar modes in the LHC allows both the space charge and beam-beam luminosity limitations to be significantly reduced, if not practically eliminated.

Burov, A.

2013-06-01T23:59:59.000Z

108

Circular modes for flat beams in the LHC  

Science Journals Connector (OSTI)

Typically x/y optical coupling is considered as unwanted and thus suppressed; particular exclusions are electron and ionization coolers. Could some special coupled modes be effectively applied for the LHC complex? Perhaps, the answer is positive: use of the circular modes in the injectors with their transformation into planar modes in the LHC allows both the space charge and beam-beam luminosity limitations to be significantly reduced, if not practically eliminated.

A. Burov

2013-06-24T23:59:59.000Z

109

Federal Acquisition Regulation Federal Acquisition Circular 2005-71 Summary of Rules  

Broader source: Energy.gov (indexed) [DOE]

1 Summary of Rules 1 Summary of Rules Item Subject FAR Case I Accelerated Payments to Small Business Subcontractors 2012-031 II New Designated Country--Croatia 2013-019 III Technical Amendment Item I--Accelerated Payments to Small Business Subcontractors (FAR Case 2012-031) This final rule amends the FAR to add a new clause, Providing Accelerated Payments to Small Business Subcontractors, as part of the implementation of OMB Memorandum M-12-16, Providing Prompt Payment to Small Business Subcontractors (as extended by OMB Memorandum M-13-15, Extension of Policy to Provide Accelerated Payment to Small Business Subcontractors). This new clause requires the prime contractor, upon receipt of accelerated payments from the Government, to make accelerated payments to small business subcontractors,

110

File:DEQ MFSA Circular 1.pdf | Open Energy Information  

Open Energy Info (EERE)

DEQ MFSA Circular 1.pdf DEQ MFSA Circular 1.pdf Jump to: navigation, search File File history File usage File:DEQ MFSA Circular 1.pdf Size of this preview: 463 × 599 pixels. Other resolution: 464 × 600 pixels. Go to page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 Go! next page → next page → Full resolution ‎(1,275 × 1,650 pixels, file size: 313 KB, MIME type: application/pdf, 33 pages) File history Click on a date/time to view the file as it appeared at that time. Date/Time Thumbnail Dimensions User Comment current 16:00, 9 October 2012 Thumbnail for version as of 16:00, 9 October 2012 1,275 × 1,650, 33 pages (313 KB) Dklein2012 (Talk | contribs) You cannot overwrite this file. Edit this file using an external application (See the setup

111

NON-ZEEMAN CIRCULAR POLARIZATION OF MOLECULAR ROTATIONAL SPECTRAL LINES  

SciTech Connect (OSTI)

We present measurements of circular polarization from rotational spectral lines of molecular species in Orion KL, most notably {sup 12}CO (J = 2 {yields} 1), obtained at the Caltech Submillimeter Observatory with the Four-Stokes-Parameter Spectral Line Polarimeter. We find levels of polarization of up to 1%-2% in general; for {sup 12}CO (J = 2 {yields} 1) this level is comparable to that of linear polarization also measured for that line. We present a physical model based on resonant scattering in an attempt to explain our observations. We discuss how slight differences in scattering amplitudes for radiation polarized parallel and perpendicular to the ambient magnetic field, responsible for the alignment of the scattering molecules, can lead to the observed circular polarization. We also show that the effect is proportional to the square of the magnitude of the plane of the sky component of the magnetic field and therefore opens up the possibility of measuring this parameter from circular polarization measurements of Zeeman insensitive molecules.

Houde, Martin; Jones, Scott; Rajabi, Fereshte [Department of Physics and Astronomy, The University of Western Ontario, London, ON, N6A 3K7 (Canada)] [Department of Physics and Astronomy, The University of Western Ontario, London, ON, N6A 3K7 (Canada); Hezareh, Talayeh [Max-Planck-Institut fuer Radioastronomie, Auf dem Huegel 69, D-53121 Bonn (Germany)] [Max-Planck-Institut fuer Radioastronomie, Auf dem Huegel 69, D-53121 Bonn (Germany)

2013-02-10T23:59:59.000Z

112

Dynamical evolution of quasi-circular binary black hole data  

E-Print Network [OSTI]

We study the fully nonlinear dynamical evolution of binary black hole data, whose orbital parameters are specified via the effective potential method for determining quasi-circular orbits. The cases studied range from the Cook-Baumgarte innermost stable circular orbit (ISCO) to significantly beyond that separation. In all cases we find the black holes to coalesce (as determined by the appearance of a common apparent horizon) in less than half an orbital period. The results of the numerical simulations indicate that the initial holes are not actually in quasi-circular orbits, but that they are in fact nearly plunging together. The dynamics of the final horizon are studied to determine physical parameters of the final black hole, such as its spin, mass, and oscillation frequency, revealing information about the inspiral process. We show that considerable resolution is required to extract accurate physical information from the final black hole formed in the merger process, and that the quasi-normal modes of the final hole are strongly excited in the merger process. For the ISCO case, by comparing physical measurements of the final black hole formed to the initial data, we estimate that less than 3% of the total energy is radiated in the merger process.

Miguel Alcubierre; Bernd Bruegmann; Peter Diener; F. Siddhartha Guzman; Ian Hawke; Scott Hawley; Frank Herrmann; Michael Koppitz; Denis Pollney; Edward Seidel; Jonathan Thornburg

2004-11-30T23:59:59.000Z

113

Data:26579101-295e-42fe-a76c-5546756967c9 | Open Energy Information  

Open Energy Info (EERE)

295e-42fe-a76c-5546756967c9 295e-42fe-a76c-5546756967c9 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Borough of Chambersburg, Pennsylvania (Utility Company) Effective date: 2004/05/03 End date if known: Rate name: Area Lighting Rate- (250W HPS Flood) Sector: Lighting Description: Source or reference: ISU Documentation Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous 1 2 3 Next >>

114

Data:Ddc521eb-361d-4a14-a76c-fdbbcda79048 | Open Energy Information  

Open Energy Info (EERE)

Ddc521eb-361d-4a14-a76c-fdbbcda79048 Ddc521eb-361d-4a14-a76c-fdbbcda79048 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Coos-Curry Electric Coop, Inc Effective date: 2011/12/22 End date if known: Rate name: General Service less than 30kw- Three-Phase Sector: Commercial Description: * Base charge or as established in a contract for electric service. Source or reference: Rate binder #4 (Illinois State University) Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V):

115

Data:47761cec-0334-4bb4-a76c-90da90ed1526 | Open Energy Information  

Open Energy Info (EERE)

61cec-0334-4bb4-a76c-90da90ed1526 61cec-0334-4bb4-a76c-90da90ed1526 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Nebraska Public Power District Effective date: 2013/01/01 End date if known: Rate name: 150 W LED- Nonwood Sector: Commercial Description: To all night street lighting service (dusk to daylight) from the overhead systems conforming to the District's standard specifications. Nonwood; Enclosed Electricity is provided through the Village, which obtains electric power from Nebraska Public Power District (NPPD) Source or reference: http://www.nppd.com/assets/municipalstreetlightingservice.pdf

116

Data:Ad668934-6c65-496d-8870-39601a76dcef | Open Energy Information  

Open Energy Info (EERE)

Ad668934-6c65-496d-8870-39601a76dcef Ad668934-6c65-496d-8870-39601a76dcef No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: NSTAR Electric Company Effective date: 2012/03/01 End date if known: Rate name: ACTON Basic rate G1(Green) Sector: Industrial Description: Default Generation Service ("Default Service") shall be available to any Customer who, for any reason, is not receiving Generation Service from a Competitive Supplier. Service under this rate to any Customer is subject to both the Company's printed requirements and the Company's Terms and Conditions - Distribution Service, each as in effect from time to time.

117

Strong circular photogalvanic effect in ZnO epitaxial films  

SciTech Connect (OSTI)

A strong circular photogalvanic effect (CPGE) in ZnO epitaxial films was reported under interband excitation. It was observed that CPGE current is as large as 100 nA/W in ZnO, which is about one order in magnitude higher than that in InN film while the CPGE currents in GaN films are not detectable. The possible reasons for the above observations are the strong spin orbit coupling in ZnO or the inversed valence band structure of ZnO.

Zhang, Q.; Wang, X. Q.; Yin, C. M.; Shen, B. [State Key Laboratory of Artificial Microstructure and Mesoscopic Physics, School of Physics, Peking University, Beijing 100871 (China); Chen, Y. H.; Chang, K. [Laboratory of Semiconductor Materials Science, Institute of Semiconductors, CAS, Beijing 100083 (China); Ge, W. K. [Department of Physics, Tsinghua University, Beijing 100871 (China)

2011-12-23T23:59:59.000Z

118

Analysis of transverse apertures in a circular waveguide  

E-Print Network [OSTI]

, (r, g, z) + H, (r, g, z) = h(r, g)en&' + h, (r, P)ei"*' where E, and H, are the transverse field components and E, and H, are the axial field components of the waveguide fields. By substitution of the previous decompositions into Maxwell's equauons... equation Vzhz + gihz =0 h, is equal to the scalar function V given in equation (10. b). Therefore, the axial magnetic field can be written as hx = ttr = J?(k, r) ( sin(nP) or cos(ntIt) ) e-i? (17) 15 For the circular waveguide cross section shown...

Eastham, Gary Bryan

2012-06-07T23:59:59.000Z

119

Vibration of circular plates, of several thicknesses, with three supports  

E-Print Network [OSTI]

~ ~ ~ ~ ~ ~ e ~ o ~ ~ i Prccedure and DeeoriPt'alen Of APPSXat'aua ~ ~ e ~ a ~ 0 ~ ~ i EmPirioal Ccrrelabicn Of Dataa ~ ~ ~ 1 ~ ~ ~ 01 ~ ~ ~ ~ ~ ~ ~ ~ i Kathemat, ical Theory of Thin Plates ~ a ~ ~ ~ ~ ~ 1 ~ a ~ ~ ~ Heeultaa ~ ~ ~ ~ ~ a... (cps) e M = symmetric mode, ie. 1, 2, 3, and 4. h= thickness of circular plate, in, Vhen there are mox'e than-thoro variables involved in the x esult, s of an experimental research, an empirical xelat, ionsh1p concerning the several variables may...

Ballentine, John Richard

2012-06-07T23:59:59.000Z

120

Wave induced forces on a partially exposed circular cylinder  

E-Print Network [OSTI]

to determine the wave forces on a pipeline rest. ing on the bottom partia'lly embeded in surrounding sediments was conducted. The forces were measured by strain gauge load cells and recorded on an electronic strip chart recorder. The resulting forces were... Associated with the Potential Function of Stokes' 3rd Order Wave Theory Fluid Density Circular Have Frequency (ML a) O'-. 'APTER I IN RJCUCTION Since the Tate nineteenth century, men have been constructing various types of pipelines in t"e ocean...

Parker, Michael Edward

2012-06-07T23:59:59.000Z

Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

Cylindrical Circular and Elliptical, Toroidal Circular and Elliptical Multipoles Fields, Potentials and their Measurement for Accelerator Magnets  

E-Print Network [OSTI]

Recent progress in particle accelerator tracking has shown that the field representation is one of the major limits of the prediction accuracy especially for machines, whose aperture is fully filled by the beam and thus higher the artefacts created by higher order modes have to be thoroughly understood. The standard tool for field presentation today are cylindrical circular multipoles due to their straight forward correspondence to the Cartesian coordinates. In this paper we extend the standard approach to other coordinate systems, show how these can be measured next to their realisation in measuring the SIS100 Magnets for the FAIR project.

Schnizer, Pierre; Schnizer, Bernhard

2014-01-01T23:59:59.000Z

122

NEAR-INFRARED CIRCULAR POLARIZATION IMAGES OF NGC 6334-V  

SciTech Connect (OSTI)

We present results from deep imaging linear and circular polarimetry of the massive star-forming region NGC 6334-V. These observations show high degrees of circular polarization (CP), as much as 22% in the K{sub s} band, in the infrared nebula associated with the outflow. The CP has an asymmetric positive/negative pattern and is very extended ({approx}80'' or 0.65 pc). Both the high CP and its extended size are larger than those seen in the Orion CP region. Three-dimensional Monte Carlo light-scattering models are used to show that the high CP may be produced by scattering from the infrared nebula followed by dichroic extinction by an optically thick foreground cloud containing aligned dust grains. Our results show not only the magnetic field orientation of around young stellar objects, but also the structure of circumstellar matter such as outflow regions and their parent molecular cloud along the line of sight. The detection of the large and extended CP in this source and the Orion nebula may imply the CP origin of the biological homochirality on Earth.

Kwon, Jungmi; Tamura, Motohide; Hashimoto, Jun; Kusakabe, Nobuhiko; Kandori, Ryo [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan); Lucas, Phil W.; Hough, James H. [Centre for Astrophysics Research, University of Hertfordshire, College Lane, Hatfield AL10 9AB (United Kingdom); Nakajima, Yasushi [Center of Information and Communication Technology, Hitotsubashi University, 2-1 Naka, Kunitachi, Tokyo 186-8601 (Japan); Nagayama, Takahiro [Department of Astrophysics, Nagoya University, Nagoya 464-8602 (Japan); Nagata, Tetsuya, E-mail: jungmi.kwon@nao.ac.jp [Department of Astronomy, Kyoto University, Kyoto 606-8502 (Japan)

2013-03-01T23:59:59.000Z

123

Numerical simulation of wind resonance of a circular profile by means of the vortex element method  

Science Journals Connector (OSTI)

The problem regarding the numerical simulation of a circular profile motion in a ... element method is used. The phenomenon of wind resonance has been examined. The investigation has...

I. K. Marchevskii; O. I. Ivanov

2009-10-01T23:59:59.000Z

124

An experimental study on heat transfer from a horizontal heated circular cylinder enhanced by water spray.  

E-Print Network [OSTI]

??A series of experiments were conducted to investigate the heat transfer which occurs with a heated, constant heat flux, horizontal, single circular cylinder is exposed… (more)

Chau, Man Hei

2009-01-01T23:59:59.000Z

125

Circular diffuse scattering of akermanite studied by the optical diffraction method  

Science Journals Connector (OSTI)

Circular diffuse scattering appears when the incommensurate phase of akermanite transforms partly to either the normal phase ... constant phase difference within each layer of the akermanite structure.

K. Iishi; K. Hagiya; M. Ohmasa

1994-05-01T23:59:59.000Z

126

kxo8171.tmp  

Broader source: Energy.gov (indexed) [DOE]

00.33 (Encl 7) 00.33 (Encl 7) Sep 9, 85 Part W -. . COST COMPARISON HANDBOOK . q .- > Supplement OMB Circular No. A-76 Performance of Commercial Activities - - . . . . . 7-2 4100.33 (Encl 7) Sep 9, 85 . Chapter A. B. c. Chapter . G. . H. I. Chapter A." B. c. D. E. F. G. TABLE OF CONTENTS - PART IV - COST COMPARISON HANDBOOK . 1- General . . . . . . . . . . . . . . . . . . . . q . . . . . . . . . . ..0...0.. . ...00. Purpose . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Organization of the Handbook . . . . ...0.". . . . . . . . . . . . . . . . . . . . . Overview of the PrOCess . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2- Developing the Cost of Introduction . . . . . . . . . . . . . . . . . . . . . . . Relationship to the Budget . . . . . . . . . .

127

Detailed structure of spinning detonation in a circular tube  

SciTech Connect (OSTI)

A single spinning detonation wave propagating in a circular tube, discovered experimentally in 1926, is simulated three-dimensionally with a detailed chemical reaction mechanism. The detonation front obtained numerically rotates periodically with a Mach leg, whiskers, and a transverse detonation. A long pressure trail, which is distributed from the transverse detonation to downstream, was reproduced, clearly showing that the pressure trail also spins synchronously with the transverse detonation. The formation of an unburned gas pocket behind the detonation front was not observed in the present simulations because the rotating transverse detonation completely consumed the unburned gas. The calculated profiles of instantaneous OH mass fraction have a keystone shape behind the detonation front. The numerical results for pitch, track angle, Mach stem angle, and incident shock angle on the tube wall agree well with the experimental results. (author)

Tsuboi, N. [Space Transportation Engineering Department, Institute of Space and Astronautical Science, Japan Aerospace Exploration Agency, Yoshinodai 3-1-1, Sagamihara, Kanagawa 229-8510 (Japan); Eto, K.; Hayashi, A.K. [Department of Mechanical Engineering, Aoyama Gakuin University, Fuchinobe 5-10-1, Sagamihara, Kanagawa 229-8558 (Japan)

2007-04-15T23:59:59.000Z

128

Large-amplitude circularly polarized electromagnetic waves in magnetized plasma  

SciTech Connect (OSTI)

We consider large-amplitude circularly polarized (LACP) waves propagating in a magnetized plasma. It is well-known that the dispersion relation for such waves coincides with the dispersion relation given by the linear theory. We develop the model of LACP wave containing a finite population of Cerenkov resonant particles. We find that the current of resonant particles modifies the linear dispersion relation. Dispersion curves of low-frequency (i.e., whistler and magnetosonic) waves are shifted toward larger values of the wave vector, i.e., waves with arbitrarily large wavelengths do not exist in this case. Dispersion curves of high-frequency waves are modified so that the wave phase velocity becomes smaller than the speed of light.

Vasko, I. Y., E-mail: vaskoiy@gmail.com; Artemyev, A. V.; Zelenyi, L. M. [Space Research Institute, RAS, Moscow (Russian Federation)] [Space Research Institute, RAS, Moscow (Russian Federation)

2014-05-15T23:59:59.000Z

129

Federal Acquisition Regulations Federal Acquisition Circular 2005-51 Summary  

Broader source: Energy.gov (indexed) [DOE]

Regulations Regulations Federal Acquisition Circular 2005-51 Summary Federal Register April 1, 2011 76FR 18304 I Women-Owned Small Business (WOSB) Program (Interim Rule). II Clarification of Standard Form 26--Award/Contract. Item I--Women-Owned Small Business (WOSB) Program (FAR Case 2010-015) (Interim) This interim rule amends the FAR to add subpart 19.15, Women-Owned Small Business Program, which will assist Federal agencies in achieving the 5 percent statutory goal for contracting with women-owned small business (WOSB) concerns. Agencies may restrict competition to economically disadvantaged women-owned small business (EDWOSB) concerns for contracts assigned a North American Industry Classification Systems (NAICS) code in an industry in which the Small Business Administration has

130

On the Radiation of Sound from an Unflanged Circular Pipe  

Science Journals Connector (OSTI)

A rigorous and explicit solution is obtained for the problem of sound radiation from an unflanged circular pipe, assuming axially symmetric excitation. The solution is valid throughout the wave-length range of dominant mode (plane wave) propagation in the pipe. The reflection coefficient for the velocity potential within the pipe and the power-gain function, embodying the characteristics of the radiation pattern, are evaluated numerically. The absorption cross section of the pipe for a plane wave incident from external space, and the gain function for this direction, are found to satisfy a reciprocity relation. In particular, the absorption cross section for normal incidence is just the area of the mouth. At low frequencies of vibration, the velocity potential within the pipe is the same as if the pipe were lengthened by a certain fraction of the radius and the open end behaved as a loop. The exact value of the end correction turns out to be 0.6133.

Harold Levine and Julian Schwinger

1948-02-15T23:59:59.000Z

131

Protein Characterisation by Synchrotron Radiation Circular Dichroism (SRCD) Spectroscopy  

SciTech Connect (OSTI)

Circular dichroism (CD) spectroscopy is a well-established technique for the study of proteins. Synchrotron radiation circular dichroism (SRCD) spectroscopy extends the utility of conventional CD spectroscopy (i.e. using laboratory-based instruments) because the high light flux from a synchrotron enables collection of data to lower wavelengths, detection of spectra with higher signal-to-noise levels and measurements in the presence of strongly absorbing non-chiral components such as salts, buffers, lipids and detergents. This review describes developments in instrumentation, methodologies and bioinformatics that have enabled new applications of the SRCD technique for the study of proteins. It includes examples of the use of SRCD spectroscopy for providing static and dynamic structural information on molecules, including determinations of secondary structures of intact proteins and domains, assessment of protein stability, detection of conformational changes associated with ligand and drug binding, monitoring of environmental effects, examination of the processes of protein folding and membrane insertion, comparisons of mutant and modified proteins, identification of intermolecular interactions and complex formation, determination of the dispositions of proteins in membranes, identification of natively disordered proteins and their binding partners and examination of the carbohydrate components of glycoproteins. It also discusses how SRCD can be used in conjunction with macromolecular crystallography and other biophysical techniques to provide a more complete picture of protein structures and functions, including how proteins interact with other macromolecules and ligands. This review also includes a discussion of potential new applications in structural and functional genomics using SRCD spectroscopy and future instrumentation and bioinformatics developments that will enable such studies. Finally, the appendix describes a number of computational/bioinformatics resources for secondary structure analyses that take advantage of the improved data quality available from SRCD. In summary, this review discusses how SRCD can be used for a wide range of structural and functional studies of proteins.

Wallace, B.

2009-01-01T23:59:59.000Z

132

The writhing of circular cross–section rods: undersea cables to DNA supercoils  

Science Journals Connector (OSTI)

...circular cross-section rods: undersea cables to DNA supercoils D. M. Stump 1 W...tension and torque, such as undersea cables, and to closed loops with inserted twist...circular cross-section rods: undersea cables to DNA supercoils By D. M. Stump1...

1998-01-01T23:59:59.000Z

133

O:\A76\FAIR\Fair Act 2008\Guidance\PDF\ATTACHMENT 4.pdf.prn.pdf  

Broader source: Energy.gov (indexed) [DOE]

1 1 ORGANIZATIONS RESPONSIBLE FOR INVENTORY AND VERIFICATION OF ACCURACY SUBMISSION Organizations Reporting Directly to the Deputy Secretary All Organizations Listed Submit an IGCA Inventory and Provide Verifications of Inventory Accuracy Chief Financial Officer Chief Information Officer Congressional and Intergovernmental Affairs Economic Impact and Diversity Energy Information Administration General Counsel Health, Safety and Security Hearings and Appeals Human Capital Management Inspector Gene ral Intelligence and Counterintelligence Management Policy and International Affairs Public Affairs Bonneville Power Administration Southeastern Power Administration Southwestern Power Administration Western Area Power Administration All Organizations listed are to prepare and submit an inventory to the Office of Competitive Sourcing/A-76

134

X-ray magnetic circular dichroism in (Ge,Mn) compounds: experiments and modeling Samuel Tardif,1, 2,  

E-Print Network [OSTI]

X-ray magnetic circular dichroism in (Ge,Mn) compounds: experiments and modeling Samuel Tardif,1, 2: July 29, 2013) X-ray absorption (XAS) and x-ray magnetic circular dichroism (XMCD) spectra at the L2),6 and x-ray spectroscopy (x-ray absorption spec- troscopy, XAS, and x-ray magnetic circular

135

Circular Higgs Factories & Possible Long-Term Strategy  

E-Print Network [OSTI]

In 2012 two LHC experiments have discovered a new particle with a mass around 125 GeV, which appears to be the scalar Higgs boson of the Standard Model. To further examine this remarkable particle it could be produced in large numbers for precision studies by an e+e? collider operating near the ZH threshold at beam energies of 120 GeV, or, in the s-channel by a gamma-gamma collider with primary electron beam energies of 80 GeV, or by a high-energy electron-proton collider. In this talk I will discuss tentative design parameters, novel concepts and accelerator-physics challenges (1) for a high-luminosity lepton-hadron collider, bringing into collision a 60-GeV electron beam from an energy-recovery electron linac with one of the LHC hadron beams – LHeC –, (2) for a gamma-gamma Higgs-factory collider based on the reconfigured recirculating SC electron linac – SAPPHiRE – and (3) for a circular e+e? Higgs-factory collider in a new tunnel with a circumference of 80-100 km – TLEP. I will also discuss f...

Zimmermann, F

2013-01-01T23:59:59.000Z

136

Simulation on Buildup of Electron Cloud in Proton Circular Accelerator  

E-Print Network [OSTI]

Electron cloud interaction with high energy positive beam are believed responsible for various undesirable effects such as vacuum degradation, collective beam instability and even beam loss in high power proton circular accelerator. An important uncertainty in predicting electron cloud instability lies in the detail processes on the generation and accumulation of the electron cloud. The simulation on the build-up of electron cloud is necessary to further studies on beam instability caused by electron cloud. China Spallation Neutron Source (CSNS) is the largest scientific project in building, whose accelerator complex includes two main parts: an H- linac and a rapid cycling synchrotron (RCS). The RCS accumulates the 80Mev proton beam and accelerates it to 1.6GeV with a repetition rate 25Hz. During the beam injection with lower energy, the emerging electron cloud may cause a serious instability and beam loss on the vacuum pipe. A simulation code has been developed to simulate the build-up, distribution and dens...

Liu, Yu-Dong

2014-01-01T23:59:59.000Z

137

E-Print Network 3.0 - adiabatic circular cylinder Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

1983;105:161-7. 2 Balabani S, Yianneskis M... on the flow past a circular cylinder at a subcritical ... Source: Luo, Xiaoyu - Department of Mathematics, University of Glasgow...

138

Induced chirality in fisetin upon binding to serum albumin: experimental circular dichroism and TDDFT calculations  

Science Journals Connector (OSTI)

Theoretical absorption and electronic circular dichroism (ECD) spectra predicted via time-dependent density functional theory (TDDFT) calculations on the neutral and four anionic species of fisetin, an achiral fl...

Iulia Matei; Sorana Ionescu; Mihaela Hillebrand

2012-09-01T23:59:59.000Z

139

Circular Dichroism Techniques for the Analysis of Intrinsically Disordered Proteins and Domains  

Science Journals Connector (OSTI)

Circular dichroism (CD) spectroscopy is a simple and powerful technique, which allows for the assessment of the conformational properties of a protein or protein domain. Intrinsically disordered proteins (IDPs), ...

Lucía B. Chemes; Leonardo G. Alonso…

2012-01-01T23:59:59.000Z

140

An Analysis of Depolarization of Circular Polarization in S-Band Radar Sensing of Alberta Storms  

Science Journals Connector (OSTI)

An analysis is given of storm events in 1982–85 in which the Alberta Research Council circularly polarized polarization diversity S-band radar recorded data indicating significant depolarization. The accompanying two-way differential propagation ...

Anthony R. Holt

2001-09-01T23:59:59.000Z

Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

Experimental investigation of an oscillating circular piston positive displacement flowmeter: I - Piston movement and pressure losses.  

E-Print Network [OSTI]

Tests of an oscillating circular piston positive displacement flowmeter are described which focused on the effect on pressure drop across the meter of variation in key parameters. These included flow rate, liquid density and viscosity, mass...

Morton, Charlotte E; Hutchings, Ian M; Baker, Roger C

142

Experimental investigation of an oscillating circular piston positive displacement flowmeter: II - Leakage flows and wear tests.  

E-Print Network [OSTI]

Experimental data from an oscillating circular piston positive displacement flowmeter are described which focused on leakage flows and wear. This is the second part of a two part paper on the experimental tests, the first part concerned piston...

Morton, Charlotte E; Baker, Roger C; Hutchings, Ian M

143

Travels of a floating space tool. A spacecraft is in a circular orbit ...  

E-Print Network [OSTI]

Travels of a floating space tool. A spacecraft is in a circular orbit 6750 km from the Earth's center of mass (i.e, it is about 250 miles above the surface).

2008-01-22T23:59:59.000Z

144

Microsoft Word - GRS Review_OMB White Paper - Real Property Right-sizing and Carbon Reduction August 7 2009 _2_.docx  

Broader source: Energy.gov (indexed) [DOE]

Document - Submitted to OMB Document - Submitted to OMB August 7th, 2009 1 Whitepaper on Real Property Right-Sizing and Carbon Footprint Reduction Purpose: 1. The team (identified at the end of this document) was tasked by the Federal Real Property Council (FRPC) with identifying action-oriented goals, specific to the disposal of unneeded real property assets which will ultimately yield improved efficiency of operations. The goals related to the disposal of real property are part of a set of strategic goals to focus FRPC efforts under the new Administration and must be meaningful to the taxpayer. The objective of this tasking included: Establish a long-term, high impact "stretch" goal with enabling activities that lead to significant improvement to real property management.

145

Use of Crystals for High Energy Photon Beam Linear Polarization Conversion into Circular  

E-Print Network [OSTI]

The possibility to convert the photon beam linear polarization into circular one at photon energies of hundreds GeV with the use of crystals is considered. The energy and orientation dependencies of refractive indexes are investigated in case of diamond, silicon and germanium crystal targets. To maximize the values for figure of merit, the corresponding crystal optimal orientation angles and thickness are found. The degree of circular polarization and intensity of photon beam are estimated and possibility of experimental realization is discussed.

N. Z. Akopov; A. B. Apyan; S. M. Darbinyan

2000-02-15T23:59:59.000Z

146

Radio Frequency Station - Beam Dynamics Interaction in Circular Accelerators  

SciTech Connect (OSTI)

The longitudinal beam dynamics in circular accelerators is mainly defined by the interaction of the beam current with the accelerating Radio Frequency (RF) stations. For stable operation, Low Level RF (LLRF) feedback systems are employed to reduce coherent instabilities and regulate the accelerating voltage. The LLRF system design has implications for the dynamics and stability of the closed-loop RF systems as well as for the particle beam, and is very sensitive to the operating range of accelerator currents and energies. Stability of the RF loop and the beam are necessary conditions for reliable machine operation. This dissertation describes theoretical formalisms and models that determine the longitudinal beam dynamics based on the LLRF implementation, time domain simulations that capture the dynamic behavior of the RF station-beam interaction, and measurements from the Positron-Electron Project (PEP-II) and the Large Hadron Collider (LHC) that validate the models and simulations. These models and simulations are structured to capture the technical characteristics of the system (noise contributions, non-linear elements, and more). As such, they provide useful results and insight for the development and design of future LLRF feedback systems. They also provide the opportunity to study diverse longitudinal beam dynamics effects such as coupled-bunch impedance driven instabilities and single bunch longitudinal emittance growth. Coupled-bunch instabilities and RF station power were the performance limiting effects for PEP-II. The sensitivity of the instabilities to individual LLRF parameters, the effectiveness of alternative operational algorithms, and the possible tradeoffs between RF loop and beam stability were studied. New algorithms were implemented, with significant performance improvement leading to a world record current during the last PEP-II run of 3212 mA for the Low Energy Ring. Longitudinal beam emittance growth due to RF noise is a major concern for LHC. Simulations studies and measurements were conducted that clearly show the correlation between RF noise and longitudinal bunch emittance, identify the major LLRF noise contributions, and determine the RF component dominating this effect. With these results, LHC upgrades and alternative algorithms are evaluated to reduce longitudinal emittance growth during operations. The applications of this work are described with regard to future machines and analysis of new technical implementations, as well as to possible future work which would continue the directions of this dissertation.

Mastoridis, Themistoklis; /Stanford U., Elect. Eng. Dept. /SLAC

2011-03-01T23:59:59.000Z

147

Microsoft Word - SGIG FAQ Misc 01 29 2010.doc  

Broader source: Energy.gov (indexed) [DOE]

Frequently Asked Questions Frequently Asked Questions Grant and Award-Related Frequently Asked Questions Costs and Reimbursement Question: How long after a reimbursement request is submitted should an awardee expect payment? Answer: DOE will make payment within thirty (30) days after receipt of an acceptable invoice. Question: Can DOE confirm that Recipient will bill DOE, and DOE will reimburse Recipient for, 50% of qualified direct project expenses disbursed during the billing period as the federal share along with the proportionate share of fringe benefits? Answer: The Recipient will be reimbursed for all direct and indirect costs pursuant to the applicable OMB Cost Circular. See OMB Cost Circular A-21, Cost Principles for Educational Institutions (05/10/2004) HTML or PDF (109 pages, 263 kb), Relocated to 2 CFR, Part 220 (30 pages, 384 kb); OMB Circular OMB Circular OMB Circular OMB Circular

148

O:\A76\FAIR\Fair Act 2008\Guidance\PDF\GUIDE TO INVENTORY SUBMISSION ATTCH 2.pdf.prn.pdf  

Broader source: Energy.gov (indexed) [DOE]

2 2 DEPARTMENT OF ENERGY / OFFICE OF MANAGEMENT 2008 IGCA INVENTORY GUIDE TO INVENTORY SUBMISSION This document presents the instructions for submission of the 2008 Department of Energy (DOE) Inherently Governmental and Commercial Activities (IGCA) Inventory. This inventory will be used to respond to various reporting requirements including, but not limited to, the Federal Activities Inventory Reform Act of 1998, Public Law 105-270 (FAIR Act) and the inventory of inherently governmental activities required by the Office of Management and Budget (OMB). It is important to note that for the 2008 IGCA Inventory, the Under Secretary for National Nuclear Security is requiring the National Nuclear Security Administration (NNSA) office at headquarters to obtain, review and submit for inclusion in the Department's complete IGCA

149

Laser photons acquire circular polarization by interacting with a Dirac or Majorana neutrino beam  

E-Print Network [OSTI]

It is shown that for the reason of neutrinos being left-handed and their gauge-couplings being parity-violated, linearly polarized photons acquire their circular polarization by interacting with neutrinos. Calculating the ratio of linear and circular polarizations of laser photons interacting with either Dirac or Majorana neutrino beam, we obtain this ratio for the Dirac neutrino case, which is about twice less than the ratio for the Majorana neutrino case. Based on this ratio, we discuss the possibility of using advanced laser facilities and the T2K neutrino experiment to measure the circular polarization of laser beams interacting with neutrino beams in ground laboratories. This could be an additional and useful way to gain some insight into the physics of neutrinos, for instance their Dirac or Majorana nature.

Rohoollah Mohammadi; She-Sheng Xue

2014-03-14T23:59:59.000Z

150

Data:4a68a76f-8946-418f-aae1-d6f2eba7c592 | Open Energy Information  

Open Energy Info (EERE)

a76f-8946-418f-aae1-d6f2eba7c592 a76f-8946-418f-aae1-d6f2eba7c592 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of College Station, Texas (Utility Company) Effective date: 2009/07/23 End date if known: Rate name: Security Lights- 100W Sector: Lighting Description: Applicable to all security lights installed and maintained by the City for customers at their request. The customer will be required to contract for security light service for a minimum period of three (3) years. Service will be furnished under this rate schedule subject to the established rules and regulations of the City covering this type of service.

151

Data:28c567a3-08e4-4fb3-806b-c40003a76e0c | Open Energy Information  

Open Energy Info (EERE)

-08e4-4fb3-806b-c40003a76e0c -08e4-4fb3-806b-c40003a76e0c No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Benton County Effective date: 2013/05/01 End date if known: Rate name: GSB Sector: Industrial Description: Source or reference: ISU Documentation Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous 1 2 3 Next >> << Previous 1 2 3 Next >> Seasonal/Monthly Demand Charge Structures

152

Data:76811635-00e2-4422-a76b-7a90a1e1897f | Open Energy Information  

Open Energy Info (EERE)

5-00e2-4422-a76b-7a90a1e1897f 5-00e2-4422-a76b-7a90a1e1897f No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Brownfield, Texas (Utility Company) Effective date: End date if known: Rate name: Residential - Senior Citizen Sector: Residential Description: Source or reference: http://www.ci.brownfield.tx.us/utilityresidential.htm Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous 1 2 3 Next >>

153

Data:700ef927-1349-47fa-9a76-65ec43c5406c | Open Energy Information  

Open Energy Info (EERE)

ef927-1349-47fa-9a76-65ec43c5406c ef927-1349-47fa-9a76-65ec43c5406c No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Columbus Southern Power Co Effective date: 2012/03/09 End date if known: Rate name: General Service - Low Load Factor(secondary voltage) Sector: Industrial Description: Available for general service to customers with maximum demands greater than or equal to 10 KW. Maximum Energy Charge(¢ per KWH):4.62172 Tiered demand charge Source or reference: https://www.aepohio.com/global/utilities/lib/docs/ratesandtariffs/Ohio/2012-04-05_CSP_OP_StandardTariff.pdf Source Parent: Comments

154

Data:Ea3bd1ef-3ad1-4287-8fe0-b6fbdd245a76 | Open Energy Information  

Open Energy Info (EERE)

bd1ef-3ad1-4287-8fe0-b6fbdd245a76 bd1ef-3ad1-4287-8fe0-b6fbdd245a76 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Chicopee, Massachusetts (Utility Company) Effective date: 2013/01/01 End date if known: Rate name: Large General Service - Off Peak Heating & Water Heating Service Sector: Commercial Description: Applicable: To any commercial customer having a water heater of a type approved by the Plant for off peak storage water heating and during the hours specified by the Plant. Where the customer also has all-electric heating, this rate schedule applies to the entire electric consumption of such customer during the specified off peak hours.

155

Data:Bc5978a3-128f-47ea-af8f-4fd11673a76d | Open Energy Information  

Open Energy Info (EERE)

a3-128f-47ea-af8f-4fd11673a76d a3-128f-47ea-af8f-4fd11673a76d No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Village of Leigh, Nebraska (Utility Company) Effective date: 2013/01/15 End date if known: Rate name: District Owned Lighting EWN27500 Sector: Commercial Description: Source or reference: http://www.loup.com/docs/customersvc/LLS-Rates2013.pdf Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous

156

Data:02addec0-0ff8-42ee-937f-a76c99825250 | Open Energy Information  

Open Energy Info (EERE)

addec0-0ff8-42ee-937f-a76c99825250 addec0-0ff8-42ee-937f-a76c99825250 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Monroe County Elec Coop, Inc Effective date: 2013/04/01 End date if known: Rate name: Security Lights(Unmetered 250 W Flood Lights- Koerber Dist) Sector: Commercial Description: Unmetered automatic Mercury Vapor Lighting and High Pressure Lighting, shall be available to consumers of the cooperative at the following rates and conditions. Source or reference: http://www.mcec.org/Documents/2013%20Rates.pdf Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW):

157

Data:463fb42e-9825-4e6a-befa-0a76dff581ea | Open Energy Information  

Open Energy Info (EERE)

2e-9825-4e6a-befa-0a76dff581ea 2e-9825-4e6a-befa-0a76dff581ea No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Piedmont Electric Member Corp Effective date: 2012/05/01 End date if known: Rate name: RESIDENTIAL SERVICE - ENERGY STAR All- Electric Single Phase(RS-ES-3) Sector: Residential Description: Applicability: Service under this Schedule is applicable to all residential consumers whose residence is in compliance with the Energy Star standards. REPS CHARGE: Residential $ 0.35 INCLUDED IN FIXED MONTHLY CHARGE This rate is also subject to Wholesale Power Cost Adjustments, the Energy Efficiency Rider, as well as any applicable sales taxes imposed by any governmental authority.

158

Data:813c36ef-dfa3-4a0a-a76a-bf31f61d7828 | Open Energy Information  

Open Energy Info (EERE)

6ef-dfa3-4a0a-a76a-bf31f61d7828 6ef-dfa3-4a0a-a76a-bf31f61d7828 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Clarksville Light & Water Co Effective date: 2013/04/01 End date if known: Rate name: Residential (R1) Sector: Residential Description: Applicable for residential service to single residences or individual family apartments supplied through one meter. Services will normally be single phase 60 cycle at approximately 120/240 Volts. Source or reference: Rate Binder#4 (Illinois State University) Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months):

159

Data:E5ed8ad6-2caf-4a76-aa1f-394e4cc4ccf2 | Open Energy Information  

Open Energy Info (EERE)

ad6-2caf-4a76-aa1f-394e4cc4ccf2 ad6-2caf-4a76-aa1f-394e4cc4ccf2 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Southeast Colorado Power Assn Effective date: 2012/01/01 End date if known: Rate name: Irrigation & Water Pumping - Demand Sector: Commercial Description: Source or reference: http://secpa.com/sites/rate-schedules.html Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous 1 2 3 Next >>

160

Data:1bbd8a76-23b0-4c7b-8aa1-7591808ba570 | Open Energy Information  

Open Energy Info (EERE)

bbd8a76-23b0-4c7b-8aa1-7591808ba570 bbd8a76-23b0-4c7b-8aa1-7591808ba570 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Greenfield, Indiana (Utility Company) Effective date: End date if known: Rate name: GENERAL SERVICE (GS), Single-Phase Sector: Commercial Description: If the electric utility places its meters at the primary voltage level, the consumer's demand (kW) and energy (kWh) measurements shall be reduced by 2% for the purposes of this schedule. Source or reference: http://www.greenfieldin.org/utility-billing Source Parent: http://www.greenfieldin.org/utilities/utility-billing-department

Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

Data:3162f424-eab7-4e46-a76c-d5366edf5108 | Open Energy Information  

Open Energy Info (EERE)

4-eab7-4e46-a76c-d5366edf5108 4-eab7-4e46-a76c-d5366edf5108 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Duncan, Oklahoma (Utility Company) Effective date: End date if known: Rate name: Security Lighting- (1000W SV Directional Flood Lighting on existing 50 ft. wood Pole- Overheard Wiring) Sector: Lighting Description: This rate schedule is available on an annual basis to any customer for illumination of outdoor areas. Source or reference: ISU Documentation Rate Binder Ted #9 Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh)

162

Data:12769b05-d863-401d-b10a-76ff4fdd86d4 | Open Energy Information  

Open Energy Info (EERE)

5-d863-401d-b10a-76ff4fdd86d4 5-d863-401d-b10a-76ff4fdd86d4 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Blaine, Washington (Utility Company) Effective date: End date if known: Rate name: Submetered Electrical Rates - Small Commercial Sector: Commercial Description: Source or reference: http://www.cityofblaine.com/DocumentCenter/Home/View/2461 Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring:

163

Data:A3864f3e-0586-49a3-a0e9-f8a76a559035 | Open Energy Information  

Open Energy Info (EERE)

64f3e-0586-49a3-a0e9-f8a76a559035 64f3e-0586-49a3-a0e9-f8a76a559035 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Nebraska Public Power District Effective date: 2013/01/01 End date if known: Rate name: 100 W High Pressure Sodium- Nonwood Sector: Lighting Description: To all night street lighting service (dusk to daylight) from the overhead systems conforming to the District's standard specifications. Nonwood; Open Refractor Electricity is provided through the Village, which obtains electric power from Nebraska Public Power District (NPPD) Source or reference: http://www.nppd.com/assets/municipalstreetlightingservice.pdf

164

Data:Aa2db634-f9cc-47aa-ba8a-76cafdc19fc0 | Open Energy Information  

Open Energy Info (EERE)

34-f9cc-47aa-ba8a-76cafdc19fc0 34-f9cc-47aa-ba8a-76cafdc19fc0 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Painesville, Ohio (Utility Company) Effective date: 1990/07/01 End date if known: Rate name: Roadway Lighting-High Pressure Sodium-250 watts-Within Corporate Limits Sector: Lighting Description: For the purpose of paying the expenses of conducting and managing the Electric Division, Utilities Department of the City, the City Manager is hereby authorized and directed to charge the following rates for furnishing electric current for outdoor lights, which rates are hereby adopted, for all utility bills issued on and after July 1, 1990

165

Scour around a group of circular piles caused by waves and currents  

E-Print Network [OSTI]

SCOUR AROUND A GROUP OF CIRCULAR PILES CAUSED BY WAVES AND CURRENTS A Thesis by TA-YANG LEE Submitted to the graduate College of Texas A&M University in partial fulfillment of the requirements for the degree of MASTER OF SCIENCE May 1983... Major Subject: Ocean Engineering SCOUR AROUND A GROUP OF CIRCULAR PILES CAUSED BY WAVES AND CURRENTS A Thesis by TA-YANG LEE Approved as to style and content by: John B. Herbich (Chairman of Committee) Robert O. Reid (Member) Gi lio V...

Lee, Ta-Yang

2012-06-07T23:59:59.000Z

166

Optical Rotatory and Circular Dichroic Scattering Werner Kaminsky,* Morten Andreas Geday, Javier Herreros-Cedres, and Bart Kahr*  

E-Print Network [OSTI]

Optical Rotatory and Circular Dichroic Scattering Werner Kaminsky,* Morten Andreas Geday, Javier, Washington 98195-1700 ReceiVed: June 23, 2002; In Final Form: NoVember 5, 2002 Optical effects are observed in regularly dyed crystals that serve to mimic optical rotation and circular dichroism by rotating the azimuth

Kaminsky, Werner

167

Electron acceleration by a circularly polarized laser pulse in a plasma K. P. Singha)  

E-Print Network [OSTI]

Electron acceleration by a circularly polarized laser pulse in a plasma K. P. Singha) Department of electrons in an axial static field are presented. The electron rotates around the propagation direction occurs between the electrons and electric field of the laser pulse for two optimum values of the magnetic

Roy, Subrata

168

REFERENCES AND NOTES 1. A. Hale and T. Bopp, IAU Circular 6187 (1995).  

E-Print Network [OSTI]

to an H2O-driven coma occurred at about 3 AU. The gas outflow velocity and temperature increased as HaleREFERENCES AND NOTES ___________________________ 1. A. Hale and T. Bopp, IAU Circular 6187 (1995 3 March 1997 Evolution of the Outgassing of Comet Hale-Bopp (C/1995 O1) from Radio Observations

Demoulin, Pascal

169

GLOBAL EXISTENCE FOR A TRANSLATING NEAR-CIRCULAR HELE-SHAW BUBBLE WITH SURFACE TENSION  

E-Print Network [OSTI]

GLOBAL EXISTENCE FOR A TRANSLATING NEAR-CIRCULAR HELE-SHAW BUBBLE WITH SURFACE TENSION J. YE1 AND S for any nonzero surface tension despite the fact that a local planar approximation near the front problem, Dissipative equations, Hele-Shaw prob- lem, Translating bubbles, Surface tension Mathematics

Tanveer, Saleh

170

Pitch angle scattering of an energetic magnetized particle by a circularly polarized electromagnetic wave  

E-Print Network [OSTI]

Pitch angle scattering of an energetic magnetized particle by a circularly polarized://pop.aip.org/features/most_downloaded Information for Authors: http://pop.aip.org/authors #12;Pitch angle scattering of an energetic magnetized valley, but for finite mismatch, there can be two valleys separated by a hill. A large pitch angle

Bellan, Paul M.

171

Spatial impulse responses from a flexible baffled circular piston Ronald M. Aartsa)  

E-Print Network [OSTI]

Spatial impulse responses from a flexible baffled circular piston Ronald M. Aartsa) Philips response, Zernike expansion, piston sound radiation, non-uniform profile, loudspeaker, ultrasound 2 #12;I, baffled, planar piston is often done by using the spatial impulse response approach as can be found

172

Design of a Series Fed Circularly Polarized Microstrip Patch Array Lale Alatan  

E-Print Network [OSTI]

Design of a Series Fed Circularly Polarized Microstrip Patch Array Lale Alatan Electrical polarized microstrip patch array operating in S-band (2210 ± 5 MHz) is designed to be used as a sub-array for a ground based antenna receiving signals from a LEO satellite. Slot-coupled square patch antenna is chosen

Alatan, Lale Hayýrlýoðlu

173

Study on the Vibration Displacement Distribution of a Circular Ultrasonic Motor Stator  

E-Print Network [OSTI]

In this paper is presented a theoretical consideration on the stator's displacement distribution, which is one of the most important problems in defining the structure of the circular ultrasonic motor stator. The results are compared with results obtained utilizing holographic interferometer, laser vibrometer and a FEM (finite element method) simulation. They are in a good agreement with each other.

Ri, Chol-Su; Kim, Chol-Su; Im, Song-Jin

2014-01-01T23:59:59.000Z

174

SOLVING BY PARALLEL COMPUTATION THE POISSON PROBLEM FOR HIGH INTENSITY BEAMS IN CIRCULAR ACCELERATORS.  

SciTech Connect (OSTI)

Simulation of high intensity accelerators leads to the solution of the Poisson Equation, to calculate space charge forces in the presence of acceleration chamber walls. We reduced the problem to ''two-and-a-half'' dimensions for long particle bunches, characteristic of large circular accelerators, and applied the results to the tracking code Orbit.

LUCCIO,A.U.; DIMPERIO,N.L.; SAMULYAK,R.; BEEB-WANG,J.

2001-06-18T23:59:59.000Z

175

Condensation heat transfer in square, triangular, and semi-circular mini-channels Melanie Derby a  

E-Print Network [OSTI]

Condensation heat transfer in square, triangular, and semi-circular mini-channels Melanie Derby: Condensation Heat transfer Minichannel Channel shape Correlation a b s t r a c t Condensation heat transfer significant effects on the condensation process, even at lower mass fluxes, while saturation pressure, heat

Peles, Yoav

176

Potential Game Theoretic Attitude Coordination on the Circle: Synchronization and Balanced Circular Formation  

E-Print Network [OSTI]

: "synchronization" and "balanced circular for- mation". We first show that both problems constitute potential games Technological innovations produce cheap and low power smart sensors, wireless communication devices and embed to spatially distributed control systems. For example, [6] uses a mobile sensor network for ocean sampling

177

The evolution of circular loops of a cosmic string with periodic tension  

E-Print Network [OSTI]

In this paper the equation of circular loops of cosmic string with periodic tension is investigated in the Minkowski spacetime and Robertson-Walker universe respectively. We find that the cosmic string loops possessing this kind of time-varying tension will evolve to oscillate instead of collapsing to form a black hole if their initial radii are not small enough.

Wang, Leilin

2012-01-01T23:59:59.000Z

178

Numerical Analysis of the Flow Characteristics and Heat and Mass Transfer of Falling-Water Films in an Industrial-Scale Dip Tube of a WSCC in an OMB Gasifier  

Science Journals Connector (OSTI)

A water-scrubbing cooling chamber (WSCC) is applied to an opposed multi-burner (OMB) gasifier(1-3) in which high-temperature syngas (with molten slag) is cooled, washed, and humidified, and the coarse particles are collected. ... On a lab.-scale testing platform of impinging entrained-flow gasifier with two opposed burners, the detailed measurements of gas concn. ...

Yifei Wang; Qiangqiang Guo; Bihua Fu; Jiangliang Xu; Guangsuo Yu; Fuchen Wang

2013-06-12T23:59:59.000Z

179

PRODUCTION OF LARGE VOLUME CYLINDRICAL RF PLASMA USING CIRCULAR MAGNETIC LINE CUSP FIELD  

Science Journals Connector (OSTI)

A large volume cylindrical rf (radio frequency) plasma source using a circular magnetic line cusp field has been developed for various large scale plasma processings. In this type of plasma source, a capacitively coupled 13.56 \\{MHz\\} rf plasma is produced in a circular magnetic line cusp field. Two versions of the plasma source have been constructed and tasted. The first version has a pair of peripheral rf electrodes placed outside the ionization chamber and is suitable for preparing a large volume uniform plasma. This plasma source can attain uniformity within 107 cm?3 over a 30 cm diameter region. The other which is provided with parallel doughnut plate electrodes forming part of the chamber wall serves as a high current plasma source, where the electron density is proportional to the rf power and equal to 7 × 109 cm?3 for 500 W.

K. YAMAUCHI; M. SHIBAGAKI; A. KONO; K. TAKAHASHI; T. SHEBUYA; E. YABE; K. TAKAYAMA

1993-01-01T23:59:59.000Z

180

Global existence for a translating near-circular Hele-Shaw bubble with surface tension  

E-Print Network [OSTI]

This paper is concerned with proving global existence and stability of a translating bubble in a Hele-Shaw cell that is small relative to cell width. When the ratio of cell width to bubble dimension is sufficient large, the equations admit the steady translating near-circular bubble shape. We are concerned with global existence with the initial condition close to this steady shape. When the cell side walls effects are negligible, we show that the translating circular bubble is asymptotically stable for nonzero surface tension. With side walls effects, we obtain similar results for bubble shapes symmetric about the channel centerline. As with our prior work, we exploit a boundary integral approach that allows for a finite nonzero viscosity ratio between fluid inside and outside the bubble.

Ye, J

2009-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

First measurement of the circular beam asymmetry in the gamma p --> pi0 eta p reaction  

E-Print Network [OSTI]

The circular photon asymmetry for pi0 eta photoproduction on the proton was measured for the first time at the tagged photon facility of the MAMI C accelerator using the Crystal Ball/TAPS photon spectrometer. The experimental results are interpreted within a phenomenological isobar model that confirms the dominant role of the Delta(1700)D33 resonance. The measured asymmetry allows us to identify small contributions from positive-parity resonances via interference terms with the dominant D33 amplitude.

V. L. Kashevarov; A. Fix; P. Aguar-Bartolomé; L. K. Akasoy; J. R. M. Annand; H. J. Arends; K. Bantawa; R. Beck; V. Bekrenev; H. Berghäuser; A. Braghieri; D. Branford; W. J. Briscoe; J. Brudvik; S. Cherepnya; R. F. B. Codling; B. T. Demissie; E. J. Downie; P. Drexler; L. V. Fil'kov; D. I. Glazier; R. Gregor; D. Hamilton; E. Heid; D. Hornidge; I. Jaegle; O. Jahn; T. C. Jude; J. D. Kellie; I. Keshelashvili; R. Kondratiev; M. Korolija; M. Kotulla; A. Koulbardis; S. Kruglov; B. Krusche; V. Lisin; K. Livingston; I. J. D. MacGregor; Y. Maghrbi; D. M. Manley; M. Martinez-Fabregate; J. C. McGeorge; E. F. McNicoll; D. Mekterovic; V. Metag; S. Micanovic; D. Middleton; A. Mushkarenkov; B. M. K. Nefkens; A. Nikolaev; R. Novotny; M. Ostrick; P. B. Otte; B. Oussena; P. Pedroni; F. Pheron; A. Polonski; S. N. Prakhov; J. Robinson; G. Rosner; T. Rostomyan; S. Schumann; M. H. Sikora; D. Sober; A. Starostin; I. I. Stakovsky; I. M. Suarez; I. Supek; C. Tarbert; M. Thiel; A. Thomas; M. Unverzagt; D. P. Watts; D. Werthmüller; I. Zamboni; F. Zehr.

2010-09-24T23:59:59.000Z

182

Failure determination for a laminated composite plate with a circular hole  

E-Print Network [OSTI]

be predicted for graphite-epoxy laminated composite systems containing a 3/16-inch circular hole from strain energy intensity determinations. The strain energy release rates (G ) for composite systems and indi- c vidual plies outline the crack propagation... of Unidirectional Graphite/Epoxy Laminate 23 Stiffness and Compliance Matrices for Laminate 24 Roots of Characteristic Equation Maximum Stress Concentrations 46 Maximum Laminate Stress Concentrations Crack Initiation Stress 47 Laminate Strain Energy Release...

Ko, Chi-Ren Clarence

2012-06-07T23:59:59.000Z

183

Static detectors and circular-geodesic detectors on the Schwarzschild black hole  

E-Print Network [OSTI]

We examine the response of an Unruh-DeWitt particle detector coupled to a massless scalar field on the (3+1)-dimensional Schwarzschild spacetime, in the Boulware, Hartle-Hawking and Unruh states, for static detectors and detectors on circular geodesics, by primarily numerical methods. For the static detector, the response in the Hartle-Hawking state exhibits the known thermality at the local Hawking temperature, and the response in the Unruh state is thermal at the local Hawking temperature in the limit of a large detector energy gap. For the circular-geodesic detector, we find evidence of thermality in the limit of a large energy gap for the Hartle-Hawking and Unruh states, at a temperature that exceeds the Doppler-shifted local Hawing temperature. Detailed quantitative comparisons between the three states are given. The response in the Hartle-Hawking state is compared with the response in the Minkowski vacuum and in the Minkowski thermal state for the corresponding Rindler, drifted Rindler, and circularly accelerated trajectories. The analysis takes place within first-order perturbation theory and relies in an essential way on stationarity.

Lee Hodgkinson; Jorma Louko; Adrian C. Ottewill

2014-05-05T23:59:59.000Z

184

Nonlinear coupling of left and right handed circularly polarized dispersive Alfvén wave  

SciTech Connect (OSTI)

The nonlinear phenomena are of prominent interests in understanding the particle acceleration and transportation in the interplanetary space. The ponderomotive nonlinearity causing the filamentation of the parallel propagating circularly polarized dispersive Alfvén wave having a finite frequency may be one of the mechanisms that contribute to the heating of the plasmas. The contribution will be different of the left (L) handed mode, the right (R) handed mode, and the mix mode. The contribution also depends upon the finite frequency of the circularly polarized waves. In the present paper, we have investigated the effect of the nonlinear coupling of the L and R circularly polarized dispersive Alfvén wave on the localized structures formation and the respective power spectra. The dynamical equations are derived in the presence of the ponderomotive nonlinearity of the L and R pumps and then studied semi-analytically as well as numerically. The ponderomotive nonlinearity accounts for the nonlinear coupling between both the modes. In the presence of the adiabatic response of the density fluctuations, the nonlinear dynamical equations satisfy the modified nonlinear Schrödinger equation. The equations thus obtained are solved in solar wind regime to study the coupling effect on localization and the power spectra. The effect of coupling is also studied on Faraday rotation and ellipticity of the wave caused due to the difference in the localization of the left and the right modes with the distance of propagation.

Sharma, R. P., E-mail: rpsharma@ces.iitd.ac.in; Sharma, Swati, E-mail: swati.sharma704@gmail.com; Gaur, Nidhi, E-mail: nidhiphysics@gmail.com [Centre for Energy Studies, Indian Institute of Technology Delhi, New Delhi 110016 (India)

2014-07-15T23:59:59.000Z

185

Synchrotron Radiation Circular Dichroism (SRCD) Spectroscopy - An Enhanced Method for Examining Protein Conformations and Protein Interactions  

SciTech Connect (OSTI)

CD (circular dichroism) spectroscopy is a well-established technique in structural biology. SRCD (synchrotron radiation circular dichroism) spectroscopy extends the utility and applications of conventional CD spectroscopy (using laboratory-based instruments) because the high flux of a synchrotron enables collection of data at lower wavelengths (resulting in higher information content), detection of spectra with higher signal-to-noise levels and measurements in the presence of absorbing components (buffers, salts, lipids and detergents). SRCD spectroscopy can provide important static and dynamic structural information on proteins in solution, including secondary structures of intact proteins and their domains, protein stability, the differences between wild-type and mutant proteins, the identification of natively disordered regions in proteins, and the dynamic processes of protein folding and membrane insertion and the kinetics of enzyme reactions. It has also been used to effectively study protein interactions, including protein-protein complex formation involving either induced-fit or rigid-body mechanisms, and protein-lipid complexes. A new web-based bioinformatics resource, the Protein Circular Dichroism Data Bank (PCDDB), has been created which enables archiving, access and analyses of CD and SRCD spectra and supporting metadata, now making this information publicly available. To summarize, the developing method of SRCD spectroscopy has the potential for playing an important role in new types of studies of protein conformations and their complexes.

B Wallace; R Janes

2011-12-31T23:59:59.000Z

186

Separation of sheet flow on the surface of a circular cylinder  

Science Journals Connector (OSTI)

The shape of a spout of a pot is very important for the liquid to flow smoothly from the pot. This is known as the “teapot effect.” Separation of flow must take place at the tip of the spout. Separation of sheet flow on the surface of a circular cylinder may provide an explanation as to why pot spouts have such a unique shape. As can be easily observed by a simple experiment separation of sheet flow from the surface of a circular cylinder is a very interesting phenomenon beyond intuition. In the nonviscous case the flow released at the top of the surface may proceed completely around the surface and come back to the flow start point without separation. In the present paper effects of gravity and viscosity on sheet flow are theoretically explained and the theory is verified by experiments. The results of the theoretical model proposed in the present study were very similar to the experimental measurements. In the present study the effects of viscosity on sheet flow on a circular cylinder the location of flow separation and other associated responses were investigated.

Hiroshi Isshiki; Bum-Sang Yoon; Deuk-Joon Yum

2009-01-01T23:59:59.000Z

187

An analytic solution for a fault tree with circular logics in which the systems are linearly interrelated  

Science Journals Connector (OSTI)

A circular logic or a logical loop is defined as the infinite circulation of supporting relations due to their mutual dependencies among the systems in the fault tree analysis. While many methods to break the circular logic have been developed and used in the fault tree quantification codes, the general solution for a circular logic is not generally known as yet. This paper presents an analytic solution for circular logics in which the systems are linearly interrelated with each other. To formulate the analytic solution, the relations among systems in the fault tree structure are described by the Boolean equations. The solution is, then, obtained from the successive substitutions of the Boolean equations, which is equivalent to the attaching processes of interrelated system's fault tree to a given fault tree. The solution for three interrelated systems and their independent fault tree structures are given as an example.

Ho-Gon Lim; Seung-Cheol Jang

2007-01-01T23:59:59.000Z

188

Investigation of the effect of a circular patch of vegetation on turbulence generation and sediment deposition using four case studies  

E-Print Network [OSTI]

This study describes the spatial distribution of sediment deposition in the wake of a circular patch of model vegetation and the effect of the patch on turbulence and mean flow. Two difference types pf vegetation were used ...

Ortiz, Alejandra C

2012-01-01T23:59:59.000Z

189

Imaging photoelectron circular dichroism of chiral molecules by femtosecond multiphoton coincidence detection  

SciTech Connect (OSTI)

Here, we provide a detailed account of novel experiments employing electron-ion coincidence imaging to discriminate chiral molecules. The full three-dimensional angular scattering distribution of electrons is measured after photoexcitation with either left or right circular polarized light. The experiment is performed using a simplified photoelectron-photoion coincidence imaging setup employing only a single particle imaging detector. Results are reported applying this technique to enantiomers of the chiral molecule camphor after three-photon ionization by circularly polarized femtosecond laser pulses at 400 nm and 380 nm. The electron-ion coincidence imaging provides the photoelectron spectrum of mass-selected ions that are observed in the time-of-flight mass spectra. The coincident photoelectron spectra of the parent camphor ion and the various fragment ions are the same, so it can be concluded that fragmentation of camphor happens after ionization. We discuss the forward-backward asymmetry in the photoelectron angular distribution which is expressed in Legendre polynomials with moments up to order six. Furthermore, we present a method, similar to one-photon electron circular dichroism, to quantify the strength of the chiral electron asymmetry in a single parameter. The circular dichroism in the photoelectron angular distribution of camphor is measured to be 8% at 400 nm. The electron circular dichroism using femtosecond multiphoton excitation is of opposite sign and about 60% larger than the electron dichroism observed before in near-threshold one-photon ionization with synchrotron excitation. We interpret our multiphoton ionization as being resonant at the two-photon level with the 3s and 3p Rydberg states of camphor. Theoretical calculations are presented that model the photoelectron angular distribution from a prealigned camphor molecule using density functional theory and continuum multiple scattering X alpha photoelectron scattering calculations. Qualitative agreement is observed between the experimental results and the theoretical calculations of the Legendre moments representing the angular distribution for the two enantiomers. The electron-ion coincidence technique using multiphoton ionization opens new directions in table-top analytical mass-spectrometric applications of mixtures of chiral molecules.

Lehmann, C. Stefan; Ram, N. Bhargava; Janssen, Maurice H. M., E-mail: m.h.m.janssen@vu.nl [LaserLaB Amsterdam, VU University Amsterdam, De Boelelaan 1081, 1081 HV Amsterdam (Netherlands)] [LaserLaB Amsterdam, VU University Amsterdam, De Boelelaan 1081, 1081 HV Amsterdam (Netherlands); Powis, Ivan [School of Chemistry, University of Nottingham, Nottingham NG7 2RD (United Kingdom)] [School of Chemistry, University of Nottingham, Nottingham NG7 2RD (United Kingdom)

2013-12-21T23:59:59.000Z

190

Data:73716e11-880e-4c7d-8e2b-c6d5cac5a76b | Open Energy Information  

Open Energy Info (EERE)

-880e-4c7d-8e2b-c6d5cac5a76b -880e-4c7d-8e2b-c6d5cac5a76b No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Sauk Centre, Minnesota (Utility Company) Effective date: 2012/01/01 End date if known: Rate name: Residential annexed service - Dual Meter/Heat pump Sector: Residential Description: Energy adjustment base average = $0.054/kwh (E.A. base would vary each month based on projected power costs.) Source or reference: http://www.saukcentre.govoffice2.com/vertical/sites/%7BD28FAE32-EDE3-421C-BD2D-FA8E76EA5F8C%7D/uploads/Operational_Policy_Rate_Schedule_2012_final.pdf Source Parent:

191

Data:Ce75e81c-40c8-4a76-bd41-8b07e16cd429 | Open Energy Information  

Open Energy Info (EERE)

5e81c-40c8-4a76-bd41-8b07e16cd429 5e81c-40c8-4a76-bd41-8b07e16cd429 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: CenterPoint Energy Effective date: 2013/01/25 End date if known: Rate name: Secondary Service - Greater than 10 kVa, IDR Metered, beween 400 and 2000 kVa (TC-LGS) Sector: Commercial Description: Delivery Service will be single-phase, 60 hertz, at a standard secondary voltage. Delivery Service will be metered using Company's standard watt-hour Meter provided for this type of Delivery Service. Any other metering option(s) will be provided at an additional charge and/or will be provided by a Meter Owner other than the Company pursuant to Applicable Legal Authorities. Where Delivery Service of the type desired is not available at the Point of Delivery, additional charges and special contract arrangements may be required prior to Delivery Service being furnished, pursuant to Section 6.1.2.2, Construction Services, in this Tariff.

192

Data:B15e28ed-4192-4146-a76d-b7ef034483dc | Open Energy Information  

Open Energy Info (EERE)

e28ed-4192-4146-a76d-b7ef034483dc e28ed-4192-4146-a76d-b7ef034483dc No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Ameren Illinois Company Effective date: 2010/11/19 End date if known: Rate name: DS-2 and BGS-2 Zone 3 - Bundled Small General Delivery Service 600V or Less Sector: Commercial Description: AVAILABILITY Service under this Rate is available for any eligible Non-Residential Customer within the territory served by Company that meets the following criteria: Customers served under this Rate shall have a maximum monthly Demand of less than 150 kilowatts (kW) as qualified in the Delivery Service Rate Reassignment section. A Customer without a demand meter installed, but with an average usage of less than 1,200 kWh per day during each monthly billing period will be normally assumed to have a maximum monthly Demand of less than 150 kW. Where Customer's average daily usage is 1,200 kWh per day or more in any monthly billing period, Company may install a demand meter at Company's expense to determine if Customer remains eligible for service under this Rate.

193

Data:3b148163-13cf-4d33-84ee-376a69a76c8a | Open Energy Information  

Open Energy Info (EERE)

8163-13cf-4d33-84ee-376a69a76c8a 8163-13cf-4d33-84ee-376a69a76c8a No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: South Central Indiana REMC Effective date: 2010/09/01 End date if known: Rate name: Large Industrial Off-Peak Rate - LI-TOU (optional rate) Sector: Industrial Description: Availability Available as an optional rate to three-phase consumers with a transformer capacity requirement greater than 1,000 KVA. A consumer choosing this optional rate must remain on the rate for a minimum of six months. Consumers opting to change to a different rate schedule after the six month minimum period must wait a minimum of six months before returning to this optional rate.

194

Data:935a76a3-c4c6-4a5d-ac59-eacbfb865c43 | Open Energy Information  

Open Energy Info (EERE)

a76a3-c4c6-4a5d-ac59-eacbfb865c43 a76a3-c4c6-4a5d-ac59-eacbfb865c43 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Public Utility District No 2 Effective date: 2011/10/01 End date if known: Rate name: Renewable Resource Sector: Commercial Description: The renewable resource service rate is in addition to regular billing. Rates & Charges: $1.05 per 100 kilowatt hour block per month Source or reference: http://www.pacificpud.org/rate_renew.html Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months):

195

Data:7fba2972-23c1-4a76-befd-da3a23ab854b | Open Energy Information  

Open Energy Info (EERE)

972-23c1-4a76-befd-da3a23ab854b 972-23c1-4a76-befd-da3a23ab854b No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: New York State Elec & Gas Corp Effective date: 2011/09/01 End date if known: Rate name: SERVICE CLASSIFICATION NO. 5 Outdoor Lighting Service - ESS Flood Lights Metal Halide 400W Sector: Lighting Description: APPLICABLE TO THE USE OF SERVICE FOR: Outdoor lighting for residential and general service customers where applicable electric service is available. Flat rate Adjustments = Transition Charge. Source or reference: http://www.nyseg.com/MediaLibrary/2/5/Content%20Management/NYSEG/SuppliersPartners/PDFs%20and%20Docs/PSC120ServiceClassification_5.pdf

196

Data:5464c80f-58c2-4261-b370-a76d25c1b1e9 | Open Energy Information  

Open Energy Info (EERE)

0f-58c2-4261-b370-a76d25c1b1e9 0f-58c2-4261-b370-a76d25c1b1e9 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Pontotoc Electric Power Assn Effective date: 2013/07/01 End date if known: Rate name: Street Light HPS 400 W 30' pole Sector: Lighting Description: Source or reference: http://www.sitemason.com/files/fjDo1q/May%202012.pdf Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous 1 2 3 Next >>

197

Data:2206334d-a736-48a0-a76e-c4a21a0d7463 | Open Energy Information  

Open Energy Info (EERE)

34d-a736-48a0-a76e-c4a21a0d7463 34d-a736-48a0-a76e-c4a21a0d7463 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: PUD No 1 of Franklin County Effective date: 2008/05/01 End date if known: Rate name: MEDIUM INDUSTRIAL GENERAL SERVICE RATE SCHEDULE NO. 2.1 Sector: Industrial Description: Service under this schedule shall be available throughout the service area of the District for lighting and power to commercial, industrial, public buildings, and other services not eligible under other rate schedules where measured demand equals or exceeds 50 kW at least 3 times during a calendar year and less than 300 kW at least 10 times during any calendar year.

198

Data:Dcbe0e9c-a02c-4beb-ba07-aa9a76b3c43a | Open Energy Information  

Open Energy Info (EERE)

Dcbe0e9c-a02c-4beb-ba07-aa9a76b3c43a Dcbe0e9c-a02c-4beb-ba07-aa9a76b3c43a No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Slinger Utilities Effective date: 2007/01/05 End date if known: Rate name: Yard Lighting- 150W HPS Sector: Lighting Description: This schedule will be applied to municipal street lighting and private yard lighting. The utility will furnish, install, and maintain street lighting units. This rate is subject to a Power Cost Adjustment charge per all kWh, that varies on a monthly basis. Source or reference: http://psc.wi.gov/apps40/tariffs/viewfile.aspx?type=electric&id=5510

199

Data:6916aba1-4136-4405-b38d-b03a76eadf4b | Open Energy Information  

Open Energy Info (EERE)

aba1-4136-4405-b38d-b03a76eadf4b aba1-4136-4405-b38d-b03a76eadf4b No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: New London Electric&Water Util Effective date: 2009/07/01 End date if known: Rate name: Cp-3 Industrial Power Time-of-Day Service Primary Metering Discount with Parallel Generation(20kW or less) Sector: Industrial Description: Power Cost Adjustment Clause - All metered rates shall be subject to a positive or negative power cost adjustment charge equivalent to the amount by which the current cost of power (per kilowatt-hour of sales) is greater or lesser than the base cost of power purchased (per kilowatt-hour of sales). The base cost of power (U) is $0.0699 per kilowatt-hour.

200

Data:6ee6c22b-3a76-486a-bdc0-2817da9ed5da | Open Energy Information  

Open Energy Info (EERE)

ee6c22b-3a76-486a-bdc0-2817da9ed5da ee6c22b-3a76-486a-bdc0-2817da9ed5da No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City Utilities of Springfield Effective date: 1999/10/01 End date if known: Rate name: Automatic Throwover Switch Sector: Description: Applicability Under this Rider B, City Utilities will install an automatic throwover switch which can automatically change a customer's source of electric supply. Customers electing to receive service under this rider will remain on this rider for a minimum period of five (5) years. Customers requesting a disconnect will be required to pay $250.00 per month for each month less than 60 the customer has received service under this rider. Availability Service under this rider shall be available within the corporate limits of the City of Springfield, Missouri, and the adjacent territory served by City Utilities for commercial and industrial customers with monthly demands of 300 kilowatts or greater. Charges for service under this rider shall be in addition to charges for service under other applicable electric service rates. Availability is subject to the General Terms and Conditions Governing Electric Service and the Utility Service Rules and Regulations.

Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

Data:D7af1a76-c515-4833-a0f2-b06fdfc6a916 | Open Energy Information  

Open Energy Info (EERE)

a76-c515-4833-a0f2-b06fdfc6a916 a76-c515-4833-a0f2-b06fdfc6a916 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Arcadia, Wisconsin (Utility Company) Effective date: End date if known: Rate name: Small Power Service - 40kW-200kW Demand Sector: Industrial Description: Power Cost Adjustment Clause (PCAC) - All meter rates shall be subject to a positive or negative power cost adjustment charge equivalent to the amount by which the current cost of power (per kWh of sales) is greater or lesser than the base cost of power purchased and produced. The base cost until changed by order of the Public Service Commission of Wisconsin is $0.0507 per kWh.

202

Data:Efc1d6ee-9ac5-486e-a76d-e6082bfc2db8 | Open Energy Information  

Open Energy Info (EERE)

Efc1d6ee-9ac5-486e-a76d-e6082bfc2db8 Efc1d6ee-9ac5-486e-a76d-e6082bfc2db8 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Village of Leigh, Nebraska (Utility Company) Effective date: 2013/01/15 End date if known: Rate name: Irrigation- Interruptible 5-Day Control Sector: Industrial Description: See source for information. Source or reference: http://www.loup.com/docs/customersvc/LIS-I-Rates2013.pdf Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service

203

Data:05e5ec6a-e3c9-4a76-a83f-341cc82d4290 | Open Energy Information  

Open Energy Info (EERE)

ec6a-e3c9-4a76-a83f-341cc82d4290 ec6a-e3c9-4a76-a83f-341cc82d4290 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Taylor County Rural E C C Effective date: 2013/01/01 End date if known: Rate name: Cogeneration and small power production power purchase rate schedule less than 100 kW - Non-Time Differentiated Rates Sector: Commercial Description: Available only to qualified cogeneration or small power production facilities with a design capacity of less than 100 kW which have executed a contract with Taylor County RECC and East Kentucky Power Cooperative for the purchase of electric power by East Kentucky Power Cooperative.

204

Data:87acc466-73ec-404e-a76a-771a2a2ba96f | Open Energy Information  

Open Energy Info (EERE)

acc466-73ec-404e-a76a-771a2a2ba96f acc466-73ec-404e-a76a-771a2a2ba96f No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Village of Gresham, Wisconsin (Utility Company) Effective date: 2010/06/23 End date if known: Rate name: Fg-1 Rural Residential Service Three Phase(Year-Round Customers) Sector: Residential Description: Power Cost Adjustment Clause - All metered rates shall be subject to a positive or negative power cost adjustment charge equivalent to the amount by which the current cost of power (per kilowatt-hour of sales) is greater or lesser than the base cost of power purchased (per kilowatt-hour of sales). The base cost of power (U) is $0.0627 per kilowatt-hour.

205

Interface and process for enhanced transmission of non-circular ion beams between stages at unequal pressure  

DOE Patents [OSTI]

The invention discloses a new interface with non-circular conductance limit aperture(s) useful for effective transmission of non-circular ion beams between stages with different gas pressure. In particular, the invention provides an improved coupling of field asymmetric waveform ion mobility spectrometry (FAIMS) analyzers of planar or side-to-side geometry to downstream stages such as mass spectrometry or ion mobility spectrometry. In this case, the non-circular aperture is rectangular; other geometries may be optimum in other applications. In the preferred embodiment, the non-circular aperture interface is followed by an electrodynamic ion funnel that may focus wide ion beams of any shape into tight circular beams with virtually no losses. The jet disrupter element of the funnel may also have a non-circular geometry, matching the shape of arriving ion beam. The improved sensitivity of planar FAIMS/MS has been demonstrated in experiments using a non-contiguous elongated aperture but other embodiments (e.g., with a contiguous slit aperture) may be preferable, especially in conjunction with an ion funnel operated at high pressures.

Tang, Keqi (Richland, WA); Shvartsburg, Alexandre A. (Richland, WA); Smith, Richard D. (Richland, WA)

2008-03-04T23:59:59.000Z

206

Neutron production from ultrashort pulse lasers using linear and circular polarization  

SciTech Connect (OSTI)

An implicit 2D3V particle-in-cell code is used to study proton and deuteron acceleration from an ultrathin CD foil with thickness between 20 and 200 nm using linear and circular polarization. The proton and deuteron beams drive nuclear fusion reactions from converter foils in a pitcher-catcher set-up. The neutron yield for three representative reactions d - d, d - Li, and p - Li has been calculated analytically using the total neutron production cross section and ion stopping power. For linear polarization, maximum normalized neutron yield of Y{sub d-d}=3.4x10{sup 6}, Y{sub d-Li}=3.2x10{sup 7}, and Y{sub p-Li}=6.8x10{sup 6} neutrons/J laser energy has been calculated at the optimum foil thickness of 50 nm. For circular polarization, the optimum foil thickness is 20 nm, for which the corresponding neutron yields are Y{sub d-d}=1.9x10{sup 6}, Y{sub d-Li}=2.0x10{sup 7}, and Y{sub p-Li}=2.7x10{sup 6}, respectively. The laser polarization strongly affects the neutron production; for our regime, i.e., intensity I=1x10{sup 21} W/cm{sup 2}, pulse duration {tau}{sub FWHM}=30 fs, and laser energy {epsilon}{sub laser}=3.8 J, both the conversion efficiency of laser energy into ion kinetic energy and neutron yield are higher for linear polarization. Only for ultrathin ({approx}20 nm) foils in the radiation pressure acceleration regime, circular and linear polarizations yield comparable results.

Davis, J.; Petrov, G. M. [Naval Research Laboratory, Plasma Physics Division, 4555 Overlook Ave. SW, Washington, DC 20375 (United States)

2011-07-15T23:59:59.000Z

207

SEARCH FOR A MAGNETIC FIELD VIA CIRCULAR POLARIZATION IN THE WOLF-RAYET STAR EZ CMa  

SciTech Connect (OSTI)

We report on the first deep, direct search for a magnetic field via the circular polarization of Zeeman splitting in a Wolf-Rayet (W-R) star. Using the highly efficient ESPaDOnS spectropolarimeter at the Canada-France-Hawaii Telescope, we observed at three different epochs one of the best W-R candidates in the sky expected to harbor a magnetic field, the bright, highly variable WN4 star EZ CMa = WR6 = HD 50896. We looked for the characteristic circular polarization (Stokes V) pattern in strong emission lines that would arise as a consequence of a global, rotating magnetic field with a split monopole configuration. We also obtained nearly simultaneous linear polarization spectra (Stokes Q and U), which are dominated by electron scattering, most likely from a flattened wind with large-scale corotating structures. As the star rotates with a period of 3.766 days, our view of the wind changes, which in turn affects the value of the linear polarization in lines versus continuum at the {approx}0.2% level. Depending on the epoch of observation, our Stokes V data were affected by significant crosstalk from Stokes Q and U to V. We removed this spurious signal from the circular polarization data and experimented with various levels of spectral binning to increase the signal-to-noise ratio of our data. In the end, no magnetic field is unambiguously detected in EZ CMa. Assuming that the star is intrinsically magnetic and harbors a split monopole configuration, we find an upper limit of B {approx} 100 G for the intensity of its field in the line-forming regions of the stellar wind.

De la Chevrotiere, A.; St-Louis, N.; Moffat, A. F. J. [Departement de Physique, Universite de Montreal and Centre de Recherche en Astrophysique du Quebec (CRAQ), C. P. 6128, succ. centre-ville, Montreal (Quebec) H3C 3J7 (Canada)] [Departement de Physique, Universite de Montreal and Centre de Recherche en Astrophysique du Quebec (CRAQ), C. P. 6128, succ. centre-ville, Montreal (Quebec) H3C 3J7 (Canada); Collaboration: MiMeS Collaboration

2013-02-20T23:59:59.000Z

208

GC-859 Energy Information Administration Form Approved Revised (05/2013) U.S. DEPARTMENT OF ENERGY OMB NO. 1901-0287  

U.S. Energy Information Administration (EIA) Indexed Site

GC-859 Energy Information Administration Form Approved GC-859 Energy Information Administration Form Approved Revised (05/2013) U.S. DEPARTMENT OF ENERGY OMB NO. 1901-0287 Average Burden 67.5 Hours Expiration Date: 04/30/2016 NUCLEAR FUEL DATA SURVEY FORM GC-859 Legislative Authority: Data on this mandatory form are collected under authority of the Federal Energy Administration Act of 1974 (15 USC Schedule 761 et seq.), and the Nuclear Waste Policy Act of 1982, as amended (42 USC 10101 et seq.). Failure to file after receiving Energy Information Administration (EIA) notification may result in criminal fines, civil penalties and other sanctions as provided by the law. Data being collected on this form are not considered to be confidential. Title 18 U.S.C. 1001 makes it a criminal offense for any person knowingly and willingly to

209

Summary Description Federal Acquisition Circular 2005-58 Federal Acquisition Regulation Amendments  

Broader source: Energy.gov (indexed) [DOE]

Description Description Federal Acquisition Circular 2005-58 Federal Acquisition Regulation Amendments Published in the Federal Register April 18, 2012 Page 23364 ----------------------------------------------------------------------- I. Biobased Procurements FAR Case 2010-004 II. Representation Regarding Export of Sensitive Technology to Iran FAR Case 2010-018 III. Justification and Approval of Sole-Source 8(a) Contracts FAR Case 2009-038 IV. Technical Amendments ----------------------------------------------------------------------------- Item I--Biobased Procurements (FAR Case 2010-004) This final rule amends the FAR to implement changes that require contractors to report the biobased products purchased under service and construction contracts. The Farm Security and Rural Investment Act (7 U.S.C.

210

Self-focusing of circularly polarized laser pulse propagating through a magnetized non-Maxwellian plasma  

SciTech Connect (OSTI)

Self-focusing of an intense circularly polarized laser pulse propagating through a magnetized non-Maxwellian plasma is investigated. Based on a relativistic two-fluid model, nonlinear equation describing dynamics of the slowly varying amplitude is obtained. The evolution of laser spot size is studied and effect of non-Maxwellian distribution of charge density on the spot size is considered. It is shown that the existence of super-thermal particles leads to the enhancement of the self-focusing quality of plasma.

Sepehri Javan, N., E-mail: sepehri-javan@uma.ac.ir [Department of physics, University of Mohaghegh Ardabili, PO Box 179, Ardabil (Iran, Islamic Republic of)

2014-10-15T23:59:59.000Z

211

Nonlinear dissipation of circularly polarized Alfven waves due to the beam-induced obliquely propagating waves  

SciTech Connect (OSTI)

In the present study, the dissipation processes of circularly polarized Alfven waves in solar wind plasmas including beam components are numerically discussed by using a 2-D hybrid simulation code. Numerical results suggest that the parent Alfven waves are rapidly dissipated due to the presence of the beam-induced obliquely propagating waves, such as kinetic Alfven waves. The nonlinear wave-wave coupling is directly evaluated by using the induction equation for the parent wave. It is also observed both in the 1-D and 2-D simulations that the presence of large amplitude Alfven waves strongly suppresses the beam instabilities.

Nariyuki, Y. [Faculty of Human Development, University of Toyama, 3190, Toyama City, Toyama 930-8555 (Japan); Hada, T. [Department of Earth System Science and Technology, Kyushu University, 6-1, Kasuga City, Fukuoka 816-8580 (Japan); Tsubouchi, K. [Department of Earth and Planetary Physics, University of Tokyo, 7-3-1 Hongo, Bunkyo, Tokyo 113-0033 (Japan)

2012-08-15T23:59:59.000Z

212

Data:Cc740648-5411-4594-8b6d-a1f368a76e2c | Open Energy Information  

Open Energy Info (EERE)

8-5411-4594-8b6d-a1f368a76e2c 8-5411-4594-8b6d-a1f368a76e2c No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Village of Cadott, Wisconsin (Utility Company) Effective date: 2000/10/19 End date if known: Rate name: Cp-2 Large Power Service with Parallel Generation(20kW or less) Sector: Industrial Description: Application: This rate will be applied to customers for all types of service, if their monthly Maximum Measured Demand is in excess of 200 kilowatts (kW) per month for three or more months in a consecutive 12-month period. Customers billed on this rate shall continue to be billed on this rate until their monthly Maximum Measured Demand is less than 200 kW per month for 12 consecutive months. The utility shall offer customers billed on this rate a one-time option to continue to be billed on this rate for another 12 months if their monthly Maximum Measured Demand is less than 200 kW per month. However, this option shall be offered with the provision that the customer waives all rights to billing adjustments arising from a claim that the bill for service would be less on another rate schedule than under this rate schedule. Power Cost Adjustment Clause: Charge per all kWh varies monthly.Fixed Monthly Charge includes Commitment to Community Rider: $1.33 per customer per month

213

Irregular Magnetic Fields in Interstellar Clouds and Variations in the Observed Circular Polarization of Spectral Lines  

E-Print Network [OSTI]

The strengths of magnetic fields in interstellar gas clouds are obtained through observations of the circular polarization of spectral line radiation. Irregularities in this magnetic field may be present due to turbulence, waves or perhaps other causes, and may play an essential role in the structure and evolution of the gas clouds. To infer information about these irregularities from the observational data, we develop statistical relationships between the rms values of the irregular component of the magnetic field and spatial variations in the circular polarization of the spectral line radiation. The irregularities are characterized in analogy with descriptions of turbulence---by a sum of Fourier waves having a power spectrum with a slope similar to that of Kolmogorov turbulence. For comparison, we also perform computations in which turbulent magnetic and velocity fields from representative MHD simulations by others are utilized. Although the effects of the variations about the mean value of the magnetic field along the path of a ray tend to cancel, a significant residual effect in the polarization of the emergent radiation remains for typical values of the relevant parameters. A map of observed spectra of the 21 cm line toward Orion A is analyzed and the results are compared with our calculations in order to infer the strength of the irregular component of the magnetic field. The rms of the irregular component is found to be comparable in magnitude to the mean magnetic field within the cloud. Hence, the turbulent and Alfven velocities should also be comparable.

W. D. Watson; D. S. Wiebe; R. M. Crutcher

2000-10-13T23:59:59.000Z

214

On the application of circular–cylindrical waves to ocean wave power absorption  

Science Journals Connector (OSTI)

This study derives mathematical forms for the waves radiated from a heaving, surging and swaying point source on the surface of a three dimensional ocean. The interactions between a monochromatic plane wave and monochromatic circular–cylindrical radiated waves are examined, and solutions to the time averaged power are calculated. These calculations confirm pre-existing theoretical maximum absorption lengths for both a heaving and surging point source. The derivations also lead to the definition of the amplitude, phase and form of the radiated waves required to achieve these maximums. Two experimental case studies match measured radiated wave with circular waves. These matches demonstrate a correlation between the body motions and the dominant form of radiated waves as well as higher frequency waves. The study develops three general guidelines for the design of efficient point absorber wave energy converters (PAWECs). Optimum power absorption occurs when the PAWEC radiates theoretical heave and surge waves of the appropriate amplitude and phase. Theoretical sway type waves should be minimized as these radiate energy and do not interact with the incident wave. Similarly, the radiation of higher harmonic waves should also be minimized for the same reasons.

Matthew Wypych; Lan Le-Ngoc; Keith Alexander; Alister Gardner

2012-01-01T23:59:59.000Z

215

Shining New Light on Protein Structure and Function thru Synchrotron Radiation Circular Dichroism (SRCD) Spectroscopy  

SciTech Connect (OSTI)

Circular dichroism (CD) spectroscopy has been employed for more than 50 years for the study of the structure and dynamics of proteins. It is now a workhorse of structural biology, finding applications in the determination of protein secondary structures, monitoring and deciphering protein folding, examining macromolecular interactions, and defining and quantitating protein-ligand binding. For the most part, CD studies have used laboratory-based instruments to measure electronic transitions in the far (190-250 nm), near ultraviolet (UV) (250-300 nm) and visible (> 400 nm) wavelength ranges, which have enabled studies of polypeptide backbones, aromatic amino acids and colored chromophores, respectively. Additional transitions exist at lower wavelengths in the vacuum ultraviolet (VUV) region (<190 nm); however, these transitions tend to be inaccessible to conventional CD instruments, due to the low intensity of their Xenon arc lamp light sources at wavelengths below190 nm. In 1980, the first synchrotron-based CD instruments were constructed, which took advantage of the high photon flux available from synchrotron light sources at these wavelengths. However, the technique of synchrotron radiation circular dichroism (SRCD) did not really take off until enabling studies had been done to show that additional data were obtainable for proteins in the VUV region, that these data were readily accessible with modern beamlines, and most importantly, that new applications of these data existed in structural molecular biology.

Wallace,B.

2005-01-01T23:59:59.000Z

216

module 4  

Broader source: Energy.gov (indexed) [DOE]

u u r r e n t I s s u e s C u r r e n t I s s u e s 4 - 2 Current Issues President's Management Agenda OFPP Initiatives GAO High Risk Series Major OPAM Initiatives 4 - 3 President's Management Agenda (PMA) 4 - 4 In 2001, the President unveiled his management agenda (PMA) aimed at improving Government performance and management The Office of Procurement and Assistant Management (OPAM) actively supports the PMA initiatives in: Competitive Sourcing Financial Performance E-Government Human Capital Management Budget and Performance Integration President's Management Agenda (PMA) Background 4 - 5 Competitive Sourcing Promotes cost savings and performance improvements in work designated as commercial under the FAIR Act and OMB Circular A-76 The Competitive Sourcing Office (CSO) is responsible for DOE's

217

Competitive Sourcing  

Broader source: Energy.gov (indexed) [DOE]

Competitive Sourcing Competitive Sourcing The Department of Energy's (DOE) Competitive Sourcing program is a management initiative aimed at improving DOE's performance and reducing the Department's operational costs. The program is governed by Office of Management and Budget (OMB) Circular A- 76, Performance of Commercial Activities, dated May 29, 2003. The commercial activities selected for review and competition include functions performed by government employees that are readily available in the private sector, and where the potential for efficiencies, regardless of the winning provider, are highly likely. The candidate functions are chosen from the Department's annual Federal Activities Inventory Reform (FAIR) Act Inventory and subjected to a feasibility review to determine if a prudent business case can be made to enter

218

Microsoft Word - Minutes.060503.doc  

Broader source: Energy.gov (indexed) [DOE]

COMPETITIVE SOURCING COMPETITIVE SOURCING EXECUTIVE STEERING GROUP MEETING PROCEEDINGS June 5, 2003 2:00 pm-3:00 pm Room 7B-252 ATTENDEES Kyle McSlarrow Robert Card Linton Brooks James Campbell Brandon Daneher, AFGE Cary Kurtz, NTEU Karen Evans Brian Costlow William Pearce Helen Sherman Frank Bessera Eric Fygi Prentis Cook Mary Ann Shebek Kathy Peery Robert Tuttle Jeffery Dowell Kevin Kolevar Al Knight Dennis O'Brien Steven Apicella AGENDA Opening Remarks (Kyle McSlarrow) Approvals/Notification Overview (Dennis O'Brien/Team Chiefs) Team Study Change Decisions (Brian Costlow, William Pearce, Karen Evans) New OMB Circular A-76 (Dennis O'Brien) Team Status Synopsis (Time permitting) Open discussion

219

A photoelastic stress analysis of a flat circular plate simply supported and subjected to a concentrated load at the center  

E-Print Network [OSTI]

LIBRARy 4 4 III coI I BGv IIf Tf4 A PHOTOELASTIC STRESS ANALYSIS OF A FLAT CIRCULAR PLATE SIWPLY SUPPORTED AND SUBJECTED TO A CONCENTRATED LOAD AT THE CENTERS A Thesis By Joseph Lloyd Fulbright Submitted to the Graduate School... of the Agricultural and Wechanical College of Texas in partial fulfillment of the requirements for the degree of MASTER OF SCIENCE Way 1958 Wa)or Sub]ect& Wechanical Engineering A PHOTOELASTIC STRESS ANALYSIS OF A FLAT CIRCULAR PLATE SIMPLY SUPPORTED...

Fulbright, Joseph Lloyd

2012-06-07T23:59:59.000Z

220

ANL-85-51 ANL-85-51 FLOW-INDUCED VIBRATION OF CIRCULAR CYLINDRICAL STRUCTURES  

Office of Scientific and Technical Information (OSTI)

ANL-85-51 ANL-85-51 ANL-85-51 ANL-85-51 FLOW-INDUCED VIBRATION OF CIRCULAR CYLINDRICAL STRUCTURES by ShoeiSheng Chen BASE TECHNOLOGY ARGONNE NATIONAL LABORATORY, ARGONNE, ILLINOIS Operated by THE UNIVERSITY OF CHICAGO for the U. S. DEPARTMENT OF ENERGY under Contract W-31-109-Eng-38 A major purpose of the Techni- cal information Center is to provide the broadest dissemination possi- ble of information contained in DOE's Research and Development Reports to business, industry, the academic community, and federal, state and local governments. Although a small portion of this report is not reproducible, it is being made available to expedite the availability of information on the research discussed herein. Distribution Category: LMFBR-Components: Base Technology (UC-79k) ANL-85-51 ANL-85-51

Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

Computational study of subcritical response in flow past a circular cylinder  

E-Print Network [OSTI]

Flow past a circular cylinder is investigated in the subcritical regime, below the onset of Benard-von Karman vortex shedding at Re_c ~ 47. The transient response of infinitesimal perturbations is computed. The domain requirements for obtaining converged results is discussed at length. It is shown that energy amplification occurs as low as Re=2.2. Throughout much of the subcritical regime the maximum energy amplification increases approximately exponentially in the square of Re reaching 6800 at Re_c$. The spatiotemporal structure of the optimal transient dynamics is shown to be transitory Benard-von Karman vortex streets. At Re ~ 42 the long-time structure switches from exponentially increasing downstream to exponentially decaying downstream. Three-dimensional computations show that two-dimensional structures dominate the energy growth except at short times.

Cantwell, Christopher D; 10.1103/PhysRevE.82.026315

2013-01-01T23:59:59.000Z

222

Photo-production of scalar particles in the field of a circularly polarized laser beam  

E-Print Network [OSTI]

The photo-production of a pair of scalar particles in the presence of an intense, circularly polarized laser beam is investigated. Using the optical theorem within the framework of scalar quantum electrodynamics, explicit expressions are given for the pair production probability in terms of the imaginary part of the vacuum polarization tensor. Its leading asymptotic behavior is determined for various limits of interest. The influence of the absence of internal spin degrees of freedom is analyzed via a comparison with the corresponding probabilities for production of spin-1/2 particles; the lack of spin is shown to suppress the pair creation rate, as compared to the predictions from Dirac theory. Potential applications of our results for the search of minicharged particles are indicated.

Selym Villalba-Chávez; Carsten Müller

2012-08-17T23:59:59.000Z

223

Theoretical description of field-induced magnetic circular x-ray dichroism in nonmagnetic solids  

Science Journals Connector (OSTI)

It is demonstrated that the presence of an external magnetic field for a paramagnetic solid gives rise to a circular magnetic dichroism in x-ray dichroism (MCXD) in full analogy to the MCXD observed in ferromagnetic solids. It is shown that the conventional sum rules can be adopted for this situation to give access to the spin and orbital susceptibilities. Results of calculations for various transition metal systems demonstrate the applicability of the sum rules. In particular, for the alloy systems AgxPd1-x and AgxPt1-x use of the field induced MCXD should allow us to study in detail the Stoner enhancement of the spin susceptibility as well as the role of the orbital susceptibility of Pd and Pt, respectively.

S. Mankovsky and H. Ebert

2004-01-23T23:59:59.000Z

224

Circularly Polarized X Rays: Another Probe of Ultrafast Molecular Decay Dynamics  

SciTech Connect (OSTI)

Dissociative nuclear motion in core-excited molecular states leads to a splitting of the fragment Auger lines: the Auger-Doppler effect. We present here for the first time experimental evidence for an Auger-Doppler effect following F1s{yields}a{sub 1g}* inner-shell excitation by circularly polarized x rays in SF{sub 6}. In spite of a uniform distribution of the dissociating S-F bonds near the polarization plane of the light, the intersection between the subpopulation of molecules selected by the core excitation with the cone of dissociation induces a strong anisotropy in the distribution of the S-F bonds that contributes to the scattering profile measured in the polarization plane.

Travnikova, Oksana; Lindblad, Andreas; Nicolas, Christophe; Soederstroem, Johan; Kimberg, Victor; Miron, Catalin [Synchrotron SOLEIL, L'Orme des Merisiers, Saint-Aubin, B.P. 48, F-91192 Gif-sur-Yvette Cedex (France); Liu Jicai; Gel'mukhanov, Faris [Department of Theoretical Chemistry, Roslagstullsbacken 15, Royal Institute of Technology, S-106 91 Stockholm (Sweden)

2010-12-03T23:59:59.000Z

225

A proposed measurement of the reverse Cherenkov radiation effect in a metamaterial-loaded circular waveguide  

SciTech Connect (OSTI)

The authors have recently proposed an experiment on verification of the Reverse Cherenkov Radiation (RCR) effect in a Left-Handed-Material-loaded waveguide. Applications of the RCR effect may range from novel higher-order-mode suppressors in microwave and millimeter-wave sources to improved particle detectors for satellite non-proliferation missions. The experimental configuration includes a circular waveguide filled with an artificial metamaterial with simultaneously negative permittivity and permeability, in which the electromagnetic wave with a frequency of 95 GHz will interact with an electron beam. They have demonstrated that for certain values of effective permittivity and permeability only the backward-propagating mode can be exited by the electron beam. At the conference they will present some newly developed metamaterial designs, which they plan to employ for producing the proper effective medium parameters for this experiment.

Shchegolkov, Dmitry [Los Alamos National Laboratory; Azad, Abul K [Los Alamos National Laboratory; O' Hara, John F [Los Alamos National Laboratory; Smirnova, Evgenya I [Los Alamos National Laboratory

2009-01-01T23:59:59.000Z

226

Stability under radiation reaction of circular equatorial orbits around Kerr black holes  

Science Journals Connector (OSTI)

We examine the evolution, under gravitational radiation reaction, of slightly eccentric equatorial orbits of point particles around Kerr black holes. Our method involves numerical integration of the Sasaki-Nakamura equation. It is discovered that such orbits decrease in eccentricity throughout most of the inspiral, until shortly before the innermost stable circular orbit, when a critical radius rcrit is reached beyond which the inspiralling orbits increase in eccentricity. It is shown that the number of orbits remaining in this last (eccentricity increasing) phase of the inspiral is an order of magnitude less for prograde orbits around rapidly spinning black holes than for retrograde orbits. In the extreme limit of a Kerr black hole with spin parameter a=1, this critical radius descends into the “throat” of the black hole.

Daniel Kennefick

1998-08-11T23:59:59.000Z

227

Computational study of subcritical response in flow past a circular cylinder C. D. Cantwell* and D. Barkley  

E-Print Network [OSTI]

Computational study of subcritical response in flow past a circular cylinder C. D. Cantwell* and D is investigated in the subcritical regime, below the onset of Bénard-von Kármán vortex shedding at Reynolds number as Re=2.2. Throughout much of the subcritical regime the maximum energy amplification increases

Barkley, Dwight

228

Laboratory Model of a Contactless Device for Measuring Diameter of Objects with Circular Cross-section Objects  

E-Print Network [OSTI]

and improves the accuracy to measure the outside diameter of optical fibers manufactured at high speed. The device has folow specifications: measuring range: (0.1­1) mm, measuring area 2mm, light sourse ­ laser9 3 Laboratory Model of a Contactless Device for Measuring Diameter of Objects with Circular Cross

Borissova, Daniela

229

Continuum–discontinuum analysis of failure mechanisms around unsupported circular excavations in anisotropic clay shales  

Science Journals Connector (OSTI)

Abstract The stability of circular excavations in clay shales is a key issue in the drilling and tunnelling industries as well as in the field of deep geological waste storage. A large body of experimental evidence indicates that the damaged zone around these cavities is influenced by strong mechanical anisotropy induced by the layered material structure. The vast majority of numerical models adopted to date to analyse the stability of openings in layered rocks have been based on continuum mechanics principles using classic shear failure theory for elasto-plastic materials. However, a number of experimental observations demonstrate that clay shales may fail in a brittle manner under low-confinement conditions such as those characterizing the near-field of the excavation. Therefore, an alternative numerical approach based on non-linear fracture mechanics principles and the discrete element method is adopted to gain new insight into the failure process of this class of geomaterials. In order to account for the influence of clay shale microstructure on its mechanical behaviour a newly developed approach to capture the anisotropy of strength is proposed. With this numerical approach, the cohesive strength parameters of the fracture model are assumed to be a function of the relative orientation between the element bonds and the layering orientation. The effectiveness of the numerical technique is quantitatively demonstrated by simulating standard rock mechanics tests on an indurated claystone, namely Opalinus Clay. Emergent strength and deformation properties, together with the simulated fracture mechanisms, are shown to be in good agreement with experimental observations. The modelling technique is then applied to the simulation of the Excavation Damaged Zone (EDZ) around a circular tunnel in horizontally bedded Opalinus Clay. The simulated fracturing process is mainly discussed in the context of the damage mechanisms observed at the Mont Terri URL. Furthermore, the influence of in situ stress on resulting EDZ geometry is analysed together with possible implications for ground support and tunnel constructability. Modelling results highlight the importance of shear strength mobilization along bedding planes in controlling the EDZ formation process. In particular, slippage of bedding planes is shown to cause rock mass deconfinement which in turn promotes brittle failure processes in the form of spalling. The numerical technique is currently limited to two-dimensional analyses without any thermo-hydro-mechanical coupling.

A. Lisjak; G. Grasselli; T. Vietor

2014-01-01T23:59:59.000Z

230

VOLUME 89, NUMBER 1 P H Y S I C A L R E V I E W L E T T E R S 1 JULY 2002 Multiple Filamentation of Circularly Polarized Beams  

E-Print Network [OSTI]

of Circularly Polarized Beams G. Fibich and B. Ilan Department of Applied Mathematics, Tel Aviv University, Tel of equations that describes the propagation of circularly polarized laser beams in a Kerr medium. Analysis and simulations of this system show that multiple filamentation is suppressed for circularly polarized beams. DOI

Fibich, Gadi

231

2012 OMB Annual Report  

Broader source: Energy.gov (indexed) [DOE]

National Technology Transfer and Advancement Act National Technology Transfer and Advancement Act Office of Management and Budget Report for FY-2012 Questions and Responses 1. Please describe the importance of standards in the achievement of your agency's mission, how your agency uses standards to deliver its primary services in support of its mission, and provide any examples or case studies of standards success. Please include relevant Internet links and links to your agency's standards website. The Department of Energy (DOE) relies heavily on voluntary consensus standards (VCSs) to fulfill its mission. DOE has a long history of working with the VCS community to develop standards that help DOE achieve its mission with regard to the safety, security, design, operations, and maintenance of its facilities. Where appropriate,

232

OMB Guidance and Scoring  

Broader source: Energy.gov (indexed) [DOE]

which must cover the full cost of the Federal investment for the improvements; * (2) measurement and verification (M& V) of savings through commissioning and...

233

OMB Control No.  

Energy Savers [EERE]

(complete a. or b. - whichever applies): a. U.S. b. Foreign National By birth Alien Registration NumberDateCity, State Issued: Derivative (provide Certificate Number):...

234

NTTAA 2010 OMB Report  

Broader source: Energy.gov (indexed) [DOE]

2010 Annual Report for The Department of Energy 1. Please describe the importance of standards in the achievement of your agency's mission, how your agency uses standards to deliver its primary services in support of its mission, and provide any examples or case studies of standards success. Please include relevant Internet links and links to your agency's standards website. The Department of Energy (DOE) uses voluntary consensus standards (VCSs) extensively in managing, operating, and implementing requirements applicable to its diverse sites, laboratories, operations, and facilities. The VCSs are used to support a wide range of program areas, including those addressing nuclear weapons and materials production, energy research, energy efficiency, oil storage, hydroelectric power, accelerator

235

Strong-field tidal distortions of rotating black holes: Formalism and results for circular, equatorial orbits  

E-Print Network [OSTI]

Tidal coupling between members of a compact binary system can have an interesting and important influence on that binary's dynamical inspiral. Tidal coupling also distorts the binary's members, changing them (at lowest order) from spheres to ellipsoids. At least in the limit of fluid bodies and Newtonian gravity, there are simple connections between the geometry of the distorted ellipsoid and the impact of tides on the orbit's evolution. In this paper, we develop tools for investigating tidal distortions of rapidly rotating black holes using techniques that are good for strong-field, fast-motion binary orbits. We use black hole perturbation theory, so our results assume extreme mass ratios. We develop tools to compute the distortion to a black hole's curvature for any spin parameter, and for tidal fields arising from any bound orbit, in the frequency domain. We also develop tools to visualize the horizon's distortion for black hole spin $a/M \\le \\sqrt{3}/2$ (leaving the more complicated $a/M > \\sqrt{3}/2$ case to a future analysis). We then study how a Kerr black hole's event horizon is distorted by a small body in a circular, equatorial orbit. We find that the connection between the geometry of tidal distortion and the orbit's evolution is not as simple as in the Newtonian limit.

Stephen O'Sullivan; Scott A. Hughes

2014-07-25T23:59:59.000Z

236

Residence time distribution and heat transfer in circular pipe fitted with longitudinal rectangular wings  

Science Journals Connector (OSTI)

Abstract Numerical simulations are used to analyze the heat and mass transfer in a circular pipe fitted with longitudinal rectangular vortex generators for Reynolds number between 7500 and 15,000 based on the pipe diameter. The aim of the present study is to test and quantify the mixing efficiency of a new solution able to avoid the bypass region that exists in the center of the high efficiency vortex static mixer (HEV), and also to enhance the heat transfer without increasing the pressure losses. The rectangular wings used here generate each a streamwise counter-rotating vortex pair sweeping the volume of the mixer and act as internal agitator on the flow. The particle dispersion is investigated by analyzing Poincaré sections and by studying the residence time distribution (RTD). The two approaches show much better mass transfer performance and better mixing homogeneity for the new wings arrangement. The heat transfer is also investigated and it is shown that the thermal enhancement factor in the new arrangement is much greater than that of the conventional systems used in the industry. When compared to the HEV heat exchangers it is shown that the thermal enhancement in the present configuration reaches about 40% relative to the classic HEV and 15% relative to the reversed HEV.

Charbel Habchi; Jean-Luc Harion

2014-01-01T23:59:59.000Z

237

System and method for chromatography and electrophoresis using circular optical scanning  

DOE Patents [OSTI]

A system and method is disclosed for chromatography and electrophoresis using circular optical scanning. One or more rectangular microchannel plates or radial microchannel plates has a set of analysis channels for insertion of molecular samples. One or more scanning devices repeatedly pass over the analysis channels in one direction at a predetermined rotational velocity and with a predetermined rotational radius. The rotational radius may be dynamically varied so as to monitor the molecular sample at various positions along a analysis channel. Sample loading robots may also be used to input molecular samples into the analysis channels. Radial microchannel plates are built from a substrate whose analysis channels are disposed at a non-parallel angle with respect to each other. A first step in the method accesses either a rectangular or radial microchannel plate, having a set of analysis channels, and second step passes a scanning device repeatedly in one direction over the analysis channels. As a third step, the scanning device is passed over the analysis channels at dynamically varying distances from a centerpoint of the scanning device. As a fourth step, molecular samples are loaded into the analysis channels with a robot.

Balch, Joseph W. (Livermore, CA); Brewer, Laurence R. (Oakland, CA); Davidson, James C. (Livermore, CA); Kimbrough, Joseph R. (Pleasanton, CA)

2001-01-01T23:59:59.000Z

238

Flow patterns and heat transfer around six in-line circular cylinders at low Reynolds number  

E-Print Network [OSTI]

The flow field and the heat transfer around six in-line iso-thermal circular cylinders has been studied by mean of numerical simulations. Two values of the center to center spacing ($s=3.6d$ and $4d$, where $d$ is the cylinder diameter) at Reynolds number of $100$ and Prandtl number of $0.7$ has been investigated. Similarly to the in-line two cylinder configuration, in this range a transition in the flow and in the heat transfer occurs. Two different flow patterns have been identified: the stable shear layer (SSL) mode and the shear layer secondary vortices (SLSV) mode, at $3.6$ and $4$ spacing ratio ($s/d$), respectively. At $s/d=3.6$ the flow pattern causes the entrainment of cold fluid on the downstream cylinders enhancing the heat transfer. On the other hand at $s/d=4$ two stable opposite shear layer prevent the cold fluid entrainment over the downstream cylinders reducing their heat exchange. The overall time average heat transfer of the array is enhanced up to 25% decreasing the spacing ratio from $4$ t...

Fornarelli, Francesco; Lippolis, Antonio

2014-01-01T23:59:59.000Z

239

Two-dimensional flows of foam: drag exerted on circular obstacles and dissipation  

E-Print Network [OSTI]

A Stokes experiment for foams is proposed. It consists in a two-dimensional flow of a foam, confined between a water subphase and a top plate, around a fixed circular obstacle. We present systematic measurements of the drag exerted by the flowing foam on the obstacle, \\emph{versus} various separately controlled parameters: flow rate, bubble volume, solution viscosity, obstacle size and boundary conditions. We separate the drag into two contributions, an elastic one (yield drag) at vanishing flow rate, and a fluid one (viscous coefficient) increasing with flow rate. We quantify the influence of each control parameter on the drag. The results exhibit in particular a power-law dependence of the drag as a function of the solution viscosity and the flow rate with two different exponents. Moreover, we show that the drag decreases with bubble size, increases with obstacle size, and that the effect of boundary conditions is small. Measurements of the streamwise pressure gradient, associated to the dissipation along the flow of foam, are also presented: they show no dependence on the presence of an obstacle, and pressure gradient depends on flow rate, bubble volume and solution viscosity with three independent power laws.

Benjamin Dollet; Florence Elias; Catherine Quilliet; Arnaud Huillier; Miguel Aubouy; Francois Graner

2004-11-22T23:59:59.000Z

240

Design of a High Flux Vacuum-Ultraviolet Beamline for Circular Dichroism Experiments  

SciTech Connect (OSTI)

A vacuum-ultraviolet bending-magnet beamline for circular dichroism (CD) experiments has been designed. To maximize the photon flux and minimize the focused beam size, a cylindrical mirror and a cylindrical grating with independent optical functions are utilized. The beamline can collect a 30 mrad horizontal by 7 mrad vertical solid angle of synchrotron radiation. By using a 600 grooves/mm grating, the calculated photon flux is greater than 1x10{sup 13} photons/sec and the focused beam size is 0.4 mmx0.65 mm for the spectral range from 130 nm to 330 nm with the energy resolving power set at 1000. The linear polarization degree is better than 75% and can be increased to 90% by reducing the vertical acceptance angle down to 2 mrad. In addition to the high flux mode described above, this beamline can also be operated in a high resolution mode. By using a 1200 grooves/mm grating, a resolving power greater than 10,000 can be achieved for the spectral range from 180 to 330 nm. This beamline can provide photon flux as high as the best synchrotron CD beamlines in the world while offers simultaneously a smaller focused beam size.

Fu, H. W.; Fung, H. S.; Chung, S. C.; Huang, L. J.; Chen, C. T. [National Synchrotron Radiation Research Center, Hsinchu 30076, Taiwan (China)

2010-06-23T23:59:59.000Z

Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

On the ability of various circular inspiral templates to capture inspiral gravitational waves from compact binaries having tiny orbital eccentricities  

E-Print Network [OSTI]

We probe the ability of various types of post-Newtonian(PN)-accurate circular templates to capture inspiral gravitational-wave (GW) signals from compact binaries having tiny orbital eccentricities. The GW signals are constructed by adapting the phasing formalism, available in T. Damour, A. Gopakumar, and B. R. Iyer, [Phys. Rev. D 70, 064028 (2004)], employing the orbital energy and the time-eccentricity to describe the orbital evolution. Using the fitting factor estimates, relevant for the initial LIGO, we show that circular templates, based on the adiabatic TaylorT1, complete adiabatic TaylorT1 and TaylorT4 approximants are unable to capture our GW signals from compact binaries having tiny residual orbital eccentricities. However, the 2PN-order circular inspiral templates based on the recently introduced TaylorEt approximant are found to be both effectual and faithful in capturing GWs from inspiralling compact binaries having moderate eccentricities and we provide physical explanations for our observations.

Manuel Tessmer; Achamveedu Gopakumar

2012-02-28T23:59:59.000Z

242

Drag force on a circular cylinder midway between two parallel plates at Part 2: moving uniformly (numerical and experimental)  

Science Journals Connector (OSTI)

To contribute to the determination of the hydrodynamic interactions between a long straight circular cylindrical particle and flow boundaries, we calculate the wall correction of the drag force exerted on a circular cylinder moving uniformly midway between two parallel plane walls, at very low Reynolds numbers. The wall correction factor is numerically and asymptotically investigated. Furthermore, we present a new experimental results for the drag force exerted on this straight circular cylinder. The Navier–Stokes and continuity equations are expressed in the stream function and vorticity formulation and are rewritten in an orthogonal system of curvilinear co-ordinates. These equations are solved with a finite-differences method. The accuracy of the numerical code is tested successfully through a comparison with theoretical and experimental results. In the lubrication regime the numerical calculations of the pressure and viscosity forces are in very good agreement with those obtained by asymptotic expansions. Combining the present results with those obtained in Poiseuille flow (Chem. Eng. Sci. 59 (15, part 1) (2004) 3215) we give the speed at which a force-free cylindrical particle would move with the fluid perpendicularly to it's axis between two planar walls in Poiseuille flow and corrected by wall effects.

A. Ben Richou; A. Ambari; M. Lebey; J.K. Naciri

2005-01-01T23:59:59.000Z

243

Improved resummation of post-Newtonian multipolar waveforms from circularized compact binaries  

SciTech Connect (OSTI)

We improve and generalize a resummation method of post-Newtonian multipolar waveforms from circular (nonspinning) compact binaries introduced in Refs. 1,2. One of the characteristic features of this resummation method is to replace the usual additive decomposition of the standard post-Newtonian approach by a multiplicative decomposition of the complex multipolar waveform h{sub lm} into several (physically motivated) factors: (i) the Newtonian waveform, (ii) a relativistic correction coming from an 'effective source', (iii) leading-order tail effects linked to propagation on a Schwarzschild background, (iv) a residual tail dephasing, and (v) residual relativistic amplitude corrections f{sub lm}. We explore here a new route for resumming f{sub lm} based on replacing it by its l-th root: {rho}{sub lm}=f{sub lm}{sup 1/l}. In the extreme-mass-ratio case, this resummation procedure results in a much better agreement between analytical and numerical waveforms than when using standard post-Newtonian approximants. We then show that our best approximants behave in a robust and continuous manner as we deform them by increasing the symmetric mass ratio {nu}{identical_to}m{sub 1}m{sub 2}/(m{sub 1}+m{sub 2}){sup 2} from 0 (extreme-mass-ratio case) to 1/4 (equal-mass case). The present paper also completes our knowledge of the first post-Newtonian corrections to multipole moments by computing ready-to-use explicit expressions for the first post-Newtonian contributions to the odd-parity (current) multipoles.

Damour, Thibault [Institut des Hautes Etudes Scientifiques, 91440 Bures-sur-Yvette (France); ICRANet, 65122 Pescara (Italy); Iyer, Bala R. [Institut des Hautes Etudes Scientifiques, 91440 Bures-sur-Yvette (France); Raman Research Insitute, Bangalore 560 080 (India); Nagar, Alessandro [Institut des Hautes Etudes Scientifiques, 91440 Bures-sur-Yvette (France); ICRANet, 65122 Pescara (Italy); INFN, Sezione di Torino, Via Pietro Giuria 1, Torino (Italy)

2009-03-15T23:59:59.000Z

244

Anisotropic Circular Dichroism Signatures of Oriented Thylakoid Membranes and Lamellar Aggregates of LHCII  

SciTech Connect (OSTI)

In photosynthesis research, circular dichroism (CD) spectroscopy is an indispensable tool to probe molecular architecture at virtually all levels of structural complexity. At the molecular level, the chirality of the molecule results in intrinsic CD; pigment-pigment interactions in protein complexes and small aggregates can give rise to excitonic CD bands, while 'psi-type' CD signals originate from large, densely packed chiral aggregates. It has been well established that anisotropic CD (ACD), measured on samples with defined non-random orientation relative to the propagation of the measuring beam, carries specific information on the architecture of molecules or molecular macroassemblies. However, ACD is usually combined with linear dichroism and can be distorted by instrumental imperfections, which given the strong anisotropic nature of photosynthetic membranes and complexes, might be the reason why ACD is rarely studied in photosynthesis research. In this study, we present ACD spectra, corrected for linear dichroism, of isolated intact thylakoid membranes of granal chloroplasts, washed unstacked thylakoid membranes, photosystem II (PSII) membranes (BBY particles), grana patches, and tightly stacked lamellar macroaggregates of the main light-harvesting complex of PSII (LHCII). We show that the ACD spectra of face- and edge-aligned stacked thylakoid membranes and LHCII lamellae exhibit profound differences in their psi-type CD bands. Marked differences are also seen in the excitonic CD of BBY and washed thylakoid membranes. Magnetic CD (MCD) spectra on random and aligned samples, and the largely invariable nature of the MCD spectra, despite dramatic variations in the measured isotropic and anisotropic CD, testify that ACD can be measured without substantial distortions and thus employed to extract detailed information on the (supra)molecular organization of photosynthetic complexes. An example is provided showing the ability of CD data to indicate such an organization, leading to the discovery of a novel crystalline structure in macroaggregates of LHCII.

Miloslavina Y.; Hind G.; Lambrev, P. H.; Javorfi, T.; Varkonyi, Z.; Karlicky, V.; Wall, J. S.; Garab, G.

2012-03-01T23:59:59.000Z

245

Experimental Investigations of Mixing?Processes in The Wake of A Circular Cylinder in Stratified Flows  

Science Journals Connector (OSTI)

The existence of oxygen?rich saltwater in the deeper basins of the Baltic Sea is mainly caused by sporadic inflow?events of salty and oxygen?rich saltwater from the North Sea into the Baltic Sea. These inflows take place over the narrow and shallow Drogden Sill into the first basin the Arkona Sea. Actually different offshore wind farms are planned in this region which opens a whole string of questions about the ecological influence of offshore wind farms on the mixing of both layers. To answer these questions numerical simulations of the mixing processes in the wake of wind turbine bases have been carried out. For the evaluation and quantification of these mixing processes a laboratory?experiment with a simplified model of the natural configuration has been realized. For this purpose a new water?channel has been build. This channel allows to simulate the inflow of saltwater in a size?scale of 1:100 to reality by keeping the densimetric Froude?Number. The experimental configuration consists of a long circular cylinder with a diameter of 8 cm in a 10 cm thick saltwater?layer flowing under a stationary fresh?water layer of 30 cm thickness. Focus point of this investigation is the wake of the cylinder in the stratified flow and the mixing?processes in the shear?layer due to the influence of the cylinder. The stratified flow around the cylinder induces the typical Karman?vortex wake horseshoe?vortices at the bottom and in the shear layer and Kelvin?Helmholtz?instabilities in the shear?layer. Nonintrusive optical measurements were taken with planar laser?induced fluorescence (PLIF) combined with two dimensional particle imaging velocimetry (PIV). The combination of both techniques allows the determination of instantaneous velocity components u and w from PIV?measurements the salinity s from PLIF?experiments their variations u? w? s? and the correlations of those like Reynolds?stress terms (u?u? u?w? w?w?) and turbulent? or Reynolds?flux terms (w?s? u?s?). Especially the vertical Reynolds?flux w?s? is the characteristic parameter to evaluate entrainment?velocity and entrainment?coefficient.

Peter Menzel; Frank Hüttmann; Martin Brede; Alfred Leder

2007-01-01T23:59:59.000Z

246

A practical method for incorporating Real Options analysis into US federal benefit-cost analysis procedures  

E-Print Network [OSTI]

This research identifies how Real Options (RO) thinking might acceptably and effectively complement the current mandates for Benefit-Cost Analysis (BCA) defined by the Office of Management and Budget (OMB) in Circular A-94. ...

Rivey, Darren

2007-01-01T23:59:59.000Z

247

MEMORANDUM FOR HEADS OF DEPARTMENTAL ELEMENTS FROM:  

Energy Savers [EERE]

is stipulated and endorsed within OMB's Circular A-l 1. Given current fiscal dynamics (price of fuel and commodities), now more than ever, requests for 1 1 1 funding on projects...

248

Your Vital Records INTRODUCTION The Federal Emergency Management Agency's Federal Preparedness Circular 65 states "The  

Broader source: Energy.gov (indexed) [DOE]

Identify and Protect Identify and Protect Your Vital Records INTRODUCTION The Federal Emergency Management Agency's Federal Preparedness Circular 65 states "The protection and ready availability of electronic and hardcopy documents, references, records, and information systems needed to support essential functions under the full spectrum of emergencies is another critical element of a successful COOP plan. Agency personnel must have access to and be able to use these records and systems in conducting their essential functions." Each Federal agency is responsible for establishing a Vital Records Program for the identification and protection of those records needed for Continuity of Operations Plans (COOP) before, during,

249

Half of internal inductance plus poloidal beta and plasma position in a circular cross-section tokamak  

Science Journals Connector (OSTI)

A special analytical solution of the Grad–Shafranov equation (GSE) is presented with source functions, where the plasma pressure is linear in ? and the squared poloidal current has both a quadratic and a linear ? term. Half of internal inductance plus poloidal beta and plasma position have been calculated for a typical discharge of IR-T1 tokamak with circular cross-section. In the presented solution, six parameters are measured by the magnetic measurements. The calculated parameters approach the values measured by discrete magnetic coils in the middle of IR-T1 discharge.

A Rahimi-Rad; M Ghoranneviss; S Mohammadi; R Arvin

2012-01-01T23:59:59.000Z

250

Verification of Ni magnetic moment in GdNi2 Laves phase by magnetic circular dichroism measurement  

Science Journals Connector (OSTI)

Investigation of the magnetic moment of nickel in the polycrystal GdNi2 Laves phase was carried out by means of magnetic circular dichroism (MCD) in the core-level x-ray-absorption spectroscopy. It was revealed that the nickel magnetic moment originating from the 3d state (band) does exist and couples antiparallel to that of gadolinium whose MCD was observed at the M4,5 absorption edge. That is, nickel retains an intrinsic magnetic moment even in the Laves phase concentration. Furthermore, by analyzing in terms of sum rule, the contribution of spin and orbital magnetic moments to the magnetic moment was evaluated and discussed.

M. Mizumaki; K. Yano; I. Umehara; F. Ishikawa; K. Sato; A. Koizumi; N. Sakai; T. Muro

2003-04-09T23:59:59.000Z

251

Extremal Correlator of Three Vertex Operators for Circular Winding Strings in AdS5xS5  

E-Print Network [OSTI]

We study a three-point correlator of the three heavy vertex operators representing the circular winding string states which are point-like in AdS_5 and rotating with two spins and two winding numbers in S^5. We restrict ourselves to the case that two of the three vertex operators are located at the same point. We evaluate semiclassically the specific three-point correlator on a stationary splitting string trajectory which is mapped to the complex plane with three punctures. It becomes an extremal and 4d conformal invariant three-point correlator on the boundary. The marginality condition of the vertex operator is discussed.

Shijong Ryang

2011-09-15T23:59:59.000Z

252

Effects of symmetry on circular and linear magnetic dichroism in angle-resolved photoemission spectra of Gd/Y (0001) and Fe-Ni//Cu (001)  

SciTech Connect (OSTI)

We have observed circular and linear magnetic dichroism in angle- resolved photoemission spectra of 50-monolayer Gd film grown on Y(0001) and 6-monolayer Fe-Ni alloy films grown on Cu(001). The 4f level of Gd and the Fe 3p level of the Fe-Ni alloy were measured. A different geometry was used for the magnetic circular dichroism than was used to measure the magnetic linear dichroism. The geometries were chosen so that the shape of the magnetic circular dichroism is predicted to be equal to the shape of the magnetic linear dichroism for four-fold symmetric Fe-Ni/Cu(001) but not for three-fold symmetric Gd/Y(0001). Experimental results are presented. In this paper we examine the effect of symmetry (experimental geometry and sample geometry) on magnetic linear and circular dichroism in angle- resolved photoemission. In particular we chose separate geometries for measuring magnetic circular and magnetic linear dichroism. The geometries were chosen such that samples with four-fold symmetry about the sample normal may have magnetic circular and magnetic linear dichroism of the same shape. But samples with three-fold symmetry should not exhibit circular and magnetic linear dichroism of the same shape. The samples studied are three-fold symmetric Gd films grown on Y(0001) and four-fold symmetric Fe-Ni alloy grown on Cu(001). After presenting the methods of the experiment, we briefly review parts of a model of magnetic dichroism developed by Venus and coworkers and our specialization and extension of it, particularly for FeNi/Cu(001). We then show the results of our measurements.

Goodman, K.W.; Tobin, J.G.; Schumann, F.O. [Pennsylvania State Univ., University Park, PA (United States); Willis, R.F. [Pennsylvania State Univ., University Park, PA (United States); Gammon, J.W. [Virginia Commonwealth Univ., Richmond, VA (United States); Pappas, D.P. [Virginia Commonwealth Univ., Richmond, VA (United States); Kortright, J.B. [Lawrence Berkeley National Lab., CA (United States); Denlinger, J.D. [Lawrence Berkeley National Lab., CA (United States); Rotenberg, E. [Lawrence Berkeley National Lab., CA (United States); Warwick, A. [Lawrence Berkeley National Lab., CA (United States); Smith, N.V. [Lawrence Berkeley National Lab., CA (United States)

1997-03-26T23:59:59.000Z

253

Data:D0a76e5d-0a12-4abf-a5f5-9800c617ab12 | Open Energy Information  

Open Energy Info (EERE)

a76e5d-0a12-4abf-a5f5-9800c617ab12 a76e5d-0a12-4abf-a5f5-9800c617ab12 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Austin Energy Effective date: End date if known: Rate name: Large Primary Service - Industrial Sector: Industrial Description: * This rate is applicable to electric service required by any customer who receives service at 12,500 volts (nominal) or higher and whose demand for power meets or exceeds 3,000 kilowatts for any two months within the previous twelve months or as determined by the City of Austin. This rate is also available for buildings, parks, and other establishments owned and operated by the City of Austin that implement conservation and peak shaving technologies, such as thermal energy storage systems.

254

Data:D9157b31-4e5c-45e0-999a-de2fa3a76a44 | Open Energy Information  

Open Energy Info (EERE)

7b31-4e5c-45e0-999a-de2fa3a76a44 7b31-4e5c-45e0-999a-de2fa3a76a44 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Sawnee Electric Membership Corporation Effective date: 2012/06/01 End date if known: Rate name: Outdoor Lighting Cobrahead/Ornamental MH 175 W Sector: Lighting Description: *Wood Poles a. Prior to construction, the requesting party will be required to pay a one-time, non-refundable, contribution-in-aid of construction (CIAC) as outlined below; i. $600 per 30 foot wood pole, ii. $625 per 35 foot wood pole, Standard Ornamental Fixtures and Standard Ornamental Poles a. Prior to construction, the requesting party will be required to pay a one-time, non-refundable, contribution-in-aid of construction (CIAC) as outlined below; i. $ 525 per 22 foot fiberglass pole; ii. $1,450 per 35 foot fiberglass pole;

255

Data:A5bfb05f-17f4-4a76-a7f9-2d3d6834e48f | Open Energy Information  

Open Energy Info (EERE)

bfb05f-17f4-4a76-a7f9-2d3d6834e48f bfb05f-17f4-4a76-a7f9-2d3d6834e48f No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Electrical Dist No4 Pinal Cnty Effective date: 2009/01/01 End date if known: Rate name: Night Light Rate- 2X250 W DBL Fix HPS Sector: Lighting Description: Source or reference: ISU Documentation Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous 1 2 3 Next >> << Previous

256

Evaluation of the TE12 mode in circular waveguide for low-loss, high-power rf transmission  

Science Journals Connector (OSTI)

The use of TE12 in circular waveguide with smooth walls was suggested for low-loss transport of rf signals in multimoded systems [S. G. Tantawi et al., in Advanced Accelerator Concepts: Eighth Workshop, edited by Wes Lawson, AIP Conf. Proc. No. 472 (AIP, New York, 1999), pp. 967–974]. Such systems use the same waveguide to transport different signals over different modes. In this report we detail a series of experiments designed to measure the characteristics of this mode. We also describe the different techniques used to generate it and receive it. The experiments were done at X band around a frequency of 11.424 GHz, the frequency of choice for future linear colliders at X band [The NLC Design Group, Report No. LBNL-PUB-5424, SLAC Report No. 474, Report No. UCRL-ID 124161, 1996; The JLC Design Group, KEK-REPORT-97-1, 1997]. The transportation medium is 55 m of highly overmoded circular waveguide. The design of the joining flanges is also presented.

Sami G. Tantawi, C. D. Nantista, G. B. Bowden, K. S. Fant, N. M. Kroll, A. E. Vlieks, Y.-H. Chin, H. Hayano, V. F. Vogel, and J. Nielson

2000-08-03T23:59:59.000Z

257

Award Number: Federal Non-Federal Federal Non-Federal Total  

Broader source: Energy.gov (indexed) [DOE]

Prescribed by OMB Circular A-102 Prescribed by OMB Circular A-102 Previous Edition Usable Total (5) f. Contractual g. Construction Section B - Budget Categories Catalog of Federal Domestic Assistance Number Grant Program Function or Activity Estimated Unobligated Funds e. Supplies i. Total Direct Charges (sum of 6a-6h) Grant Program, Function or Activity Object Class Categories Authorized for Local Reproduction h. Other a. Personnel b. Fringe Benefits c. Travel d. Equipment 6. j. Indirect Charges k. Totals (sum of 6i-6j) Program Income Applicant Name: Budget Information - Non Construction Programs OMB Approval No. 0348-0044 New or Revised Budget Section A - Budget Summary

258

Experimental and Theoretical Study on Circular Disk Particles Suspended in Centrifugal and Non-Centrifugal Force Environments  

SciTech Connect (OSTI)

Theoretical and experimental studies are performed on suspension particle motion in Centrifugal and Non-Centrifugal Force Environment, i.e., in both an axially rotating drum and a stable liquid tank. The particle velocity of circular disks is measured by PTV (Particle Tracking Velocimetry) method and is predicted by BBO (Basset-Boussinesq-Ossen) equation. It is found that (1) as time progresses, one side of the disk in the axially rotating drum is attracted toward the drum wall and its velocity is affected by the rotating speed, (2) when the particle moves in the Stokes' regime, its velocity is linearly increased with the distance from the center of the drum, (3) in contrast, the autorotation of the disk occurs in the non-centrifugal force field, and (4) the corresponding drag coefficient in the low Reynolds number region is in good agreement with the theoretical value of the sphere.

Torii, Shuichi [Department of Mechanical System Engineering, Kumamoto University (Japan); Watanabe, Yoshimi [Department of Engineering Physics, Electronics and Mechanics, Nagoya Institute of Technology (Japan); Tanaka, Satoyuki; Yano, Toshiaki; Iino, Naoko [Depertment of Mechanical Engineering, Kagoshima University (Japan)

2008-02-15T23:59:59.000Z

259

Unruh-DeWitt detector response along static and circular geodesic trajectories for Schwarzschild-AdS black holes  

E-Print Network [OSTI]

We present novel methods to numerically address the problem of characterizing the response of particle detectors in curved spacetimes. These methods allow for the integration of the Wightman function, at least in principle, in rather general backgrounds. In particular we will use this tool to further understand the nature of conformal massless scalar Hawking radiation from a Schwarzschild black hole in anti-de Sitter space. We do that by studying an Unruh-DeWitt detector at rest above the horizon and in circular geodesic orbit. The method allows us to see that the response rate shows peaks at certain characteristic frequencies, which correspond to the quasinormal modes (QNMs) of the space-time. It is in principle possible to apply these techniques to more complicated and interesting physical scenarios, e.g. geodesic infall or multiple detector entanglement evolution, or the study of the behaviour of quantum correlations in spacetimes with black hole horizons.

Keith K. Ng; Lee Hodgkinson; Jorma Louko; Robert B. Mann; Eduardo Martin-Martinez

2014-09-15T23:59:59.000Z

260

Circular geodesics of Bardeen and Ayon-Beato-Garcia regular black-hole and no-horizon spacetimes  

E-Print Network [OSTI]

We study circular geodesic motion of test particles and photons in the Bardeen and Ayon-Beato-Garcia (ABG) geometry describing spherically symmetric regular black-hole or no-horizon spacetimes. While the Bardeen geometry is not exact solution of Einstein's equations, the ABG spacetime is related to self-gravitating charged sources governed by Einstein's gravity and non-linear electrodynamics. They both are characterized by the mass parameter $m$ and the charge parameter $g$. We demonstrate that in similarity to the Reissner-Nordstrom (RN) naked singularity spacetimes an antigravity static sphere should exist in all the no-horizon Bardeen and ABG solutions that can be sorrounded by a Keplerian accretion disc. However, contrary to the RN naked singularity spacetimes, the ABG no-horizon spacetimes with parameter $g/m > 2$ can contain also an additional inner Keplerian disc hidden under the static antigravity sphere. Properties of the geodesic structure are reflected by simple observationally relevant optical phe...

Stuchlik, Zdenek

2015-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

DC response of hot carriers under circularly polarized intense microwave fields and intense magnetic fields in quantum wells  

SciTech Connect (OSTI)

Hot carrier dynamics under intense microwave and crossed magnetic fields are investigated theoretically for the case that the dominant scattering process is inelastic collision, especially intersubband and intrasubband transition in Quantum wells. If the applied electric fields are circularly polarized, the equation of motion forms symmetric on the x-y plane. But the carrier motions are complicated to accumulate because of acceleration and emission process. This situation makes possible to create a variation of the carrier motion, typically the carrier bunching is occurred. This state is a sort of population inversion. The DC response of this system attains strongly negative at appropriate field conditions. Through the simulation for the real case described below, it may include a type of induced emission.

Ishida, Norihisa, E-mail: ishida-norihisa@hotmail.com [Japan Electronics College, 1-25-5 Hyakunin-cho, Shinjuku-ku, Tokyo 169-8522 (Japan)

2013-12-04T23:59:59.000Z

262

Numerical modelling of a magnetic fluid-based squeeze film between rotating transversely rough curved circular plates  

Science Journals Connector (OSTI)

An attempt has been made to analyse the behaviour of a magnetic fluid-based squeeze film between two curved rough rotating circular plates when the curved upper plate lying along a surface determined by hyperbolic function approaches the curved lower plate along the surface governed by a secant function. The concerned Reynolds equation is solved with appropriate boundary conditions in dimensionless form to get the pressure distribution. The results show that the bearing system records a considerably enhanced performance as compared to that of the bearing system working with a conventional lubricant. This investigation suggests that although the bearing suffers owing to transverse roughness in general, there are some scopes for getting a relatively better performance in the case of negatively skewed roughness by properly choosing curvature parameters and the rotation ratio. Interestingly enough this positive effect further enhances especially when negative variance is involved.

G.M. Deheri; Nikhilkumar Abhangi

2011-01-01T23:59:59.000Z

263

Spin oscillations of relativistic fermions in the field of a traveling circularly polarized electromagnetic wave and a constant magnetic field  

E-Print Network [OSTI]

The Dirac equation, in the field of a traveling circularly polarized electromagnetic wave and a constant magnetic field, has singular solutions, corresponding the expansion of energy in vicinity of some singular point. These solutions described relativistic fermions. States relating to these solutions are not stationary. The temporal change of average energy, momentum and spin for single and mixed states is studied in the paper. A distinctive feature of the states is the disappearance of the longitudinal component of the average spin. Another feature is the equivalence of the condition of fermion minimal energy and the classical condition of the magnetic resonance. Finding such solutions assumes the use of a transformation for rotating and co-moving frames of references. Comparison studies of solutions obtained with the Galilean and non-Galilean transformation shown that some parameters of the non-Galilean transformation may be measured in high-energy physics.

Boris V. Gisin

2014-05-13T23:59:59.000Z

264

EMCORORG uses cross-correlation procedures to determine the location of the origin (center) of particles which appear circular in projection.  

E-Print Network [OSTI]

to produce the BATCH command procedure that computes the set of projections. After this is done, EMICOEMCORORG uses cross-correlation procedures to determine the location of the origin (center) of particles which appear circular in projection. This program can be implemented in one of three distinct

Baker, Timothy S.

265

B3 Trains Problem Statement The train problem assumes a circular track 101 miles in circumference. The track is labeled clockwise in  

E-Print Network [OSTI]

B3 Trains ­ Problem Statement The train problem assumes a circular track 101 miles in circumference be at the same spot as mile 0. One train starts at mile 0 going clockwise, another train starts at mile 100 going counterclockwise. The program prompts for speeds of each train in mph. The output is the mile (or fraction

Huth, Michael

266

Biology Lab 3: Small Scale Plasmid DNA Purification (Minipreps) Plasmids are small, circular pieces of DNA (about 3-5 kilobases in length on average) that  

E-Print Network [OSTI]

Biology Lab 3: Small Scale Plasmid DNA Purification (Minipreps) Plasmids are small, circular pieces. Plasmid purification procedures selectively enrich plasmid DNA over genomic DNA, which is present the small plasmids remain intact. Thus, when denatured, the plasmids remain linked to their complementary

267

INTERNATIONAL UNION OF OPERATING ENGINEERS NATIONAL HAZMAT PROGRAM - ADAMANT CIRCULAR SAW OENHP{number_sign}: 2001-05, VERSION A  

SciTech Connect (OSTI)

Florida International University's (FIU) Hemispheric Center for Environmental Technology (HCET) evaluated five saws for their effectiveness in cutting up specially prepared fiberglass-reinforced plywood crates. These crates were built as surrogates for crates that presently hold radioactive contaminated glove boxes at the Department of Energy's (DOE) Los Alamos facility. The Adamant circular saw was assessed on August 14, 2001. During the FIU test of efficacy, a team from the Operating Engineers National Hazmat Program (OENHP) evaluated the occupational safety and health issues associated with this technology. The Adamant was only used during a limited ''test'' on a regular plywood crate due to safety considerations of the tool for this application. The Adamant circular saw, a counter-rotating twin-cutter, constructed with blades that work differently than conventional cutting wheels with twin blades, each rotating in opposite directions. It is used to cut wood and metals. Each blade is approximately 8 3/4 inches in diameter with a maximum cutting depth of 2 1/2 inches. The machine has two rotation speeds: 1,900 and 2,900 rotations per minute (rpm). The saw is operated with an interlocked, guarded trigger switch located at the end of the saw opposite the cutting blades. To operate the saw, the safety interlock must be depressed prior to powering the saw with the trigger control. The saw is supported by a handle at the front of the saw near the cutting blades. The top part of the blades is guarded near the handle, with approximately three-fourths of the face of the blades exposed. The Adamant circular saw is an innovative technology used to cut metals and wood. Its safety features include: interlocking switch for powering the saw, overload indicator and shutoff, and an electronic brake that stops the engine immediately when the start button is released. The top part of the blades is guarded near the motor. With approximately three-fourths of the face of the blades open, the operator is exposed to the potential risk of serious and minor cuts and abrasions when using and handling the saw. There is also potential for damage to the blades if the saw is not stored properly. Without guarding on the lower part of the blades, these can be damaged if the saw is dropped or rested on the cutting blades. Based upon the industrial hygiene sampling conducted for the other four saws demonstrated at FIU, noise levels, nuisance dust, and airborne fiberglass may be a problem when using this technology for the cutting of fiberglass-reinforced plywood crates. No industrial hygiene sampling was conducted while the Adamant saw was in use. Engineering controls should be used to eliminate these problems whenever possible. Where this is not possible, administrative controls, training, and proper personal protective equipment (PPE) should be used. Respirators should be used if engineering controls do not sufficiently control the dust or fiberglass generated. Respirators should be equipped with an organic vapor and acid gas cartridge with High Efficiency Particulate Air (HEPA) filter, since during the demonstration, the workers complained of an odd smell, which may have been the breakdown of the fiberglass.

Unknown

2002-01-01T23:59:59.000Z

268

INTERNATIONAL UNION OF OPERATING ENGINEERS NATIONAL HAZMAT PROGRAM - EVOLUTION 180 CIRCULAR SAW OENHP: 2001-03, VERSION A  

SciTech Connect (OSTI)

Florida International University's (FIU) Hemispheric Center for Environmental Technology (HCET) evaluated five saws for their effectiveness in cutting specially prepared fiberglass-reinforced plywood crates. These crates were built as surrogates for crates that presently hold radioactively contaminated gloveboxes at the Department of Energy's (DOE) Los Alamos facility. The Evolution 180 circular saw was assessed on August 14, 2001. During the FIU test of efficacy, a team from the Operating Engineers National Hazmat Program (OENHP) evaluated the occupational safety and health issues associated with this technology. The Evolution 180 is a portable, metal cutting circular saw with a 7-inch diameter blade. The blade is contained within the main housing and has a retractable lower blade guard to prevent operator access to the blade during operation and shutdown. The saw is equipped with a chip collector. The maximum cutting thickness for metal is one-quarter inch and can cut steel tubing and pipe 2 inches in diameter. The unit is operated with an on/off guarded trigger switch and is supported with the hand guide mounted to the side of the saw. An adjustable lever sets the depth of the cut. The machine's circuitry will automatically shut the saw motor off if excessive overload is detected during operation. The one-half hour demonstration involved vertical and horizontal cuts and blade changes. During this process, operators experienced binding of the saw. This caused the blade to become hot, causing the sawdust collected in the chip collector to smoke. Care should be exercised to use the appropriate blade for the application, operator training, and personal protective equipment (PPE). Personal noise sampling indicated that neither worker was over the Occupational Safety and Health Administration's (OSHA) Action Level of 85 decibels (dBA) with time-weighted averages (TWA's) of 69.1 and 68.8 dBA. The personal noise sample taken during the special demonstration with the stainless steel plate had a TWA of 69.8 dBA. These data are not entirely representative as they were gathered during a simulation and not at the actual worksite. Additional sampling should be conducted on-site, but the workers should wear hearing protection until it is determined that it is no longer necessary. The total nuisance dust sample for the Evolution 180 circular saw was 3.5 milligrams per cubic meter (mg/m{sup 3}), which is lower than the OSHA Permissible Exposure Limit (PEL) of 15 mg/m{sup 3} and the American Conference of Governmental Industrial Hygienists' (ACGIH) Threshold Limit Value (TLV) of 10 mg/m{sup 3}. The fiber analysis yielded 1.74 fibers per cubic centimeter (f/cc), which is above the PEL of 1 f/cc. Although the nuisance dust levels were low, fiberglass dust levels were higher than the PEL. Since fiberglass dust is known to be a strong skin irritant and a possible human carcinogen, the workers should continue to wear appropriate suits and gloves, as well as a full-face air-purifying respirator. The respirator should be equipped with a combination organic vapor and acid gas cartridge in combination with a High Particulate Air (HEPA) filter, since particulate filter, since during the demonstration, the workers complained of an odd smell, which may have been from the breakdown of the fiberglass.

Unknown

2002-01-25T23:59:59.000Z

269

Variable Circular Collimator in Robotic Radiosurgery: A Time-Efficient Alternative to a Mini-Multileaf Collimator?  

SciTech Connect (OSTI)

Purpose: Compared with many small circular beams used in CyberKnife treatments, beam's eye view-shaped fields are generally more time-efficient for dose delivery. However, beam's eye view-shaping devices, such as a mini-multileaf collimator (mMLC), are not presently available for CyberKnife, although a variable-aperture collimator (Iris, 12 field diameters; 5-60 mm) is available. We investigated whether the Iris can mimic noncoplanar mMLC treatments using a limited set of principal beam orientations (nodes) to produce time-efficient treatment plans. Methods and Materials: The data from 10 lung cancer patients and the beam-orientation optimization algorithm 'Cycle' were used to generate stereotactic treatment plans (3 x 20 Gy) for a CyberKnife virtually equipped with a mMLC. Typically, 10-16 favorable beam orientations were selected from 117 available robot node positions using beam's eye view-shaped fields with uniform fluence. Second, intensity-modulated Iris plans were generated by inverse optimization of nonisocentric circular candidate beams targeted from the same nodes selected in the mMLC plans. The plans were evaluated using the mean lung dose, lung volume receiving {>=}20 Gy, conformality index, number of nodes, beams, and monitor units, and estimated treatment time. Results: The mMLC plans contained an average of 12 nodes and 11,690 monitor units. For a comparable mean lung dose, the Iris plans contained 12 nodes, 64 beams, and 21,990 monitor units. The estimated fraction duration was 12.2 min (range, 10.8-13.5) for the mMLC plans and 18.4 min (range, 12.9-28.5) for the Iris plans. In contrast to the mMLC plans, the treatment time for the Iris plans increased with an increasing target volume. The Iris plans were, on average, 40% longer than the corresponding mMLC plans for small targets (<80 cm{sup 3}) and {<=}121% longer for larger targets. For a comparable conformality index, similar results were obtained. Conclusion: For stereotactic lung irradiation, time-efficient and high-quality plans were obtained for robotic-controlled noncoplanar treatments using a mMLC. Iris is a time-efficient alternative for small targets, with similar or better plan quality.

Water, Steven van de, E-mail: s.vandewater@erasmusmc.nl [Department of Radiation Oncology, Erasmus Medical Center-Daniel den Hoed Cancer Center, Rotterdam (Netherlands); Hoogeman, Mischa S.; Breedveld, Sebastiaan; Nuyttens, Joost J.M.E. [Department of Radiation Oncology, Erasmus Medical Center-Daniel den Hoed Cancer Center, Rotterdam (Netherlands); Schaart, Dennis R. [Department of Radiation Detection and Medical Imaging, Delft University of Technology, Delft (Netherlands); Heijmen, Ben J.M. [Department of Radiation Oncology, Erasmus Medical Center-Daniel den Hoed Cancer Center, Rotterdam (Netherlands)

2011-11-01T23:59:59.000Z

270

Effects of alpha beam on the parametric decay of a parallel propagating circularly polarized Alfven wave: Hybrid simulations  

SciTech Connect (OSTI)

Alfven waves with a finite amplitude are found to be unstable to a parametric decay in low beta plasmas. In this paper, the parametric decay of a circularly polarized Alfven wave in a proton-electron-alpha plasma system is investigated with one-dimensional (1-D) hybrid simulations. In cases without alpha particles, with the increase of the wave number of the pump Alfven wave, the growth rate of the decay instability increases and the saturation amplitude of the density fluctuations slightly decrease. However, when alpha particles with a sufficiently large bulk velocity along the ambient magnetic field are included, at a definite range of the wave numbers of the pump wave, both the growth rate and the saturation amplitude of the parametric decay become much smaller and the parametric decay is heavily suppressed. At these wave numbers, the resonant condition between the alpha particles and the daughter Alfven waves is satisfied, therefore, their resonant interactions might play an important role in the suppression of the parametric decay instability.

Gao, Xinliang; Lu, Quanming; Tao, Xin; Hao, Yufei; Wang, Shui [CAS Key Laboratory of Geospace Environment, Department of Geophysics and Planetary Science, University of Science and Technology of China, Hefei 230026 (China)] [CAS Key Laboratory of Geospace Environment, Department of Geophysics and Planetary Science, University of Science and Technology of China, Hefei 230026 (China)

2013-09-15T23:59:59.000Z

271

Cadmium binding studies to the earthworm Lumbricus rubellus metallothionein by electrospray mass spectrometry and circular dichroism spectroscopy  

SciTech Connect (OSTI)

The earthworm Lumbricus rubellus has been found to inhabit cadmium-rich soils and accumulate cadmium within its tissues. Two metallothionein (MT) isoforms (1 and 2) have been identified and cloned from L. rubellus. In this study, we address the metalation status, metal coordination, and structure of recombinant MT-2 from L. rubellus using electrospray ionization mass spectrometry (ESI-MS), UV absorption, and circular dichroism (CD) spectroscopy. This is the first study to show the detailed mass and CD spectral properties for the important cadmium-containing earthworm MT. We report that the 20-cysteine L. rubellus MT-2 binds seven Cd{sup 2+} ions. UV absorption and CD spectroscopy and ESI-MS pH titrations show a distinct biphasic demetalation reaction, which we propose results from the presence of two metal-thiolate binding domains. We propose stoichiometries of Cd{sub 3}Cys{sub 9} and Cd{sub 4}Cys{sub 11} based on the presence of 20 cysteines split into two isolated regions of the sequence with 11 cysteines in the N-terminal and 9 cysteines in the C-terminal. The CD spectrum reported is distinctly different from any other metallothionein known suggesting quite different binding site structure for the peptide.

Ngu, Thanh T. [Department of Chemistry, University of Western Ontario, London, Ont., N6A 5B7 (Canada); Sturzenbaum, Stephen R. [School of Biomedical and Health Sciences, King's College, London, SE1 9NH (United Kingdom); Stillman, Martin J. [Department of Chemistry, University of Western Ontario, London, Ont., N6A 5B7 (Canada)]. E-mail: Martin.Stillman@uwo.ca

2006-12-08T23:59:59.000Z

272

Shliomis model-based magnetic squeeze film in rotating rough curved circular plates: a comparison of two different porous structures  

Science Journals Connector (OSTI)

This study aims to analyse the effect of different porous structures on the performance of a Shliomis model-based magnetic squeeze film in rotating rough porous curved circular plates. For porous structures Kozeny-Carman's formulation and Irmay's model have been adopted. A Shliomis model-based magnetic fluid flow is considered. The stochastically averaging models of Christensen and Tonder have been used for characterising the effect of transverse roughness. The associated stochastically averaged Reynolds type equation is solved to obtain the pressure distribution leading to the calculation of the load carrying capacity. The results presented in graphical form show that the adverse effect of transverse roughness can be compensated by the positive effect of magnetisation in the case of negatively skewed roughness, suitably choosing the rotation ratio and the curvature parameters. Further, this compensation appears to be more in the case of Kozeny-Carman's formulation as compared to that of Irmay's model, which makes the Kozeny-Carman's model a superior choice.

Jimit R. Patel; Gunamani Deheri

2014-01-01T23:59:59.000Z

273

Generation of ultraintense proton beams by multi-ps circularly polarized laser pulses for fast ignition-related applications  

SciTech Connect (OSTI)

A scheme of generation of ultraintense proton beams relevant for proton fast ignition (PFI) which employs multi-ps, circularly polarized laser pulse irradiating a thick ({>=} 10 {mu}m) H-rich target is proposed and examined using one-dimensional particle-in cell-simulations. It is shown that a 5-ps laser pulse of intensity {approx} (2-5) x 10{sup 20}W/cm{sup 2} irradiating the target of the areal proton density {approx} 2 x 10{sup 20}cm{sup -2} can produce - with a high energetic efficiency - a proton beam (plasma block) of parameters (intensity, energy fluence, pulse duration, proton energy spectrum) close to those required for PFI. At a fixed total laser energy, the proton beam parameters can be controlled and fitted to the PFI requirements by changing the laser intensity (energy fluence) and/or the target thickness as well as by using a shaped (curved) target inserted into a guiding cone.

Badziak, J. [Institute of Plasma Physics and Laser Microfusion, Euratom Association, 01-497 Warsaw (Poland); Mishra, G.; Gupta, N. K. [Theoretical Physics Division, Bhabha Atomic Research Centre, Mumbai 400 085 (India); Holkundkar, A. R. [Department of Physics, Umeaa University (Sweden)

2011-05-15T23:59:59.000Z

274

INTERNATIONAL UNION OF OPERATING ENGINEERS NATIONAL HAZMAT PROGRAM - MILWAUKEE WORM DRIVE CIRCULAR SAW OENHP{number_sign}: 2001-02, VERSION A  

SciTech Connect (OSTI)

Florida International University's (FIU) Hemispheric Center for Environmental Technology (HCET) evaluated five saws for their effectiveness in cutting specially prepared fiberglass-reinforced plywood crates. These crates were built as surrogates for crates that presently hold radioactively contaminated glove boxes at the Department of Energy's (DOE) Los Alamos facility. The Milwaukee worm drive circular saw was assessed on August 14, 2001. During the FIU test of efficacy, a team from the Operating Engineers National Hazmat Program (OENHP) evaluated the occupational safety and health issues associated with this technology. The Milwaukee worm drive circular saw is a hand-held tool with a 7 1/4-inch diameter circular blade for cutting wood. The saw contains a fixed upper and a retractable lower blade guard to prevent access to the blade during use. The unit is operated with an on/off guarded trigger switch; and is supported with a handgrip mounted on top of the saw. An adjustable lever sets the depth of cut. The retractable blade guard permits blind or plunge cuts and protects from blade access during shutdown and blade coast. Kickback, the sudden reaction to a pinched blade, is possible when using this saw and could cause the saw to lift up and out of the work piece toward the operator. Proper work position and firm control of the saw minimizes the potential for a sprain or strain. Care needs to be exercised to support the work piece properly and to not force the tool. Personal noise sampling indicated that one worker was near the Occupational Safety and Health Administration's (OSHA) Action Level of 85 decibels (dBA) while the other was at the Action Level with time-weighted averages (TWA's) of 82.7 and 84.6 dBA, respectively. These data are not entirely representative as they were gathered during a simulation and not at the actual worksite. Additional sampling should be conducted on-site, but the workers should wear hearing protection until it is determined that it is no longer necessary. Air sampling was performed while the workers dismantled the fiberglass-reinforced crates. The total nuisance dust sample for the Milwaukee circular saw was 36.07 milligrams per cubic meter (mg/m{sup 3}), which is much higher than the OSHA Permissible Exposure Limit (PEL) of 15 mg/m{sup 3} and the American Conference of Governmental Industrial Hygienists' (ACGIH) Threshold Limit Value (TLV) of 10 mg/m{sup 3}. Galson Laboratories considered the fiber analysis void due to the overloading of the filter. The PEL for fiberglass is 1 fiber per cubic centimeter (f/cc).

Unknown

2002-01-05T23:59:59.000Z

275

Energy dependence of the parity-violating asymmetry of circularly polarized photons in $d\\vec? \\to np$ in pionless effective field theory  

E-Print Network [OSTI]

We calculate the energy dependence of the asymmetry in the cross sections for circularly polarized photons on an unpolarized deuteron target in $d\\vec{\\gamma} \\to np$ in pionless effective field theory. By matching the parity-violating low-energy constants to different sets of corresponding model parameters we obtain estimates for the asymmetry. In addition we calculate two possible figures of merit for the asymmetry in order to assess the preferred photon energy at which to perform a possible future experiment at a high-intensity photon source.

Jared Vanasse; Matthias R. Schindler

2014-10-28T23:59:59.000Z

276

INTERNATIONAL UNION OF OPERATING ENGINEERS NATIONAL HAZMAT PROGRAM - PORTER-CABLE CIRCULAR SAW OENHP: 2001-04, VERSION A  

SciTech Connect (OSTI)

Florida International University's (FIU) Hemispheric Center for Environmental Technology (HCET) evaluated five saws for their effectiveness in cutting specially prepared fiberglass-reinforced plywood crates. These crates were built as surrogates for crates that presently hold radioactively contaminated glove boxes at the Department of Energy's (DOE) Los Alamos facility. The Porter-Cable circular saw was assessed on August 15-16, 2001 (Porter-Cable No.1 and Porter-Cable No.2, respectively). During the FIU test of efficacy, a team from the Operating Engineers National Hazmat Program (OENHP) evaluated the occupational safety and health issues associated with this technology. The Porter-Cable saw is a straightforward machine for cutting wood of varying thickness. The blade is fully guarded with a fixed upper and a lower retractable guard. The lower guard retracts as the blade engages the work piece. The unit is operated with an on/off guarded trigger switch and is supported with a handgrip mounted near the front of the saw. The saw is equipped with a directional nozzle, which aims sawdust away from the operator and the line of cut. An optional vacuum system, attached to the directional nozzle, is used to remove and collect dust. During the demonstration of Porter-Cable No.1, personal noise sampling indicated that one worker was under and one was at the Occupational Safety and Health Administration's (OSHA) Action Level of 85 decibels (dBA) with time-weighted averages (TWA's) of 82.7 and 84.6 dBA, respectively. During the demonstration of Porter-Cable No.2, however, both workers did exceed the Action Level with TWA's of 89.7 and 90.0 dBA. These data are not entirely representative as they were gathered during a simulation and not at the actual worksite. Additional sampling should be conducted on-site, but the workers should wear hearing protection until it is determined that it is no longer necessary. The total nuisance dust sample for Porter-Cable No.1 was 3.53 milligrams per cubic meter (mg/m{sup 3}), which is lower than the OSHA Permissible Exposure Limit (PEL) of 15 mg/m{sup 3} and the American Conference of Governmental Industrial Hygienists' (ACGIH) Threshold Limit Value (TLV) of 10 mg/m{sup 3}. Porter-Cable No.2's nuisance dust results yielded a value of 22.05 mg/m{sup 3}, which is over the PEL and TLV. The fiber analysis for the first demonstration yielded 12.9 fibers per cubic centimeter (f/cc), which is much higher than the PEL of 1 f/cc. Galson Laboratories considered the fiber analysis for the second demonstration void due to the overloading of dust on the filter. Kickback, the sudden reaction to a pinched blade, is possible with this saw and could cause the saw to lift up and out of the work piece and toward the operator. Proper work position and firm control of the saw minimizes the potential for a sprain or strain. Care needs to be exercised to support the work piece properly and to not force the tool.

Unknown

2002-01-15T23:59:59.000Z

277

Heat transfer and friction factor analysis in a circular tube with Al2O3 nanofluid by using computational fluid dynamics  

Science Journals Connector (OSTI)

Turbulent fully developed flow heat transfer coefficient and friction factor of Al2O3 nanoparticles are dispersed in water and ethylene glycol in circular tube is discussed in this paper. In order to validate the heat transfer coefficient and friction factor of nanofluid in circular tube commercially available CFD software FLUENT 6.0 is used. To achieve the fully developed flow condition, the aspect ratio (L/D) of the test section is equal to 94. The thermo-physical properties of the Al2O3 nanofluid are estimated by using the equations available in literature. Thermo-physical properties of the nanofluid are considered for heat transfer coefficient and friction factor by assuming nanofluid is a single-phase fluid. Constant Wall Heat Flux (CWHF) boundary condition is incorporated for heat transfer analysis and adiabatic boundary condition is incorporated for friction factor analysis. The analysis is conducted in the volume concentration range from 0.1% to 4%. A maximum of 2.25 times heat transfer enhancement and 1.42 times of friction is obtained by using nanofluid as working medium.

L. Syam Sundar; K.V. Sharma; Shabana Parveen

2009-01-01T23:59:59.000Z

278

AcqGuide42pt1.doc  

Broader source: Energy.gov (indexed) [DOE]

Chapter 42.1 (December 2004) Chapter 42.1 (December 2004) 1 Indirect Cost Rate Administration References * FAR 31. * DEAR 931. * FAR 42.7. * DEAR 942.7. * Title 10 CFR 600, DOE Financial Assistance Rules. * OMB Circular A-21, Cost Principles for Educational Institutions. * OMB Circular A-87, Cost Principles for State, Local, and Indian Tribal Governments. * OMB Circular A-122, Cost Principles for Nonprofit Organizations. Overview This section discusses the Department's procedures for the administration of contractor overhead costs, general and administrative expenses, and rates for DOE awarded contracts and financial assistance instruments. Terminology The following terminology is used in the day-to-day administration of indirect cost rate issues.

279

AcqGuide42pt1.doc  

Broader source: Energy.gov (indexed) [DOE]

October 2010) October 2010) 1 Indirect Cost Rate Administration References FAR 31. DEAR 931. FAR 42.7. DEAR 942.7. Title 10 CFR 600, DOE Financial Assistance Rules. OMB Circular A-21, Cost Principles for Educational Institutions. OMB Circular A-87, Cost Principles for State, Local, and Indian Tribal Governments. OMB Circular A-122, Cost Principles for Nonprofit Organizations. Overview This section discusses the Department's procedures for the administration of contractor overhead costs, general and administrative (G&A) expenses, and rates for DOE awarded contracts and financial assistance instruments. Terminology The following terminology is used in the day-to-day administration of indirect cost rate issues. Predominant Financial Interest - A term used to determine which Federal agency has the

280

End station for nanoscale magnetic materials study: Combination of scanning tunneling microscopy and soft X-ray magnetic circular dichroism spectroscopy  

SciTech Connect (OSTI)

We have constructed an end station for nanoscale magnetic materials study at the soft X-ray beamline HiSOR BL-14 at Hiroshima Synchrotron Radiation Center. An ultrahigh-vacuum scanning tunneling microscope (STM) was installed for an in situ characterization of nanoscale magnetic materials in combination with soft X-ray magnetic circular dichroism (XMCD) spectroscopy experiment. The STM was connected to the XMCD experimental station via damper bellows to isolate it from environmental vibrations, thus achieving efficient spatial resolution for observing Si(111) surface at atomic resolution. We performed an in situ experiment with STM and XMCD spectroscopy on Co nanoclusters on an Au(111) surface and explored its practical application to investigate magnetic properties for well-characterized nanoscale magnetic materials.

Ueno, Tetsuro; Sawada, Masahiro; Namatame, Hirofumi [Hiroshima Synchrotron Radiation Center, Hiroshima University, 2-313 Kagamiyama, Higashi-Hiroshima 739-0046 (Japan); Kishimizu, Yusuke; Kimura, Akio [Graduate School of Science, Hiroshima University, 1-3-1 Kagamiyama, Higashi-Hiroshima 739-8526 (Japan); Taniguchi, Masaki [Hiroshima Synchrotron Radiation Center, Hiroshima University, 2-313 Kagamiyama, Higashi-Hiroshima 739-0046 (Japan); Graduate School of Science, Hiroshima University, 1-3-1 Kagamiyama, Higashi-Hiroshima 739-8526 (Japan)

2012-12-15T23:59:59.000Z

Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

Theoretical Fe L2,3- and K-edge x-ray magnetic circular dichroism spectra of free iron clusters  

Science Journals Connector (OSTI)

A fully relativistic ab initio theoretical scheme is employed for investigating L2,3- and K-edge x-ray absorption near-edge structure (XANES) and x-ray magnetic circular dichroism (XMCD) spectra of free Fe clusters of 9–89 atoms. The L2,3-edge spectra of clusters differ from spectra of bulk only quantitatively; a higher degree of localization of the d electrons in clusters is reflected through a higher intensity of the main XANES and XMCD peaks at the absorption edge. The K-edge XANES and XMCD spectra of clusters, on the other hand, differ from their bulk counterparts more significantly, even for the largest clusters investigated within our study. Several features, which could serve as spectroscopic markers of the difference between the clusters and bulk, were identified in both the L2,3- and K-edge spectra. Contracting the bond lengths in clusters changes XMCD spectra only quantitatively.

Ond?ej Šipr and Hubert Ebert

2005-10-05T23:59:59.000Z

282

An Experimental Enquiry concerning the Natural Powers of Water and Wind to Turn Mills, and Other Machines, Depending on a Circular Motion. By Mr. J. Smeaton, F. R. S.  

Science Journals Connector (OSTI)

1759-1760 research-article An Experimental Enquiry concerning the Natural Powers of Water and Wind to Turn Mills, and Other Machines, Depending on a Circular Motion. By Mr. J. Smeaton, F. R. S. J. Smeaton The Royal Society is collaborating...

1759-01-01T23:59:59.000Z

283

The train problem assumes a circular track 101 miles in circumference. The track is labeled clockwise in miles starting at due north. ie. 0 through 100. Mile 101 would be at the same spot as mile 0.  

E-Print Network [OSTI]

A3: trains The train problem assumes a circular track 101 miles in circumference. The track as mile 0. Train1 starts at mile 0 going clockwise. Train2 starts at mile 50 also going clockwise. The program prompts for speeds of each train in mph. The output is the mile (or fraction) at which one train

Huth, Michael

284

A numerical investigation of wall effects up to high blockage ratios on two-dimensional flow past a confined circular cylinder  

Science Journals Connector (OSTI)

A finite volume method based on a velocity-only formulation is used to solve the flow field around a confined circular cylinder in a channel in order to investigate lateral wall proximity effects on stability Strouhal number hydrodynamic forces and wake structure behind the cylinder for a wide range of blockage ratios (0.1lift coefficient reveal that the oscillations are no longer symmetric in the rising and falling parts of each cycle. Very strong vortices shed from the cylinder and the wall cause drastic increases in the amplitudes of the lift and drag coefficients. A co-dimension 2 point where pitchfork and Hopf bifurcations occur simultaneously has been located in parameter space. Altogether four distinct regions in the parameter space (? Re)?(0 0.9]×(0 280] have been identified each corresponding to a different class of flow: (i) Steady symmetric flow (ii) symmetric vortex shedding (iii) steady asymmetric flow and (iv) asymmetric vortex shedding where a periodic-in-time flow is classed as symmetric or asymmetric depending on whether the time-average over one cycle of the lift coefficient is zero or not. Numerical solutions are computed on meshes having up to 1.8 million degrees of freedom. Extensive comparisons are made with the results available in the literature.

Mehmet Sahin; Robert G. Owens

2004-01-01T23:59:59.000Z

285

Drag force on a circular cylinder midway between two parallel plates at very low Reynolds numbers—Part 1: Poiseuille flow (numerical)  

Science Journals Connector (OSTI)

At very low Reynolds numbers, we calculate the drag force exerted on a circular cylinder in cross flow fixed midway between two parallel plane walls which are fixed while the fluid experiences a Poiseuille profile at upstream and downstream. The drag wall correction factor is numerically investigated from a very weak interaction to the lubrication regime. The Navier–Stokes and continuity equations are expressed in the stream function and vorticity formulation and are rewritten in an orthogonal system of curvilinear co-ordinates. These equations are solved with using a finite differences method. The generation of the grid was carried out by the singularities method. We calculated the separate contributions of the pressure and viscous forces numerically. At very weak interactions, our numerical results are in good agreement with those obtained analytically by Harrison (Trans. Camb. Phil. Soc. 23 (1924) 71) and Faxèn (Proc. Roy. Swed. Acad. Eng. Sci. 187 (1946) 1). In the lubrication regime these numerical calculations are in very good agreement with those we carried out by asymptotic expansion. So that, the accuracy of the numerical code is tested. This analysis allowed us to show how that the pressure term prevails over the viscosity term in the lubrication regime. At very weak interaction, these forces have the same value.

A Ben Richou; A Ambari; J.K Naciri

2004-01-01T23:59:59.000Z

286

Solution structure of a fragment of the dimerization domain of E2F-1 determined by circular dichroism, 1H nuclear magnetic resonance and distance geometry  

Science Journals Connector (OSTI)

The structure of a synthesized peptide with the sequence GVVDLNWAAEVLKVQKRRIYDITNVLEGIQ which corresponds to residues 149–178 of transcription factor E2F-1 was determined by 1H nuclear magnetic resonance in 40% d3-TFE/water. NOE cross peaks and ?H chemical shifts indicate that the peptide consists of a helix from Ala-8 to Leu-26 in this solution. Circular dichroism measurements confirm the presence of nearly 45% helix in TFE/water solution but show no evidence of helicity in water solution of this peptide. Fifty structures were constructed with 329 upper distance limits by DIANA. The 20 best conformers show a RMSD of 0.78 Å for backbone atoms and 1.78 Å for heavy atoms from residue Ala-8 to Leu-26. This result, together with our previous work on the solution structure of a fragment of DP-1, supports the proposal that E2F-1 and DP-1 may dimerize with a coiled-coil type interaction.

Shouhong Guang; Jihui Wu; Limei Tao; Youlin Xia; Yunyu Shi

1998-01-01T23:59:59.000Z

287

C:\Documents and Settings\Laura\Local Settings\temp\_11co1e84r3903c5ph.pdf  

Gasoline and Diesel Fuel Update (EIA)

SECTION SECTION A - BUDGET SUMMARY $ BUDGET INFORMATION - Non-Construction Programs OMB Number: 4040-0006 Expiration Date: 06/30/2014 Grant Program Function or Activity (a) Catalog of Federal Domestic Assistance Number (b) Estimated Unobligated Funds New or Revised Budget Federal (c) Non-Federal (d) Federal (e) Non-Federal (f) Total (g) 5. Totals 4. 3. 2. 1. $ $ $ $ $ $ $ $ $ Standard Form 424A (Rev. 7- 97) Prescribed by OMB (Circular A -102) Page 1 SECTION B - BUDGET CATEGORIES 7. Program Income d. Equipment e. Supplies f. Contractual g. Construction h. Other j. Indirect Charges k. TOTALS (sum of 6i and 6j) i. Total Direct Charges (sum of 6a-6h) (1) Authorized for Local Reproduction Prescribed by OMB (Circular A -102) Page 1A Standard Form 424A (Rev. 7- 97) GRANT PROGRAM, FUNCTION OR ACTIVITY

288

Audit Report: OAS-L-08-03 | Department of Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

03 03 Audit Report: OAS-L-08-03 December 11, 2007 The Department of Energy's Implementation of Revised OMB Circular No. A-123 The Office of Management and Budget's (OMB) revised Circular No. A-123 (A-123) requires Federal agencies to assess, document and test their internal controls over financial reporting and prepare an annual assurance statement on the operating effectiveness of those controls. The Department of Energy (Department), with approval from OMB, elected to use a three year phased approach to implement A-123. In Fiscal Year (FY) 2006, the first phase of its implementation, the Department focused on the highest risk activities with the potential for the greatest impact on the financial statement audit. Audit Report: OAS-L-08-03 More Documents & Publications

289

United States Government Memorandum  

Broader source: Energy.gov (indexed) [DOE]

Department of Energy United States Government Memorandum DATE: January 26, 2007 Audit Report Number: OAS-L-07-05 REPLY TO ATTN OF: IG-34 (A06GT035) SUBJECT: Report on "The Department of Energy's Implementation of Revised OMB Circular No. A-123" TO: Acting Chief Financial Officer, CF-1 INTRODUCTION AND OBJECTIVE The Office of Management arid Budget's (OMB) revised Circular No. A-123 (Circular) requires Federal agencies to assess the adequacy of their internal controls. Beginning in Fiscal Year (FY) 2006, the Circular requires agencies to strengthen their assessment, documentation and testing of internal controls over financial reporting and prepare an annual assurance statement on the operating effectiveness of those controls. In August 2005, the Department of Energy's

290

ISU Sponsored Programs Costing Policy Iowa State University  

E-Print Network [OSTI]

what costs are allowable on federally funded grants, contracts and cooperative agreements (collectively). These federal regulations require that the same types of costs be treated consistently as either direct costs and various sponsor rules and regulations. II. Definitions Direct Costs OMB Circular A-21, Section D.1, states

Daniels, Thomas E.

291

Minor ion heating in spectra of linearly and circularly polarized Alfvén waves: Thermal and non-thermal motions associated with perpendicular heating  

SciTech Connect (OSTI)

Minor ion (such as He{sup 2+}) heating via nonresonant interaction with spectra of linearly and circularly polarized Alfvén waves (LPAWs and CPAWs hereafter) is studied. The obtained analytic solutions are in good agreement with the simulation results, indicating that newborn ions are heated by low-frequency Alfvén waves with finite amplitude in low-beta plasmas such as the solar corona. The analytic solutions also reproduce the preferential heating of heavy ions in the solar wind. In the presence of parallel propagating Alfvén waves, turbulence-induced particle motion is clearly observed in the wave (magnetic field) polarized directions. After the waves diminish, the newborn ions are heated, which is caused by the phase difference (randomization) between ions due to their different parallel thermal motions. The heating is dominant in the direction perpendicular to the ambient magnetic field. The perpendicular heating, ?=(T{sub i?}{sup R}?T{sub i0?}{sup R})/T{sub i0?}{sup R} (where T{sub i0?}{sup R} and T{sub i?}{sup R} are the perpendicular temperature of species i before and after genuine heating, respectively), in the spectrum of CPAWs is a factor of two stronger than that of LPAWs. Moreover, we also study the effect of field-aligned differential flow speed of species i relative to H{sup +}, ?v{sub ip}=(v{sub i}?v{sub p})·B/|B| (where v{sub i} and v{sub p} denote vector velocities of the H{sup +} and species i, respectively), on the perpendicular heating. It reveals that large drift speed, v{sub d}=?v{sub ip}, has an effect on reducing the efficiency of perpendicular heating, which is consistent with observations.

Dong, Chuanfei, E-mail: dcfy@umich.edu [Department of Atmospheric, Oceanic and Space Sciences, University of Michigan, Ann Arbor, Michigan 48109 (United States) [Department of Atmospheric, Oceanic and Space Sciences, University of Michigan, Ann Arbor, Michigan 48109 (United States); Los Alamos National Laboratory, Los Alamos, New Mexico 87544 (United States)

2014-02-15T23:59:59.000Z

292

Drop of coherence of the lower kilo-Hz QPO in neutron stars: is there a link with the innermost stable circular orbit?  

E-Print Network [OSTI]

Using all available archival data from the Rossi X-ray Timing Explorer (RXTE), we follow the frequency of the kilo-Hz QPOs in three low luminosity neutron star low mass X-ray binaries; namely 4U 1636-536, 4U 1608-522, and 4U1735-44. Following earlier work, we focus our analysis on the lower kilo-Hz QPO, for which we study the dependency of its quality factor (Q) amplitude as a function of frequency over a range covering from 500 Hz to 1000 Hz. As previously found for 4U 1636-536, we show that the quality factor of the lower kilo-Hz increases with frequency up to a maximum frequency around 800 Hz, beyond which an abrupt drop of its coherence is observed down to a limiting frequency where the QPO disappears completely. Simultaneously the amplitude of the QPOs is almost constant below the peak frequency and starts to decrease smoothly afterwards. The peak frequency is 850 Hz, 820 Hz, 740 Hz whereas the limiting frequency is 920 Hz, 900 Hz and 830 Hz for 4U 1636-536, 4U 1608-522 and 4U 1735-44 respectively. A ceiling of the lower QPO frequencies is also seen clearly in a frequency versus count rate diagram for all sources. This behavior is reproducible within an object and between objects. We suggest here that the drop of coherence of the lower QPO may be a geometry-related effect, which could be related to the last stable circular orbit.

Didier Barret; Jean-Francois Olive; M. Coleman Miller

2005-10-04T23:59:59.000Z

293

THE VIBRATION OF CIRCULAR PLATES  

Science Journals Connector (OSTI)

...originals will be found in another article by one of the writers.1 Below them in Fig. 2 are the mathematical curves resulting from dFIG. 1. Actual sand patterns obtained. 1 Robert C. Colwell, Jour. Franklin Inst., 213: 373-380, 1932. substitution in...

R. C. COLWELL; J. K. STEWART; H. D. ARNETT

1940-11-01T23:59:59.000Z

294

Fluid forces on circular cylinders  

E-Print Network [OSTI]

hence tbe lateral oscillstim results, Although the frictional effect of tbe lower guide sywtea was never isolated~ its effect was deterained in e "total drag coefficient" and was subtracted frca tbe total resistance. This will be discussed in Nore... Carriage assembly ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ e ~ ~ ~ ~ ~ ~ ~ Frictional resistance of carriage versus normal loads on sheol bearings ~ ~ ~ o ~ ~ ~ s ~ ~ ~ ~ ~ ~ ~ ~ o e ~ ~ * ~ Scheme of spelling mechanism ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ librct'1on...

Dean, Robert G

2012-06-07T23:59:59.000Z

295

Paperwork Reduction Act Submission (OMB 83-I)  

Broader source: Energy.gov (indexed) [DOE]

PA PA PERW ORK REDUCTION A CT SUBM ISSION to: . 1. Agency/Subagency originating request b. None - a. a. a. Regular b. b. / / c. c. Delegated d. e. Yes N o f. a. b. / Yes N o 7. Title (Mark primary with "P" and all others that apply with "X") (Mark primary with "P" and all others that apply with "X") a. d. a. Voluntary b. e. b. c. f. c. % a. b. a. e. c. Reporting b. f. Research 1. 2. 3. c. General purpose statistics g. Regulatory or compliance 4. Quarterly 5. 6. d. 7. Biennially 8. Yes N o Phone: Please read the instructions before completing this form. For additional forms or assistance in completing this form, contact your agency's Paperwork Clearance Officer. Send two copies of this form, the collection instrument to be reviewed, the Supporting Statement, and any additional documentation

296

Paperwork Reduction Act Submission (OMB 83-I)  

Energy Savers [EERE]

18. Agen cy contact (person who can bes t ans we r qu es tion s reg ard ing the c on ten t of this Does this information collection employ statistical methods? submission) Nam...

297

DOE FAIR 2007 (OMB).xls  

Office of Environmental Management (EM)

I Z 1999 40 19-05 AL NNSA NM Albuquerque US 1 P119 I Z 1999 41 19-05 AL NNSA AZ Fort Smith US 1 T999 C B 1999 42 19-05 AL NNSA AZ Fort Smith US 1 T999 I Z 1999 43 19-05 AL NNSA...

298

FY 2011 Agency Financial Report  

Broader source: Energy.gov (indexed) [DOE]

Foreword Foreword he Reports Consolidation Act of 2000 authorizes Federal agencies, with the Office of Management and Budget's (OMB) concurrence, to consolidate various reports in order to provide performance, financial and related information in a more meaningful and useful format. The Department of Energy (Department or DOE) has chosen an alternative reporting to the consolidated Performance and Accountability Report and instead, produces an Agency Financial Report, an Annual Performance Report and a Summary of Performance and Financial Information, pursuant to the OMB Circular A-136. This reporting approach simplifies and streamlines the performance presentations while utilizing the Internet for providing and leveraging additional performance

299

Agency Financial Reports | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Agency Financial Reports Agency Financial Reports Agency Financial Reports The Reports Consolidation Act of 2000 authorizes Federal agencies, with the Office of Management and Budget's (OMB) concurrence, to consolidate various reports in order to provide performance, financial and related information in a more meaningful and useful format. The Department of Energy (Department or DOE) has chosen an alternative reporting to the consolidated Performance and Accountability Report and instead, produces an Agency Financial Report, an Annual Performance Report and a Summary of Performance and Financial Information, pursuant to the OMB Circular A-136. This reporting approach simplifies and streamlines the performance presentations while utilizing the Internet for providing and leveraging

300

Agency Financial Reports | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Agency Financial Reports Agency Financial Reports Agency Financial Reports The Reports Consolidation Act of 2000 authorizes Federal agencies, with the Office of Management and Budget's (OMB) concurrence, to consolidate various reports in order to provide performance, financial and related information in a more meaningful and useful format. The Department of Energy (Department or DOE) has chosen an alternative reporting to the consolidated Performance and Accountability Report and instead, produces an Agency Financial Report, an Annual Performance Report and a Summary of Performance and Financial Information, pursuant to the OMB Circular A-136. This reporting approach simplifies and streamlines the performance presentations while utilizing the Internet for providing and leveraging

Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

Award Number: Federal Non-Federal Federal Non-Federal Total  

Broader source: Energy.gov (indexed) [DOE]

j. Indirect Charges j. Indirect Charges k. Totals (sum of 6i-6j) Program Income Applicant Name: Budget Information - Non Construction Programs OMB Approval No. 0348-0044 New or Revised Budget Section A - Budget Summary i. Total Direct Charges (sum of 6a-6h) Grant Program, Function or Activity Object Class Categories Authorized for Local Reproduction h. Other a. Personnel b. Fringe Benefits c. Travel d. Equipment 6. Total (5) f. Contractual g. Construction Section B - Budget Categories Catalog of Federal Domestic Assistance Number Grant Program Function or Activity Estimated Unobligated Funds e. Supplies Prescribed by OMB Circular A-102 Previous Edition Usable

302

FY 2000 Annual Report to the Office of Management and Budget  

Broader source: Energy.gov (indexed) [DOE]

Department of Energy Department of Energy memorandum DATE: REPLY TO ATTN OF: Office of Nuclear and Facility Safety Policy:R. Serbu:301-903-2856 SUBJECT: FY 2000 Annual Report to the Office of Management and Budget TO: David Michaels, PhD, MPH Assistant Secretary Environment, Safety and Health As Standards Executive for the Department of Energy, I am providing our input for the Fiscal Year 2000 Annual Report to the Office of Management and Budget (OMB) on the Status of Agency Interaction with Voluntary Standards Bodies as required by OMB Circular No. A-119. Included with our input is supplementary information regarding Department of Energy standards and conformity assessment activities related to the principles and objectives of Public Law 104-113 and OMB

303

REFERENCES  

Broader source: Energy.gov (indexed) [DOE]

205.1B 205.1B Approved 05-16-2011 Page 1 REFERENCES 1. INTRODUCTION 2. . Includes a list of sources cited in the directive and additional information sources to assist in implementing DOE Order 205.1B, Cyber Security Program. FEDERAL LAWS AND REGULATIONS a. Public Law (P.L.) 93-579, Privacy Act of 1974, as amended [Title 5 United States Code (U.S.C.) Section 552a]. . b. P.L. 104-106, Division E, Clinger Cohen Act (CCA) (formerly Information Technology Management Reform Act of 1996. c. P.L. 106-65, "National Defense Authorization Act [Section 3212(d)], enacted October 1999. d. P.L. 107-347, Title III, Federal Information Security Management Act of 2002 (FISMA), enacted December 2002. 3. OFFICE OF MANAGEMENT AND BUDGET (OMB) CIRCULARS. Located at http://www.whitehouse.gov/omb/circulars_default/.

304

Procurement .:. Lawrence Berkeley National Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Fiscal Close Forms: By Group Forms: Full Listing Glossary OCFO EH&S OCFO HR OCFO Home Signature Authority Training ---------------------------------- UCOP University of California DOE CFO U.S. Department of Energy --------------------------------- Cost Accounting Standards DOE Accounting Handbook Federal Accounting Standards Generally Accepted Accounting Principles OMB Circular Regulations & Procedures Manual (RPM) UC Accounting Manual UC/DOE Prime Contract (Contract 31) Fiscal Close Forms: By Group Forms: Full Listing Glossary OCFO EH&S OCFO HR OCFO Home Signature Authority Training ---------------------------------- UCOP University of California DOE CFO U.S. Department of Energy --------------------------------- Cost Accounting Standards DOE Accounting Handbook Federal Accounting Standards Generally Accepted Accounting Principles OMB Circular Regulations & Procedures Manual (RPM) UC Accounting Manual UC/DOE Prime Contract (Contract 31) CFO Departments: Budget Office Business Systems Analysis Conference Services Controller's Office Field Operations Management Financial Policy & Training Procurement & Property Office of Sponsored Projects & Industry Partnerships Travel Office Procurement Google Search:

305

Lunch & Learn Facilities &  

E-Print Network [OSTI]

" 3 #12;What are F&A costs? OMB Circular A-21 provides guidance on F&A costs F&A a.k.a. Overhead a #12;F&A Rate Development Process FSU's process must be designed to ensure that Federal sponsors do usage ­ Allocate facilities costs ­ Provide productivity analysis Space survey tool WebSpace ­ On-line

McQuade, D. Tyler

306

Microsoft Word - Final DOE BY 2012 IT Reporting Instructions_September 2010  

Broader source: Energy.gov (indexed) [DOE]

Information Technology (IT) Reporting Format and Requirements for the BY 2012 Budget Submission Based on the Final Office of Management and Budget (OMB's) Circular A-11 for the BY 2012 Exhibit 300 and Exhibit 53 September 2010 Table of Contents 1. Purpose........ ..................................................................................................................2 2. Sections of the Exhibit 53 A ...........................................................................................2 3. Exhibit 53 A Component Descriptions and Instructions ................................................5 4. Exhibit 53 B Component Descriptions and Instructions................................................13 5. Cost Estimation ..............................................................................................................15

307

Measurement of the transmission magnetic circular dichroism of Ga{sub 1?x}Mn{sub x}As epilayers using a built-in p-i-n photodiode  

SciTech Connect (OSTI)

By constructing a GaMnAs epilayer/semi-insulating In{sub 0.2}Ga{sub 0.8}As/(001) n{sup +}-GaAs substrate layer structure as a built-in p-i-n photodiode, we developed a scheme for on-chip measurements of transmission magnetic circular dichroism (T-MCD). Both the hysteresis loops in the magnetic field sweeps and the wavelength scans at saturated magnetic fields measured using the new T-MCD scheme, illustrated the same features as those previously measured on the freestanding GaMnAs thin films by conventional T-MCD. Because a large group of epitaxially grown magnetic film/semiconductor heterostructures, such as Fe, NiFe, CoFeAl, and MnGa films on semiconductor substrates, are becoming important new building blocks for semiconductor-based spin field-effect transistor, perpendicular magnetic tunnel junction (p-MTJ) and lateral MTJ devices, the new T-MCD scheme can be applied to tests of their magnetic properties by forming either p-i-n or Schottky photodiodes.

He, Z. X.; Zheng, H. Z., E-mail: hzzheng@red.semi.ac.cn; Wang, H. L.; Zhao, J. H. [State Key Laboratory of Superlattices and Microstructures, Institute of Semiconductors, Chinese Academy of Sciences, P. O. Box 912, Beijing 100083 (China)

2014-02-28T23:59:59.000Z

308

Spherical harmonic modes of 5.5 post-Newtonian gravitational wave polarizations and associated factorized resummed waveforms for a particle in circular orbit around a Schwarzschild black hole  

SciTech Connect (OSTI)

Recent breakthroughs in numerical relativity enable one to examine the validity of the post-Newtonian expansion in the late stages of inspiral. For the comparison between post-Newtonian (PN) expansion and numerical simulations, the waveforms in terms of the spin-weighted spherical harmonics are more useful than the plus and cross polarizations, which are used for data analysis of gravitational waves. Factorized resummed waveforms achieve better agreement with numerical results than the conventional Taylor expanded post-Newtonian waveforms. In this paper, we revisit the post-Newtonian expansion of gravitational waves for a test particle of mass {mu} in circular orbit of radius r{sub 0} around a Schwarzschild black hole of mass M and derive the spherical harmonic components associated with the gravitational wave polarizations up to order v{sup 11} beyond Newtonian. Using the more accurate h{sub lm}'s computed in this work, we provide the more complete set of associated {rho}{sub lm}'s and {delta}{sub lm}'s that form important bricks in the factorized resummation of waveforms with potential applications for the construction of further improved waveforms for prototypical compact binary sources in the future. We also provide ready-to-use expressions of the 5.5PN gravitational waves polarizations h{sub +} and h{sub x} in the test-particle limit for gravitational waves data analysis applications. Additionally, we provide closed analytical expressions for 2.5PN h{sub lm}, 2PN {rho}{sub lm}, and 3PN {delta}{sub lm}, for general multipolar orders l and m in the test-particle limit. Finally, we also examine the implications of the present analysis for compact binary sources in Laser Interferometer Space Antenna.

Fujita, Ryuichi; Iyer, Bala R. [Raman Research Institute, Bangalore 560 080 (India)

2010-08-15T23:59:59.000Z

309

Spherical harmonic modes of 5.5 post-Newtonian gravitational wave polarizations and associated factorized resummed waveforms for a particle in circular orbit around a Schwarzschild black hol  

E-Print Network [OSTI]

Recent breakthroughs in numerical relativity enable one to examine the validity of the post-Newtonian expansion in the late stages of inspiral. For the comparison between post-Newtonian (PN) expansion and numerical simulations, the waveforms in terms of the spin-weighted spherical harmonics are more useful than the plus and cross polarizations, which are used for data analysis of gravitational waves. Factorized resummed waveforms achieve better agreement with numerical results than the conventional Taylor expanded post-Newtonian waveforms. In this paper, we revisit the post-Newtonian expansion of gravitational waves for a test-particle of mass $\\m$ in circular orbit of radius $r_0$ around a Schwarzschild black hole of mass $M$ and derive the spherical harmonic components associated with the gravitational wave polarizations up to order $v^{11}$ beyond Newtonian. Using the more accurate $h_{\\ell m}$'s computed in this work, we provide the more complete set of associated $\\rho_{\\ell m}$'s and $\\delta_{\\ell m}$'s that form important bricks in the factorized resummation of waveforms with potential applications for the construction of further improved waveforms for prototypical compact binary sources in the future. We also provide ready-to-use expressions of the 5.5PN gravitational waves polarizations $h_+$ and $h_\\times$ in the test-particle limit for gravitational wave data analysis applications. Additionally, we provide closed analytical expressions for 2.5PN $h_{\\ell m}$, 2PN $\\rho_{\\ell m}$ and 3PN $\\delta_{\\ell m}$, for general multipolar orders $\\ell$ and $m$ in the test-particle limit. Finally, we also examine the implications of the present analysis for compact binary sources in Laser Interferometer Space Antenna.

Ryuichi Fujita; Bala R. Iyer

2010-09-01T23:59:59.000Z

310

Federal Acquisition Circular 2005-50  

Broader source: Energy.gov (indexed) [DOE]

50 50 Federal Register: March 16, 2011 (76 FR 14541) Summary of Cases Item I--Proper Use and Management of Cost-Reimbursement Contracts (FAR Case 2008-030) (Interim) This rule amends the FAR to implement section 864 of the Duncan Hunter National Defense Authorization Act for Fiscal Year 2009 (Pub. L. 110-417). This law aligns with the goal of the Presidential Memorandum on Government Contracting, issued on March 4, 2009, which is to reduce waste, fraud, and abuse in Government contracting. This rule provides internal regulatory guidance on the proper use and management of all contracts, specifically cost-reimbursement contracts. The rule identifies (1) circumstances when cost-reimbursement contracts are appropriate; (2) acquisition plan findings

311

Federal Acquisition Regulation Federal Acquisition Circular 59  

Broader source: Energy.gov (indexed) [DOE]

59 59 Item Subject FAR Case ------------------------------------------------------------------------------------------------------ I. Prohibition on Contracting With Inverted Domestic Corporations 2012-013 II. Free Trade Agreement--Colombia 2012-012 III. Revision of Cost Accounting Standards Threshold 2012-003 ------------------------------------------------------------------------------------------------------- These rules were published in the Federal Register on May 10, 2012 at 77 FR 27546 Item I--Prohibition on Contracting With Inverted Domestic Corporations This interim rule implements section 738 of Division C of the Consolidated Appropriations Act, 2012 (Pub. L. 112-74), which prohibits the award of contracts using Fiscal Year 2012 appropriated funds to any foreign incorporated entity that is treated as

312

Circular Chloroplast Chromosomes: The Grand Illusion  

Science Journals Connector (OSTI)

...As replication winds down, and forks...conceptually before analysis. The ploidy...activities in the cell cycle. In Escherichia...Recycling the cell cycle: Cyclins revisited...Morphological analysis of nuclear separation...division during the life cycle of Escherichia...

Arnold J. Bendich

313

CIRCULAR INTENSITY DIFFERENTIAL SCATTERING OF CHIRAL MOLECULES  

E-Print Network [OSTI]

cs TC CALCLLATE THE SCATTEflNG CF CO,..CE,..TRIC ~EI. ! tESl4) "'" a.r 5o o SC2 l,•cuN~lNG="'• P" INT~02 FCRMATII. ~X.DISCRETE ARFAY CF PC!" T~ FCF~lNG A ~EL! X INC ~AVl~G A POLA

Bustamante, Carlos J.

2014-01-01T23:59:59.000Z

314

Circular Chloroplast Chromosomes: The Grand Illusion  

Science Journals Connector (OSTI)

...genome size (Bendich, 1991), exemplifying the pernicious power of the Broken Circles theory. It was only when we produced...cpDNA forms reflects their activity in RDR. As replication winds down, and forks reach the ends of template strands, DNA is...

Arnold J. Bendich

315

1st Circular Time-Resolved Vibrational  

E-Print Network [OSTI]

, Germany) Giulio Cerullo (Politec. Milano, Italy) Majed Chergui (EPFL, Switzerland) Dana Dlott (University of Illinois, USA) Thomas Elssser (Max Born Institute, Germany) Nikolaus Ernsting (Humbolt Univ. Germany Gerwert (Ruhr University, Germany) Peter Hamm (Univ. Zurich, Switzerland) Joachim Heberle (Free Univ

Gerwert, Klaus

316

Circular velocity profiles of dark matter haloes  

Science Journals Connector (OSTI)

......thank Avishai Dekel and Lucio Mayer for fruitful discussions and Nick Seymour for correcting the manuscript. This work was supported...Governato F., Verde L., Gardner J., Quinn T., Stadel J., Merritt D., Lake G., 2005, MNRAS, 357, 82. Springel V. , Yoshida......

Felix Stoehr

2006-01-01T23:59:59.000Z

317

Microsoft Word - first_circular.docx.pdf  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AdvisoryCommittee S.N.Dmitriev(JINR,Russia) C.E.Duellmann(GSI,Germany) S.Gales(GANIL,France) C.K.Gelbke(FRIB,USA) J.H.Hamilton(Vanderbilt,US...

318

Fourth Circular December 14th, 2012  

E-Print Network [OSTI]

-docs, IAEA-sponsored participants and participants making presentations in the Nuclear Physics Education 15'. We'll be grateful if participants making presentations, both talks and posters, can confirm Contributed talks: Francesco Cerutti, Hiroshi Matsumura, Vitaly Pronskikh Posters: Carlos Diez, Ferenc Ditroi

Ohta, Shigemi

319

Federal Acquisition Regulation Federal Acquisition Circular 2005...  

Energy Savers [EERE]

of Rules FAC 2005-75 Item Subject FAR Case I EPEAT Items (Interim) 2013-016 II Contracting with Women-Owned Small Business Concerns 2013-010 III Limitation on Allowable...

320

Covalently closed circular deoxyribonucleic acids in spiroplasmas.  

Science Journals Connector (OSTI)

...DNA-mediated trans- formation to tetracycline resistance in M. hom- inis and M. salivarium (14), no DNA transfer has been reported...transformation to tetracycline resistance by DNA extracted from M. hom- inis tetR. J. Infect. Dis. 139:444-451. 15. Greene, P...

J M Ranhand; W O Mitchell; T J Popkin; R M Cole

1980-09-01T23:59:59.000Z

Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

Vibrations of circular steel plates with damping  

E-Print Network [OSTI]

OF TABLL'S TABLE Page Irequcncics for Two 1/16" Plates for Different Nodal Shapes 16 Frequencies for Two 1/8" Plates for Different Nodal Shapes 16 I'requencies for Two 3/16" Plates for Different Nodal Shapes 17 Frequencies for Two 1/4" Plates... 21 10 Amplitudes for Two 3/16" Plates with Nodal Shape "A" . . 22 Amplitudes for Two 3/16" Plates with Nodal Shape "B" . . 23 12 13 14 15 16 Amplitudes for Two 3/16" Plates with Nodal Shape "C" Amplitudes for Two 1/4" Plates with Nodal Shape...

Sheth, Prafulchandra Naginlal

2012-06-07T23:59:59.000Z

322

Federal Acquisition Regulation Federal Acquisition Circular 2005...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Item I- Incorporating Section K in Contracts (FAR Case 2014-001) (Final) This final rule revises the language at FAR subpart 4.12, Representations and Certifications, and adds...

323

OMB No. 038-R0459 EIA 457B  

U.S. Energy Information Administration (EIA) Indexed Site

*1980-1981 *1980-1981 U.S. Department of Energy Energy Information Administration Location # Housing Unit #_ 111-116 117-118 TIME INTERVIEW STARTED 1. 3. In what year did your family move into this house (apartment)? IF "1980" OR "1981." ASK: 2. In which month did you move in? (SPECIFY MONTH AND ENTER LAST TWO DIGITS OF YEAR.) In what year was this house (building) built? Just your estimate. IF "1977," ASK: 4. Do you happen to know if the (house/ building) was completed in January through June or July through December of 1977? 01 [] BEFORE 1940 02[] 1940-1949

324

LGPO - Feb 12th Hearing Bingaman - OMB 02 11 09  

Broader source: Energy.gov (indexed) [DOE]

DAVID G. FRANTZ DAVID G. FRANTZ U.S. DEPARTMENT OF ENERGY BEFORE THE COMMITTEE ON ENERGY AND NATURAL RESOURCES UNITED STATES SENATE FEBRUARY 12, 2009 Mr. Chairman and members of the Committee, thank you for this opportunity to be before you today to discuss the Department of Energy's Title XVII Loan Guarantee Program and to provide you with the current status of the program and the progress we have made to date. First, I would like extend my appreciation to you Mr. Chairman and the other members of the Committee for your continued support and interest in the effective development of the Title XVII Loan Guarantee Program. INTRODUCTORY STATEMENT This program is an urgent priority for Secretary Chu as we face an unprecedented economic crisis that demands action. Secretary Chu is personally reviewing the program,

325

January 2013 OMB Scorecard on Sustainability/Energy  

E-Print Network [OSTI]

ReductioninFleetPetroleumUse Reductioninfleetpetroleumusecomparedto2005: 33.9%andontrackfor20%in2015 GreenBuildingsPotable WaterIntensity ReductioninFleet PetroleumUse Green Buildings Standardsfor

Waliser, Duane E.

326

January 2014 OMB Scorecard on Sustainability/Energy  

E-Print Network [OSTI]

ReductioninFleetPetroleumUse Reductioninfleetpetroleumusecomparedto2005: 12.5%andnotontrack GreenBuildingsIntensity ReductioninFleet PetroleumUse Green Buildings Standardsfor

US Army Corps of Engineers

327

OMB No. 038-R0459 EIA 457B  

U.S. Energy Information Administration (EIA) Indexed Site

PARTS q and r), ASK Q. 163 ff. OTHERWISE SKIP TO INSTRUCTION FOR Q. 176. 163. How many tanks do you have for fuel oil or kerosene? ONE TWO THREE OR MORE 1232 164. What is the...

328

OMB No. 1905-0093 * EIA 457B  

Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

AT SAME TIME 6 RECOMMENDED BY FRIEND OR RELATIVE 7 RECOMMENDED BY PROFESSIONAL ENERGY ADVISOR (ENERGY AUDITOR OR EXPERT) 8 HEARD OR READ ABOUT BENEFITS (ON RADIO OR TV, MAGAZINE...

329

Microsoft Word - OE Monthly Reporting Request OMB 83I Renewal...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

e. Difference 13,248 f. Explanation of difference 1. Program change addition of meter counts 2. Adjustment feedback from recipients on burden impact 14. Annual reporting...

330

OMB No. 038-R0459 EIA 457B  

Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

1981-1982 U.S. Department of Energy Energy Information Administration Location* Housing Unit 111-116 117-118 TIME INTERVIEW STARTED 1. In what year did your family move into...

331

Controller's Office, OMB A-123 .:. Lawrence Berkeley National...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

CFO U.S. Department of Energy --- Cost Accounting Standards DOE Accounting Handbook Federal Accounting Standards Generally Accepted Accounting...

332

PM2 DNA, quantitative conversion of closed circular to open circular form by ionizing radiation  

E-Print Network [OSTI]

. Le Pecq, Use of ethidium bromide for separation and determina- tion of nucleic acids of various conformational forms and measure- f h S. d*y. Mhd f3h YA I 20, 41-86 (1977). 9 I\\ 1 ] 91 1 9 I f S I'1 ~yh 'h 9 ? 313 fit 1 1: Eastman Kodak Co...

Corey, John Michael

1980-01-01T23:59:59.000Z

333

Single Molecule Chiroptical Spectroscopy: Fluorescence Excitation Circular Dichroism and Circular Polarized Luminescence of Bridged Triarylamine Helicenes.  

E-Print Network [OSTI]

??In this thesis, I describe the first exploratory experimental efforts probing light-matter interactions of chiral systems at the single molecule level. The dissymmetric single molecule… (more)

Paradise, Ruthanne Hassey

2009-01-01T23:59:59.000Z

334

Technical Standards, 2004 Annual Report - July 29, 2004 | Department of  

Broader source: Energy.gov (indexed) [DOE]

2004 Annual Report - July 29, 2004 2004 Annual Report - July 29, 2004 Technical Standards, 2004 Annual Report - July 29, 2004 July 29, 2004 Fiscal Year 2004, Annual Report to the Office of Management and Budget, Standards use and Participation The Department of Energy (DOE) implements the federal guidance and requirements of OMB Circular A-119 (OMB A-119) and the statutory requirements of Public Law (PL) 104-113 (15 USC 272) regarding the use of voluntary consensus standards (VCSs) through specific Departmental directives (policies, orders, requirements, guides, and technical standards) and supporting programs and management systems. Technical Standards, 2004 Annual Report More Documents & Publications Technical Standards, Office of Management and Budget Report for FY-2012 - December 19, 2012

335

Technical Standards, 2004 Annual Report - July 29, 2004 | Department of  

Broader source: Energy.gov (indexed) [DOE]

Technical Standards, 2004 Annual Report - July 29, 2004 Technical Standards, 2004 Annual Report - July 29, 2004 Technical Standards, 2004 Annual Report - July 29, 2004 July 29, 2004 Fiscal Year 2004, Annual Report to the Office of Management and Budget, Standards use and Participation The Department of Energy (DOE) implements the federal guidance and requirements of OMB Circular A-119 (OMB A-119) and the statutory requirements of Public Law (PL) 104-113 (15 USC 272) regarding the use of voluntary consensus standards (VCSs) through specific Departmental directives (policies, orders, requirements, guides, and technical standards) and supporting programs and management systems. Technical Standards, 2004 Annual Report More Documents & Publications Technical Standards, Office of Management and Budget Report for FY-2012 -

336

EERE Program Management Guide - Appendix Q  

Broader source: Energy.gov (indexed) [DOE]

Q Q Glossary of Terms Allotment Allowance Amendments Annual Operating Plan (AOP) Annual Performance Plan Apportionment Appropriation Appropriation Bill Approved Funding Program (AFP) Authorization Bill Base Table An authorization by either the agency head, or another authorized employee, to subordinate agency employees to incur obligations within a specified amount pursuant to an Office of Management and Budget (OMB) apportionment or reapportionment action, in accordance with OMB Circular No. A-34, or other statutory authority making funds available for obligation. The allotment is the means by which the Department assigns responsibility under the administrative control of funds provision of Title 31, U.S.C., Section 1514. Chapter 6. The number of FTEs that the Department is permitted to use during a specified

337

FY 2010 DOE Agency Financial Report  

Broader source: Energy.gov (indexed) [DOE]

Foreword Foreword „ „ „ „ „ „ „ „ „ „ „ „ „ „ „ „ „ T he Reports Consolidation Act of 2000 authorizes Fed- eral agencies, with the Office of Management and Bud- get's (OMB) concurrence, to consolidate various reports in order to provide performance, financial and related informa- tion in a more meaningful and useful format. The Department of Energy (Department or DOE), has chosen an alternative reporting to the consolidated Performance and Accountability Report and instead, produces an Agency Financial Report, an Annual Performance Report and a Summary of Performance and Financial Information, pursuant to the OMB Circular A-136. This reporting approach simplifies and streamlines the performance presentations while utilizing the Internet for providing and leveraging additional performance information.

338

National Technology Transfer and Advancement Act of 1995 [Public Law (PL)  

Broader source: Energy.gov (indexed) [DOE]

National Technology Transfer and Advancement Act of 1995 [Public National Technology Transfer and Advancement Act of 1995 [Public Law (PL) 104-113] National Technology Transfer and Advancement Act of 1995 [Public Law (PL) 104-113] On March 7, 1996, President Clinton signed into law "The National Technology Transfer and Advancement Act of 1995." The new law, referred to as PL 104-113, serves to continue the policy changes initiated in the 1980s under Office of Management and Budget (OMB) Circular A-119 (OMB A-119), Federal Participation in the Development and Use of Voluntary Standards, that are transitioning the Executive branch of the Federal Government from a developer of internal standards to a customer of external standards. Section 12, "Standards Conformity," of the act states that "...all Federal

339

DOE Guidance on the Use of the SSN  

Broader source: Energy.gov (indexed) [DOE]

Defining Information System Defining Information System For the Baseline Inventory Goal 1 - Establish a baseline inventory of all unclassified automated (electronic) information systems. Goal 2 - Identify which systems in the inventory collect or maintain Social Security numbers (SSNs), including legal and regulatory authority, system owner, etc. Goal 3 - Review holdings of Personally Identifiable Information (PII). OMB Circular A-130 defines and information system as follows: The term "information system" means a discrete set of information resources organized for the collection, processing, maintenance, transmission, and dissemination of information, in accordance with defined procedures, whether automated or manual. Recognizing the ongoing debate/confusion associated with this term, the following

340

Internal Controls Guidance | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Internal Controls Guidance Internal Controls Guidance Internal Controls Guidance Guidance required to be implemented by Departmental elements to meet the requirements of the Federal Managers' Financial Integrity Act (FMFIA), as described in Office of Management and Budget (OMB) Circular A-123, Management's Responsibility for Internal Control. This guidance provides instructions for conducting internal controls evaluations and help ensure the Secretary's annual Statement of Assurance is accurate and adequately supported. Internal Control Evaluations Guidance More Documents & Publications Re: DOE Request for Information - Implementing the National Broadband Plan by Studying the Communications Requirements of Electric Utilities To Inform Federal Smart Grid Policy Request for Information - Operations and Maintenance (O & M) Support

Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

FY 2012 Agency Financial Report  

Broader source: Energy.gov (indexed) [DOE]

in order to provide performance, financial in order to provide performance, financial and related information in a more meaningful and useful format. The Department of Energy (Department or DOE), has chosen an alternative reporting to the consolidated Performance and Accountability Report and instead, produces an Agency Financial Report, an Annual Performance Report and a Summary of Performance and Financial Information, pursuant to the OMB Circular A-136. This reporting approach simplifies and streamlines the performance presentations while utilizing the Internet for providing and leveraging additional performance information. The Department's fiscal year (FY) 2012 reporting includes the following three components and will be available at the website below, as each component

342

DOE F 1340.3a  

Broader source: Energy.gov (indexed) [DOE]

a a (10-96) U.S. Department of Energy Public Communications Publications Procurement Proposal (Attach sheets if needed in responding to questions) 1. Identify Project, Including Scope and Proposed Titles (if known) of Publications Involved 2. Project Officer, Agency Code, Location and Telephone 3. Estimated Publication Preparation Cost, Including Research, Writing, & Graphics 4. Identify Funding Source 5. Attach Justification/Need for Publication (If Mandated, Identify Law or Regulation). Identify Potential Audience & Distribution Plan(s) 6. If Periodical(s) Involved Attach OMB Circular A-3 Justification, Including Subscription Fee 7. Storage Location After Initial Distribution 8. Identify Similar Publications 9. Special Production Considerations, i.e., Multicolor, Special

343

Microsoft Word - AcqGuide34pt1.doc  

Broader source: Energy.gov (indexed) [DOE]

-----------------------------Chapter 34.1 (June 2005) 1 PROJECT MANAGEMENT AND THE ACQUISITION OF MAJOR SYSTEMS Applicability: This section is applicable to projects as defined by DOE Order 413.3 under the responsibility of elements of the Department of Energy. However, the principles, concepts and guidance may be applied to other "project-like" work scopes, as appropriate. References: * DOE Order 413.3, "Program and Project Management for the Acquisition of Capital Assets" * DOE Manual 413.3-1, "Project Management for the Acquisition of Capital Assets" 1 * DOE O 361.1 "Acquisition Career Development Program" * OMB Circular A-11, Part 7 "Planning, Budgeting, Acquisition and Management of Capital Assets"

344

O:\A76\Post Award Accountability\PCA Handbook.prn.pdf  

Broader source: Energy.gov (indexed) [DOE]

COMPETITIVE SOURCING PROGRAM POST-COMPETITION ACCOUNTABILITY HANDBOOK August 2006 DOE Competitive Sourcing Program POST-COMPETITION ACCOUNTABILITY HANDBOOK i POST-COMPETITION ACCOUNTABILITY HANDBOOK Table of Contents Executive Summary ii Introduction 1 1. Post-Competition Accountability 13 2. Contract/LOO Extension or Closeout 20 Appendix A-1: Post-Competition Accountability Responsibilities D-1 Appendix A-2: MEO Independent Validation and Verification (IV&V) D-2 Appendix B: Definitions E-1 Appendix C: Acronyms F-1 DOE Competitive Sourcing Program POST-COMPETITION ACCOUNTABILITY HANDBOOK ii Executive Summary This document provides information on the actions required to implement a competitive sourcing performance decision within the Department of Energy (DOE) in accordance with Office of

345

O:\A76\FAIR\Fair Act 2008\Guidance\Enclosure 3.prn.pdf  

Broader source: Energy.gov (indexed) [DOE]

1 1 Enclosure 3 - List of selected Function Codes with definitions This section includes definitions of some functions. The definitions are based on information contained in the Department of Defense Guide for Inventory Submission. The DOE Inventory is not restricted to just the functions that are defined in this section. The information provided is all that is currently available. As more functions are defined, they will be added to this section. A - RECURRING TEST AND INSPECTION SERVICES A100 Electronic. This function includes inspection and test of security equipment. B - PERSONNEL AND SOCIAL SERVICES B400 Employee Relations . This function includes review and coordination of employee organization and union affiliate partnership programs

346

O:\A76\FAIR\Fair Act 2008\Guidance\Enclosure 2.prn.pdf  

Broader source: Energy.gov (indexed) [DOE]

Enclosure 2 - IGCA Inventory Function Codes A - Recurring Testing and Inspection Services A100 Electronic A200 Health Care A300 Safety A400 Transportation A500 Food and Drug A600 Other Technical Testing or Inspection A610 Management Headquarters-Test and Evaluation A620 Test and Evaluation Operations A630 Management and Support to Test and Evaluation A699 Other Test and Evaluation Activities A700 Systems Certification Services A000 Administrative Support B - Personnel Management B100 Classification B102 Classification Reviews B200 Employee Development B300 Staffing Reviews B301 Processing B302 Manpower Research and Analysis B303 Manpower Development B400 Employee Relations B401 Benefits Reviews and Analysis B500 Labor Relations and Support

347

DOI: 10.1007/s00339-002-2004-5 Appl. Phys. A 76, 17 (2002)  

E-Print Network [OSTI]

- pects of TiO2 surfaces or interfaces would potentially have a positive impact. Titanium dioxide is used online: 2001 · © Springer-Verlag 2002 ABSTRACT Titanium oxides are used in a wide variety of tech initio approaches and to calculate properties of adsorption systems. Scanning tunneling microscopy (STM

Diebold, Ulrike

348

Part I, General Audit Program  

Broader source: Energy.gov (indexed) [DOE]

and subrecipients of and subrecipients of federal financial assistance from the Department of Energy (DOE). Such compliance audits must be conducted in accordance with the requirements and guidance set forth in Statement on Auditing Standards No. 117, Compliance Audits (SAS 117) and generally accepted government auditing standards (GAGAS). See section C below for more detail. The audit procedures provided in this Audit Program are the minimum necessary for uniform and consistent audit coverage. Auditors conducting audits of entities subject to the requirements of Office of Management and Budget (OMB) Circular No. A-133, Audits of States, Local Governments and Non-Profit Organizations, should not use this Audit Program and should instead refer to the Circular and the

349

Office of Sponsored Projects and Industry Partnerships .:. Lawrence  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Quicklinks: A-Z Index for the OCFO Berkeley Lab Home Contact Us: By Group Contact Us: By Subject Contact Us: Full Listing Employment Financial Systems Modernization (F$M) Fiscal Close Forms: By Group Forms: Full Listing Glossary OCFO EH&S OCFO HR OCFO Home Signature Authority Training ---------------------------------- UCOP University of California DOE CFO U.S. Department of Energy --------------------------------- Cost Accounting Standards DOE Accounting Handbook Federal Accounting Standards Generally Accepted Accounting Principles OMB Circular Regulations & Procedures Manual (RPM) UC Accounting Manual UC/DOE Prime Contract (Contract 31) Quicklinks: A-Z Index for the OCFO Berkeley Lab Home Contact Us: By Group Contact Us: By Subject Contact Us: Full Listing Employment Financial Systems Modernization (F$M) Fiscal Close Forms: By Group Forms: Full Listing Glossary OCFO EH&S OCFO HR OCFO Home Signature Authority Training ---------------------------------- UCOP University of California DOE CFO U.S. Department of Energy --------------------------------- Cost Accounting Standards DOE Accounting Handbook Federal Accounting Standards Generally Accepted Accounting Principles OMB Circular Regulations & Procedures Manual (RPM) UC Accounting Manual UC/DOE Prime Contract (Contract 31) CFO Departments: Budget Office Business Systems Analysis Conference Services Controller's Office Field Operations Management Financial Policy & Assurance Procurement & Property Office of Sponsored Projects & Industry Partnerships Training Travel Office

350

Federal Acquisition Regulation Federal Acquisition Circular 2005-61  

Broader source: Energy.gov (indexed) [DOE]

1 1 Summary of Rules in FAC 2005-61 Item Subject FAR Case I. United States--Korea Free Trade Agreement. 2012-004 II. Delete Outdated FAR Reference to the 2012-026 DoD Industrial Preparedness Program. III. NAICS and Size Standards 2012-021 IV. Bid Protest and Appeal Authorities. 2012-008 V. Technical Amendments. Item I--United States-Korea Free Trade Agreement (FAR Case 2012-004) This final rule adopts without change the interim rule published in the Federal Register on March 7, 2012 (77 FR 13952), to implement the United States-Korea Free Trade Agreement. The Republic of Korea is already party to the World Trade Organization Government Procurement Agreement (WTO GPA). The Korea Free Trade Agreement now covers acquisition of supplies and services between $100,000 and the current WTO GPA threshold of

351

FEDERAL ACQUISITION CIRCULAR 2005-56 SUMMARY OF FINAL RULES  

Broader source: Energy.gov (indexed) [DOE]

56 56 SUMMARY OF FINAL RULES Item Subject FAR Case I. Women-Owned Small Business Program 2010-015 II. Proper Use and Management of Cost-Reimbursement Contracts 2008-030 III. Requirements for Acquisitions Pursuant to Multiple-Award Contracts 2007-012 IV. Socioeconomic Program Parity 2011-004 V. Trade Agreements Thresholds 2012-002 VI. New Designated Country (Armenia) and Other Trade Agreements Updates 2011-30 VII. Government Property 2010-009 VIII. Technical Amendments Item I--Women-Owned Small Business (WOSB) Program (FAR Case 2010-015) This rule adopts as final, with changes, an interim rule published in the Federal Register at 76 FR 18304 on April 1, 2011, which provides a tool to assist Federal agencies in achieving the 5

352

FEDERAL ACQUISITION CIRCULAR 2005-38 SUMMARY Item Subject FAR...  

Energy Savers [EERE]

CCR for the indicator before exercising an option. Purchases and orders at or below the micro-purchase threshold are exempt from verification in the CCR database as to whether...

353

The circular jump is a white hole G. Jannes,1  

E-Print Network [OSTI]

on the surface of the fluid (c = gh in the shallow-water gravity wave limit, with h the fluid height and g is such that vs r > c so that surface ripples can only propagate downstream--to a subcritical flow outside, where and subcritical typically refer to the value of the Froude number Fr = vs r/ gh or the related Mach num- ber M

Weeks, Eric R.

354

THE FIRST CIRCULAR UNESCO-APEID 2011 INTERNATIONAL SYMPOSIUM ON  

E-Print Network [OSTI]

APEID The utilization and conservation of the water resources for human survival, bioproduction and the environment 8 countries: Philippines, Thailand, Indonesia,Afghanistan, Bangladesh, Malawi, Ghana and Japan

Ejiri, Shinji

355

THE FIRST CIRCULAR UNESCO-APEID 2012 INTERNATIONAL SYMPOSIUM ON  

E-Print Network [OSTI]

APEID The utilization and conservation of the water resources for human survival, bioproduction and the environment 8 countries: Philippines, Thailand, Indonesia,Afghanistan, Bangladesh, Malawi, Ghana and Japan

Ejiri, Shinji

356

Detection of circular polarization in light scattered from photosynthetic microbes  

Science Journals Connector (OSTI)

...13). Beyond the Solar System, methods will...16). Typical disadvantages of these methods...enormous evolutionary advantages of photosynthesis...The evolutionary advantages of photosynthesis...elsewhere in the Solar System has succeeded...will likely use the energy consequently available through...

William B. Sparks; James Hough; Thomas A. Germer; Feng Chen; Shiladitya DasSarma; Priya DasSarma; Frank T. Robb; Nadine Manset; Ludmilla Kolokolova; Neill Reid; F. Duccio Macchetto; William Martin

2009-01-01T23:59:59.000Z

357

Circular sensor array and nonlinear analysis of homopolar magnetic bearings  

E-Print Network [OSTI]

an adjustment factor for single failures. A prototype 8-sensor array shows substantial runout reduction and bandwidth and sensitivity comparable to commercial systems. Nonlinear behavior in homopolar magnetic bearings is caused primarily by the quadratic...

Wiesenborn, Robert Kyle

2007-04-25T23:59:59.000Z

358

Circular Dichroism of Long Wavelength Forms of Chlorophyll a  

Science Journals Connector (OSTI)

... and Love and Bannister3 reported a form absorbing at 685 nm produced by this method. Sherman and Fujimori4,5 have reported similar results obtained by exposure of a thin film of ...

GWENDOLYN M. SHERMAN

1969-12-13T23:59:59.000Z

359

Performance monitoring and numerical modelling of a deep circular excavation  

E-Print Network [OSTI]

is then filled into the trench from the bottom and displaces the bentonite liquid, which is pumped from the top to the storage tanks. To create a tight wall primary panels are built with a spacing and secondary panels are added in-between. The joints have...

Schwamb, Tina

2014-07-01T23:59:59.000Z

360

PHYSICS 201 --FORMULA SUMMARY --MODULE 2 Uniform Circular Motion  

E-Print Network [OSTI]

T or vtangential = 2R T r aradial = r v 2 r r or aradial = v2 R Newton's Law of Universal Gravitation r Fgravity = G m1m2 r2 Universal Gravitation and Weight G mEm RE 2 = mg Kepler /Newton Law of Periods = r F r r cos Work­Energy Theorem Wtotal = K = 1 2 mvfinal 2 - 1 2 mvinitial 2 #12;Gravitational

Allen, Roland E.

Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

Extraordinarily wide-view circular polarizers for liquid crystal displays  

E-Print Network [OSTI]

, Thomas X. Wu1 , Shin-Tson Wu1 , Chao-Lien Lin2 , Nai-Chin Hsu2 , Wang-Yang Li2 , and Chung-Kuang Wei2 1 sphere and through computer-aided parameter search method. According to this design, the high of Light (Wiley, New York, 1997). 13. A. Lien, "Extended Jones matrix representation for the twisted

Wu, Shin-Tson

362

Feasibility of water diversion and overburden dewatering. Information Circular/1985  

SciTech Connect (OSTI)

The Bureau of Mines studied the feasibility of water diversion and overburden dewatering for underground coal mines in the Appalachian region. All relevant published literature pertaining to the occurrence and control of surface and ground water in underground coal mines was reviewed, and the impacts of mine water with respect to health and safety, production, environment, and costs were assessed and are described in this report.

Moebs, N.N.; Clar, M.L.

1985-01-01T23:59:59.000Z

363

Terahertz Circular Dichroism Spectroscopy of Biomolecules. , Jhenny Galanb  

E-Print Network [OSTI]

93106 d Center for Polymer and Organic Solids, UCSB, Santa Barbara, CA 93106 e Department of Chemistry Department, UCSB, Santa Barbara, CA 93106; b Biological and Physical Chemistry, University of Connecticut beautifully illustrated in crystallographic structures that appear in text books. Proteins and nucleic acids

Xu, Jing

364

USGS CIRCULAR 938 U.S. GEOLOGICAL SURVEY  

E-Print Network [OSTI]

-----------------------------------------------------------------------------------------------------------------· 57 Rafael W. Rodriguez The Submari ne LandsIide of 1980 off Northern Ca Zone _____________________________ 125 James V. Gardner Abstracts of selected papers submitted

365

Stability of detonation in a circular pipe with porous walls  

Science Journals Connector (OSTI)

...AZ 85721, USA 2 Department of Aerospace and Mechanical Engineering, The...eigenvalue problem. To this end, recent advances-[30] in defining linear instability...funding for C.C. from the National Science Foundation Vertical InteGration...

2012-01-01T23:59:59.000Z

366

The circular loop antenna over a lossy dielectric slab  

E-Print Network [OSTI]

interfaces. The method of moments is employed to solve the resulting 1ntegral equations for the current distribut1on on the loop. With the current distribution determined, the input impedance and input admit- tance are calculated. The electromagnetic f1... of the current density can be neglected. For the loop antenna, the surface current density can be written as (2. 3a) where $' = cos(4 - $') f + sin(4 - 4 ')p (2. 3b) In developing an integral equation to represent the loop, the observation point is located...

Overly, Michael Robert

2012-06-07T23:59:59.000Z

367

An experimental study of jet impingement on a circular cylinder  

E-Print Network [OSTI]

diameter of 6 5/8 inches. The jet was impinged upon the cylinder at nozzle distances of 7, 15, and 30 nozzle diameters, and at velocities of' 400 and 500 ft/s. The free jet was studied and found to be "typical" by comparing it to earlier studies done... Instrumentation schematic 17 5 Cylindrical suriace coordinate system 22 6 Photograph of the cylinder with "grid" 23 7 Photograph of the wall jet traversing apparatus 24 8 Orientation of the hot film sensor 25 9 Free jet geometry and parameters 30 10 Velocity...

Potts, Dennis Wayne

2012-06-07T23:59:59.000Z

368

Vibration Analysis of Circular Plates Subjected to Preshearing Loading.  

E-Print Network [OSTI]

??The present study proposes a simple and relatively complete displacement field, which, with the finite element formulation, can be employed in the analyses of the… (more)

chen, Chien-hao

2010-01-01T23:59:59.000Z

369

Drought Strategies for Alfalfa Cooperative Extension Service Circular 581  

E-Print Network [OSTI]

and Home Economics #12;1 Drought Strategies for Alfalfa With continued dry conditions throughout New Mexico produced under dry conditions will be higher in crude protein and digestible dry matter than under wet Extension agronomist, Department of Extension Plant Sciences, New Mexico State University, Las Cruces, New

Mukhtar, Saqib

370

Major Facility Siting Program - Circular 2 | Open Energy Information  

Open Energy Info (EERE)

included in a linear facility application; including but not limited to: the need for the transmission line or pipeline, the proposed location, baseline data and reasonable...

371

NOAA Technical Report NMFS Circular 447 Proceedings of the Eighth  

E-Print Network [OSTI]

to aquaculture, current subjects in the program are desalination of seawater, toxic microorganisms, air pollution furnished by NMFS, in any advertising or sales pro- motion which would indicate or imply that NMFS approves purpose an intent to cause directly or indirectly the advertised product to be used or purchased because

372

Contractor Past Performance Information  

Office of Environmental Management (EM)

for 100% reporting compliance. The DOE Agency Coordinator will submit OMB required reports to the OMB MAX site on a quarterly basis or as required. Other contractor...

373

Microsoft Word - 2010 Annual Plan - 12-3-09 - OMB Cleared-glc tables.docx  

Broader source: Energy.gov (indexed) [DOE]

EPAct 2005 Title IX, Subtitle J, Section 999B(e) - 2010 Annual Plan 163 EPAct 2005 Title IX, Subtitle J, Section 999B(e) - 2010 Annual Plan 163 December 2009 EPAct 2005 Title IX, Subtitle J, Section 999B(e) - 2010 Annual Plan 164 December 2009 EPAct 2005 Title IX, Subtitle J, Section 999B(e) - 2010 Annual Plan 165 December 2009 Unconventional Resources Technology Advisory Committee Comments and Recommendations 2010 Annual Plan OCTOBER 2009 Unconventional Resources Technology Advisory Committee Report EPAct 2005 Title IX, Subtitle J, Section 999B(e) - 2010 Annual Plan 166 December 2009 TABLE OF CONTENTS 1.0 INTRODUCTION...................................................................................................................3 2.0 EXECUTIVE SUMMARY AND RECOMMENDATION HIGHLIGHTS......................5

374

Microsoft Word - PSRP June 5 2009 _LGPO_ OMB with minor errors fixedMBF.docm  

Broader source: Energy.gov (indexed) [DOE]

E-mail: E-mail: lgprogram@hq.doe.gov Address: LGPO Forrestal Bldg. CF 1.3 1000 Independence Ave, SW Washington, D.C. 20585 Does this program align with an existing PART program? N Does this program align with an existing CFDA program? N Program Title: Innovative Technology Loan Guarantee Program (Section 1705 Recovery Act) 1. Objectives: Program Purpose The main purposes of the Recovery Act portion of Title XVII Loan Guarantee Program are to create a temporary program for rapid deployment of renewable energy (including leading edge biofuels) and electric power transmission projects while ensuring that there is a reasonable prospect of repayment of the principal and interest on the obligation by the borrower.

375

Microsoft Word - Sec 999 Annual Plan - January 2008 revOMB final agreement.doc  

Broader source: Energy.gov (indexed) [DOE]

7 Annual Plan for the Ultra-Deepwater and 7 Annual Plan for the Ultra-Deepwater and Unconventional Natural Gas and Other Petroleum Resources Research and Development Program January 2008 DOE/NETL-2007/1294 Provided in Response to Energy Policy Act of 2005 Section 999, Subtitle J DISCLAIMER The Administration has submitted a legislative proposal to repeal the Ultra-Deepwater and Unconventional Natural Gas and Other Petroleum Resources Research Program. However, the Department of Energy is currently implementing the Subtitle J program according to the requirements of the law and will continue to do so unless the law is repealed. 2007 Annual Plan for the Ultra-Deepwater and Unconventional Natural Gas and Other Petroleum Resources Research and Development Program DOE/NETL-2007/1294

376

DOE _Final_ DOE - Enclosure 4 to 2005 CS 647b Report OMB.d...  

Broader source: Energy.gov (indexed) [DOE]

4 4 Projected Number of DOE FTEs To Be Announced for Competition in FY 2006 The Department of Energy anticipates announcing an estimated 100-300 FTEs for public-private competition under its Competitive Sourcing program by the end of FY 2006. The Department is employing a sound methodology for identifying potential competitions, nominating potential competition candidates, analyzing nominated candidates through feasibility reviews, executing competitions, and implementing the results. The Federal Activities Inventory Reform Act of 1998 (FAIR Act) commercial activities inventory forms the primary basis for identifying potential candidates for nomination to undergo a feasibility review. A feasibility review, which is not a formal competitive sourcing study, is a preliminary assessment to

377

Microsoft Word - 1817 Report incl GC&OMB Comments 8 20 07mas2.doc  

Broader source: Energy.gov (indexed) [DOE]

POTENTIAL BENEFITS OF DISTRIBUTED POTENTIAL BENEFITS OF DISTRIBUTED GENERATION AND RATE-RELATED ISSUES THAT MAY IMPEDE ITS EXPANSION A STUDY PURSUANT TO SECTION 1817 OF THE ENERGY POLICY ACT OF 2005 June 2007 U.S. Department of Energy EPAct 2005 SEC. 1817. STUDY OF DISTRIBUTED GENERATION. (a) Study- (1) IN GENERAL- (A) POTENTIAL BENEFITS- The Secretary, in consultation with the Federal Energy Regulatory Commission, shall conduct a study of the potential benefits of cogeneration and small power production. (B) RECIPIENTS- The benefits described in subparagraph (A) include benefits that are received directly or indirectly by-- (i) an electricity distribution or transmission service provider; (ii) other customers served by an electricity distribution or transmission service provider; and

378

Microsoft Word - OMB1910-5149 Bonner Letter response 2010 08 23DM edits.docx  

Broader source: Energy.gov (indexed) [DOE]

DOE Response to comments regarding U.S. Department of Energy Proposed Agency DOE Response to comments regarding U.S. Department of Energy Proposed Agency Information Collection Request, Federal Register/Vol. 75, No. 100, Tuesday, May 25, 2010/Notices August 23, 2010 Consolidated Edison Company of New York, Inc. Detroit Edison Indianapolis Power & Light Company PECO Progress Energy Dear Recipients: The Department of Energy (DOE) appreciates your response to our May 25 Federal Register Notice regarding DOE's proposed Information Collection Request for Recovery Act activities, including Smart Grid Investment Grants (SGIG) and Smart Grid Demonstration Projects (SGDP). The DOE shares your commitment to providing taxpayers and the public with timely reporting on the progress of Recovery Act projects - and we share your desire to do this in as efficient a manner as possible. The DOE has

379

Microsoft Word - 2010 Annual Plan - 12-3-09 - OMB Cleared-glc tables.docx  

Broader source: Energy.gov (indexed) [DOE]

2009 2009 DOE/NETL-2009/1384 Provided in Response to Energy Policy Act of 2005 Title IX, Subtitle J, Section 999B(e) 2010 Annual Plan Ultra-Deepwater and Unconventional Natural Gas and Other Petroleum Resources Research and Development Program DISCLAIMER The Administration has submitted to Congress a legislative proposal to repeal Subtitle J of Title IX of the Energy Policy Act of 2005 which authorized the Ultra-Deepwater and Unconventional Natural Gas and Other Petroleum Resources Research Program. However, the Department of Energy is implementing Title IX, Subtitle J according to the requirements of the law, and will continue to do so unless the law is repealed. 2010 Annual Plan Ultra-Deepwater and Unconventional Natural Gas and Other

380

COGR Guide to the OMB Uniform Administrative Requirements, Cost Principles, and Audit Requirements for Federal Awards  

E-Print Network [OSTI]

al. (i.e., the Uniform Guidance) was released on December 26, 2013. The implementation date is scheduled for December 26, 2014, with the exception of the audit requirements, which are scheduled to be effective the first fiscal year that begins after December 26, 2014. This COGR Guide provides an assessment

Johnson, Eric E.

Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

Microsoft Word - Written Statement FY2011 NNSA OMB approved final03012...  

National Nuclear Security Administration (NNSA)

Technology and Engineering (Science Campaign, Engineering Campaign, Inertial Confinement Fusion and High Yield Campaign, Advanced Simulation and Computing Campaign, Science,...

382

[OMB # 0648-0327 EXP 07-31-2015] NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION  

E-Print Network [OSTI]

Phone No. ( ) City State Zip Code Fax Phone No. ( ) Email Address Website Cell Phone No. ( ) SECTION 2 No. ( ) Email Address Birth Date (mm/dd/yy) Cell Phone No. ( ) SECTION 4 - ADDITIONAL FEDERAL - ADDITIONAL FACILITIES (add additional sheets if necessary) Business Name Daytime Phone No. Fax Phone No

383

Microsoft Word - PSRP June 5 2009 _LGPO_ OMB with minor errors...  

Energy Savers [EERE]

ATVM The Advanced Technology Vehicle Manufacturing (ATVM) program provides loans to automobile and automobile part manufacturers for the cost of re-equipping, expanding, or...

384

OMB Number: 4040-0004 Expiration Date: 01/31/2009  

E-Print Network [OSTI]

-Lincoln * b. Employer/Taxpayer Identification Number (EIN/TIN): 47-0049123 * c. Organizational DUNS: 555456995 * Street1: 312 N 14th Street Street2: Alexander West * City: Lincoln County: Lancaster * State: NE

Farritor, Shane

385

OMB Approval: 1205-0508 Expiration Date: 03/31/2016  

E-Print Network [OSTI]

: ______________ to _______________ Please read and review the instructions carefully before completing this form and print legibly. A copy to be performed with as much specificity as possible, including details regarding the areas/fields and/or products required, such as the area(s), frequency and nature of the travel. § ***This employer is a research entity

Wisconsin at Madison, University of

386

Microsoft Word - 3 25 14 WAPA Testimony OMB Edits MDM COMMENTS...  

Office of Environmental Management (EM)

FY 2015 Budget. Western markets and delivers clean, renewable, reliable, cost-based hydroelectric power and related services within a 15-state region of the central and western...

387

Microsoft Word - 3 25 14 SWPA Testimony OMB Edits v2  

Energy Savers [EERE]

47.5 billion cubic feet of natural gas. 1 1 Fuel savings based on thermal conversion factors from EIA's Annual Energy Review-2011. 5 WORKFORCE PLANNING As I mentioned before,...

388

OMB Approval Number 2700-0087 NATIONAL AERONAUTICS AND SPACE ADMINISTRATION (NASA)  

E-Print Network [OSTI]

observations and field campaigns that support SMD science missions; development of integrated Earth system models; development of systems for applying Earth science research data to societal needs

Mojzsis, Stephen J.

389

Policy Flash 2013-48 OMB memorandum M-13-10, Antideficiency Act...  

Broader source: Energy.gov (indexed) [DOE]

Agreements Questions concerning this policy flash should be directed to Kevin M. Smith, of the Contract and Financial Assistance Policy Division, at Kevin.M.Smith@hq.doe.gov...

390

Microsoft Word - Sec 999 Annual Plan - January 2008 revOMB final...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

J January 2008 NETL Contact: Brad Tomer Director Strategic Center for Natural Gas & Oil Prepared by: National Energy Technology Laboratory www.netl.doe.gov Prepared for:...

391

O:\A76\FAIR\Fair Act 2008\Guidance\PDF\Attachment 7.pdf.prn.pdf  

Broader source: Energy.gov (indexed) [DOE]

ATTACHMENT 7 ATTACHMENT 7 TO BE USED AS A SAMPLE Office of Environmental Management - Complex Wide Narrative Description of Changes in the 2007 Activities Inventory There are 1,495 FTEs in the 2007 inventory, 13 fewer than reported in 2006. Changes between the 2007 and 2006 inventories are identified below: Function Codes: Code Description 2006 Inventory 2007 Inventory Delta A Recurring Testing and Inspection Services 1 9 8 B Personnel Management 62.5 58 -4.5 C Finance and Accounting 62 71 9 D Regulatory and Program Management Support Services 46 44 -2 E Environment 968.5 937.5 -31 F Procurement 119 128 9 I Investigations 26 27 1 M Forces and Direct Support 4 5 1 P 1 -1 R Research, Development, Test and Evaluation (RDT&E) 4 4 0 S Installation Services 47 47 0

392

O:\A76\FAIR\Fair Act 2008\Guidance\PDF\COLLECTION TOOL TRAINING.pdf.prn.pdf  

Broader source: Energy.gov (indexed) [DOE]

FY 2008 IGCA Inventory Data Collection FY 2008 IGCA Inventory Data Collection FY 2008 IGCA Inventory Data Collection Office of Procurement & Assistance Management Objective Objective Familiarize you with the Excel spreadsheet being provided for Familiarize you with the Excel spreadsheet being provided for collecting the FY 2008 Inherently Governmental and Commercial collecting the FY 2008 Inherently Governmental and Commercial Activities Inventory. The collection tool enables the user to s Activities Inventory. The collection tool enables the user to s ee ee side by side previous and current year data side by side previous and current year data - - allowing an allowing an "apples with apples" comparison. The spreadsheet provides "apples with apples" comparison. The spreadsheet provides

393

Draft FY 2012 Agency Financial Report  

Broader source: Energy.gov (indexed) [DOE]

to provide performance, financial and to provide performance, financial and related information in a more meaningful and useful format. For Fiscal Year 2013, the Department of Energy (Department or DOE), has produced an Agency Financial Report, and will provide an Annual Performance Report and a Summary of Performance and Financial Information, pursuant to OMB Circular A-136. They will be available at the website below, as each report is completed. This reporting approach simplifies and streamlines the performance presentations. T Agency Financial Report (AFR) - The AFR is organized by three major sections.  Management's Discussion and Analysis provides executive-level information on the Department's history, mission, organization, Secretarial priorities, analysis of financial statements, systems, controls and legal

394

Financial Risk, Policy & Controls | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Financial Risk, Policy & Controls Financial Risk, Policy & Controls Financial Risk, Policy & Controls The mission of the Office of Financial Risk, Policy and Controls (CF-50) is to contribute to the effective management of the financial resources of the Department of Energy by working in collaboration with our stakeholders, we will achieve the shared goal of continuous process improvement while complying with federal regulations. As stewards of taxpayers' money, we will be an objective source of internal controls expertise while providing the following functions: Internal Controls - Implement and maintain a complex-wide program for internal controls under the Federal Managers' Financial Integrity Act and OMB Circular A-123. Financial Policy - Establish and interpret Departmental accounting and

395

Newsletter8.08  

Broader source: Energy.gov (indexed) [DOE]

Man- Man- ager. This program is being overseen by the Federal Acquisition Institute (FAI). Definitions: "Acquisition workforce" is used to refer to the uni- verse of professionals sub- ject to the requirements of DOE O 361.1B. "Major Acquisitions" are defined in OMB Circular A-11, Part 7, Exhibit 300. FAC-P/PM will recognize three levels of certification: entry/apprentice, mid level/ journeyman, and senior/ expert. CRB Announcements The Certification Review Board has expanded the activities for which con- tinuing education credit may be requested. The fol- lowing three activities are eligible for continuing edu- cation credit effective im- mediately. Participation on an O413.3A Guide Team: * Team Member (Maximum per guide team) = 8 hours

396

Earned Value Management System (EVMS) Surveillance Standard Operating Procedure  

Broader source: Energy.gov (indexed) [DOE]

System (EVMS) System (EVMS) Surveillance Standard Operating Procedure (ESSOP) Issued by Office of Acquisition and Project Management MA-63 September 30, 2013 V2 DEPARTMENT OF ENERGY Office of Acquisition and Project Management (OAPM) EVMS SURVEILLANCE SOP (ESSOP) SEPTEMBER 30, 2013 ii Earned Value Management System (EVMS) Surveillance Standard Operating Procedure (ESSOP) OPR: MA-63 Update V2: September 30, 2013 1. PURPOSE. This EVMS Surveillance Standard Operating Procedure (ESSOP) serves as a primary reference for OAPM MA-63 when conducting EVM System-level assessments. DOE Order (O) 413.3B, the Office of Management and Budget (OMB) Circular A-11, and the Federal Acquisition Regulations (FAR) require implementation of an EVMS on DOE capital asset

397

follow  

Broader source: Energy.gov (indexed) [DOE]

AUDIT FOLLOW-UP PROCESS AUDIT FOLLOW-UP PROCESS U.S. DEPARTMENT OF ENERGY OFFICE OF INSPECTOR GENERAL OFFICE OF AUDIT SERVICES JULY 1999 DOE/IG-0447 AUDIT REPORT July 7, 1999 MEMORANDUM FOR THE SECRETARY FROM: Gregory H. Friedman Inspector General SUBJECT: INFORMATION : Report on "The U.S. Department of Energy's Audit Follow-up Process" BACKGROUND Audit follow-up is an integral part of good management. According to Office of Management and Budget (OMB) Circular A-50, corrective action taken by Departmental officials on audit findings and recommendations is essential to improving the effectiveness and efficiency of Government operations. Over the past several years, the Office of Inspector General (OIG) has issued reports addressing a variety of

398

The Standards Forum, March 1998  

Broader source: Energy.gov (indexed) [DOE]

4 – March 1998 4 – March 1998 The Standards News on the DOE Technical Standards Program Forum Volume 5 – Number 4 – March 1998 UN I T E D S T A T ES O F A M E R I C A D E P A R T M E N T O F E N E R G Y (Continued on Page 15) News Briefs .................................... 5 Standards Actions ........................... 7 OMB Circular A-119 ........................ 13 Upcoming Meetings ......................... 14 A Note From the Manager ................ 2 Questions & Answers ...................... 2 TSM Spotlight ................................. 3 Topical Committee Developments .... 4 INSIDE THIS ISSUE (Continued on Page 2) Working Together for Standards Leadership in the 21st Century By Phil Condit Reprinted with permission of Standards Engineering, Journal of the Standards Engineering Society (SES), No- vember/December 1997, Vol. 49, No. 6. For subscription

399

Document  

Broader source: Energy.gov (indexed) [DOE]

June 30, 2003 June 30, 2003 Part II Department of Energy Privacy Act of 1974; Publication of Compilation of Systems of Records; Notice VerDate Jan2003 18:47 Jun 27, 2003 Jkt 200001 PO 00000 Frm 00001 Fmt 4717 Sfmt 4717 E:\FR\FM\30JNN2.SGM 30JNN2 38756 Federal Register / Vol. 68, No. 125 / Monday, June 30, 2003 / Notices DEPARTMENT OF ENERGY Privacy Act of 1974; Publication of Compilation of Systems of Records AGENCY: Department of Energy. ACTION: Notice. SUMMARY: As required by the Privacy Act of 1974, 5 U.S.C. 552a, and the Office of Management and Budget (OMB) Circular A-130, the Department of Energy (DOE or Department) is publishing its compilation of Privacy Act Systems of Records. This notice provides an accurate and complete text of the agency's systems of records, and

400

Page not found | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

91 - 17400 of 26,764 results. 91 - 17400 of 26,764 results. Download FIA-12-0069- In the Matter of Mary Ann Parker On November 16, 2012, the Office of Hearings and Appeals (OHA) issued a decision denying an appeal (Appeal) from a Privacy Act determination issued by the Department of Energy's Oak Ridge Office ... http://energy.gov/oha/downloads/fia-12-0069-matter-mary-ann-parker Download Audit Letter Report: OAS-L-07-05 The Department of Energy's Implementation of Revised OMB Circular No. A-123 http://energy.gov/ig/downloads/audit-letter-report-oas-l-07-05 Page Official Use Only Information Welcome to the Official Use Only (OUO) webpage. This page is designed to provide information, answer questions, and provide a point of contact for inquiries concerning OUO and Controlled... http://energy.gov/hss/services/classification/official-use-only-information

Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

Flash2006-38Attachment.doc  

Broader source: Energy.gov (indexed) [DOE]

AM18EXB.DOC EXHIBIT B AM18EXB.DOC EXHIBIT B October 1, 2002 Page 1 of 18 Release 5 SAMPLE AUDIT PROGRAM FOR ALLOWABLE COSTS REVIEWS I. PURPOSE AND OBJECTIVE The purpose of the cost allowability audit is to determine whether costs charged to Department of Energy (DOE) contracts are allowable, allocable, and reasonable per contract terms; Federal Acquisition Regulations (FAR) or OMB Circulars, as applicable, and DOE Acquisition Regulations (DEAR); and Cost Accounting Standards as implemented by the contract terms. Specific guidance covering the three criteria for allowability and example audit steps for select cost areas are included in Appendix A. This program is intended for use by contractor internal audit activities. The audit steps are general

402

Field Operations Management .:. Lawrence Berkeley National Laboratory  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Home OCFO Financial Calendar Home OCFO Financial Calendar Quicklinks: A-Z Index for the OCFO Berkeley Lab Home Contact Us: By Group Contact Us: By Subject Contact Us: Full Listing Employment Financial Systems Modernization (F$M) Fiscal Close Forms: By Group Forms: Full Listing Glossary OCFO EH&S OCFO HR OCFO Home Policies Signature Authority ---------------------------------- UCOP University of California DOE CFO U.S. Department of Energy --------------------------------- Cost Accounting Standards DOE Accounting Handbook Federal Accounting Standards Generally Accepted Accounting Principles OMB Circular Regulations & Procedures Manual (RPM) UC Accounting Manual UC/DOE Prime Contract (Contract 31) CFO Departments: Budget Office Business Systems Analysis Conference Services Controller's Office Field Operations Management Financial Policy & Assurance Procurement & Property Office of Sponsored Projects & Industry Partnerships Training Travel Office

403

SECTION 124„AGENCY OPERATIONS IN THE ABSENCE OF APPROPRIATIONS  

Broader source: Energy.gov (indexed) [DOE]

124-AGENCY OPERATIONS IN THE ABSENCE OF APPROPRIATIONS 124-AGENCY OPERATIONS IN THE ABSENCE OF APPROPRIATIONS OMB Circular No. A-11 (2013) Page 1 of Section 124 SECTION 124-AGENCY OPERATIONS IN THE ABSENCE OF APPROPRIATIONS Table of Contents 124.1 What types of actions may my agency conduct during a funding hiatus? 124.2 What plans should my agency make in anticipation of a funding hiatus? 124.3 When should my agency's shutdown plans be implemented? 124.1 What types of actions may my agency conduct during a funding hiatus? (a) Background. The Attorney General issued two opinions in the early 1980s that the language and legislative history of the Antideficiency Act unambiguously prohibit agency officials from incurring obligations in the absence of appropriations ("Applicability of the Antideficiency Act Upon a Lapse in an Agency's Appropriations"

404

Policy Flash 2013-05 | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

5 5 Policy Flash 2013-05 Attached is Policy Flash 2013-05 Class Deviation from the Federal Acquisition Regulation (FAR) to Implement Office of Management and Budget (OMB) Policy Memorandum M-12-16, Providing Prompt Payment to Small Business Subcontractors. Questions concerning this policy flash should be directed to Nancy Harvey of the Contract and Financial Assistance Policy Division, Office of Policy, Office of Acquisition and Project Management at Nancy.Harvey@hq.doe.gov. Class Deviation -Providing Prompt Payment 2013-05.pdf Signed Deviation Bosco-Waddell w-attachement.pdf More Documents & Publications Policy Flash 2014-11 Federal Acquisition Circular (FAC) 2005-71 Policy Flashes FY 2013 Policy Flash 2013-69 Extension of Policy to Provide accelerated payment to

405

Calendar Year 2007 | Department of Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

7 7 Calendar Year 2007 RSS December 19, 2007 Inspection Report: IG-0784 The Department of Energy's Pandemic Influenza Planning December 18, 2007 Audit Report: OAS-M-08-04 Management Controls over Operations of the Integrated Disposal Facility atthe Hanford Site December 17, 2007 Audit Report: IG-0783 Beryllium Surface Contamination at the Y-12 National Security Complex December 13, 2007 Special Report: IG-0782 Management Challenges at the Department of Energy December 11, 2007 Audit Report: OAS-L-08-03 The Department of Energy's Implementation of Revised OMB Circular No. A-123 December 11, 2007 Audit Report: OAS-M-08-03 Management Controls over Implementation of the Homeland Defense Equipment Reuse Program November 28, 2007 Audit Letter Report: OAS-L-08-02 Department's Implementation of the Strategic Integrated Procurement

406

Document  

Broader source: Energy.gov (indexed) [DOE]

January 9, 2009 January 9, 2009 Part II Department of Energy Privacy Act of 1974; Publication of Compilation of Privacy Act Systems of Records; Notice VerDate Nov2008 15:08 Jan 08, 2009 Jkt 217001 PO 00000 Frm 00001 Fmt 4717 Sfmt 4717 E:\FR\FM\09JAN2.SGM 09JAN2 yshivers on PROD1PC62 with NOTICES2 994 Federal Register / Vol. 74, No. 6 / Friday, January 9, 2009 / Notices DEPARTMENT OF ENERGY Privacy Act of 1974; Publication of Compilation of Privacy Act Systems of Records AGENCY: U.S. Department of Energy. ACTION: Notice. SUMMARY: As required by the Privacy Act of 1974, 5 U.S.C. 552a, and the Office of Management and Budget (OMB) Circular A-130, the Department of Energy including the National Nuclear Security Agency (NNSA) (hereinafter referred to collectively as

407

Microsoft Word - TAB 6.1- APMS Interim Report  

Broader source: Energy.gov (indexed) [DOE]

REVIEW REVIEW 1 U.S. Department of Energy ENVIRONMENTAL MANAGEMENT ADVISORY BOARD Report of Activities for June 14, 2013 Public Meeting Submitted by the EMAB Acquisition and Project Management Subcommittee June 14, 2013 Background: The APMS presented a written report on its efforts at the EMAB meeting on May 31, 2012, on FY 2012 activity related to the 2012 work plan. An oral update was presented at the December 5, 2012 on FY 2013 work plan activity related to OMB Circular A-11 previously unused capital project classifications that would appropriately match the EM mission requirements. In addition, GAO reports issued in 2012 were discussed. The FY 2013 work plan included a review of the draft Operations Policy & Protocol to better track its operations activities. The plan was updated on February 22, 2013 to include a review of

408

Document  

Broader source: Energy.gov (indexed) [DOE]

886 886 Federal Register / Vol. 69, No. 129 / Wednesday, July 7, 2004 / Notices of Federal Regulations is available on GPO Access at: www.gpoaccess.gov/nara/ index.html. Dated: June 30, 2004. Troy R. Justesen, Acting Deputy Assistant Secretary for Special Education and Rehabilitative Services. [FR Doc. 04-15408 Filed 7-6-04; 8:45 am] BILLING CODE 4000-01-U DEPARTMENT OF ENERGY Privacy Act of 1974; Notice of Amendment to an Existing System of Records AGENCY: Department of Energy. ACTION: Notice. SUMMARY: As required by the Privacy Act of 1974, 5 U.S.C. 552a, and Office of Management and Budget (OMB) Circular A-130, the Department of Energy (DOE) is publishing a notice of a proposed amendment to an existing system of records. DOE proposes to amend DOE-50 ''Personnel Assurance

409

Page not found | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

21 - 18330 of 28,905 results. 21 - 18330 of 28,905 results. Article Record of Decision Issued for the FutureGen 2.0 Project The U.S. Department of Energy (DOE) has decided to provide financial assistance to the FutureGen Industrial Alliance (the Alliance) for the FutureGen 2.0 Project. DOE will provide approximately $1 billion of in cost-shared funding (the majority of which was appropriated under the American Recovery and Reinvestment Act) through cooperative agreements with the Alliance, as described in DOE's Record of Decision (ROD). http://energy.gov/nepa/articles/record-decision-issued-futuregen-20-project Page Events http://energy.gov/eere/buildings/events Page IT Capital Planning As defined by the Office of Management and Budget (OMB) Circular A-11, "Capital planning and investment control means the same as capital

410

4.5 Audit Requirements  

Broader source: Energy.gov (indexed) [DOE]

Audit Requirements Audit Requirements Audit requirements are now contained in 2 separate sub-sections. Subsection 4.5.1 contains the audit requirements for States, Local Governments and Non-Profit Organizations while subsection 4.5.2 contains the audit requirements for For-Profit Organizations. 4.5.1 Audit Requirements for States, Local Governments and Non-Profit Organizations (a) General. All States, Local Governments and Non-Profit Organizations that expend over $500,000 in Federal funds in any year are required to have a single audit conducted in accordance with OMB Circular A-133. This requirement flows down to subrecipients that meet the dollar threshold. An independent auditor shall perform the audit in accordance with the Government Auditing Standards and must: 1) audit and provide opinions on the fair presentation of the

411

Page not found | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

01 - 14510 of 31,917 results. 01 - 14510 of 31,917 results. Download Audit Letter Report: OAS-L-09-05 The Department of Energy's Implementation of Revised OMB Circular No. A-123 http://energy.gov/ig/downloads/audit-letter-report-oas-l-09-05 Download EIS-0183: DOE Notice of Availability of the Record of Decision Mint Farm Generation Project http://energy.gov/nepa/downloads/eis-0183-doe-notice-availability-record-decision Download Goodman Manufacturing: Proposed Penalty (2011-SE-4301) DOE alleged in a Notice of Proposed Civil Penalty that Goodman Manufacturing manufactured and distributed noncompliant basic model CPC180* commercial package air conditioners in the U.S. http://energy.gov/gc/downloads/goodman-manufacturing-proposed-penalty-2011-se-4301 Download NEUP Project Selections_September212011_IRP and Infrastructure

412

Microsoft PowerPoint - corps_budget_development_process1.ppt  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

6-1 6-1 Management of Hydropower O&M US Army Corps of Engineers® Budget Development & Funding Budget Development & Funding 376-2 Management of Hydropower O&M US Army Corps of Engineers® Presentation Objectives Presentation Objectives At the end of this presentation you will be able to * Discuss the annual budget process for Civil Works funding, including hydropower O&M * Understand the various roles of multiple agencies in developing the annual hydropower O&M budget * Understand performance-based budgeting 376-3 Management of Hydropower O&M US Army Corps of Engineers® Budget Development Guidance Budget Development Guidance * Engineer Circular (EC) 11-2-187 (http://www.usace.army.mil/inet/functions/cw/ cecwb/) provides guidance for development and submission to OMB of

413

Program and Project Management for the Acquisition of Capital Assets  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

The purpose of this Order is to a) provide the Department of Energy (DOE) Elements, including the National Nuclear Security Administration (NNSA), with program and project management direction for the acquisition of capital assets with the goal of delivering projects within the original performance baseline (PB), cost and schedule, and fully capable of meeting mission performance, safeguards and security, and environmental, safety, and health requirements unless impacted by a directed change; and b) implement Office of Management and Budget (OMB) Circulars to include: A-11, Part 7, Capital Programming Guide, which prescribes new requirements and leading practices for project and acquisition management; A-123, Management's Responsibility for Internal Control, which defines management's responsibility for internal control in Federal agencies; and A-131, Value Engineering, which requires that all Federal agencies use Value Engineering (VE) as a management tool. Cancels DOE O 413.3A, Chg 1 dated 6-28-06.

2010-11-29T23:59:59.000Z

414

Microsoft Word - fal2004-04.doc  

Broader source: Energy.gov (indexed) [DOE]

Subject: OMB Circular A-133 Audits and the Federal Audit Clearinghouse What is the Purpose of this Financial Assistance Letter (FAL)? This FAL provides Contracting Officers (COs) and personnel working on grants guidance regarding the use of A-133 audits and the Federal Audit Clearinghouse (FAC). The purpose of the FAL is to ensure that 1) potential recipients are screened prior to award for submission of the audit and for qualified or adverse opinions in the audit; 2) audits with questioned items are reviewed and management decisions issued; and 3) that submission of audits and questioned costs are reviewed during the closeout process. How will this FAL Change My Work Processes? COs will need to check the FAC while performing the business and financial management

415

Microsoft Word - AL2003-04.doc  

Broader source: Energy.gov (indexed) [DOE]

No. 2003-04 No. 2003-04 Acquisition Regulation Date 08/25/03 ACQUISITION LETTER This Acquisition Letter is issued under the authority of the DOE Procurement Executive. Subject: Value Engineering References: OMB Circular No. A-131 Value Engineering FAR 48 Value Engineering FAR 52.248 Value Engineering DEAR 970.1504-5 Solicitation provision and contract clauses DEAR 970.5215-4 Cost reduction DOE O 413.3 Program and Project Management for the Acquisition of Capital Assets DOE O 430.1A Life Cycle Asset Management When is this Acquisition Letter (AL) Effective? This AL is effective 10 days after the date of issuance. When does this AL Expire?

416

An experimental study of the buckling behavior and frictional effects of a circular rod laterally constrained within a horizontal circular cylinder  

E-Print Network [OSTI]

. . 22 22 22 28 31 33 vn TABLE OF CONTENTS (continued) CHAPTER Page 4. 4 Analysis of Lateral Load Applied by Buckled Pipe . 40 V DISCUSSION. VI CONCLUSIONS . 45 49 VII RECOMMENDATIONS . 51 NOMENCLATURE 53 REFERENCES APPENDIX A FIXED END... CONDITIONS. 55 58 APPENDIX B 12 FT. MODEL EXPERIMENTS. 63 APPENDIX C LOAD VARIATION DURING ROD MOVEMENT. . . 70 APPENDIX D PHOTOGRAPHS. 72 VITA 74 LIST OF FIGURES Figure Page 2. 1 Post buckle rod position during the sinusoidal mode. 2. 2 Post buckle...

Williams, Thomas H.

1995-01-01T23:59:59.000Z

417

DOE O 130.1  

Office of Legacy Management (LM)

requests to the Office of Management and Budget (OMB) and the Congress in a timely, cost-effective manner and in accordance with OMB directives and applicable federal laws. To...

418

Christopher Johns | Department of Energy  

Energy Savers [EERE]

assignment at OMB, which he held for more than half his OMB career, he was a senior advisor to the Deputy Associate Director for National Security. In this role, he oversaw the...

419

Slide12 | OSTI, US Dept of Energy, Office of Scientific and Technical...  

Office of Scientific and Technical Information (OSTI)

OSTI on the Right Track * OMB Watch OSTI one of five federal government Web sites recognized as "on the right track" by OMB Watch, a nonprofit government watchdog organization...

420

2013 DOE Scorecard  

Broader source: Energy.gov [DOE]

Office of Management and Budget (OMB) Scorecard reporting Department of Energy sustainability achievements for fiscal year 2013.

Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

Slide 1 | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

DOE Supplemental Instructions for OMB Section 1512 Reporting - For Grant and Loan Recipients Instructions for Grant and Loan Recipients...

422

Microsoft PowerPoint - DOE Supplemental Instructions for OMB Section 1512 Reporting Contractors Q1 2010 [Compatibility Mode]  

Broader source: Energy.gov (indexed) [DOE]

Contractors Contractors 1 For Contractors Quarterly reporting through FederalReporting.gov April 2010 April 2010 Reporting Timeline Date Action Ongoing Registration open for FederalReporting.gov. Early registration is encouraged. April 1, 2010 Reporting Period Begins April 16, 2010 Reporting Period Ends - No new reports can be entered after 11:59 PM PDT on this date. NOTE: Reporting deadline was extended. April 17, 2010 Prime Recipient Review begins- Only corrections to existing reports can be made. April 19, 2010 Prime Recipient Review ends- No updates may be made after 11:59 PM PDT on this date without DOE Reviewer action. April 20, 2010 Federal review of data begins -Recipients may be contacted to answer 2 April 20, 2010 Federal review of data begins -Recipients may be contacted to answer

423

Microsoft PowerPoint - DOE Supplemental Instructions for OMB Section 1512 Reporting Grant and Loan Recipients Q1 2010 [Compati  

Broader source: Energy.gov (indexed) [DOE]

Grant and Loan Recipients Grant and Loan Recipients | 1 For Grant and Loan Recipients Quarterly reporting through FederalReporting.gov April 2010 April 2010 Reporting Timeline Date Action Ongoing Registration open for FederalReporting.gov. Early registration is encouraged. April 1, 2010 Reporting Period Begins April 16, 2010 Reporting Period Ends - No new reports can be entered after 11:59 PM PDT on this date. NOTE: Reporting deadline was extended. April 17, 2010 Prime Recipient Review begins- Only corrections to existing reports can be made. April 19, 2010 Prime Recipient Review ends- No updates may be made after 11:59 PM PDT on this date without DOE Reviewer action. For more information, contact DOE at: https://recoveryclearinghouse.energy.gov or 1-888-363-7289 or go to: http://www.FederalReporting.gov

424

OMB No. 0990-0115 U.S. DEPARTMENT OF HEALTH AND HUMAN SERVICES PHS 2013-1  

E-Print Network [OSTI]

INNOVATION RESEARCH CONTRACT PROPOSALS Internet: http://sbir.nih.gov PROPOSAL RECEIPT DATE NOVEMBER 13, 2012 ........................................................................................................... 3 1.5 REPORT FRAUD, WASTE AND ABUSE

Levin, Judith G.

425

Form Approved Through 6/30/2012 OMB No. 0925-0001 Department of Health and Human Services  

E-Print Network [OSTI]

-owned Socially and Economically Disadvantaged 11. ENTITY IDENTIFICATION NUMBER DUNS NO. Cong. District 12-01 University of Nebraska-Lincoln 312 N 14th Street, Alexander West Lincoln, NE 68588-0430 147-0049123A8 55-545-6995 NE-001 Jeanne Wicks Director, Sponsored Programs 312 N 14th Street, Alexander West Lincoln, NE 68588

Farritor, Shane

426

Revised: 06/11/2013 OMB Control No. 0648-0633 Expiration Date: 03/31/2015  

E-Print Network [OSTI]

/CHINOOK EDR AFA POLLOCK FISHERY VESSEL FUEL SURVEY CALENDAR YEAR 2012 EXAMPLE ONLY. SUBMI EDR ONLINE Administrator, Sustainable Fisheries Division, NOAA National Marine Fisheries Service, P.O. Box 21668, Juneau;Chinook EDR: Vessel Fuel Survey Page 2 of 5 ANNUAL CHINOOK EDR AFA POLLOCK VESSEL FUEL SURVEY The Chinook

427

Federal Acquisition Regulation Federal Acquisition Circular 2005-69 Summary of Rules  

Broader source: Energy.gov (indexed) [DOE]

9 Summary of Rules 9 Summary of Rules Item Subject FAR Case I Definition of Contingency Operation 2013-003 II Iran Threat Reduction 2012-030 III Documenting Contractor Performance 2012-009 IV Repeal of Sunset for Certain Protests of Task and Delivery Order Contracts 2013-011 V Least Developed Countries that Are Designated Countries 2013-009 VI Update to Biobased Reporting Requirements 2013-006 VII Technical Amendments Item I-Definition of Contingency Operation (FAR Case 2013-003) This final rule amends, without change, the interim rule published in the Federal Register at 78 FR 13765 on February 28, 2013, revising the definition of "contingency operation" in FAR 2.101 to address the statutory change to the definition made by paragraph (b) of section 515 of

428

Federal Acquisition Regulation Federal Acquisition Circular 2005-62 Summary of Rules  

Broader source: Energy.gov (indexed) [DOE]

2 Summary of Rules 2 Summary of Rules Item Subject FAR Case I. Updates to Contract Reporting and Central 2010-014 Contractor Registration II. Interagency Acquisitions: Compliance by Nondefense 2012-010 Agencies with Defense Procurement Requirements. III. Free Trade Agreement-Panama 2012-027 Item I-- Updates to Contract Reporting and Central Contractor Registration (FAR Case 2010-014) This final rule amends the FAR to limit the use of generic substitutes instead of Data Universal Numbering System (DUNS) numbers, and update the policies and procedures associated with reporting in the Federal Procurement Data System (FPDS). Additionally, this final rule changes the clauses requiring contractor registration in the Central Contractor

429

Federal Acquisition Regulation Federal Acquisition Circular 2005-65 Summary of Rules  

Broader source: Energy.gov (indexed) [DOE]

5 Summary of Rules 5 Summary of Rules Item Subject FAR Case I. Prohibition on Contracting with Inverted Domestic Corporations 2012-013 II. Extension of Sunset Date for Protests of Task and Delivery Orders 2012-007 III. Free Trade Agreement-Colombia 2012-012 IV. Unallowability of Costs Associated With Foreign Contractor Excise Tax 2011-011 V. Technical Amendment Item I-Prohibition on Contracting With Inverted Domestic Corporations (FAR Case 2012-013) This rule adopts as final an interim rule implementing section 738 of Division C of the Consolidated Appropriations Act, 2012 (Pub. L. 112-74), which prohibits the award of contracts using Fiscal Year 2012 appropriated funds to any foreign incorporated entity that is

430

Federal Acquisition Regulation Federal Acquisition Circular 2005-72 Summary of Rules  

Broader source: Energy.gov (indexed) [DOE]

72 Summary of Rules 72 Summary of Rules Item Subject FAR Case I Service Contracts Reporting Requirements 2010-010 II Prioritizing Sources of Supplies and Services for Use by Government 2009-024 III Terms of Service and Open-Ended Indemnification, and Unenforceability of Unauthorized Obligations 2013-005 IV Trade Agreements Thresholds 2013-021 Item I-- Service Contracts Reporting Requirements (FAR Case 2010-010) This final rule amends the FAR to implement section 743 of Division C of the Consolidated Appropriations Act, 2010. Section 743 calls for certain agencies, not including the Department of Defense, to submit annual inventories of service contracts. FAR subpart 4.17, Service Contracts Inventory, provides annual reporting requirements for agencies and contractors.

431

Federal Acquisition Regulation Federal Acquisition Circular 2005-70 Summary of Rules  

Broader source: Energy.gov (indexed) [DOE]

0 Summary of Rules 0 Summary of Rules Item Subject FAR Case I Pilot Program for Enhancement of Contractor Employee Whistleblower Protections 2013-015 II Allowability of Legal Costs for Whistleblower Proceedings 2012-017 Item I- Pilot Program for Enhancement of Contractor Employee Whistleblower Protections (FAR Case 2013-015) This interim rule amends the FAR to implement a four-year pilot program to enhance the existing whistleblower protections for contractor employees at subpart 3.9. In accordance with FAR 1.108(d)(3), contracting officers are encouraged to include the changes in these rules in major modifications to contracts and orders awarded prior to the effective date of this interim rule. The pilot program is mandated by section 828, entitled "Pilot Program for Enhancement of

432

Federal Acquisition Regulation Federal Acquisition Circular 2005-68 Summary of Rule  

Broader source: Energy.gov (indexed) [DOE]

8 Summary of Rule 8 Summary of Rule Item I- Expansion of Applicability of the Senior Executive Compensation Benchmark (Interim)(FAR Case 2012-017) This interim rule amends the FAR to implement the statutorily-expanded reach of the limitation on the allowability of compensation costs for certain contractor personnel. This limitation on the allowability of compensation costs is an amount set annually by the Office of Federal Procurement Policy. Prior to the enactment of section 803 of the National Defense Authorization Act for Fiscal Year 2012 (Pub. L. 112-81), this limitation applied to a contractor's five most highly compensated employees in management positions at each home office and each segment of the contractor, with respect to all contracts subject to the FAR cost principles with all

433

Federal Acquisition Regulation Federal Acquisition Circular 2005-66 Summary of Rules  

Broader source: Energy.gov (indexed) [DOE]

6 Summary of Rules 6 Summary of Rules Item Subject FAR Case I. Definition of Contingency Operation (Interim) 2013-003 II. Changes to Time-and-Materials and Labor-Hour Contracts and Orders 2011-025 III. Extension of Authority for Use of Simplified Acquisition Procedures 2013-007 for Certain Commercial Items IV. Technical Amendment Item I-Definition of Contingency Operation (Interim) (FAR Case 2013-003) This interim rule amends the definition of ''contingency operation'' in FAR 2.101 to address the statutory change to the definition made by paragraph (b) of section 515 of the National Defense Authorization Act for Fiscal Year 2012 (Pub. L. 112-081). Expanding the definition to include responding to a major disaster or emergency will increase the circumstances under which

434

A Micro-Variable Circular Orifice (MVCO) Fuel Injector for Zoned Low Temperature Combustion  

Broader source: Energy.gov [DOE]

Presentation given at DEER 2006, August 20-24, 2006, Detroit, Michigan. Sponsored by the U.S. DOE's EERE FreedomCar and Fuel Partnership and 21st Century Truck Programs.

435

Discovery of an unusual biosynthetic origin for circular proteins in legumes  

Science Journals Connector (OSTI)

...found in Oldenlandia affinis DC. An indigenous, Congolese drug “Kalata-Kalata” used to accelerate the delivery . Medd Norsk Farm Selskap 32 : 173 – 180 . 3 Gustafson KR ( 1994 ) Circulins A and B: Novel HIV-inhibitory macrocyclic peptides from...

Aaron G. Poth; Michelle L. Colgrave; Russell E. Lyons; Norelle L. Daly; David J. Craik

2011-01-01T23:59:59.000Z

436

Doppler-shifted cyclotron resonance of fast ions with circularly polarized shear Alfvn wavesa...  

E-Print Network [OSTI]

and M. K. Lilley3 1 Department of Physics and Astronomy, University of California, Irvine, California 92697, USA 2 Department of Physics and Astronomy, University of California, Los Angeles, California to infer the distribution function in the core. In the solar-terrestrial plasma environ- ments, where

Heidbrink, William W.

437

Target design optimization for an electron accelerator driven subcritical facility with circular and square beam profiles.  

SciTech Connect (OSTI)

A subcritical facility driven by an electron accelerator is planned at the Kharkov Institute of Physics and Technology (KIPT) in Ukraine for medical isotope production, materials research, training, and education. The conceptual design of the facility is being pursued through collaborations between ANL and KIPT. As part of the design effort, the high-fidelity analyses of various target options are performed with formulations to reflect the realistic configuration and the three dimensional geometry of each design. This report summarizes the results of target design optimization studies for electron beams with two different beam profiles. The target design optimization is performed via the sequential neutronic, thermal-hydraulic, and structural analyses for a comprehensive assessment of each configuration. First, a target CAD model is developed with proper emphasis on manufacturability to provide a basis for separate but consistent models for subsequent neutronic, thermal-hydraulic, and structural analyses. The optimizations are pursued for maximizing the neutron yield, streamlining the flow field to avoid hotspots, and minimizing the thermal stresses to increase the durability. In addition to general geometric modifications, the inlet/outlet channel configurations, target plate partitioning schemes, flow manipulations and rates, electron beam diameter/width options, and cladding material choices are included in the design optimizations. The electron beam interactions with the target assembly and the neutronic response of the subcritical facility are evaluated using the MCNPX code. the results for the electron beam energy deposition, neutron generation, and utilization in the subcritical pile are then used to characterize the axisymmetric heat generation profiles in the target assembly with explicit simulations of the beam tube, the coolant, the clad, and the target materials. Both tungsten and uranium are considered as target materials. Neutron spectra from tungsten and uranium are very similar allowing the use of either material in the subcritical assembly without changing its characteristics. However, the uranium target has a higher neutron yield, which increases the neutron flux of the subcritical assembly. Based on the considered dimensions and heat generation profiles, the commercial CFD software Star-CD is used for the thermal-hydraulic analysis of each target design to satisfy a set of thermal criteria, the most limiting of which being to maintain the water temperature 50 below the boiling point. It is found that the turbulence in the inlet channels dissipates quickly in narrow gaps between the target plates and, as a result, the heat transfer is limited by the laminar flow conditions. On average, 3-D CFD analyses of target assemblies agree well with 1-D calculations using RELAP (performed by KIPT). However, the recirculation and stagnation zones predicted with the CFD models prove the importance of a 3-D analysis to avoid the resulting hotspots. The calculated temperatures are subsequently used for the structural analysis of each target configuration to satisfy the other engineering design requirements. The thermo-structural calculations are performed mostly with NASTRAN and the results occasionally compared with the results from MARC. Both, NASTRAN and MARC are commercially available structural-mechanics analysis software. Although, a significant thermal gradient forms in target elements along the beam direction, the high thermal stresses are generally observed peripherally around the edge of thin target disks/plates. Due to its high thermal conductivity, temperatures and thermal stresses in tungsten target are estimated to be significantly lower than in uranium target. The deformations of the target disks/plates are found to be insignificant, which eliminate concerns for flow blockages in narrow coolant channels. Consistent with the specifications of the KIPT accelerator to be used in this facility, the electron beam power is 100-kW with electron energy in the range of 100 to 200 MeV. As expected, the 100 MeV el

Gohar, M. Y. A; Sofu, T.; Zhong, Z.; Belch, H.; Naberezhnev, D.; Nuclear Engineering Division

2008-10-30T23:59:59.000Z

438

Circularly Inclined Solenoid Channel for 6D Ionization Cooling of Muons  

SciTech Connect (OSTI)

Ionization cooling is essential for realization of Muon Collider, muons beam based neutrino factories and other experiments involving muons. The simplest structure - absorber(s) immersed in alternating solenoidal magnetic field - provides only transverse cooling since the longitudinal motion in the most suitable momentum range (2-300MeV/c) is naturally anti-damped. To overcome this difficulty it is proposed to periodically tilt solenoids so that a rotating transverse magnetic field was created. By choosing the phase advance per period above a multiple of 2{pi} it is possible to ensure that muons with higher momentum make a longer path in the absorber (whether distributed or localized) thus providing longitudinal damping. Basic theory of such channel and results of tracking simulations are presented.

Alexahin, Y.; /Fermilab

2009-05-01T23:59:59.000Z

439

Policy Flash 2014-11 Federal Acquisition Circular (FAC) 2005-71  

Broader source: Energy.gov [DOE]

Questions concerning this policy flash should be directed to Barbara Binney, of the Office of Acquisition and Project Management Policy at (202) 287-1340 or at Barbara.Binney@hq.doe.gov.

440

Effect of wall conduction on heat transfer for turbulent flow in a circular tube  

E-Print Network [OSTI]

) then ~ y+) 1+ g-7 x? ~? CmR. ~&r I'g g x I, & " pig. p()c)} f so as tm Lr=b rnn ? y Z. C R?(v)e~P( ? P X ) ~ M o (14) 2 where P =1, b. = (i+1) w. m m, ' i i+1 + + F (x )= (1 ? exp(-P x ) }/P 0 Ill Itl + . +i + F, (x )= (x -iF, (x )}/P... The dimensionless temperature gradient at the interface of the tube Qf is defined by the following equation; Q=qr/kt ? ? ? ? ? H f f o f fe Q=qr/k(t -t) ? ? -T f f o f fe w (15) from Eq. (14) 2- j. L. 'P. ( & ) j+ Pmi =I 2=1 &zH e j Anal sis of Ener E uation...

Lin, Yie-Kuang

2012-06-07T23:59:59.000Z

Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

Contraction Control of a Fleet Circular Formation of AUVs under Limited Communication Range  

E-Print Network [OSTI]

of the communication graph (distance- dependent). The multi-agent system is simulated with Matlab. Videos showing constraint is tackled by using a cooperative control scheme which includes the Laplacian matrix assumption, where the communication graph depends on the agent's relative posi- tion [1], [5], [17]. Note

Paris-Sud XI, Université de

442

Flexural Stiffnesses of and Dimensional Stability in Circular Quasi-isotropic Laminate Mirrors  

E-Print Network [OSTI]

buffer layers on composite mirrors for high surface smoothness. In this dissertation document, radial stiffness associated with stacking sequence effects in quasi-isotropic laminates (pi/n, where n=3, 4, and 6) and dimensional stability in the composite...

Kim, Kyungpyo

2009-01-01T23:59:59.000Z

443

A numerical study of steady fluid flow in the entry region of a straight circular tube  

E-Print Network [OSTI]

region. The Basic Equations The flow under i nves ti gati on is governed by the Navier-Stokes equations p ? = F - . + uv Du Dt x ax p ? = F - @uv v, Dv a A 2 Dt y ay (2) Dw= F ma+ Dt w as and the continuity equation "u av aw + ? = p ay... + w D a a a a Ut = at ax ay as and 2 a2 a2 a2 ax2 ay2 as2 Expressed in cylindrical form, the previous equations become 2 P = Fr M + & v V r e D Ve 2aV Dt r " ar r2ae DVe V Ve 2aV V p + ? = Fe - ~a + u & Ve + r - e Dt r rae (2a) F -22+ pv V...

Crain, John Kee

2012-06-07T23:59:59.000Z

444

CDtool--an integrated software package for circular dichroism spectroscopic data processing, analysis, and archiving  

E-Print Network [OSTI]

-207-631-6803. E-mail address: ubcg25a@mail.cryst.bbk.ac.uk (B.A. Wallace). 1 Abbreviations used: SRCD, synchroton

Wallace, Bonnie Ann

445

Experimental Study of Circular Laminar Confined Jets at Low Reynolds Numbers  

E-Print Network [OSTI]

such as piping, heat exchangers, combustion chambers, mixers and bio-fluidics. - Insufficient experimental

Diggavi, Suhas

446

ANL-85-51 ANL-85-51 FLOW-INDUCED VIBRATION OF CIRCULAR CYLINDRICAL...  

Office of Scientific and Technical Information (OSTI)

Soc Civil Eng. 97(EM6), 1039-1060. Lighthill, M. J. 1960. Note on Swimming of Slender Fish. J. Fluid Mech. 9(2), 305-317. Lin, W. H., Wambsganss, M. W., and Jendrzejczyk, J. A....

447

U. S. GEOLOGICAL SURVEY CIRCULAR 930-N International Strategic Minerals Inventory  

E-Print Network [OSTI]

of Australia, Canada, the Federal Republic of Germany, the Republic of South Africa, the United Kingdom of Germany, the Republic of South Africa, the United Kingdom, and the United States of America 1993 #12;U-resource agencies of Australia, Canada, the Federal Republic of Germany, the Republic of South Africa, the United

448

Bearing capacity and settlement of circular shallow foundations using a non-linear constitutive relationship  

E-Print Network [OSTI]

. Page 5 of 26 INTRODUCTION Shallow foundations are widely used to support lightly loaded structures on clay soils, as well as more heavily loaded structures such as fluid storage tanks. These are typically designed using the classical Prandtl...

McMahon, B.T.; Haigh, Stuart; Bolton, M.D.

2014-04-04T23:59:59.000Z

449

CAPITO—a web server-based analysis and plotting tool for circular dichroism data  

Science Journals Connector (OSTI)

......capable of analysing multiple CD datasets of virtually any format and...CAPITO accepts multiple CD datasets and, hence, is well suited...X-ray crystallography and nuclear magnetic resonance (NMR...analysis. 2.2 Reference datasets For this study, we used the......

Christoph Wiedemann; Peter Bellstedt; Matthias Görlach

2013-07-15T23:59:59.000Z

450

Are large perimeter- minimizing two-dimensional clusters of equal-area bubbles hexagonal or circular?  

Science Journals Connector (OSTI)

...as N increases, with sharp upward jumps that occur roughly midway between hexagonal numbers and then a slower decay. So, we...far from hexagonal numbers, e.g. for N=868, which is midway between the hexagonal numbers 817 and 919 (figure-5), although...

2013-01-01T23:59:59.000Z

451

Office of Management and Budget Circular No. A-133 | Open Energy...  

Open Energy Info (EERE)

of agency programs, projects, activities, as well as contracts for supplies and services, including performance based, architect-engineering, and construction contracts....

452

Policy Flash 2014-38 Federal Acquisition Circular (FAC) 2005-76  

Broader source: Energy.gov [DOE]

Questions concerning this policy flash should be directed to Jason Taylor, of the Contract and Financial Assistance Policy Division at (202) 287-1560 or at Jason.Taylor@hq.doe.gov

453

A circular electrostatic zipping actuator for the application of a MEMS tunable capacitor  

E-Print Network [OSTI]

Micromechanical circuits such as MEMS switches, tunable capacitors (varactors) or resonators in general have lower loss and consume less power than their CMOS counterparts and have seen an increase of applications in ...

Yang, Xue'en, 1975-

2005-01-01T23:59:59.000Z

454

Wave Interactions with Arrays of Bottom-Mounted Circular Cylinders: Investigation of Optical and Acoustical Analogies  

E-Print Network [OSTI]

Wave scattering by arrays of cylinders has received special attention by many authors and analytical solutions have been derived. The investigation of optical and acoustical analogies to the problem of interaction of water waves with rigid...

Baquet, Aldric

2010-10-12T23:59:59.000Z

455

Wave Energy Extraction from an Oscillating Water Column in a Truncated Circular Cylinder  

E-Print Network [OSTI]

Oscillating Water Column (OWC) device is a relatively practical and convenient way that converts wave energy to a utilizable form, which is usually electricity. The OWC is kept inside a fixed truncated vertical cylinder, which is a hollow structure...

Wang, Hao

2013-07-19T23:59:59.000Z

456

PANS method of turbulence: simulation of high and low Reynolds number flows past a circular cylinder  

E-Print Network [OSTI]

cylinder are performed at ReD 140,000 and ReD 3900 using the PANS model. The high Reynolds number PANS results are compared with experimental results from Cantwell and Coles, Large Eddy Simulation results from Breuer, and Detached Eddy Simulation results...

Lakshmipathy, Sunil

2006-04-12T23:59:59.000Z

457

Capillary instability of the cylindrical interface between ferrofluids in a magnetic field with circular field lines  

Science Journals Connector (OSTI)

Capillary breakup of a viscous magnetic fluid layer subjected to a gradient magnetic field under hydroweightlessness is studied within the linear theory. The cylinder surface of a current-carrying conductor se...

V. M. Korovin

2001-12-01T23:59:59.000Z

458

Particle Tracking in Circular Accelerators Using the Exact Hamiltonian in SixTrack  

E-Print Network [OSTI]

Particle motion in accelerators is in general complex. Tracking codes are developed to simulate beam dynamics in accelerators. SixTrack is a long lived particle tracking code maintained at CERN, the European Organization for Nuclear Research. A particle accelerator consists of a large number of magnets and other electromagnetic devices that guide the particle through the accelerator. Each device defines its own equation of motion, which often cannot be solved exactly. For this purpose, a number of approximations are introduced in order to facilitate the solution and to speed up the computation. In a high-energy accelerator, the particle has small transverse momentum components. This is exploited in the small-angle approximation. In this approximation the equations of motion are expanded to a low order in the transverse momentum components. In low-energy particle accelerators, or in tracking with large momentum deviations, this approximation is invalid. The equations of motion of a particle passing through a f...

Fjellstrom, Mattias; Hansson, Johan

2013-12-13T23:59:59.000Z

459

CRADA with PACCAR Experimental Investigation in Coolant Boiling in a Half-Heated Circular Tube  

Broader source: Energy.gov [DOE]

2011 DOE Hydrogen and Fuel Cells Program, and Vehicle Technologies Program Annual Merit Review and Peer Evaluation

460

PACCAR CRADA: Experimental Investigation in Coolant Boiling in a Half-Heated Circular Tube  

Broader source: Energy.gov [DOE]

2012 DOE Hydrogen and Fuel Cells Program and Vehicle Technologies Program Annual Merit Review and Peer Evaluation Meeting

Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

Flows of Incompressible Newtonian and Generalized Newtonian Fluids over a Circular Cylinder  

E-Print Network [OSTI]

for progressively increasing flow rates corresponding to Re = 20, 40, 60, 100 and 200 for Newtonian and Carreau fluids and Re_n = 15.6, 37.2, 64.2, 118.8 and 285.0 for power-law fluids. The inlet length and the height of the domain are established so that boundaries...

Klein, Kayla

2012-05-31T23:59:59.000Z

462

Scattering and focusing of SH waves by a convex circular-arc topography  

Science Journals Connector (OSTI)

......of focusing wave energy, which is a significant...focusing of wave energy by the shallow or...6 and 3.2 at frequencies of 3, 5 and 10...collecting wave energy in much the same...cables, mines, storage facilities, mass...the seismic ground response has been investigated......

Deng-How Tsaur; Kao-Hao Chang

2009-04-01T23:59:59.000Z

463

September 15, 2002 / Vol. 27, No. 18 / OPTICS LETTERS 1589 Backscattering of circularly polarized pulses  

E-Print Network [OSTI]

-dependent vector radiative transport equation, using the Chebyshev spectral method.5 We consider a left simulations of vector radiative transport, we examine time-resolved backscattering of circu- larly polarized the theory of radiative transport. This theory assumes that scattered fields from different scatterers

Kim, Arnold D.

464

Proof of principle study of ultrasonic particle manipulation by a circular array device  

Science Journals Connector (OSTI)

...violated. Figure 5. Force potential U for a polystyrene...FE-based calculation of a force potential U in a 16 element...and I. A. Stegun 1964 Handbook of mathematical functions...Schmerr, L. W. J. 1998 Fundamentals of ultrasonic nondestructive...1990 Acoustic radiation force on a small compressible...

2012-01-01T23:59:59.000Z

465

Hydrogen atoms in circularly polarized microwave fields: Near-integrability and ionization  

E-Print Network [OSTI]

systems I and II. Con- sider the energy momentum map-[8] corresponding to the integrable system II: AfsM: P~)R': (r, p)~(H(r, p), I(r, p), J(r, p)), A,FM(P)=Q . where Q C:IR is the image of the phase space P under the energy-momentum map. Let M(r, p... of the points from Q ) pz c c = [(r,p): H(r, p) =E,I(r, p) =C„J(r,p) =Cz j =JRFM(E, C„C2), (E,C), C~) H Q . Each level set pz c c is invariant under the motion cor-i' 2 responding to the Hamiltonian function H, as weH as un- der the motions of I and J treated...

Rakovi?, M. J.; Chu, Shih-I

1995-08-01T23:59:59.000Z

466

Simple Circular Odor Chart for Characterization of Trace Amounts of Odorants Discharged from Thirteen Odor Sources  

Science Journals Connector (OSTI)

......and F. Dewinter. Gas chromato- graphic determination of ethylene in large air volumes at the fractional parts-per-billion...Mckean, Jr., B.F. Hrutfiord, K.V. Sarkanen, L. Price, and I.B. Douglass. Effect of kraft pulping condi- tions......

Yasuyuki Hoshika; Yoshimasa Nihei; Giichi Muto

1981-04-01T23:59:59.000Z

467

Circularly Polarized Photoluminescence from Gradient-Pitch Chiral-Nematic Films  

Science Journals Connector (OSTI)

Departments of Chemical Engineering and Chemistry, Materials Science Program, and Laboratory for Laser Energetics, Center for Optoelectronics and Imaging, University of Rochester, 240 East River Road, Rochester, New York 14623-1212 ... A mixture consisting of a nematic acrylate and a chiral diacrylate lightly doped with Exalite 428, a laser dye, was prepared into thin films for in situ photopolymerization. ... The laser dye served to regulate the photocuring intensity profile into the film and as a light emitter. ...

D. Katsis; D. U. Kim; H. P. Chen; L. J. Rothberg; S. H. Chen; T. Tsutsui

2001-01-06T23:59:59.000Z

468

Policy Flash 2013-63 Federal Acquisition Circular (FAC) 2005-67  

Broader source: Energy.gov [DOE]

Questions concerning this policy flash should be directed to Barbara Binney, of the Office of Acquisition and Project Management Policy at (202) 287-1340 or at Barbara.Binney@hq.doe.gov.  

469

Phase matrix and cross sections for single scattering by circular cylinders: a comparison of ray optics  

E-Print Network [OSTI]

optics and wave theory Yoshihide Takano and Masayuki Tanaka The phase matrix and several quantities of ray optics, which includes geometrical reflection and refraction plus Fraunhofer diffraction optics approximations for m = 1.31-O.Oi and 1.31-0.li. Results by these methods approach oneanother

Takano, Yoshihide

470

Moving Toward the Circular Economy: The Role of Stocks in the Chinese Steel Cycle  

Science Journals Connector (OSTI)

(15, 16) Another common approach is to correlate the flows of steel consumption to external GDP projections, e.g., in the World Energy Model(17) or as in a publication by Das and Kandpal. ... Future demand for the total in-use stock S1(t) is determined by multiplying population estimates P(t) with a scenario-specific set of per-capita stocks ci(t) for all product categories: ...

Stefan Pauliuk; Tao Wang; Daniel B. Müller

2011-11-17T23:59:59.000Z

471

Development of vortex state in circular magnetic nanodots: Theory and experiment RID A-9247-2009  

E-Print Network [OSTI]

magnetic vortex. The vortex-core diameter is controlled by competing magnetic energy contributions. For 20-nm-thick Fe dots, the values of the critical diameter (58-60 nm) and the vortex core (16-19 nm) are in very good agreement between the different...

Mejia-Lopez, J.; Altbir, D.; Landeros, P.; Escrig, J.; Romero, A. H.; Roshchin, Igor V.; Li, C-P; Fitzsimmons, M. R.; Batlle, X.; Schuller, Ivan K.

2010-01-01T23:59:59.000Z

472

Motor regulation results in distal forces that bend partially disintegrated Chlamydomonas axonemes into circular arcs  

E-Print Network [OSTI]

The bending of cilia and flagella is driven by forces generated by dynein motor proteins. These forces slide adjacent microtubule doublets within the axoneme, the motile cytoskeletal structure. To create regular, oscilla- tory beating patterns, the activities of the axonemal dyneins must be coordinated both spatially and temporally. It is thought that coordination is mediated by stresses or strains, which build up within the moving axoneme, and somehow regulate dynein activity. While experimenting with axonemes subjected to mild proteolysis, we observed pairs of doublets associate with each other and form bends with almost constant curvature. By model- ing the statics of a pair of filaments, we show that the activity of the motors concentrates at the distal tips of the doublets. Furthermore, we show that this distribution of motor activity accords with models in which curvature, or curvature-induced normal forces, regulates the activity of the motors. These observations, together with our theoretical analysis, provide evidence that dynein activity can be regulated by curvature or normal forces, which may, therefore, play a role in coordinating the beating of cilia and flagella.

V. Mukundan; P. Sartori; V. F. Geyer; F. Julicher; J. Howard

2014-04-08T23:59:59.000Z

473

Discovery of Cyclotide-Like Protein Sequences in Graminaceous Crop Plants: Ancestral Precursors of Circular Proteins?  

Science Journals Connector (OSTI)

...nitrogen atoms are blue, and carbon is green. Actual atoms involved in the hydrogen...as the completion of natures unfinished business. Head-to-tail cyclization leads to...the basis of a model based on the lowest energy structure of the cycloviolacin O1 structure...

Jason P. Mulvenna; Joshua S. Mylne; Rekha Bharathi; Rachel A. Burton; Neil J. Shirley; Geoffrey B. Fincher; Marilyn A. Anderson; David J. Craik

2006-08-25T23:59:59.000Z

474

PANS turbulence model: investigation of computational and physical closure issues in flow past a circular cylinder  

E-Print Network [OSTI]

p = P +pu (2.4) The cut-o can be arbitrary but the lter must commute with temporal and spatial di erentiation (Germano 1992). When the lter is applied, we get hVii = Ui and 7 hpi= P. However, this decomposition is unlike that of the statistical one... of the unresolved kinetic energy equation emerges. @ku @t +Uj @ku @xj = Pu u +Tku (2.19) This is the generalized form of the unresolved kinetic energy evolution equation with ku = 12 (Vi;Vj) where Pu = 12 (Vi;Vj) @Ui@xj . In PANS closure at the two-equation level...

Reyes, Dasia Ann

2009-05-15T23:59:59.000Z

475

1983 annual report on Alaska's mineral resources. Geological Survey Circular 908  

SciTech Connect (OSTI)

This report describes activity during 1982 in Alaska relating to oil and gas, uranium, coal and peat, geothermal resources, and non-fuel, critical and strategic minerals. (ACR)

Not Available

1983-01-01T23:59:59.000Z

476

A Micro-Variable Circular Orifice (MVCO) Fuel Injector for Zoned...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Injector for Low Cost High Efficiency Clean Diesels Heavy-Duty Engine Combustion Optimization for High Thermal Efficiency Targeting EPA 2010 Emissions Enabling High Efficiency...

477

Policy Flash 2013-75 Federal Acquisition Circular 2005-69  

Broader source: Energy.gov [DOE]

Questions concerning this policy flash should be directed to Barbara Binney, of the Office of Acquisition and Project Management Policy at (202) 287-1340 or at Barbara.Binney@hq.doe.gov.

478

Dynamic Hall Effect Driven by Circularly Polarized Light in a Graphene Layer P. Olbrich,1  

E-Print Network [OSTI]

and 280 m using either a continuous-wave (cw) CH3OH laser or a high power pulsed NH3 laser [8¨ping, Sweden 4 Chalmers University of Technology, S-41296 Go¨teborg, Sweden (Received 12 August 2010; published

Ganichev, Sergey

479

Fault tolerant control of homopolar magnetic bearings and circular sensor arrays  

E-Print Network [OSTI]

Fault tolerant control can accommodate the component faults in a control system such as sensors, actuators, plants, etc. This dissertation presents two fault tolerant control schemes to accommodate the failures of power amplifiers and sensors in a...

Li, Ming-Hsiu

2006-04-12T23:59:59.000Z

480

IMPROVING SEPARABILITY OF EEG SIGNALS DURING MOTOR IMAGERY WITH AN EFFICIENT CIRCULAR LAPLACIAN  

E-Print Network [OSTI]

. 1. INTRODUCTION Imagination of body movements (motor imagery) generates measurable changes in brain-computer interfaces (BCI) [1]. These systems train subjects to associate their imaginations to the international standard placement. This standard setting approximates the head with a sphere and determines

Hong,Seokhee

Note: This page contains sample records for the topic "omb circular a-76" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

Dynamics of Sheared Ellipses and Circular Disks: Effects of Particle Shape  

E-Print Network [OSTI]

Much recent effort has focused on glassy and jamming properties of spherical particles. Very little is known about such phenomena for non-spherical particles, and we take a first step by studying ellipses. We find important differences between the dynamical and structural properties of disks and two-dimensional ellipses subject to continuous Couette shear. In particular, ellipses show slow dynamical evolution, without a counterpart in disks, in the mean velocity, local density, orientational order, and local stress. starting from an unjammed state, ellipses can first jam under shear, and then slowly unjam. The slow unjamming process is understood as a result of gradual changes in their orientations, leading to a denser packing. For disks, the rotation of particles only contributes to relaxation of frictional forces, and hence, does not significantly cause structural changes. For the shear-jammed states, the global building up and relaxation of stress, which occurs in the form of stress avalanches, is qualitatively different for disks and ellipses, and is manifested by different forms of rate-dependence for ellipses vs. disks. Unlike the weak rate dependence typical for many granular systems, ellipses show power-law dependence on the shearing rate, {\\Omega}.

Somayeh Farhadi; Robert P. Behringer

2014-02-18T23:59:59.000Z

482

E-Print Network 3.0 - administrative circulars nos Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

total, noS - oRF 522,220 516,705 511... , utilities, field office lease payments, and rent charges from the General Service Administration. NOS -- ORF... 3-57 CHAPTER 3 NOAA...

483

Cyclic Testing of Concrete-Filled Circular Steel Bridge Piers having Encased Fixed-Based Detail  

E-Print Network [OSTI]

there is no need for stain protection on piers when the superstructure is of weathering steel although some

Bruneau, Michel

484

MML clustering of multi-state, Poisson, vonMises circular and Gaussian distributions  

Science Journals Connector (OSTI)

Minimum Message Length (MML) is an invariant Bayesian point estimation technique which is also statistically consistent and efficient. We provide a brief overview of MML inductive inference (Wallace C.S. and Boulton D.M. 1968. Computer Journal, 11: ... Keywords: MML, Snob, classification, clustering, coding, induction, information theory, intrinsic classification, machine learning, minimum message length, mixture modelling, numerical taxonomy, statistical inference, unsupervised learning

Chris S. Wallace; David L. Dowe

2000-01-01T23:59:59.000Z

485

Ultra-Sensitive biochemical Sensor based on Circular Bragg Micro-Cavities  

E-Print Network [OSTI]

an SEM micrograph of an ABR sensor realized within a thin membrane of InGaAsP active material. The device with high spectral resolution and excellent sensitivity to changes in the absorption or refractive index

Scheuer, Jacob (Koby)

486

A novel patch antenna with switchable slot (PASS): Dual-frequency operation with reversed circular polarizations  

E-Print Network [OSTI]

G. Gentili, “Dual frequency patch antennas,” IEEE An- tennasF. Yang and Y. Rahmat-Samii, “Patch antennas with switchable47, no. 2, pp. 13–29, Apr. , “Patch antenna with swichable

Jin, N B; Yang, F; Rahmat-Samii, Y

2006-01-01T23:59:59.000Z

487

Heat transfer characteristics of circular impinging jet arrays in an annular section with cross flow effects  

E-Print Network [OSTI]

. . Heat transfer and Flutd flow results ? Counter flow . 32 64 CONCLUSIONS . 101 REFERENCES . 104 APPENDIX A. APPENDIX B APPENDIX C LIST OF FIGURES FIGURE 1 Detailed Schematic of the Test Section with the Flow Loop for 81. 27cm Inner pipe... with Parallel Flow. . 2 Schematic Diagram showing the arrangement of the mner pipes with different diameters with the copper segments. 3 Schematic of the test section showmg the two different flow arrangements (Parallel Flow and Counter Flow) . Page 12 14...

Mhetras, Shantanu Prakash

2012-06-07T23:59:59.000Z

488

The Circular Unitary Ensemble and the Riemann zeta function: the microscopic landscape  

E-Print Network [OSTI]

We show in this paper that after proper scalings, the characteristic polynomial of a random unitary matrix converges almost surely to a random analytic function whose zeros, which are on the real line, form a determinantal point process with sine kernel. Our scaling is performed at the so-called "microscopic" level, that is we consider the characteristic polynomial at points which are of order $1/n$ distant. We draw several consequences from our result. On the random matrix theory side, we obtain the limiting distribution for ratios of characteristic polynomials where the points are evaluated at points of the form $\\exp(2 i \\pi \\alpha/n)$. We also give an explicit expression for the (dependence) relation between two different values of the characteristic polynomial on the microscopic scale. On the number theory side, inspired by the Keating-Snaith philosophy, we conjecture some new limit theorems for the Riemann zeta function at the stochastic process level as well as some alternative approach to the conjecture by Goldston, Montgomery and Gonek for the moments of the logarithmic derivative of the Riemann zeta function. We prove our main random matrix theory result in the framework of virtual isometries to circumvent the fact that the rescaled characteristic polynomial does not even have a moment of order one, hence making the classical techniques of random matrix theory difficult to apply.

Reda Chhaibi; Joseph Najnudel; Ashkan Nikeghbali

2014-10-06T23:59:59.000Z

489

Simple Circular Odor Chart for Characterization of Trace Amounts of Odorants Discharged from Thirteen Odor Sources  

Science Journals Connector (OSTI)

......sulfur com- pounds in waste process gases. Tappi. 43: 602-08 (1960). 23. I. Hornstein...kraft pulp mills. Part I. II. III. IV. Tappi. 46: 1-20 (1963). 26. B.J. Tyson...mercaptans and alkyl sulfides and disulfide. Tappi. 42: 601-05 (1959). 59. E.W......

Yasuyuki Hoshika; Yoshimasa Nihei; Giichi Muto

1981-04-01T23:59:59.000Z

490

Legume cyclotides shed light on the genetic origin of knotted circular proteins  

Science Journals Connector (OSTI)

...cyclotides with pharmaceutical or agrochemical properties by using transgenic...of the cyclotide Cter M. The composition and size of the PA1b loops are...with useful pharmacological or agrochemical properties in the near future...

Julio A. Camarero

2011-01-01T23:59:59.000Z

491

tended, the area of the bore becomes sot-4.00 circular  

E-Print Network [OSTI]

date under the in?uence of heat in motion, their crystals .... spherical) breech, so as to avoid the great planes of ..... and strike on it with a sledge to bend it.

492

Circular Retribution: The Effects of Climate Change on U .S. and Global Economy  

E-Print Network [OSTI]

of global oil supply, Saudi Arabia, Qatar, and the Unitedof global oil supply, Saudi Arabia, Qatar, and the United

Prescher, Hannes

2010-01-01T23:59:59.000Z

493

Circular Retribution: The Effects of Climate Change on U .S. and Global Economy  

E-Print Network [OSTI]

Qatar, and the United Arab Emirates recognize that oil is a finite resource. commercial equipment, residential structures, commercial revenues,

Prescher, Hannes

2010-01-01T23:59:59.000Z

494

Heat Transfer Characteristics of Sulfur and Sulfur Diluted with Hydrogen Sulfide Flowing Through Circular Tubes  

E-Print Network [OSTI]

is called the pumping-power advantage factor, and has the value 2. 5 x 10 for sodium. The only metals having a higher value of H are 13 lithium 7 and bismuth. Lithium 7 comprises 92. 5% of natural lithium, but the cost of separating it from lithium 6...-section for thermal neutrons being 0. 130 barns. For comparison, water has an absorption cross-section of 0. 58 barns for thermal neutrons (2) . Sulfur is not activated by exposure to neutron flux in such a way as to produce a radioactive isotope which...

Stone, Porter Walwyn

1960-01-01T23:59:59.000Z

495

Instabilities of a circularly polarized wave with trapped particles in an isotropic plasma  

SciTech Connect (OSTI)

The structure and stability of a transverse electromagnetic wave propagating with a velocity lower than the speed of light in an unmagnetized plasma are considered. The stationary finite-amplitude wave is described by exact solutions to the Vlasov-Maxwell equations. However, unlike the well-known electrostatic analog, the Bernstein-Greene-Kruskal wave, the wave structure is determined to a large extent by the presence of trapped particles with a shear of transverse velocities, without which the existence of waves with a refraction index larger than unity is impossible. It is shown that the main origin of the wave instability is the longitudinal motion of trapped particles relative to the background plasma. Expressions for the growth rates in the main instability regimes are found under definite restrictions on the wave parameters.

Krasovsky, V. L., E-mail: vkrasov@iki.rssi.ru [Russian Academy of Sciences, Space Research Institute (Russian Federation)

2013-04-15T23:59:59.000Z

496

Analysis of the circular track experiment measuring the one-way speed of light  

E-Print Network [OSTI]

All experiments attempting to verify the invariance of speed of light directly are based on two-way speed measurement. The challenge in one-way speed measurement, the requirement of spatially separated synchronised clocks, can be possibly circumvented by measuring the speed of light travelling in a closed path. An apparent violation of the invariance principle has been recently reported in the first experiment attempting to measure the one-way speed of light utilising this concept. This experiment is reanalysed here. It is found that the results of the experiment can be explained within the framework of relativity, without requiring any violation of the invariance principle.

Evan John Philip

2012-12-07T23:59:59.000Z

497

Data:6a76f55b-5fb2-4f95-be3e-9b0810872ec5 | Open Energy Information  

Open Energy Info (EERE)

b-5fb2-4f95-be3e-9b0810872ec5 b-5fb2-4f95-be3e-9b0810872ec5 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of South Sioux City, Nebraska (Utility Company) Effective date: 2013/01/01 End date if known: Rate name: Commercal- All Electric Single Phase Sector: Commercial Description: Any commercial or industrial customer for all purposes where all utility energy for the entire premises is supplied by the electrical service. If the load reaches 250 kW, the Commercial and Industrial rate will apply until such time as the load has not reached 250 kW for a period of eleven months. Source or reference: ISU Documentation

498

O:\A76\647b Report\647B Report FY 2006\647bLetter.pdf.prn.pdf  

Broader source: Energy.gov (indexed) [DOE]

Richard B. Cheney Richard B. Cheney President of the Senate United States Senate Washington, DC 20510 Dear Mr. President: This letter is in response to the annual Competitive Sourcing reporting requirement contained in section 647(b) of Division F of the Consolidated Appropriations Act, for FY 2004, P.L. 108-199. The enclosed report on the Department of Energy's (DOE) Competitive Sourcing program complies with the agency reporting elements outlined in P.L. 108-199 for submitting the annual Congressiona l Competitive Sourcing Activity Report. In summary, DOE's Fiscal Year (FY) 2006 Competitive Sourcing Activity Report includes data on costs, savings, Federal full-time equivalent employees (FTEs), and other information on the Department's completed, ongoing, and planned competitive sourcing studies.

499

Data:A76ceceb-6514-4819-b28b-7e0e88a2ecf8 | Open Energy Information  

Open Energy Info (EERE)

ceceb-6514-4819-b28b-7e0e88a2ecf8 ceceb-6514-4819-b28b-7e0e88a2ecf8 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: City of Niles, Ohio (Utility Company) Effective date: 2011/12/01 End date if known: Rate name: Industrial Single phase secondary service rate A (inside city rate) Sector: Industrial Description: *Available for secondary light and power service to residential, commercial, institutional, or industrial establishments and to apartments served through one meter for each unit. Single phase motors with locked rotor current not exceeding 130 amperes served at nominal 208 or 240 volts may be included with single phase lighting service furnished through one meter.

500

Data:A76d100c-a27a-403d-9136-ada03a66d4a7 | Open Energy Information  

Open Energy Info (EERE)

0c-a27a-403d-9136-ada03a66d4a7 0c-a27a-403d-9136-ada03a66d4a7 No revision has been approved for this page. It is currently under review by our subject matter experts. Jump to: navigation, search Loading... 1. Basic Information 2. Demand 3. Energy << Previous 1 2 3 Next >> Basic Information Utility name: Northeast Nebraska P P D Effective date: 2013/01/01 End date if known: Rate name: Schedule L - Metered Lighting Sector: Commercial Description: Source or reference: http://www.nnppd.com/billing/rates/ Source Parent: Comments Applicability Demand (kW) Minimum (kW): Maximum (kW): History (months): Energy (kWh) Minimum (kWh): Maximum (kWh): History (months): Service Voltage Minimum (V): Maximum (V): Character of Service Voltage Category: Phase Wiring: << Previous 1 2 3 Next >> << Previous