National Library of Energy BETA

Sample records for oil market analysts

  1. Oil Market Assessment

    Reports and Publications (EIA)


    Based on Energy Information Administration (EIA) contacts and trade press reports, overall U.S. and global oil supplies appear to have been minimally impacted by yesterday's terrorist attacks on the World Trade Center and the Pentagon.

  2. EIA Financial and Physical Oil Market Workshop on Evolution of...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    oil market Price references like fundamentals and others in oil Behavior and ... San Diego Price References in Oil: Fundamentals and Other Factors Presenter: Robert ...

  3. Update: US oil-import market. 1982 top 7 suppliers to US import market: how their shares changed since 1973

    SciTech Connect (OSTI)

    Not Available


    This issue updates the Energy Detente 7/09/82, which tracked US oil imports since the Arab Oil Embargo. Since then, the phrase oil glut became common even among cautious market analysts as many exporters, hard-pressed for petrodollars, produced much more than the market was prepared to absorb. To examine how the US import market has adjusted to this continued buyers market, the top seven suppliers of 1982 are tracked backwards through time. A graph shows the 1982 reversal of Mexico's and Saudi Arabia's positions in this market. The three main reasons for Mexico's strong present position in the US market are: crude costs and corresponding refined value; proximity to US refining centers; and strategic importance of Mexico's economic stability through oil sales. Interviews with various US refiners and other market observers confirm that these elements will persist during 1983, regardless of significant price cuts among OPEC and other producers. It is believed that the profitability of running heavy Maya crude in sophisticated plants will continue to look optimistic, and that Mexican crude sales to the Strategic Petroleum Reserve implies US government interest in Mexico's economic recovery, and in its stability in the light of civil wars being waged in Central America. This issue presents the Energy Detente (1) fuel price/tax series and (2) industrial fuel prices for March 1983 for countries of the Eastern Hemisphere. 6 figures, 8 tables.

  4. Oil Shale Market | OpenEI Community

    Open Energy Info (EERE)

    Discussions Polls Q & A Events Notices My stuff Energy blogs Login | Sign Up Search Oil Shale Market Home There are currently no posts in this category. Syndicate content About...

  5. Global Industry Analysts | Open Energy Information

    Open Energy Info (EERE)

    search Name: Global Industry Analysts Address: 6150 Hellyer Avenue Place: San Jose, California Zip: 95138 Region: Bay Area Product: Market research services Year Founded:...

  6. Financial and Physical Oil Market Linkages

    Gasoline and Diesel Fuel Update (EIA)

    Financial Review of the Global Oil and Natural Gas Industry 2015 Markets and Financial Analysis Team May 2016 Key findings for 2015 * Brent crude oil prices averaged $53.60 in 2015-46% below 2014 levels- which significantly reduced cash flow for upstream companies. * Asset write-downs reduced profits and the amount of proved reserves; proved liquids reserves declined for the first time since 2008. * Production increased largely because of investment from past projects. * Companies were able to

  7. Financial and Physical Oil Market Linkages II

    Gasoline and Diesel Fuel Update (EIA)

    II September 27, 2012 Department of Energy 1000 Independence Avenue, SW Washington, D.C. 20585 8:00 a.m. Check-in and coffee break 8:45 a.m. Opening remarks by Administrator and introductions of the participants 9:15 a.m. Morning session 1: Price behavior, benchmark spreads, oil futures market participation and trading activities of commodity index traders and physical traders Paper Title: Physical Market Conditions, Paper Market Activity, and the Brent- WTI Spread * Presenter: Michel Robe,

  8. Testing for market integration crude oil, coal, and natural gas

    SciTech Connect (OSTI)

    Bachmeier, L.J.; Griffin, J.M.


    Prompted by the contemporaneous spike in coal, oil, and natural gas prices, this paper evaluates the degree of market integration both within and between crude oil, coal, and natural gas markets. Our approach yields parameters that can be readily tested against a priori conjectures. Using daily price data for five very different crude oils, we conclude that the world oil market is a single, highly integrated economic market. On the other hand, coal prices at five trading locations across the United States are cointegrated, but the degree of market integration is much weaker, particularly between Western and Eastern coals. Finally, we show that crude oil, coal, and natural gas markets are only very weakly integrated. Our results indicate that there is not a primary energy market. Despite current price peaks, it is not useful to think of a primary energy market, except in a very long run context.

  9. Bio-Oil Deployment in the Home Heating Market

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Bio-Oil Deployment in the Home Heating Market March 23, 2015 Dr. Thomas A. Butcher ... and end user acceptance. * Heating oil and diesel transportation both use the same ...

  10. Program Analyst (Transportation Safety)

    Broader source: [DOE]

    A successful candidate in this position will serve as a Program Analyst(Transportation Safety) supporting and advising management on safety and health matters for nuclear and non-nuclear activities.

  11. Petroleum marketing monthly

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data.

  12. Base Oil Market Segment Forecasts up to 2020,Research Reports...

    Open Energy Info (EERE)

    Market Research Home > Groups > Future of Condition Monitoring for Wind Turbines Wayne31jan's picture Submitted by Wayne31jan(150) Contributor 11 June, 2015 - 03:19 Base Oil...

  13. Career Map: Analyst/Researcher

    Broader source: [DOE]

    The Wind Program's Career Map provides job description information for Analyst/Researcher positions.

  14. Operations Research Analyst

    Broader source: [DOE]

    This position is located in the Market Analysis and Pricing (PTM) group in the Power Services Organization. Market Analysis and Pricing performs market analysis, product pricing, transaction and...

  15. Semantic Space Analyst

    Energy Science and Technology Software Center (OSTI)


    The Semantic Space Analyst (SSA) is software for analyzing a text corpus, discovering relationships among terms, and allowing the user to explore that information in different ways. It includes features for displaying and laying out terms and relationships visually, for generating such maps from manual queries, for discovering differences between corpora. Data can also be exported to Microsoft Excel.

  16. Petroleum marketing monthly, May 1994

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data in the Petroleum Marketing Monthly.

  17. Energy & Financial Markets: What Drives Crude Oil Prices? - Energy

    U.S. Energy Information Administration (EIA) Indexed Site

    Information Administration & Financial Markets - U.S. Energy Information Administration (EIA) U.S. Energy Information Administration - EIA - Independent Statistics and Analysis Sources & Uses Petroleum & Other Liquids Crude oil, gasoline, heating oil, diesel, propane, and other liquids including biofuels and natural gas liquids. Natural Gas Exploration and reserves, storage, imports and exports, production, prices, sales. Electricity Sales, revenue and prices, power plants, fuel

  18. Notes from Financial and Physical Oil Market Linkages

    Gasoline and Diesel Fuel Update (EIA)

    Notes from Financial and Physical Oil Market Linkages August 24, 2011 Session 1: 9:30 a.m. - 11:00 a.m. Paper Title: Does 'Paper Oil' Matter? Presenter: Michel Robe, American University Discussant: James Smith, Southern Methodist University Paper Abstract We construct a uniquely detailed, comprehensive dataset of trader positions in U.S. energy futures markets. We find considerable changes in the make-up of the open interest between 2000 and 2010 and show that these changes impact asset pricing.

  19. Petroleum marketing monthly, October 1992. [USA

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly is prepared by the Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration. The Petroleum Marketing Monthly (PMM) is designed to give information and statistical data about a variety of crude oils and refined petroleum products. The publication provides statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, education institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners' acquisition cost of crude oil. Sales data for motor gasoline, distillates, residuals, aviation fuels, kerosene and propane are presented.

  20. Operations Research Analysts

    U.S. Energy Information Administration (EIA) Indexed Site

    programming skills and knowledge of energy industries and markets, designs and develops math- ematical models (e.g., matrix algebra, LP's, non-linear programs, linear and ...

  1. Petroleum marketing monthly

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data in the Petroleum Marketing Monthly.

  2. Petroleum marketing monthly

    SciTech Connect (OSTI)


    Petroleum Marketing Monthly (PPM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o. b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data in the Petroleum Marketing Monthly.

  3. Petroleum marketing monthly

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data in the Petroleum Marketing Monthly.

  4. Markets during world oil supply crises: an analysis of industry, consumer, and governmental response

    SciTech Connect (OSTI)

    Erfle, Stephen; Pound, John; Kalt, Joseph


    An analysis of the response of American markets to supply crises in world oil markets is presented. It addresses four main issues: the efficiency of the operation of American oil markets during oil supply crises; the problems of both economic efficiency and social equity which arise during the American adaptation process; the propriety of the Federal government's past policy responses to these problems; and the relationship between perceptions of the problems caused by world oil crises and the real economic natures of these problems. Specifically, Chapter 1 presents a theoretical discussion of the effects of a world supply disruption on the price level and supply availability of the world market oil to any consuming country including the US Chapter 2 provides a theoretical and empirical analysis of the efficiency of the adaptations of US oil product markets to higher world oil prices. Chapter 3 examines the responses of various groups of US oil firms to the alterations observed in world markets, while Chapter 4 presents a theoretical explanation for the price-lagging behavior exhibited by firms in the US oil industry. Chapter 5 addresses the nature of both real and imagined oil market problems in the US during periods of world oil market transition. (MCW)

  5. Supervisory Operations Research Analyst | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Supervisory Operations Research Analyst Supervisory Operations Research Analyst Submitted by admin on Sat, 2016-01-16 00:16 Job Summary Organization Name Department Of Energy...

  6. Student Trainee (Operations Research Analyst) | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Student Trainee (Operations Research Analyst) Student Trainee (Operations Research Analyst) Submitted by admin on Fri, 2016-01-08 00:16 Job Summary Organization Name Department Of ...

  7. Patricia Hagerty, Aviation Program Analyst - Bio | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Patricia Hagerty, Aviation Program Analyst - Bio Patricia Hagerty, Aviation Program Analyst - Bio PDF icon HagertyPatPersonalProfile.pdf More Documents & Publications Ferrin ...

  8. Petroleum marketing monthly, November 1993

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly (PMM) is designed to give information and statistical data about a variety of crude oils and refined petroleum products. The publication provides statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed costs of imported crude oil, and the refiner`s acquisition cost of crude oil. Sales data for motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane are presented.

  9. Petroleum marketing monthly, August 1993

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly (PMM) is designed to give information and statistical data about a variety of crude oils and refined petroleum products. The publication provides statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Sales data for motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane are presented.

  10. Petroleum marketing monthly, July 1993

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly (PMM) is designed to give information and statistical data about a variety of crude oils and refined petroleum products. The publication provides statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Sales data for motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane are presented.

  11. Petroleum marketing monthly, February 1994

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly is designed to give information and statistical data about a variety of crude oils and refined petroleum products. The publication provides statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiner`s acquisition cost of crude oil. Sales data for motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane are presented.

  12. Petroleum marketing monthly, January 1994

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly (PMM) is designed to give information and statistical data about a variety of crude oils and refined petroleum products. The publication provides statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Sales data for motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane are presented.

  13. Petroleum marketing monthly, October 1993

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly (PMM) is designed to give information and statistical data about a variety of crude oils and refined petroleum products. The publication provides statistics on crude oil and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase prices, the f.o b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Sales data for motor gasoline, distillates residuals, aviation fuels, kerosene, and propane are presented.

  14. Petroleum marketing monthly, April 1994

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly (PMM) is designed to give information and statistical data about a variety of crude oils and refined petroleum products. The publication provides statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Sales data for motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane are presented.

  15. Petroleum marketing monthly, March 1994

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly is designed to give information and statistical data about a variety of crude oils and refined petroleum products. The publication provides statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, education institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiner`s acquisition cost of crude oil. Sales data for motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane are presented.

  16. Petroleum marketing monthly, December 1992

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly (PMM) is designed to give information and statistical data about a variety of crude oils and refined petroleum products. The publication provides statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Sales data for motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane are presented.

  17. Petroleum marketing monthly, April 1993

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly (PMM) is designed to give information and statistical data about a variety of crude oils and refined petroleum products. The publication provides statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Sales data for motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane are presented.

  18. Petroleum marketing monthly, May 1993

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly is designed to give information and statistical data about a variety of crude oils and refined petroleum products. The publication provides statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Sales data for motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane are presented.

  19. Petroleum marketing monthly, November 1992

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly (PMM) is designed to give information and statistical data about a variety of crude oils and refined petroleum products. The publication provides statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Sales data for motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane are presented.

  20. Petroleum marketing monthly, December 1994

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane.

  1. Petroleum marketing monthly, March 1993

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly (PMM) is designed to give information and statistical data about a variety of crude oils and refined petroleum products. The publication provides statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b.and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Sales data for motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane are presented.

  2. Petroleum marketing monthly, February 1993

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly is designed to give information and statistical data about a variety of crude oils and refined petroleum products. The publication provides statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Sales data for motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane are presented.

  3. Petroleum marketing monthly, November 1994

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane.

  4. Petroleum marketing monthly, December 1993

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly (PMM) is designed to give information and statistical data about a variety of crude oil and refined petroleum products. The publication provides statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Sales data for motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane are presented.

  5. Petroleum marketing monthly, August 1990

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly (PMM) is designed to give information and statistical data about a variety of crude oils and refined petroleum products. The publication provides statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners' acquisition cost of crude oil. Sales data for motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane are presented. 12 figs., 49 tabs.

  6. Specific heavy oil processing market study. Final report

    SciTech Connect (OSTI)

    Not Available


    The market potential for two not-yet-commercialized, proprietary processes for upgrading heavy oil was evaluated. Dynacracking (TM) of Hydrocarbon Research Inc. (HRI) and Aurabon of UOP Process Division (UOP), including an integrated commercial hydrotreating unit were the processes studied. The report concludes that while a large market for Heavy Oil Processing (HOP) units was originally forecast as the result of the shift to heavier crudes by US refiners under a given demand slate and refinery configuration, this market has either eroded due to massive demand shifts (both in volumetric and relative product mix terms) or largely been satisfied on an accelerated basis (due to downstream restructuring pressures) by units already constructed or under firm commitment utilizing other HOP technology. Dynacracking or Aurabon does not appear to offer the substantial economic advantage needed to replace other HOP units already committed. However, additional demands for HOP units couold arise, particularly on a regional basis, if significant additional foreign or domestic sources of heavy crude are introduced into the supply picture or the demand structure moves dramatically away from that currently foreseen by the EIA. Expected profit margins were calculated for both processes, allowing $2/barrel extra credit to the Aurabon products because of their higher quality. Both processes appear to produce about the same fraction of vacuum bottoms when processing the same crude. Dynacracking produces a higher proportion of naphtha and Aurabon produces substantially more heavy distillate. This report is not intended to serve as a basis of selecting either process for a particular installation. 10 references, 7 figures, 29 tables.

  7. Petroleum marketing monthly, August 1994

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product Sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data in the Petroleum Marketing Monthly.

  8. Petroleum marketing monthly, September 1994

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum product sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data in the Petroleum Marketing Monthly.

  9. Petroleum marketing annual 1993

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Annual (PMA) contains statistical data on a variety of crude oils and refined petroleum products. The publication provides statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the free-on-board (f.o.b.) and landed cost of imported crude oil, and the refiners acquisition cost of crude oil. Sales data for motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane are presented. For this publication, all estimates have been recalculated since their earlier publication in the Petroleum Marketing Monthly (PMM). These calculations made use of additional data and corrections that were received after the PMM publication dates.

  10. Budget Analyst (Recent Graduate) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Budget Analyst (Recent Graduate) Budget Analyst (Recent Graduate) Submitted by admin on Sat, 2016-01-16 00:16 Job Summary Organization Name Department Of Energy Agency SubElement...

  11. Petroleum marketing monthly, June 1995 with data for March 1995

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data in the Petroleum Marketing Monthly. Monthly statistics on purchases of crude oil and sales of petroleum products are presented in the Petroleum Marketing Monthly in five sections: Summary Statistics Crude Oil Prices; Prices of Petroleum Products; Volumes of Petroleum Products; and Prime Supplier Sales Volumes of Petroleum Products for Local Consumption.

  12. Petroleum marketing monthly with data for April 1995

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data on the Petroleum Marketing Monthly. Monthly statistics on purchases of crude oil and sales of petroleum products are presented in the Petroleum Marketing Monthly in five sections: Summary statistics; crude oil prices; prices of petroleum products; volumes of petroleum products; and prime supplier sales volumes of petroleum products for local consumption.

  13. EIA - Special Report 8/29/05 - Hurricane Katrina's Impact on Oil Markets

    U.S. Energy Information Administration (EIA) Indexed Site

    the U.S. Oil Market Hurricane Katrina's Impact on the U.S. Oil Market As of 3:00 pm, Monday, August 29 --SEE MOST RECENT-- According to the Minerals Management Service (MMS), Gulf of Mexico oil production was reduced by about 1.4 million barrels per day as a result of Hurricane Katrina. The MMS also reported that 8.3 billion cubic feet per day of natural gas production was shut in. The Louisiana Offshore Oil Port (LOOP) stopped making shipments to onshore facilities as of Saturday, and was

  14. Petroleum marketing monthly, November 1991. [Contains glossary

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly is designed to give information and statistical data about a variety of crude oils and refined petroleum products. The publication provides statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners' acquisition cost of crude oil. Sales data for motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane are presented. 12 figs., 53 tabs.

  15. Petroleum Marketing Monthly, January 1991. [Contains Glossary

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly (PMM) is designed to give information and statistical data about a variety of crude oils and refined petroleum products. The publication provides statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners' acquisition cost of crude oil. Sales data for motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane are presented. 12 figs., 55 tabs.

  16. Oil Shale Market is Estimated to Reach USD 7,400.70 Million by...

    Open Energy Info (EERE)

    Oil Shale Market is Estimated to Reach USD 7,400.70 Million by 2022 Home > Groups > Renewable Energy RFPs Wayne31jan's picture Submitted by Wayne31jan(150) Contributor 1 July, 2015...

  17. Oil Spill Management Market is Estimated to Reach USD 114,441...

    Open Energy Info (EERE)

    Oil Spill Management Market is Estimated to Reach USD 114,441.1 Million by 2020 Home > Groups > Renewable Energy RFPs Wayne31jan's picture Submitted by Wayne31jan(150) Contributor...

  18. Petroleum marketing monthly, March 1995

    SciTech Connect (OSTI)


    This report for March 1995, provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data in the Petroleum Marketing Monthly. A glossary is included.

  19. Who Are the Major Players Supplying the World Oil Market?

    Reports and Publications (EIA)


    Energy in Brief article on the world supply of oil through ownership of national oil companies and, for some governments, their membership in the Organization of the Petroleum Exporting Countries (OPEC).

  20. Oil merger trend: exploring the unknowns

    SciTech Connect (OSTI)

    Solomon, B.


    Experts disagree on the effect recent oil company mergers will have on exploration spending and US credit markets. Proclaiming the answers unknowable, some see the issue as surpassing antitrust concerns. It is generally agreed, however, that there will be less spending on exploration and production during the transition period of the merger. The effect on stocks is also unknown, but analysts suggest that shareholder's adjustments will have only a minimal effect on the credit market.

  1. Petroleum marketing monthly, June 1994

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. Monthly statistics on purchases of crude oil and sales of petroleum products are presented in five sections: Summary Statistics; Crude Oil Prices; Prices of Petroleum Products; Volumes of Petroleum Products; and Prime Supplier Sales Volumes of Petroleum Products for Local Consumption. The feature article is entitled ``The Second Oxygenated Gasoline Season.`` 7 figs., 50 tabs.

  2. Petroleum marketing monthly, July 1994

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. Monthly statistics on purchases of crude oil and sales of petroleum products are presented in five sections: summary statistics; crude oil prices; prices of petroleum products; volumes of petroleum products; and prime supplier sales volumes of petroleum products for local consumption. 7 figs., 50 tabs.

  3. The social costs to the US of monopolization of the world oil market, 1972--1991

    SciTech Connect (OSTI)

    Greene, D.L.; Leiby, P.N.


    The partial monopolization of the world oil market by the OPEC cartel has produced significant economic costs to the economies of the world. This paper reports estimates of the costs of monopolization of oil to the US over the period 1972--1991. Two fundamental assumptions of the analysis are, (1) that OPEC has acted as a monopoly, albeit with limited control, knowledge, and ability to act and, (2) that the US and other consuming nations could, through collective (social) action affect the cartel's ability to act as a monopoly. We measure total costs by comparing actual costs for the 1972--1991 period to a hypothetical more competitive'' world oil market scenario. By measuring past costs we avoid the enormous uncertainties about the future course of the world oil market and leave to the reader's judgment the issue of how much the future will be like the past. We note that total cost numbers cannot be used to determine the value of reducing US oil use by one barrel. They are useful for describing the overall size of the petroleum problem and are one important factor in deciding how much effort should be devoted to solving it. Monopoly pricing of oil transfers wealth from US oil consumers to foreign oil producers and, by increasing theeconomic scarcity of oil, reduces the economy's potential to produce. The actions of the OPEC cartel have also produced oil price shocks, both upward and downward, that generate additional costs because of the economy's inherent inability to adjust quickly to a large change in energy prices. Estimated total costs to the United States from these three sources for the 1972--1991 period are put at $4.1 trillion in 1990$($1.2 T wealth transfer, $0.8 T macroeconomic adjustment costs, $2.1 T potential GNP losses). The cost of the US's primary oil supply contingency program is small ($10 B) by comparison.

  4. The social costs to the US of monopolization of the world oil market, 1972--1991

    SciTech Connect (OSTI)

    Greene, D.L.; Leiby, P.N.


    The partial monopolization of the world oil market by the OPEC cartel has produced significant economic costs to the economies of the world. This paper reports estimates of the costs of monopolization of oil to the US over the period 1972--1991. Two fundamental assumptions of the analysis are, (1) that OPEC has acted as a monopoly, albeit with limited control, knowledge, and ability to act and, (2) that the US and other consuming nations could, through collective (social) action affect the cartel`s ability to act as a monopoly. We measure total costs by comparing actual costs for the 1972--1991 period to a hypothetical ``more competitive`` world oil market scenario. By measuring past costs we avoid the enormous uncertainties about the future course of the world oil market and leave to the reader`s judgment the issue of how much the future will be like the past. We note that total cost numbers cannot be used to determine the value of reducing US oil use by one barrel. They are useful for describing the overall size of the petroleum problem and are one important factor in deciding how much effort should be devoted to solving it. Monopoly pricing of oil transfers wealth from US oil consumers to foreign oil producers and, by increasing theeconomic scarcity of oil, reduces the economy`s potential to produce. The actions of the OPEC cartel have also produced oil price shocks, both upward and downward, that generate additional costs because of the economy`s inherent inability to adjust quickly to a large change in energy prices. Estimated total costs to the United States from these three sources for the 1972--1991 period are put at $4.1 trillion in 1990$($1.2 T wealth transfer, $0.8 T macroeconomic adjustment costs, $2.1 T potential GNP losses). The cost of the US`s primary oil supply contingency program is small ($10 B) by comparison.

  5. Petroleum marketing monthly, April 1997 with data for January 1997

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. 7 figs., 50 tabs.

  6. Petroleum marketing monthly, June 1997 with data for March 1997

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. 7 figs., 50 tabs.

  7. Petroleum marketing monthly, October 1997 with data for July 1997

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. 7 figs., 50 tabs.

  8. Petroleum marketing monthly, September 1997 with data for June 1997

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. 7 figs., 50 tabs.

  9. Petroleum marketing monthly, November 1997 with data for August 1997

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. 7 figs., 50 tabs.

  10. Petroleum marketing monthly, January 1998 with data for October 1997

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. 7 figs., 50 tabs.

  11. Petroleum marketing monthly, March 1998, with data for December 1997

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. 7 figs., 50 tabs.

  12. Petroleum marketing monthly, February 1997 with data for November 1996

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. 7 figs., 50 tabs.

  13. Petroleum marketing monthly, March 1996 with data for December 1995

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane.

  14. Petroleum marketing monthly, May 1997 with data for February 1997

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. 7 figs., 50 tabs.

  15. Petroleum marketing monthly, April 1996 with data for January 1996

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane.

  16. Budget Analyst | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Washington DC, District of Columbia Announcement Number DOE-SE-16-EE-00689-DE Job Summary The Office of Energy Efficiency and Renewable Energys (EERE) mission is to create and sustain American leadership in the global transition to a clean energy economy through high-impact research, development, and demonstration and by breaking down barriers to market entry. EERE helps the nation achieve greater energy efficiency and security, environmental health, and economic productivity, by exercising

  17. Budget Analyst | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    District of Columbia, District of Columbia Announcement Number DOE-SE-EE-16-00690-DE Job Summary The Office of Energy Efficiency and Renewable Energys (EERE) mission is to create and sustain American leadership in the global transition to a clean energy economy through high-impact research, development, and demonstration and by breaking down barriers to market entry. EERE helps the nation achieve greater energy efficiency and security, environmental health, and economic productivity, by

  18. Management & Program Analyst | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Management & Program Analyst Management & Program Analyst Submitted by admin on Tue, 2016-05-10 18:01 Job Summary Organization Name Department Of Energy Agency SubElement Western Area Power Administration Locations Lakewood, Colorado Announcement Number WAPA-16-DE-172 Job Summary Where would I be working? Western Area Power Administration, Corporate Services Office, Office of the Chief Financial Officer, Governance and Policy (A8500). 12155 West Alameda Parkway, Lakewood, CO 80228. Find

  19. Petroleum marketing monthly, May 1996 with data for February 1996

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data in the Petroleum Marketing Monthly.

  20. Petroleum marketing monthly, April 1999, with data for January 1999

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data in the Petroleum Marketing Monthly. 56 tabs.

  1. Petroleum marketing monthly with data for May 1997

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data in the Petroleum Marketing Monthly.

  2. Petroleum marketing monthly with data for September 1997

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures and accuracy, quality, and confidentiality of the published data in the Petroleum Marketing Monthly.

  3. Petroleum marketing monthly, June 1996: With data for March 1996

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o. b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data in the Petroleum Marketing Monthly.

  4. Petroleum marketing monthly, September 1995 with data for June 1995

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the fob and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data in the Petroleum Marketing Monthly.

  5. Petroleum marketing monthly, October 1995 with data for July 1995

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost Of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data in the Petroleum Marketing Monthly.

  6. Petroleum marketing monthly, May 1995 with data for February 1995

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data in the Petroleum Marketing Monthly.

  7. Petroleum marketing monthly: January 1995, with data for October 1994

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data in the Petroleum Marketing Monthly.

  8. Petroleum marketing monthly, with data for July 1994, October 1994

    SciTech Connect (OSTI)

    Not Available


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sale data include motor gasoline, distillates, residual, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data in the Petroleum Marketing Monthly.

  9. Impacts on U.S. Energy Markets and the Economy of Reducing Oil Imports

    Reports and Publications (EIA)


    This study was undertaken at the request of the General Accounting Office (GAO). Its purpose is to evaluate the impacts on U.S. energy markets and the economy of reducing oil imports. The approach and assumptions underlying this report were specified by GAO and are attached as an Appendix. The study focuses on two approaches: (1) a set of cases with alternative world crude oil price trajectories and (2) two cases which investigate the use of an oil import tariff to achieve a target reduction in the oil imports. The analysis presented uses the National Energy Modeling System, which is maintained by the Office of Integrated Analysis and Forecasting within the Energy Information Administration (EIA), and the DRI/McGraw Hill Macroeconomic Model of the U.S. Economy, a proprietary model maintained by DRI and subscribed to by EIA.

  10. Petroleum marketing monthly, June 1998, with data from March 1998

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. Monthly statistics on purchases of crude oil and sales of petroleum products are presented in the Petroleum Marketing Monthly in five sections: summary statistics; crude oil prices; prices of petroleum products; volumes of petroleum products and prime supplier sales volumes of petroleum products for local consumption. 7 figs., 50 tabs.

  11. Petroleum marketing monthly, September 1998, with data for June 1998

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. Monthly statistics on purchases of crude oil and sales of petroleum products are presented in the Petroleum Marketing Monthly in five sections: summary statistics; crude oil prices; prices of petroleum products; volumes of petroleum products; prime supplier sales volumes of petroleum products for local consumption. 7 figs., 50 tabs.

  12. Petroleum marketing monthly, July 1999, with data for April 1999

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. Monthly statistics on purchases of crude oil and sales of petroleum products are presented in the Petroleum Marketing Monthly in five sections: initial estimates; summary statistics; crude oil prices; prices of petroleum products; volumes of petroleum products; and prime supplier sales volumes of petroleum products for local consumption. 7 figs., 70 tabs.

  13. Petroleum marketing monthly, January 1999 with data for October 1998

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. Monthly statistics on purchases of crude oil and sales of petroleum products are presented in the Petroleum Marketing Monthly in five sections: summary statistics; crude oil prices; prices of petroleum products; volumes of petroleum products; and prime supplier sales volumes of petroleum products for local consumption. 7 figs., 50 tabs.

  14. Petroleum marketing monthly, July 1998 with data for April 1998

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. Monthly statistics on purchases of crude oil and sales of petroleum products are presented in the Petroleum Marketing Monthly in five sections: summary statistics; crude oil prices; prices of petroleum products; volumes of petroleum products; and prime supplier sales volumes of petroleum products for local consumption. 7 figs., 50 tabs.

  15. Petroleum marketing monthly, December 1998 with data for September 1998

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. Monthly statistics on purchases of crude oil and sales of petroleum products are presented in the Petroleum Marketing Monthly in five sections: summary statistics; crude oil prices; prices of petroleum products; volumes of petroleum products; and prime supplier sales volumes of petroleum products for local consumption. 7 figs., 50 tabs.

  16. Petroleum marketing monthly, February 1999 with data for November 1998

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. Monthly statistics on purchases of crude oil and sales of petroleum products are presented in the Petroleum Marketing Monthly in six sections: Initial Estimates; Summary Statistics; Crude Oil Prices; Prices of Petroleum Products; Volumes of Petroleum Products; and Prime Supplier Sales Volumes of Petroleum Products for Local Consumption. 7 figs., 50 tabs.

  17. Petroleum marketing monthly, November 1998, with data for August 1998

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. Monthly statistics on purchases of crude oil and sales of petroleum products are presented in the Petroleum Marketing Monthly in five sections: Summary statistics; Crude oil prices; Prices of petroleum products; Volumes of petroleum products; and Prime supplier sales volumes of petroleum products for local consumption. 7 figs., 50 tabs.

  18. Petroleum marketing monthly, October 1998, with data for July 1998

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. Monthly statistics on purchases of crude oil and sales of petroleum products are presented in the Petroleum Marketing Monthly in five sections: Summary statistics; Crude oil prices; Prices of petroleum products; Volumes of petroleum products; and Prime supplier sales volumes of petroleum products for local consumption. 7 figs., 50 tabs.

  19. Petroleum marketing monthly: September 1996, with data for June 1996

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. Detailed statistics for crude oil, including the price of imported crude oil by country of origin, by gravity, and by crude stream. To aid the reader in determining the market changes, the majority of the tables show data for the report month and previous months for the current year, and the report month for the previous year. 7 figs., 50 tabs.

  20. Petroleum marketing monthly: August 1998, with data for May 1998

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. Monthly statistics on purchases of crude oil and sales of petroleum products are presented in the Petroleum Marketing Monthly in five sections: Summary Statistics; Crude Oil Prices; Prices of Petroleum Products; Volumes of Petroleum Products; and Prime Supplier Sales Volumes of Petroleum Products for Local Consumption. 7 figs., 50 tabs.

  1. Petroleum marketing monthly, March 1999 with data for December 1998

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. Monthly statistics on purchases of crude oil and sales of petroleum products are presented in the Petroleum Marketing Monthly in five sections: summary statistics; crude oil prices; prices of petroleum products; volumes of petroleum products; and prime supplier sales volumes of petroleum products for local consumption. 7 figs., 50 tabs.

  2. Petroleum marketing monthly, June 1999, with data for March 1999

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. Monthly statistics on purchases of crude oil and sales of petroleum products are presented in the Petroleum Marketing Monthly in five sections: Initial Estimates; Summary Statistics; Crude Oil Prices; Prices of Petroleum Products; Volumes of Petroleum Products; and Prime Supplier Sales Volumes of Petroleum Products for Local Consumption. 7 figs., 50 tabs.

  3. Petroleum marketing monthly, May 1998, with data for February 1998

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides Information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. Monthly statistics on purchases of crude oil and sales of petroleum products are presented in the Petroleum Marketing Monthly in five sections: summary statistics; crude oil prices; prices of petroleum products; volumes of petroleum products; prime supplier sales volumes of petroleum products for local consumption. 7 figs., 50 tabs.

  4. Petroleum marketing monthly, May 1999, with data for February 1999

    SciTech Connect (OSTI)


    The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. Monthly statistics on purchases of crude oil and sales of petroleum products are presented in the Petroleum Marketing Monthly in five sections: Initial Estimates; Summary Statistics; Crude Oil Prices; Prices of Petroleum Products; Volumes of Petroleum Products; and Prime Supplier Sales Volumes of Petroleum Products for Local Consumption. 7 figs., 50 tabs.

  5. Study of the competitive viability of minority fuel oil marketers. Final report

    SciTech Connect (OSTI)


    Previous studies on the competitive viability of the fuel oil heating market had addressed some of the unique problems facing minority fuel oil marketers (MFMs) within the total market sector (TMS). This study focused on identifying and developing quantitative information on MFMs in the TMS. The specific objective was to determine whether the business problems experienced by MFMs were directly related to their minority status or were characterstic of any firm in the TMS operating under comparable conditions. As an overall conclusion, thorough investigation of the MFMs considered to constitute the universe of minoriy firms within the TMS did not reveal any evidence of overt discrimination affecting the competitive viability of MFMs. Upon analysis, the problems reported by MFMs could not be reasonably ascribed to discrimination on the basis of their minority business status. The study, however, did point up problems unique to MFMs as the result of typical operational and financial characteristics. For example, MFMs, compared to the TMS norm, have not been in the market as long and are smaller in terms of total assets, number of employees, number of trucks, number of accounts and annual volume of oil delivered. Their primary customers are low-income families in urban areas. Financial indicators suggest that the average MFM does not have long-term financial stability. The basis for this overall conclusion, derived by analyses of information from MFMs, as well as many independent sources, is summarized in three parts: (1) MFM industry profile; (2) financial analyses; and (3) problem analyses.

  6. The Social Costs to the U.S. of Monopolization of the World Oil Market, 1972-1991

    SciTech Connect (OSTI)

    Greene, D.L.


    The partial monopolization of the world oil market by the OPEC cartel has produced significant economic costs to the economies of the world. This paper reports estimates of the costs of monopolization of oil to the U.S. over the period 1972-1991. Two fundamental assumptions of the analysis are, (1) that OPEC has acted as a monopoly, albeit with limited control, knowledge, and ability to act and, (2) that the U.S. and other consuming nations could, through collective (social) action affect the cartel's ability to act as a monopoly. We measure total costs by comparing actual costs for the 1972-1991 period to a hypothetical ''more competitive'' world oil market scenario. By measuring past costs we avoid the enormous uncertainties about the future course of the world oil market and leave to the reader's judgment the issue of how much the future will be like the past. We note that total cost numbers cannot be used to determine the value of reducing U.S. oil use by one barrel. They are useful for describing the overall size of the petroleum problem and are one important factor in deciding how much effort should be devoted to solving it. Monopoly pricing of oil transfers wealth from US. oil consumers to foreign oil producers and, by increasing the economic scarcity of oil, reduces the economy's potential to produce. The actions of the OPEC Cartel have also produced oil price shocks, both upward and downward, that generate additional costs because of the economy's inherent inability to adjust quickly to a large change in energy prices. Estimated total costs to the United States from these three sources for the 1972-1991 period are put at $4.1 trillion in 1990$ ($1.2 T wealth transfer, $0.8 T macroeconomic adjustment costs, $2.1 T potential GNP losses). The cost of the US's primary oil supply contingency program is small ($10 B) by comparison.

  7. Oil companies turn cannibalistic as profits grow but reserves shrink

    SciTech Connect (OSTI)

    Corrigan, R.


    Oil company mergers, sales of storage capacity, and slow sales reveal a decline in reserves and a loss of revenues despite the large revenues and profits due to deregulation. Mobil's bid for Marathon Oil and Conoco illustrate the rush for upstream crude-oil supplies. The takeover activity includes small and large companies alike in both the domestic and international markets. Stock-market analysts rate oil companies that are buying secure proven reserves as a good investment. The administration sees no antitrust problem in the mergers, although horizontal mergers receive close scrutiny. Congressional response has been only mildly critical of the oil companies, but a moratorium bill on future mergers could pass in 1982. (DCK)

  8. Logan Daum > Analyst - DC Energy > Center Alumni > The Energy...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Logan Daum Analyst - DC Energy Formerly a graduate student with the Fennie Group, Logan joined DC Energy in June of 2013...

  9. WINDExchange Webinar: Offshore Wind Market Update

    Office of Energy Efficiency and Renewable Energy (EERE)

    Aaron Smith, an energy analyst at the National Renewable Energy Laboratory, will present an overview and update of the U.S. offshore wind market.

  10. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    Crude oil prices U.S. Energy Information Administration | Petroleum Marketing Monthly 3 February 2016...

  11. Contango in Cushing? Evidence on Financial-Physical Interactions in the U.S. Crude Oil Market

    U.S. Energy Information Administration (EIA) Indexed Site

    Contango in Cushing? Evidence on Financial-Physical Interactions in the U.S. Crude Oil Market Louis H. Ederington, University of Oklahoma Chitru S. Fernano, University of Oklahoma Kateryna Holland, University of Oklahoma Thomas K. Lee, U.S. Energy Information Administration March, 2012 Independent Statistics & Analysis U.S. Energy Information Administration Washington, DC 20585 This paper is released to encourage discussion and critical comment. The analysis and conclusions

  12. OIl Speculation

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    of investor flows and financial market conditions on returns in crude-oil futures markets. ... for returns in US and emerging-economy stock markets, a measure of the balance-sheet ...

  13. Oil

    Broader source: [DOE]

    The Energy Department works to ensure domestic and global oil supplies are environmentally sustainable and invests in research and technology to make oil drilling cleaner and more efficient.

  14. Managing the data deluge for national security analysts | National...

    National Nuclear Security Administration (NNSA)

    They're developing solutions that will enable analysts to work smarter, faster and more effectively when looking at huge, complex amounts of data in real-time, stressful ...

  15. NREL Analyst Honored with WREC Pioneer Award - News Releases | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Analyst Honored with WREC Pioneer Award September 6, 2006 Photo of Barbara Farhar Barbara Farhar Barbara Farhar, senior policy analyst with the U.S. Department of Energy's (DOE) National Renewable Energy Laboratory (NREL), received a 2006 Pioneer Award at the World Renewable Energy Congress (WREC) on Aug. 23 in Florence, Italy. The Pioneer Awards honor individuals for their contribution to advancing renewable energy through research, teaching and promotion. Farhar was recognized for her

  16. EIA - Special Report 8/30/05 - Hurricane Katrina's Impact on Oil Markets

    U.S. Energy Information Administration (EIA) Indexed Site

    August 30, 3:00 pm --SEE MOST RECENT-- According to the Minerals Management Service (MMS), as of 11:30 Central Time August 30, Gulf of Mexico oil production was reduced by over 1.4 million barrels per day as a result of Hurricane Katrina, equivalent to about 95 percent of daily Gulf of Mexico oil production. The MMS also reported that 8.8 billion cubic feet per day of natural gas production was shut in, equivalent to 88 percent of daily Gulf of Mexico natural gas production. The Louisiana

  17. EIA - Special Report 8/31/05 - Hurricane Katrina's Impact on Oil Markets

    U.S. Energy Information Administration (EIA) Indexed Site

    Wednesday, August 31, 4:00 pm --SEE MOST RECENT-- According to the Minerals Management Service (MMS), as of 11:30 Central Time August 31, Gulf of Mexico oil production was reduced by over 1.371 million barrels per day as a result of Hurricane Katrina, equivalent to about 91.45 percent of daily Gulf of Mexico oil production (which is 1.5 million barrels per day). The MMS also reported that 8.345 billion cubic feet per day of natural gas production was shut in, equivalent to 83.46 percent of daily

  18. EIA - Special Report 9/1/05 - Hurricane Katrina's Impact on Oil Markets

    U.S. Energy Information Administration (EIA) Indexed Site

    Thursday, September 1, 3:00 pm --SEE MOST RECENT-- According to the Minerals Management Service (MMS), as of 11:30 Central Time September 1, Gulf of Mexico oil production was reduced by over 1.356 million barrels per day as a result of Hurricane Katrina, equivalent to 90.43 percent of daily Gulf of Mexico oil production (which is 1.5 million barrels per day). The MMS also reported that 7.866 billion cubic feet per day of natural gas production was shut in, equivalent to 78.66 percent of daily

  19. Petroleum marketing annual, 1992

    SciTech Connect (OSTI)

    Not Available


    This publication contains statistical data on a variety of crude oils and refined petroleum products. The publication provides statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the free-on-board (f.o.b.) and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Sales data for motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane are presented.

  20. Oil Security Metrics Model

    SciTech Connect (OSTI)

    Greene, David L.; Leiby, Paul N.


    A presentation to the IWG GPRA USDOE, March 6, 2005, Washington, DC. OSMM estimates oil security benefits of changes in the U.S. oil market.

  1. Intelligence Research Analyst, GS-132-9/11 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Intelligence Research Analyst, GS-132-911 Intelligence Research Analyst, GS-132-911 Job Announcement Number: 16-0002 Who May Apply: All qualified U.S. citizens Duty Location: 2...

  2. Liquid Fuels Market Module - NEMS Documentation

    Reports and Publications (EIA)


    Defines the objectives of the Liquid Fuels Market Model (LFMM), describes its basic approach, and provides detail on how it works. This report is intended as a reference document for model analysts, users, and the public.

  3. Petroleum marketing monthly, December 1995

    SciTech Connect (OSTI)


    This publication provides information and statistical data on a variety of crude oils and refined petroleum products. It presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include domestic first purchase price, f.o.b. and landed cost of imported crude, and refiners` acquisition cost of crude. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane.

  4. Documentation of the Oil and Gas Supply Module (OGSM)

    SciTech Connect (OSTI)


    The purpose of this report is to define the objectives of the Oil and Gas Supply Model (OGSM), to describe the model`s basic approach, and to provide detail on how the model works. This report is intended as a reference document for model analysts, users, and the public. Projected production estimates of US crude oil and natural gas are based on supply functions generated endogenously within National Energy Modeling System (NEMS) by the OGSM. OGSM encompasses domestic crude oil and natural gas supply by both conventional and nonconventional recovery techniques. Nonconventional recovery includes enhanced oil recovery (EOR), and unconventional gas recovery (UGR) from tight gas formations, Devonian/Antrim shale and coalbeds. Crude oil and natural gas projections are further disaggregated by geographic region. OGSM projects US domestic oil and gas supply for six Lower 48 onshore regions, three offshore regions, and Alaska. The general methodology relies on forecasted profitability to determine exploratory and developmental drilling levels for each region and fuel type. These projected drilling levels translate into reserve additions, as well as a modification of the production capacity for each region. OGSM also represents foreign trade in natural gas, imports and exports by entry region. Foreign gas trade may occur via either pipeline (Canada or Mexico), or via transport ships as liquefied natural gas (LNG). These import supply functions are critical elements of any market modeling effort.

  5. Petroleum marketing monthly, September 1993

    SciTech Connect (OSTI)

    Not Available


    This document designed to give information and statistical data about a variety of crude oils and refined petroleum products. The publication provides statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and for the refiners` acquisition cost of crude oil. Sales data for motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane are presented.

  6. Petroleum marketing monthly, June 1993

    SciTech Connect (OSTI)

    Not Available


    This publication is designed to give information and statistical data about a variety of crude oils and refined petroleum products. The publication provides statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Sales data for motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane are presented.

  7. Crude Oil

    U.S. Energy Information Administration (EIA) Indexed Site

    Barrels) Product: Crude Oil Liquefied Petroleum Gases Distillate Fuel Oil Residual Fuel Oil Still Gas Petroleum Coke Marketable Petroleum Coke Catalyst Petroleum Coke Other Petroleum Products Natural Gas Coal Purchased Electricity Purchased Steam Period: Annual Download Series History Download Series History Definitions, Sources & Notes Definitions, Sources & Notes Show Data By: Product Area 2009 2010 2011 2012 2013 2014 View History U.S. 0 0 0 0 0 0 1986-2014 East Coast (PADD 1) 0 0 0 0

  8. Review of EIA Oil Production Outlooks

    U.S. Energy Information Administration (EIA) Indexed Site

    Review of EIA oil production outlooks For 2014 EIA Energy Conference July 15, 2014 | Washington, DC By Samuel Gorgen, Upstream Analyst Overview Gorgen, Tight Oil Production Trends EIA Conference, July 15, 2014 2 * Drilling Productivity Report performance review - Permian - Eagle Ford - Bakken * Crude oil production projections - Short-Term Energy Outlook - Annual Energy Outlook - International tight oil outlook * New DPR region highlights: Utica Drilling Productivity Report review - major tight

  9. 2013 Propane Market Outlook

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    domestic propane prices will not fully delink from oil prices, and competition against electricity and natural gas in traditional propane markets will remain very challenging....

  10. The November WINDExchange Webinar: Offshore Wind Market Update

    Broader source: [DOE]

    Aaron Smith, an energy analyst at the National Renewable Energy Laboratory, will present an overview and update of the U.S. offshore wind market. Stacy Tingley and Bryan Wilson of Deepwater Wind...

  11. Petroleum Market Model of the National Energy Modeling System. Part 1

    SciTech Connect (OSTI)


    The purpose of this report is to define the objectives of the Petroleum Market Model (PMM), describe its basic approach, and provide detail on how it works. This report is intended as a reference document for model analysts, users, and the public. The PMM models petroleum refining activities, the marketing of petroleum products to consumption regions, the production of natural gas liquids in gas processing plants, and domestic methanol production. The PMM projects petroleum product prices and sources of supply for meeting petroleum product demand. The sources of supply include crude oil, both domestic and imported; other inputs including alcohols and ethers; natural gas plant liquids production; petroleum product imports; and refinery processing gain. In addition, the PMM estimates domestic refinery capacity expansion and fuel consumption. Product prices are estimated at the Census division level and much of the refining activity information is at the Petroleum Administration for Defense (PAD) District level.

  12. Crude Oil Prices

    U.S. Energy Information Administration (EIA) Indexed Site

    Information AdministrationPetroleum Marketing Annual 2001 41 Table 21. Domestic Crude Oil First Purchase Prices (Dollars per Barrel) - Continued Year Month PAD District II...

  13. Crude Oil Prices

    U.S. Energy Information Administration (EIA) Indexed Site

    Information AdministrationPetroleum Marketing Annual 1998 41 Table 21. Domestic Crude Oil First Purchase Prices (Dollars per Barrel) - Continued Year Month PAD District II...

  14. Crude Oil Prices

    U.S. Energy Information Administration (EIA) Indexed Site

    Information AdministrationPetroleum Marketing Annual 1999 41 Table 21. Domestic Crude Oil First Purchase Prices (Dollars per Barrel) - Continued Year Month PAD District II...

  15. Petroleum marketing annual 1994

    SciTech Connect (OSTI)


    The Petroleum Marketing Annual (PMA) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysis, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the fob and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data in the Petroleum Marketing Annual. For this production, all estimates have been recalculated since their earlier publication in the Petroleum Marketing Monthly (PMM). These calculations made use of additional data and corrections that were received after the PMM publication date.

  16. Documentation of the oil and gas supply module (OGSM)

    SciTech Connect (OSTI)


    The purpose of this report is to define the objectives of the Oil and Gas Supply Model (OGSK, to describe the model`s basic approach, and to provide detail on how the model works. This report is intended as a reference document for model analysts, users, and the public. It is prepared in accordance with the Energy Information Administration`s (EIA) legal obligation to provide adequate documentation in support of its statistical and forecast reports (Public Law 93-275, Section 57(b)(2). OGSM is a comprehensive framework with which to analyze oil and gas supply potential and related issues. Its primary function is to produce forecast of crude oil, natural gas production, and natural gas imports and exports in response to price data received endogenously (within NEMS) from the Natural Gas Transmission and Distribution Model (NGTDM) and the Petroleum Market Model (PMM). To accomplish this task, OGSM does not provide production forecasts per se, but rather parameteres for short-term domestic oil and gas production functions and natural gas import functions that reside in PMM and NGTDM.

  17. Petroleum marketing monthly, October 1991. [Contains glossary

    SciTech Connect (OSTI)

    Not Available


    This report is designed to give information and statistical data about a variety of crude oils and refined petroleum products. The publication provides statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiner's acquisition cost of crude oil. Sales data for motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane are presented. 12 figs., 55 tabs.

  18. This Week In Petroleum Printer-Friendly Version

    Gasoline and Diesel Fuel Update (EIA)

    to forming their assessments of oil market trends, since they represent EIAs best estimates of prior year activity. One issue oil market analysts are likely to revisit...

  19. Supporting Mutual Understanding in a Visual Dialogue Between Analyst and Computer

    SciTech Connect (OSTI)

    Chappell, Alan R.; Cowell, Andrew J.; Thurman, David A.; Thomson, Judi R.


    The Knowledge Associates for Novel Intelligence (KANI) project is developing a system of automated “associates” to actively support and participate in the information analysis task. The primary goal of KANI is to use automatically extracted information in a reasoning system that draws on the strengths of both a human analyst and automated reasoning. The interface between the two agents is a key element in achieving this goal. The KANI interface seeks to support a visual dialogue with mixed-initiative manipulation of information and reasoning components. To be successful, the interface must achieve mutual understanding between the analyst and KANI of the other’s actions. Toward this mutual understanding, KANI allows the analyst to work at multiple levels of abstraction over the reasoning process, links the information presented across these levels to make use of interaction context, and provides querying facilities to allow exploration and explanation.

  20. Documentation of the Oil and Gas Supply Module (OGSM)

    SciTech Connect (OSTI)


    The purpose of this report is to define the objectives of the Oil and Gas Supply Model (OGSM), to describe the model`s basic approach, and to provide detail on how the model works. This report is intended as a reference document for model analysts, users, and the public. It is prepared in accordance with the Energy Information Administration`s (EIA) legal obligation to provide adequate documentation in support of its statistical and forecast reports (Public Law 93-275, Section 57(b)(2)). Projected production estimates of U.S. crude oil and natural gas are based on supply functions generated endogenously within National Energy Modeling System (NEMS) by the OGSM. OGSM encompasses domestic crude oil and natural gas supply by both conventional and nonconventional recovery techniques. Nonconventional recovery includes enhanced oil recovery (EOR), and unconventional gas recovery (UGR) from tight gas formations, Devonian shale and coalbeds. Crude oil and natural gas projections are further disaggregated by geographic region. OGSM projects U.S. domestic oil and gas supply for six Lower 48 onshore regions, three offshore regions, and Alaska. The general methodology relies on forecasted drilling expenditures and average drilling costs to determine exploratory and developmental drilling levels for each region and fuel type. These projected drilling levels translate into reserve additions, as well as a modification of the production capacity for each region. OGSM also represents foreign trade in natural gas, imports and exports by entry region. Foreign gas trade may occur via either pipeline (Canada or Mexico), or via transport ships as liquefied natural gas (LNG). These import supply functions are critical elements of any market modeling effort.

  1. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  2. Crude Oil Prices Table 21. Domestic Crude Oil First Purchase...

    U.S. Energy Information Administration (EIA) Indexed Site

    Information Administration Petroleum Marketing Annual 1995 41 Table 21. Domestic Crude Oil First Purchase Prices (Dollars per Barrel) - Continued Year Month PAD District II...

  3. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... Sources: U.S. Energy Informa on Administra on, Form EIA-856, "Monthly Foreign Crude Oil Acquisi on Report." U.S. Energy Information Administration | Petroleum Marketing Monthly 37 ...

  4. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... Sources: U.S. Energy Informa on Administra on, Form EIA-856, "Monthly Foreign Crude Oil Acquisi on Report." U.S. Energy Information Administration | Petroleum Marketing Monthly 38 ...

  5. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... nal. Sources: U.S. Energy Informa on Administra on, Form EIA-182, "Domes c Crude Oil First Purchase Report." U.S. Energy Information Administration | Petroleum Marketing Monthly 33

  6. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    Sources: U.S. Energy Informa on Administra on, Form EIA-856, "Monthly Foreign Crude Oil Acquisi on Report." U.S. Energy Information Administration | Petroleum Marketing Monthly 40 ...

  7. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... Sources: U.S. Energy Informa on Administra on Form EIA-856, "Monthly Foreign Crude Oil Acquisi on Report." U.S. Energy Information Administration | Petroleum Marketing Monthly 36 ...

  8. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    Sources: U.S. Energy Informa on Administra on, Form EIA-182, "Domes c Crude Oil First Purchase Report." U.S. Energy Information Administration | Petroleum Marketing Monthly 34 May ...

  9. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... Sources: U.S. Energy Informa on Administra on, Form EIA-856, "Monthly Foreign Crude Oil Acquisi on Report." U.S. Energy Information Administration | Petroleum Marketing Monthly 39 ...

  10. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... Sources: U.S. Energy Informa on Administra on Form EIA-856, "Monthly Foreign Crude Oil Acquisi on Report." U.S. Energy Information Administration | Petroleum Marketing Monthly 35 ...

  11. Petroleum Marketing Annual 2008

    U.S. Energy Information Administration (EIA) Indexed Site

    8 Released: August 27, 2009 Petroleum Marketing Annual --- Full report in PDF (1.2 MB) Summary Statistics Summary Statistics Tables PDF 1 Crude Oil Prices PDF TXT 1A Refiner...

  12. Petroleum Marketing Annual 2007

    U.S. Energy Information Administration (EIA) Indexed Site

    7 Released: August 29, 2008 Petroleum Marketing Annual --- Full report in PDF (1.2 MB) Summary Statistics Summary Statistics Tables PDF 1 Crude Oil Prices PDF TXT 1A Refiner...

  13. DOE/EIA-0487(98) Petroleum Marketing Annual

    U.S. Energy Information Administration (EIA) Indexed Site

    purchases of crude oil and sales of petroleum products are presented in the Petroleum Marketing Annual in five sections: * Summary Statistics * Crude Oil Prices * Prices of...

  14. Policy Analyst

    Broader source: [DOE]

    This position is located in the Strategic Planning group of the Corporate Strategy organization. The Strategic Planning group is responsible for planning, directing and managing a comprehensive...

  15. Budget Analyst

    Broader source: [DOE]

    Energy Efficiency and Renewable Energys (EERE) mission is to create and sustain American leadership in the global transition to a clean energy economy through high-impact research, development, and...

  16. Managment Analyst

    Broader source: [DOE]

    A successful candidate in this position will... Have significant experience supporting or leading technology development, and technology transfer programs, on a regional or national scale, for...

  17. Management Analyst

    Office of Energy Efficiency and Renewable Energy (EERE)

    This position is located within the Office of Energy Efficiency and Renewable Energy (EERE). EEREs mission is to create and sustain American leadership in the global transition to a clean energy...

  18. Management Analyst

    Broader source: [DOE]

    This position is located within the Office of Energy Efficiency and Renewable Energy (EERE). EERE's mission is to create and sustain American leadership in the global transition to a clean energy...

  19. Financial Analyst

    Broader source: [DOE]

    This position is located in the Debt and Investment Management group (FTC). Within Bonneville, FTC is part of Treasury(FT), which falls under Finance(F). Debt and Investment Management develops...

  20. Program Analyst

    Broader source: [DOE]

    A successful candidate in this position will Identify and document technical assistance and education models and practices. Facilitate information sharing and develop collaborative solutions....

  1. Business Analyst

    Broader source: [DOE]

    The Office of Science is the single largest supporter of basic research in the physical sciences in the United States, providing more than 40 percent of total funding for this vital area of...

  2. Analysts | NISAC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the Impacts of the Clean Power Plan May 2015 Independent Statistics & Analysis U.S. Department of Energy Washington, DC 20585 U.S. Energy Information Administration | Analysis of the Impacts of the Clean Power Plan i This report was prepared by the U.S. Energy Information Administration (EIA), the statistical and analytical agency within the U.S. Department of Energy. By law, EIA's data, analyses, and forecasts are independent of approval by any other officer or employee of the

  3. Motor Gasoline Market Model documentation report

    SciTech Connect (OSTI)

    Not Available


    The purpose of this report is to define the objectives of the Motor Gasoline Market Model (MGMM), describe its basic approach and to provide detail on model functions. This report is intended as a reference document for model analysts, users, and the general public. The MGMM performs a short-term (6- to 9-month) forecast of demand and price for motor gasoline in the US market; it also calculates end of month stock levels. The model is used to analyze certain market behavior assumptions or shocks and to determine the effect on market price, demand and stock level.

  4. Petroleum Market Model of the National Energy Modeling System

    SciTech Connect (OSTI)


    The purpose of this report is to define the objectives of the Petroleum Market Model (PMM), describe its basic approach, and provide detail on how it works. This report is intended as a reference document for model analysts, users, and the public. The PMM models petroleum refining activities, the marketing of petroleum products to consumption regions. The production of natural gas liquids in gas processing plants, and domestic methanol production. The PMM projects petroleum product prices and sources of supply for meeting petroleum product demand. The sources of supply include crude oil, both domestic and imported; other inputs including alcohols and ethers; natural gas plant liquids production; petroleum product imports; and refinery processing gain. In addition, the PMM estimates domestic refinery capacity expansion and fuel consumption. Product prices are estimated at the Census division level and much of the refining activity information is at the Petroleum Administration for Defense (PAD) District level. This report is organized as follows: Chapter 2, Model Purpose; Chapter 3, Model Overview and Rationale; Chapter 4, Model Structure; Appendix A, Inventory of Input Data, Parameter Estimates, and Model Outputs; Appendix B, Detailed Mathematical Description of the Model; Appendix C, Bibliography; Appendix D, Model Abstract; Appendix E, Data Quality; Appendix F, Estimation methodologies; Appendix G, Matrix Generator documentation; Appendix H, Historical Data Processing; and Appendix I, Biofuels Supply Submodule.

  5. Factors Influencing Oil Prices: A Survey of the Current State...

    U.S. Energy Information Administration (EIA) Indexed Site

    ... Hamilton (2009a) points out, as have numerous other authors surveying the oil market ... Hamilton argues the recent price escalation and subsequent decline in oil prices was ...

  6. DOE to Resume Filling Strategic Petroleum Reserve: Oil Acquisition...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of the recent large decline in crude oil prices, and has issued a solicitation to ... of substantially lower crude oil market prices, DOE believes it is economically prudent ...

  7. Storing and managing information artifacts collected by information analysts using a computing device

    DOE Patents [OSTI]

    Pike, William A; Riensche, Roderick M; Best, Daniel M; Roberts, Ian E; Whyatt, Marie V; Hart, Michelle L; Carr, Norman J; Thomas, James J


    Systems and computer-implemented processes for storage and management of information artifacts collected by information analysts using a computing device. The processes and systems can capture a sequence of interactive operation elements that are performed by the information analyst, who is collecting an information artifact from at least one of the plurality of software applications. The information artifact can then be stored together with the interactive operation elements as a snippet on a memory device, which is operably connected to the processor. The snippet comprises a view from an analysis application, data contained in the view, and the sequence of interactive operation elements stored as a provenance representation comprising operation element class, timestamp, and data object attributes for each interactive operation element in the sequence.

  8. Petroleum marketing monthly, December 1996 with data for September 1996

    SciTech Connect (OSTI)


    This report provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and the refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane. 7 figs., 50 tabs.

  9. Petroleum marketing monthly, January 1996 with data for October 1995

    SciTech Connect (OSTI)


    The Petroleum Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The publication presents statistics on crude oil costs and refined petroleum products sales for use by industry, government, private sector analysts, educational institutions, and consumers. Data on crude oil include the domestic first purchase price, the f.o.b. and landed cost of imported crude oil, and refiners` acquisition cost of crude oil. Refined petroleum product sales data include motor gasoline, distillates, residuals, aviation fuels, kerosene, and propane.

  10. Crude Oil Prices

    U.S. Energy Information Administration (EIA) Indexed Site

    20.86 20.67 20.47 20.24 20.32 19.57 See footnotes at end of table. 21. Domestic Crude Oil First Purchase Prices Energy Information Administration Petroleum Marketing Annual...

  11. Groundwater and Wastewater Remediation Using Agricultural Oils - Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Innovation Portal Groundwater and Wastewater Remediation Using Agricultural Oils Savannah River National Laboratory Contact SRNL About This Technology Soybean oil used for groundwater and wastewater remediation Soybean oil used for groundwater and wastewater remediation Technology Marketing Summary Scientists have developed a groundwater treatment technique that employs agricultural oils to stimulate endogenous microbes which accelerates the cleanup. The oils tested include canola oil,

  12. Lubricants Market to Record 44,165.11 Kilo Tons Volume by 2020...

    Open Energy Info (EERE)

    over 50% of the global market share. Automotive oils sector is further segmented into hydraulic oil, engine oil, and gear oil. Improving GDP in developing nations such as India and...

  13. Economics and regulation of petroleum futures markets

    SciTech Connect (OSTI)

    Not Available


    Because the futures market in petroleum products is a relatively recent phenomenon, the implications of public policies formulated for that market have not yet been fully explored. To provide the Office of Competition of the Department of Energy (DOE) with sufficient information to assess policy alternatives, Resource Planning Associates, Inc. (RPA) was asked to analyze the development of the futures market in No. 2 oil, assess the potential for futures markets in other petroleum products, and identify policy alternatives available to DOE. To perform this analysis, the criteria for a viable futures market was established first. Then, the experience to date with the 18-month-old futures market in No. 2 oil was examined, and the potential for viable futures markets in No. 6 oil, gasoline, jet fuel, and crude oil was assessed. Finally, how existing DOE regulations and prospective actions might affect petroleum futures market development was investigated.

  14. Crude Oil and Gasoline Price Monitoring

    Gasoline and Diesel Fuel Update (EIA)

    What drives crude oil prices? March 8, 2016 | Washington, DC An analysis of 7 factors that influence oil markets, with chart data updated monthly and quarterly price per barrel ...

  15. Effects of Alaska Oil and Natural Gas Provisions of H. R. 4 and S. 1766 on U.S. Energy Markets, Addendum

    Reports and Publications (EIA)


    This addendum provides projections on the increase in U.S. oil production from opening the Arctic National Wildlife Refuge, the decease in net petroleum imports, and the change in net petroleum expenditures across a range of cases.

  16. International Oil Supplies and Demands

    SciTech Connect (OSTI)

    Not Available


    The eleventh Energy Modeling Forum (EMF) working group met four times over the 1989--1990 period to compare alternative perspectives on international oil supplies and demands through 2010 and to discuss how alternative supply and demand trends influence the world's dependence upon Middle Eastern oil. Proprietors of eleven economic models of the world oil market used their respective models to simulate a dozen scenarios using standardized assumptions. From its inception, the study was not designed to focus on the short-run impacts of disruptions on oil markets. Nor did the working group attempt to provide a forecast or just a single view of the likely future path for oil prices. The model results guided the group's thinking about many important longer-run market relationships and helped to identify differences of opinion about future oil supplies, demands, and dependence.

  17. International Oil Supplies and Demands

    SciTech Connect (OSTI)

    Not Available


    The eleventh Energy Modeling Forum (EMF) working group met four times over the 1989--90 period to compare alternative perspectives on international oil supplies and demands through 2010 and to discuss how alternative supply and demand trends influence the world's dependence upon Middle Eastern oil. Proprietors of eleven economic models of the world oil market used their respective models to simulate a dozen scenarios using standardized assumptions. From its inception, the study was not designed to focus on the short-run impacts of disruptions on oil markets. Nor did the working group attempt to provide a forecast or just a single view of the likely future path for oil prices. The model results guided the group's thinking about many important longer-run market relationships and helped to identify differences of opinion about future oil supplies, demands, and dependence.

  18. Plasticizers Derived from Vegetable Oils - Energy Innovation...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Vegetable Oils Battelle Memorial Institute Contact BMI About This Technology Technology Marketing SummaryThis technology addresses the known health issues of commonly used...

  19. Plasticizers Derived from Vegetable Oils - Energy Innovation...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Vegetable Oils Battelle Memorial Institute Contact BMI About This Technology Technology Marketing Summary This technology addresses the known health issues of commonly used...

  20. Timeline: A Brief History of Oil Prices and Vehicle Technologies |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Timeline: A Brief History of Oil Prices and Vehicle Technologies Timeline: A Brief History of Oil Prices and Vehicle Technologies April 13, 2016 - 10:15am Addthis Shannon Brescher Shea Communications Manager, Clean Cities Program Benjamin Franklin once expressed that there are only two things you can count on in life: death and taxes. Transportation analysts might add a third item to that list - fluctuating gas prices. In the last decade, gas prices have risen and fallen

  1. Oil shale technology

    SciTech Connect (OSTI)

    Lee, S. (Akron Univ., OH (United States). Dept. of Chemical Engineering)


    Oil shale is undoubtedly an excellent energy source that has great abundance and world-wide distribution. Oil shale industries have seen ups and downs over more than 100 years, depending on the availability and price of conventional petroleum crudes. Market forces as well as environmental factors will greatly affect the interest in development of oil shale. Besides competing with conventional crude oil and natural gas, shale oil will have to compete favorably with coal-derived fuels for similar markets. Crude shale oil is obtained from oil shale by a relatively simple process called retorting. However, the process economics are greatly affected by the thermal efficiencies, the richness of shale, the mass transfer effectiveness, the conversion efficiency, the design of retort, the environmental post-treatment, etc. A great many process ideas and patents related to the oil shale pyrolysis have been developed; however, relatively few field and engineering data have been published. Due to the vast heterogeneity of oil shale and to the complexities of physicochemical process mechanisms, scientific or technological generalization of oil shale retorting is difficult to achieve. Dwindling supplied of worldwide petroleum reserves, as well as the unprecedented appetite of mankind for clean liquid fuel, has made the public concern for future energy market grow rapidly. the clean coal technology and the alternate fuel technology are currently of great significance not only to policy makers, but also to process and chemical researchers. In this book, efforts have been made to make a comprehensive text for the science and technology of oil shale utilization. Therefore, subjects dealing with the terminological definitions, geology and petrology, chemistry, characterization, process engineering, mathematical modeling, chemical reaction engineering, experimental methods, and statistical experimental design, etc. are covered in detail.

  2. Analyst Tools and Quality Control Software for the ARM Data System

    SciTech Connect (OSTI)

    Moore, S.T.


    ATK Mission Research develops analyst tools and automated quality control software in order to assist the Atmospheric Radiation Measurement (ARM) Data Quality Office with their data inspection tasks. We have developed a web-based data analysis and visualization tool, called NCVweb, that allows for easy viewing of ARM NetCDF files. NCVweb, along with our library of sharable Interactive Data Language procedures and functions, allows even novice ARM researchers to be productive with ARM data with only minimal effort. We also contribute to the ARM Data Quality Office by analyzing ARM data streams, developing new quality control metrics, new diagnostic plots, and integrating this information into DQ HandS - the Data Quality Health and Status web-based explorer. We have developed several ways to detect outliers in ARM data streams and have written software to run in an automated fashion to flag these outliers.

  3. EIA model documentation: Petroleum market model of the national energy modeling system

    SciTech Connect (OSTI)


    The purpose of this report is to define the objectives of the Petroleum Market Model (PMM), describe its basic approach, and provide detail on how it works. This report is intended as a reference document for model analysts, users, and the public. Documentation of the model is in accordance with EIA`s legal obligation to provide adequate documentation in support of its models. The PMM models petroleum refining activities, the marketing of petroleum products to consumption regions, the production of natural gas liquids in gas processing plants, and domestic methanol production. The PMM projects petroleum product prices and sources of supply for meeting petroleum product demand. The sources of supply include crude oil, both domestic and imported; other inputs including alcohols and ethers; natural gas plant liquids production; petroleum product imports; and refinery processing gain. In addition, the PMM estimates domestic refinery capacity expansion and fuel consumption. Product prices are estimated at the Census division level and much of the refining activity information is at the Petroleum Administration for Defense (PAD) District level.

  4. Monopolistic recycling of oil revenue and intertemporal bias in oil depletion and trade

    SciTech Connect (OSTI)

    Hillman, A.L.; Long, N.V.


    This paper investigates oil depletion and trade when monopolistic oil producers also exercise monopoly power in the capital market. A two-period model views collusively organized oil producers with an initial trade surplus and a subsequent deficit. When monopoly power in the capital market is applied to the disadvantage of borrowers, less oil is initially made available to oil importers than if the interest rate had been competitively determined. This depletion bias, however, is reversed if, because of incentives for capital accumulation, it is to the advantage of the oil producers to subsidize lending to the oil importers. In either case the bias in oil depletion due to monopolistic recycling of oil revenue is greater, the more vulnerable are oil importer's incomes to a curtailment of oil supplies. 25 references.

  5. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    Statistics U.S. Energy Information Administration | Petroleum Marketing Monthly Table 1. Crude oil prices dollars per barrel Year month Domes c fi rst purchase prices Average F.O.B.[a] cost of crude oil imports[b] Average landed cost of crude oil imports[b] Refi ner acquisi on cost of crude oil Domes c Imported Composite 1990 average 20.03 20.37 21.13 22.59 21.76 22.22 1991 average 16.54 16.89 18.02 19.33 18.70 19.06 1992 average 15.99 16.77 17.75 18.63 18.20 18.43 1993 average 14.25 14.71 15.72

  6. Table 23. Domestic Crude Oil First Purchase Prices by API Gravity

    U.S. Energy Information Administration (EIA) Indexed Site

    reported. Source: Energy Information Administration, Form EIA-182, "Domestic Crude Oil First Purchase Report." Energy Information Administration Petroleum Marketing Annual...

  7. Delineating coal market regions

    SciTech Connect (OSTI)

    Solomon, B.D.; Pyrdol, J.J.


    This study addresses the delineation of US coal market regions and their evolution since the 1973 Arab oil embargo. Dichotomizing into compliance (low sulfur) and high sulfur coal deliveries, market regions are generated for 1973, 1977, and 1983. Focus is restricted to steam coal shipments to electric utilities, which currently account for over 80% of the total domestic market. A two-stage method is used. First, cluster analyses are performed on the origin-destination shipments data to generate baseline regions. This is followed by multiple regression analyses on CIF delivered price data for 1983. Sensitivity analysis on the configuration of the regions is also conducted, and some thoughts on the behavior of coal markets conclude the paper. 37 references, 6 figures, 2 tables.

  8. U.S. Energy Information Administration | Petroleum Marketing...

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Monthly May 2014 iii May 2014 Preface The Petroleum Marketing Monthly (PMM) provides information and statistical data on a variety of crude oils and refined petroleum products. The...

  9. Circulating Fluidized Bed (CFB) Boilers Market will grow due...

    Open Energy Info (EERE)

    Energy Concerns to Push Global Market to Grow at 8.1% CAGR from 2013 to 2019 Oil Shale Market is Estimated to Reach USD 7,400.70 Million by 2022 more Group members (32)...

  10. Coal Markets

    U.S. Energy Information Administration (EIA) Indexed Site

    Coal Markets | Archive Coal Markets Weekly production Dollars per short ton Dollars per mmbtu Average weekly coal commodity spot prices dollars per short ton Week ending Week ago ...

  11. Marketing Resources

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Expand Utility Resources News & Events Expand News & Events Skip navigation links Marketing Resources Marketing Portal Reports, Publications, and Research Utility Toolkit...

  12. Northeast Heating Fuel Market The, Assessment and Options

    Reports and Publications (EIA)


    In response to the President's request, this study examines how the distillate fuel oil market (and related energy markets) in the Northeast behaved in the winter of 1999-2000, explains the role played by residential, commercial, industrial, and electricity generation sector consumers in distillate fuel oil markets and describes how that role is influenced by the structure of the energy markets in the Northeast

  13. Market and Policy Analysis

    Broader source: [DOE]

    Geothermal Technologies Office (GTO) analysts strive to help the geothermal community increase the use of geothermal resources in the marketplace and provide options for strengthening current...

  14. Fact #742: August 27, 2012 Oil Price and Economic Growth

    Broader source: [DOE]

    Major oil price shocks have disrupted world energy markets five times in the past 30 years (1973-74, 1979-80, 1990-91, 1999-2000, and 2008). Most of the oil price shocks were followed by an...

  15. Alaska Prudhoe Bay Crude Oil Shut-in Report

    Reports and Publications (EIA)


    Background and facts on Alaska's crude oil reserves, production, and transportation with the Energy Information Administration's analysis of potential shut-in impacts on U.S. oil markets.

  16. This Week In Petroleum Printer-Friendly Version

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    This may describe the feeling oil market analysts have regarding the refinery maintenance still taking place in numerous refineries. Refinery utilization reached nearly 96...

  17. North American Natural Gas Markets: Selected technical studies. Volume 3

    SciTech Connect (OSTI)

    Huntington, H.G.; Schuler, G.E.


    The Energy Modeling Forum (EMF) was established in 1976 at Stanford University to provide a structural framework within which energy experts, analysts, and policymakers could meet to improve their understanding of critical energy problems. The ninth EMF study, North American Natural Gas Markets, was conducted by a working group comprised of leading natural gas analysts and decision-makers from government, private companies, universities, and research and consulting organizations. The EMF 9 working group met five times from October 1986 through June 1988 to discuss key issues and analyze natural gas markets. This third volume includes technical papers that support many of the conclusions discussed in the EMF 9 summary report (Volume 1) and full working group report (Volume 2). These papers discuss the results from the individual models as well as some nonmodeling analysis related to US natural gas imports and industrial natural gas demand. Individual papers have been processed separately for inclusion in the Energy Science and Technology Database.

  18. North American Natural Gas Markets: Selected technical studies

    SciTech Connect (OSTI)

    Huntington, H.G.; Schuler, G.E.


    The Energy Modeling Forum (EMF) was established in 1976 at Stanford University to provide a structural framework within which energy experts, analysts, and policymakers could meet to improve their understanding of critical energy problems. The ninth EMF study, North American Natural Gas Markets, was conducted by a working group comprised of leading natural gas analysts and decision-makers from government, private companies, universities, and research and consulting organizations. The EMF 9 working group met five times from October 1986 through June 1988 to discuss key issues and analyze natural gas markets. This third volume includes technical papers that support many of the conclusions discussed in the EMF 9 summary report (Volume 1) and full working group report (Volume 2). These papers discuss the results from the individual models as well as some nonmodeling analysis related to US natural gas imports and industrial natural gas demand. Individual papers have been processed separately for inclusion in the Energy Science and Technology Database.

  19. Price changes in the gasoline market: Are Midwestern gasoline prices downward sticky?

    SciTech Connect (OSTI)


    This report examines a recurring question about gasoline markets: why, especially in times of high price volatility, do retail gasoline prices seem to rise quickly but fall back more slowly? Do gasoline prices actually rise faster than they fall, or does this just appear to be the case because people tend to pay more attention to prices when they`re rising? This question is more complex than it might appear to be initially, and it has been addressed by numerous analysts in government, academia and industry. The question is very important, because perceived problems with retail gasoline pricing have been used in arguments for government regulation of prices. The phenomenon of prices at different market levels tending to move differently relative to each other depending on direction is known as price asymmetry. This report summarizes the previous work on gasoline price asymmetry and provides a method for testing for asymmetry in a wide variety of situations. The major finding of this paper is that there is some amount of asymmetry and pattern asymmetry, especially at the retail level, in the Midwestern states that are the focus of the analysis. Nevertheless, both the amount asymmetry and pattern asymmetry are relatively small. In addition, much of the pattern asymmetry detected in this and previous studies could be a statistical artifact caused by the time lags between price changes at different points in the gasoline distribution system. In other words, retail gasoline prices do sometimes rise faster than they fall, but this is largely a lagged market response to an upward shock in the underlying wholesale gasoline or crude oil prices, followed by a return toward the previous baseline. After consistent time lags are factored out, most apparent asymmetry disappears.

  20. Model documentation coal market module of the National Energy Modeling System

    SciTech Connect (OSTI)


    This report documents the objectives and the conceptual and methodological approach used in the development of the Coal Production Submodule (CPS). It provides a description of the CPS for model analysts and the public. The Coal Market Module provides annual forecasts of prices, production, and consumption of coal.

  1. Understanding the China energy market: trends and opportunities 2006

    SciTech Connect (OSTI)

    Barbara Drazga


    The report is broken up into 4 Sections: Section I - Overview of China Energy Market (historical background, market value, consumption, production, reserves, export and import, market segmentation, market forecast); Section II - Market Analysis (PEST analysis, Porter's five forces analysis, socio-economic trends, consumption trends); Section III - Market Segments (electricity, oil, natural gas, liquefied natural gas, liquid petroleum gas, nuclear power, coal, renewables, photovoltaics, wind power, hydroelectric power. Each market segment details current and planned projects, and lists participants in that sector); and Section IV - Breaking Into the Market (regulatory framework, methods of market entry, foreign investment, challenges, government agencies).

  2. International Oil Supplies and Demands. Volume 2

    SciTech Connect (OSTI)

    Not Available


    The eleventh Energy Modeling Forum (EMF) working group met four times over the 1989--1990 period to compare alternative perspectives on international oil supplies and demands through 2010 and to discuss how alternative supply and demand trends influence the world`s dependence upon Middle Eastern oil. Proprietors of eleven economic models of the world oil market used their respective models to simulate a dozen scenarios using standardized assumptions. From its inception, the study was not designed to focus on the short-run impacts of disruptions on oil markets. Nor did the working group attempt to provide a forecast or just a single view of the likely future path for oil prices. The model results guided the group`s thinking about many important longer-run market relationships and helped to identify differences of opinion about future oil supplies, demands, and dependence.

  3. International Oil Supplies and Demands. Volume 1

    SciTech Connect (OSTI)

    Not Available


    The eleventh Energy Modeling Forum (EMF) working group met four times over the 1989--90 period to compare alternative perspectives on international oil supplies and demands through 2010 and to discuss how alternative supply and demand trends influence the world`s dependence upon Middle Eastern oil. Proprietors of eleven economic models of the world oil market used their respective models to simulate a dozen scenarios using standardized assumptions. From its inception, the study was not designed to focus on the short-run impacts of disruptions on oil markets. Nor did the working group attempt to provide a forecast or just a single view of the likely future path for oil prices. The model results guided the group`s thinking about many important longer-run market relationships and helped to identify differences of opinion about future oil supplies, demands, and dependence.

  4. Quantifying the Speculative Component in the Real Price of Oil...

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Inside the Crystal Ball: New Approaches to Predicting the Gasoline Price at the Pump EIA Workshop on Financial and Physical Oil market Linkages September 29, 2015 Washington, ...

  5. Prime Supplier Sales Volumes of Distillate Fuel Oils and Kerosene...

    Gasoline and Diesel Fuel Update (EIA)

    Marketing Annual 1997 401 Table 50. Prime Supplier Sales Volumes of Distillate Fuel Oils and Kerosene by PAD District and State (Thousand Gallons per Day) - Continued...

  6. Table 50. Prime Supplier Sales Volumes of Distillate Fuel Oils...

    U.S. Energy Information Administration (EIA) Indexed Site

    Marketing Annual 1999 359 Table 50. Prime Supplier Sales Volumes of Distillate Fuel Oils and Kerosene by PAD District and State (Thousand Gallons per Day) - Continued...

  7. Table 21. Domestic Crude Oil First Purchase Prices

    U.S. Energy Information Administration (EIA) Indexed Site

    Administration Petroleum Marketing Annual 1996 41 Table 21. Domestic Crude Oil First Purchase Prices (Dollars per Barrel) - Continued Year Month PAD District II...

  8. Table 21. Domestic Crude Oil First Purchase Prices

    U.S. Energy Information Administration (EIA) Indexed Site

    AdministrationPetroleum Marketing Annual 1998 41 Table 21. Domestic Crude Oil First Purchase Prices (Dollars per Barrel) - Continued Year Month PAD District II...

  9. Table 22. Domestic Crude Oil First Purchase Prices for Selected...

    U.S. Energy Information Administration (EIA) Indexed Site

    data. Source: Energy Information Administration, Form EIA-182, "Domestic Crude Oil First Purchase Report." 44 Energy Information AdministrationPetroleum Marketing Annual...

  10. Table 21. Domestic Crude Oil First Purchase Prices

    U.S. Energy Information Administration (EIA) Indexed Site

    Administration Petroleum Marketing Annual 1995 41 Table 21. Domestic Crude Oil First Purchase Prices (Dollars per Barrel) - Continued Year Month PAD District II...

  11. Table 22. Domestic Crude Oil First Purchase Prices for Selected...

    U.S. Energy Information Administration (EIA) Indexed Site

    data. Source: Energy Information Administration, Form EIA-182, "Domestic Crude Oil First Purchase Report." 44 Energy Information Administration Petroleum Marketing Annual...

  12. Utility Participation in the Rooftop Solar PV Market Transcript

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Utility Participation in the Rooftop Solar PV Market Page 1 of 21 Kristen Ardani, Jurstin Orkney, Marc Romito Page 1 of 21 [Speaker: Kristen Ardani] Slide 1: Good afternoon, everyone. Thank you for joining the Distributed Generation Interconnection Collaborative Monthly Informational Webinar. My name is Kristen Ardani, and I'm an analyst here at NREL and the moderator for the DGIC. So today, we are kicking off 2016 with a joint presentation from two Arizona utilities that have implemented

  13. Energy Information Administration/Petroleum Marketing Annual

    U.S. Energy Information Administration (EIA) Indexed Site

    30.5 See footnotes at end of table. 440 Energy Information AdministrationPetroleum Marketing Annual 1998 Table A3. RefinerReseller Prices of Distillate and Residual Fuel Oils,...

  14. Fuel Oil",,,"Fuel Oil Consumption",,"Fuel Oil Expenditures"

    U.S. Energy Information Administration (EIA) Indexed Site

    1. Total Fuel Oil Consumption and Expenditures, 1999" ,"All Buildings Using Fuel Oil",,,"Fuel Oil Consumption",,"Fuel Oil Expenditures" ,"Number of Buildings (thousand)","Floorspac...

  15. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  16. Fact #859 February 9, 2015 Excess Supply is the Most Recent Event to Affect Crude Oil Prices

    Broader source: [DOE]

    Crude oil prices have been extremely volatile over the past few decades. World events can disrupt the flow of oil to the market or cause uncertainty about future supply or demand for oil, leading...

  17. Market Transformation

    SciTech Connect (OSTI)

    Not Available


    Summarizes the goals and activities of the DOE Solar Energy Technologies Program efforts within its market transformation subprogram.

  18. DOE to Sell 35,000 Barrels of Oil from the Northeast Home Heating Oil

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Reserve | Department of Energy Sell 35,000 Barrels of Oil from the Northeast Home Heating Oil Reserve DOE to Sell 35,000 Barrels of Oil from the Northeast Home Heating Oil Reserve May 24, 2007 - 4:16pm Addthis WASHINGTON, DC - The U.S. Department of Energy announced today that it will sell approximately 35,000 barrels of home heating oil from the Northeast Home Heating Oil Reserve (NEHHOR). The Reserve's current 5-year storage contracts expire on September 30, 2007 and market conditions have

  19. The Northeast heating fuel market: Assessment and options

    SciTech Connect (OSTI)


    In response to a Presidential request, this study examines how the distillate fuel oil market (and related energy markets) in the Northeast behaved in the winter of 1999-2000, explains the role played by residential, commercial, industrial, and electricity generation sector consumers in distillate fuel oil markets and describes how that role is influenced by the structure of tie energy markets in the Northeast. In addition, this report explores the potential for nonresidential users to move away from distillate fuel oil and how this might impact future prices, and discusses conversion of distillate fuel oil users to other fuels over the next 5 years. Because the President's and Secretary's request focused on converting factories and other large-volume users of mostly high-sulfur distillate fuel oil to other fuels, transportation sector use of low-sulfur distillate fuel oil is not examined here.

  20. Sustainable Oils Inc | Open Energy Information

    Open Energy Info (EERE)

    producer and marketer of renewable, environmentally clean, and high-value Camelina-based biodiesel fuel. References: Sustainable Oils Inc.1 This article is a stub. You can help...

  1. Oil prices in a new light

    SciTech Connect (OSTI)

    Fesharaki, F. )


    For a clear picture of how oil prices develop, the author steps away from the price levels to which the world is accustomed, and evaluates scientifically. What makes prices jump from one notch to another The move results from a political or economic shock or the perception of a particular position by the futures market and the media. The shock could range from a war or an assassination to a promise of cooperation among OPEC members (when believed by the market) or to speculation about another failure at an OPEC meeting. In the oil market, only a couple of factual figures can provide a floor to the price of oil. The cost of production of oil in the Gulf is around $2 to $3/bbl, and the cost of production of oil (capital and operating costs) in key non-OPEC areas is well under $10/bbl. With some adjustments for transport and quality, a price range of $13/bbl to $16/bbl would correspond to a reasonable sustainable floor price. The reason for prices above the floor price has been a continuous fear of oil supply interruptions. That fear kept prices above the floor price for many years. The fear factor has now almost fully disappeared. The market has gone through the drama of the Iranian Revolution, the Iran-Iraq war, the tanker war, the invasion of Kuwait, and the expulsions of the Iraqis. And still the oil flowed -- all the time. It has become abundantly clear that fears above the oil market were unjustified. Everyone needs to export oil, and oil will flow under the worst circumstances. The demise of the fear factor means that oil prices tend toward the floor price for a prolonged period.

  2. Upgrading Orinoco Belt heavy oil

    SciTech Connect (OSTI)

    Aliantara, J.; Castillo, O.


    Petroleos de Venezuela, S.A. (PDVSA), in an effort to develop new oil resources, has undertaken a program to evaluate and develop the Orinoco Heavy Oil Belt, in the eastern part of Venezuela. Lagoven, S.A., a subsidiary of PDVSA, has been assigned the responsibility for developing and upgrading part of the Orinoco belt. This paper describes the most relevant aspects of Lagoven's first upgrading module, a facility that will convert Orinoco oil into a premium crude with a very high yield of products of great market demand.

  3. Oil privatization growing: Peru poised for comeback

    SciTech Connect (OSTI)

    Not Available


    Economic reform in Peru is transforming the oil and gas sector. Free market rationale is replacing the state monopoly mind-set. Foreign investment in oil, once discouraged by former administrations, is the response to new terms established by current government in its search for capital inflows to boost economic growth.

  4. Market Transformation

    SciTech Connect (OSTI)


    This Fuel Cell Technologies Program fact sheet outlines current status and challenges in the market transformation of hydrogen and fuel cell technologies.

  5. Market Acceleration

    SciTech Connect (OSTI)

    Solar Energy Technologies Program


    The fact sheet summarizes the goals and activities of the DOE Solar Energy Technologies Program efforts within its market acceleration subprogram.

  6. Energy Markets

    U.S. Energy Information Administration (EIA) Indexed Site

    will show a lower growth trajectory Source: EIA, International Energy Outlook 2013 carbon dioxide emissions billion metric tons 6 CSIS | Energy Markets Outlook November 16,...

  7. Market Transformation

    Fuel Cell Technologies Publication and Product Library (EERE)

    This Fuel Cell Technologies Program fact sheet outlines current status and challenges in the market transformation of hydrogen and fuel cell technologies.

  8. Energy Markets Outlook

    U.S. Energy Information Administration (EIA) Indexed Site

    Energy Markets Outlook For National Association for Business Economics March 7, 2016 | Washington, D.C. By Adam Sieminski, Administrator Forecast -3 -2 -1 0 1 2 3 4 5 6 82 84 86 88 90 92 94 96 98 100 2011-Q1 2012-Q1 2013-Q1 2014-Q1 2015-Q1 2016-Q1 2017-Q1 Implied stock change and balance (right axis) World production (left axis) World consumption (left axis) world supply and demand million barrels per day implied stock change million barrels per day Global oil inventories are forecast to

  9. Fuel oil and kerosene sales, 1990

    SciTech Connect (OSTI)

    Not Available


    Sales data is presented for kerosene and fuel oils. This is the second year that the survey data have appeared in a separate publication. Prior to the 1989 report, the statistics appeared in the Petroleum Marketing Annual (PMA) for reference year 1988 and the Petroleum Marketing Monthly (PMM) for reference years 1984 through 1987. 4 figs., 24 tabs.

  10. World Oil Price Cases (released in AEO2005)

    Reports and Publications (EIA)


    World oil prices in Annual Energy Outlook 2005 are set in an environment where the members of OPEC (Organization of the Petroleum Exporting Countries) are assumed to act as the dominant producers, with lower production costs than other supply regions or countries. Non-OPEC oil producers are assumed to behave competitively, producing as much oil as they can profitability extract at the market price for oil. As a result, the OPEC member countries will be able effectively to set the price of oil when they can act in concert by varying their aggregate production. Alternatively, OPEC members could target a fixed level of production and let the world market determine the price.

  11. Marketing and Market Transformation | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Market Transformation Marketing and Market Transformation Presents how going green will grow your business, as well as how programs can overcome appraisal challenges. PDF icon Marketing and Market Transformation Presentation More Documents & Publications Marketing and Market Transformation Working with the Real Estate Sector Trends in Real Estate and Energy Efficiency

  12. Physical Market Conditions, Paper Market Activity,

    Gasoline and Diesel Fuel Update (EIA)

    Prices U.S. Energy Information Administration | Petroleum Marketing Monthly Table 18. Domes c crude oil fi rst purchase prices dollars per barrel Year month U.S. Average PAD District 1 PAD District 2 U.S. Average Less AK North Slope Average NY PA WV Average IL IN KS KY MI NE 1990 20.03 21.57 22.06 23.32 23.00 22.16 22.88 23.36 23.46 23.21 23.20 22.92 21.94 1991 16.54 18.16 19.01 19.67 19.48 W 19.58 20.19 20.20 19.84 19.84 19.88 18.78 1992 15.99 17.38 18.52 19.05 19.01 18.09 18.63 19.26 19.27

  13. PIA - Northeast Home Heating Oil Reserve System (Heating Oil...

    Energy Savers [EERE]

    Northeast Home Heating Oil Reserve System (Heating Oil) PIA - Northeast Home Heating Oil Reserve System (Heating Oil) PIA - Northeast Home Heating Oil Reserve System (Heating Oil)...

  14. Fuel oil and kerosene sales 1996

    SciTech Connect (OSTI)


    The Fuel Oil and Kerosene Sales 1996 report provides information, illustrations and State-level statistical data on end-use sales of kerosene; No. 1, No. 2, and No. 4 distillate fuel oil; and residual fuel oil. State-level kerosene sales include volumes for residential, commercial, industrial, farm, and all other uses. State-level distillate sales include volumes for residential, commercial, industrial, oil company, railroad, vessel bunkering, military, electric utility, farm, on-highway, off highway construction, and other uses. State-level residual fuel sales include volumes for commercial, industrial, oil company, vessel bunkering, military, electric utility, and other uses. The Petroleum Marketing Division, Office of Oil and Gas, Energy Information Administration ensures the accuracy, quality, and confidentiality of the published data in the Fuel Oil and Kerosene Sales 1996. 24 tabs.

  15. Another look at the strategic petroleum reserve: Should its oil holdings be privatized?

    SciTech Connect (OSTI)

    Blumstein, C.; Komor, P.


    The sharp increases in crude oil prices in the 1970`s unleashed a gusher of economic and policy analyses concerning energy security. A consensus emerged concerning the desirability of building and using a large stock of oil to cushion the effects of a sudden loss of oil supply. The author examines the validity of this large stock of oil considering changes in the oil market and whether the oil holdings of the Strategic Petroleum Reserve should be privatized. 12 refs.

  16. DOE/EIA-0487(96) Distribution Category UC-950 Petroleum Marketing...

    U.S. Energy Information Administration (EIA) Indexed Site

    6) Distribution Category UC-950 Petroleum Marketing Annual 1996 October 1997 Energy Information Administration Office of Oil and Gas U.S. Department of Energy Washington, DC 20585...

  17. DOE/EIA-0487(95) Distribution Category UC-950 Petroleum Marketing...

    U.S. Energy Information Administration (EIA) Indexed Site

    5) Distribution Category UC-950 Petroleum Marketing Annual 1995 September 1995 Energy Information Administration Office of Oil and Gas U.S. Department of Energy Washington, DC...

  18. ,"Fuel Oil Consumption",,,"Fuel Oil Expenditures"

    U.S. Energy Information Administration (EIA) Indexed Site

    4. Fuel Oil Consumption and Expenditure Intensities for Non-Mall Buildings, 2003" ,"Fuel Oil Consumption",,,"Fuel Oil Expenditures" ,"per Building (gallons)","per Square Foot...

  19. ,"Fuel Oil Consumption",,,"Fuel Oil Expenditures"

    U.S. Energy Information Administration (EIA) Indexed Site

    2. Fuel Oil Consumption and Expenditure Intensities, 1999" ,"Fuel Oil Consumption",,,"Fuel Oil Expenditures" ,"per Building (gallons)","per Square Foot (gallons)","per Worker...

  20. Largest US oil and gas fields, August 1993

    SciTech Connect (OSTI)

    Not Available


    The Largest US Oil and Gas Fields is a technical report and part of an Energy Information Administration (EIA) series presenting distributions of US crude oil and natural gas resources, developed using field-level data collected by EIA`s annual survey of oil and gas proved reserves. The series` objective is to provide useful information beyond that routinely presented in the EIA annual report on crude oil and natural gas reserves. These special reports also will provide oil and gas resource analysts with a fuller understanding of the nature of US crude oil and natural gas occurrence, both at the macro level and with respect to the specific subjects addressed. The series` approach is to integrate EIA`s crude oil and natural gas survey data with related data obtained from other authoritative sources, and then to present illustrations and analyses of interest to a broad spectrum of energy information users ranging from the general public to oil and gas industry personnel.

  1. Statement from Energy Secretary Bodman on OPEC's Decision to Cut Crude Oil Production

    Broader source: [DOE]

    "We continue to believe that it is best for oil producers and consumers alike to allow free markets to determine issues of supply, demand and price.  Despite the recent downturn in crude oil prices...

  2. Too early to tell on $100 oil

    U.S. Energy Information Administration (EIA) Indexed Site

    Presentation to: April 8, 2008 Lehman Brothers oil outlook: Stronger signals of weaker prices Adam Robinson What's driving oil markets today? u Not the short run: Oil prices go up every time the US economy gets worse u It's tempting to argue that the rise in oil prices now is simply a continuation of past trends - The cost of F&D continues to march up - Demand in China growing faster with no signs of slowdown - Upstream and downstream supply bottlenecks are permanent u We think current price

  3. Market Studies

    Broader source: [DOE]

    This page contains links to lighting market characterization studies published by the U.S. Department of Energy, plus information on current studies under way. These studies are intended to present...

  4. Energy Markets

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Markets November 16, 2015 0 2 4 6 8 10 1990 1994 1998 2002 2006 2010 2014 biofuels geothermal solar wind waste hydroelectric wood 0 2 4 6 8 10 1990 1994 1998 2002 2006 2010...

  5. Energy Markets

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Markets October 22, 2015 0 2 4 6 8 10 1990 1994 1998 2002 2006 2010 2014 biofuels geothermal solar wind waste hydroelectric wood 0 2 4 6 8 10 1990 1994 1998 2002 2006 2010...

  6. Energy Markets

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Markets October 29, 2015 0 2 4 6 8 10 1990 1994 1998 2002 2006 2010 2014 biofuels geothermal solar wind waste hydroelectric wood 0 2 4 6 8 10 1990 1994 1998 2002 2006 2010...

  7. This Week In Petroleum Printer-Friendly Version

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    many oil market analysts and consumers are wondering if these prices are here to stay or if they are just a temporary aberration prior to a return to lower oil prices. While...

  8. This Week In Petroleum Printer-Friendly Version

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    the Sun in their heads over the next few weeks. But, as winter nears its end and spring is around the corner, oil market analysts turn their attention away from heating oil...

  9. Table 46. Refiner No. 2 Distillate, Diesel Fuel, and Fuel Oil...

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Petroleum Marketing Annual 1999 295 Table 46. Refiner No. 2 Distillate, Diesel Fuel, and Fuel Oil Volumes by PAD District and State (Thousand Gallons per Day) - Continued...

  10. Table 42. Residual Fuel Oil Prices by PAD District and State

    Gasoline and Diesel Fuel Update (EIA)

    Information Administration Petroleum Marketing Annual 1995 245 Table 42. Residual Fuel Oil Prices by PAD District and State (Cents per Gallon Excluding Taxes) - Continued...

  11. Table 42. Residual Fuel Oil Prices by PAD District and State

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Information AdministrationPetroleum Marketing Annual 1998 203 Table 42. Residual Fuel Oil Prices by PAD District and State (Cents per Gallon Excluding Taxes) - Continued...

  12. Table 23. Domestic Crude Oil First Purchase Prices by API Gravity

    U.S. Energy Information Administration (EIA) Indexed Site

    17.18 17.64 Source: Energy Information Administration, Form EIA-182, "Domestic Crude Oil First Purchase Report." Energy Information AdministrationPetroleum Marketing Annual 1999...

  13. Table 23. Domestic Crude Oil First Purchase Prices by API Gravity

    U.S. Energy Information Administration (EIA) Indexed Site

    12.17 12.80 Source: Energy Information Administration, Form EIA-182, "Domestic Crude Oil First Purchase Report." Energy Information AdministrationPetroleum Marketing Annual 1998...

  14. Supervisory Policy Analyst

    Broader source: [DOE]

    A successful candidate in this position will serve as an expert policy advisor and recognized technical authority to the Deputy Director for State, Local and Tribal Cooperation. The candidate will...

  15. Energy Industry Analyst (Litigation)

    Broader source: [DOE]

    If you are ready to begin your new career or are looking for a place to make an impact, what better place than a top 5 agency? We are looking for the best and brightest to join our team of...

  16. Operations Research Analyst

    Broader source: [DOE]

    This position is located in the Enterprise Risk Management group within the Risk Management group led by the Chief Risk Officer in the Office of the Deputy Administrator. The position is located at...

  17. Management and Program Analyst

    Broader source: [DOE]

    EEREs mission is to create and sustain American leadership in the global transition to a clean energy economy through high-impact research, development, and demonstration and by breaking down...

  18. Energy Industry Analyst

    Broader source: [DOE]

    This position is located in the Office of Enforcement's (OE) Division of Analytics and Surveillance. OE serves the public interest by ensuring effective regulations and protecting customers through...

  19. Financial Analyst (Litigation)

    Broader source: [DOE]

    If you are ready to begin your new career or are looking for a place to make an impact, what better place than a top 5 agency? We are looking for the best and brightest to join our team of...

  20. Energy Industry Analyst

    Broader source: [DOE]

    If you are ready to begin your new career or are looking for a place to make an impact, what better place than a top 5 agency? We are looking for the best and brightest to join our team of...

  1. Supervisory Supply Systems Analyst

    Office of Energy Efficiency and Renewable Energy (EERE)

    This position is located in Materials Management Group, which is part of the Logistics Management operations of Supply Chain Services. The Logistics Management organization manages the warehousing...

  2. Senior Counterintelligence Analyst

    Broader source: [DOE]

    A successful candidate in this position will: Manage counter-intelligence production and ensure analytical assessments adhere to the highest standards Support goals and objectives of the Director...

  3. Supervisory Program Analyst (Transformation)

    Broader source: [DOE]

    The Energy Information Administration (EIA) conducts a relevant, reliable, and timely data collection program that covers the full spectrum of energy sources, end uses, and energy flows; generates...

  4. Operations Research Analyst

    Broader source: [DOE]

    This position is located in the Transacting and Credit Risk Management group (TCRM) within the Risk Management group led by Chief Risk Officer (CRO) in the Office of the Compliance, Audit and Risk....

  5. Energy Industry Analyst (IT)

    Broader source: [DOE]

    If you are ready to begin your new career or are looking for a place to make an impact, what better place than a top 5 agency? We are looking for the best and brightest to join our team of...

  6. Compensation Review Analyst

    Energy Science and Technology Software Center (OSTI)


    COMPERA is a decision support system designed to facilitate the compensation review process. With parameters provided by the user(s), the system generates recommendations for base increases and nonbase compensation that strives to align total compensation with performance compensation targets. The user(s) prescribe(s) compensation targets according to performance (or value of contribution) designators. These targets are presented in look-up tables, which are then used by embedded formulas in the worksheet to determine the recommended compensation formore » each individual.« less

  7. Financial Program Analyst

    Broader source: [DOE]

    (See Frequently Asked Questions for more information). Where would I be working? Western Area Power Administration Desert Southwest Region Budget and Alternative Finance (G8100) 615 S. 43rd Avenue...

  8. DOE/EIA-0487(97) Petroleum Marketing Annual 1997

    U.S. Energy Information Administration (EIA) Indexed Site

    7) Petroleum Marketing Annual 1997 December 1998 Energy Information Administration Office of Oil and Gas U.S. Department of Energy Washington, DC 20585 This report was prepared by...

  9. International oil and gas exploration and development activities

    SciTech Connect (OSTI)

    Not Available


    This report is part of an ongoing series of quarterly publications that monitors discoveries of oil and natural gas in foreign countries and provides an analysis of the reserve additions that result. The report is prepared by the Energy Information Administration (EIA) of the US Department of Energy (DOE) under the Foreign Energy Supply Assessment Program (FESAP). It presents a summary of discoveries and reserve additions that result from recent international exploration and development activities. It is intended for use by petroleum industry analysts, various government agencies, and political leaders in the development, implementation, and evaluation of energy plans, policy, and legislation. 25 refs., 8 figs., 4 tabs.

  10. Have We Run Out of Oil Yet? Oil Peaking Analysis from an Optimist's Perspective

    SciTech Connect (OSTI)

    Greene, David L; Hopson, Dr Janet L; Li, Jia


    This study addresses several questions concerning the peaking of conventional oil production from an optimist's perspective. Is the oil peak imminent? What is the range of uncertainty? What are the key determining factors? Will a transition to unconventional oil undermine or strengthen OPEC's influence over world oil markets? These issues are explored using a model combining alternative world energy scenarios with an accounting of resource depletion and a market-based simulation of transition to unconventional oil resources. No political or environmental constraints are allowed to hinder oil production, geological constraints on the rates at which oil can be produced are not represented, and when USGS resource estimates are used, more than the mean estimate of ultimately recoverable resources is assumed to exist. The issue is framed not as a question of "running out" of conventional oil, but in terms of the timing and rate of transition from conventional to unconventional oil resources. Unconventional oil is chosen because production from Venezuela's heavy-oil fields and Canada's Athabascan oil sands is already underway on a significant scale and unconventional oil is most consistent with the existing infrastructure for producing, refining, distributing and consuming petroleum. However, natural gas or even coal might also prove to be economical sources of liquid hydrocarbon fuels. These results indicate a high probability that production of conventional oil from outside of the Middle East region will peak, or that the rate of increase of production will become highly constrained before 2025. If world consumption of hydrocarbon fuels is to continue growing, massive development of unconventional resources will be required. While there are grounds for pessimism and optimism, it is certainly not too soon for extensive, detailed analysis of transitions to alternative energy sources.


    SciTech Connect (OSTI)

    Engdahl, Eric, R.; Bergman, Eric, A.; Myers, Stephen, C.; Ryall, Floriana


    A new catalog of seismicity at magnitudes above 2.5 for the period 1923-2008 in the Iran region is assembled from arrival times reported by global, regional, and local seismic networks. Using in-country data we have formed new events, mostly at lower magnitudes that were not previously included in standard global earthquake catalogs. The magnitude completeness of the catalog varies strongly through time, complete to about magnitude 4.2 prior to 1998 and reaching a minimum of about 3.6 during the period 1998-2005. Of the 25,722 events in the catalog, most of the larger events have been carefully reviewed for proper phase association, especially for depth phases and to eliminate outlier readings, and relocated. To better understand the quality of the data set of arrival times reported by Iranian networks that are central to this study, many waveforms for events in Iran have been re-picked by an experienced seismic analyst. Waveforms at regional distances in this region are often complex. For many events this makes arrival time picks difficult to make, especially for smaller magnitude events, resulting in reported times that can be substantially improved by an experienced analyst. Even when the signal/noise ratio is large, re-picking can lead to significant differences. Picks made by our analyst are compared with original picks made by the regional networks. In spite of the obvious outliers, the median (-0.06 s) and spread (0.51 s) are small, suggesting that reasonable confidence can be placed in the picks reported by regional networks in Iran. This new catalog has been used to assess focal depth distributions throughout Iran. A principal result of this study is that the geographic pattern of depth distributions revealed by the relatively small number of earthquakes (~167) with depths constrained by waveform modeling (+/- 4 km) are now in agreement with the much larger number of depths (~1229) determined using reanalysis of ISC arrival-times (+/-10 km), within their respective errors. This is a significant advance, as outliers and future events with apparently anomalous depths can be readily identified and, if necessary, further investigated. The patterns of reliable focal depth distributions have been interpreted in the context of Middle Eastern active tectonics. Most earthquakes in the Iranian continental lithosphere occur in the upper crust, less than about 25-30 km in depth, with the crustal shortening produced by continental collision apparently accommodated entirely by thickening and distributed deformation rather than by subduction of crust into the mantle. However, intermediate-depth earthquakes associated with subducted slab do occur across the central Caspian Sea and beneath the Makran coast. A multiple-event relocation technique, specialized to use different kinds of near-source data, is used to calibrate the locations of 24 clusters containing 901 events drawn from the seismicity catalog. The absolute locations of these clusters are fixed either by comparing the pattern of relocated earthquakes with mapped fault geometry, by using one or more cluster events that have been accurately located independently by a local seismic network or aftershock deployment, by using InSAR data to determine the rupture zone of shallow earthquakes, or by some combination of these near-source data. This technique removes most of the systematic bias in single-event locations done with regional and teleseismic data, resulting in 624 calibrated events with location uncertainties of 5 km or better at the 90% confidence level (GT590). For 21 clusters (847 events) that are calibrated in both location and origin time we calculate empirical travel times, relative to a standard 1-D travel time model (ak135), and investigate event to station travel-time anomalies as functions of epicentral distance and azimuth. Substantial travel-time anomalies are seen in the Iran region which make accurate locations impossible unless observing stations are at very short distances (less than about 200 km) or travel-time models are improved to account for lateral heterogeneity in the region. Earthquake locations in the Iran region by international agencies, based on regional and teleseismic arrival time data, are systematically biased to the southwest and have a 90% location accuracy of 18-23 km, with the lower value achievable by applying limits on secondary azimuth gap. The data set of calibrated locations reported here provides an important constraint on travel-time models that would begin to account for the lateral heterogeneity in Earth structure in the Iran region, and permit seismic networks, especially the regional ones, to obtain in future more accurate locations of the earthquakes in the region.

  12. The outlook for US oil dependence

    SciTech Connect (OSTI)

    Greene, D.L.; Jones, D.W.; Leiby, P.N.


    Market share OPEC lost in defending higher prices from 1979-1985 is being steadily regained and is projected to exceed 50% by 2000. World oil markets are likely to be as vulnerable to monopoly influence as they were 20 years ago, as OPEC regains lost market share. The U.S. economy appears to be as exposed as it was in the early 1970s to losses from monopoly oil pricing. A simulated 2-year supply reduction in 2005-6 boosts OPEC revenues by roughly half a trillion dollars and costs the U.S. economy an approximately equal amount. The Strategic Petroleum Reserve appears to be of little benefit against such a determined, multi-year supply curtailment either in reducing OPEC revenues or protecting the U.S. economy. Increasing the price elasticity of oil demand and supply in the U.S. and the rest of the world, however, would be an effective strategy.

  13. Oil Shale Development from the Perspective of NETL's Unconventional Oil Resource Repository

    SciTech Connect (OSTI)

    Smith, M.W.; Shadle, L.J.; Hill, D.


    The history of oil shale development was examined by gathering relevant research literature for an Unconventional Oil Resource Repository. This repository contains over 17,000 entries from over 1,000 different sources. The development of oil shale has been hindered by a number of factors. These technical, political, and economic factors have brought about R&D boom-bust cycles. It is not surprising that these cycles are strongly correlated to market crude oil prices. However, it may be possible to influence some of the other factors through a sustained, yet measured, approach to R&D in both the public and private sectors.

  14. Fuel oil and kerosene sales 1993

    SciTech Connect (OSTI)

    Not Available


    This publication contains the 1993 survey results of the ``Annual Fuel Oil and Kerosene, Sales Report`` (Form EIA-821). This is the fifth year that the survey data have appeared in a separate publication. Prior to the 1989 report, the statistics appeared in the Petroleum Marketing Annual (PMA) for reference year 1988 and the Petroleum Marketing Monthly (PMM) for reference years 1984 through 1987. The 1993 edition marks the 10th annual presentation of the results of the ongoing ``Annual Fuel Oil and Kerosene Sales Report`` survey. Except for the kerosene and on-highway diesel information, data presented in Tables 1 through 12 (Sales of Fuel Oil and Kerosene) present results of the EIA-821 survey. Tables 13 through 24 (Adjusted Sales of Fuel Oil and Kerosene) include volumes that are based on the EIA-821 survey but have been adjusted to equal the products supplied volumes published in the Petroleum Supply Annual (PSA).

  15. Fuel oil and kerosene sales 1992

    SciTech Connect (OSTI)

    Not Available


    This publication contains the 1992 survey results of the ``Annual Fuel Oil and Kerosene Sales Report`` (Form EIA-821). This is the fourth year that the survey data have appeared in a separate publication. Prior to the 1989 report, the statistics appeared in the Petroleum Marketing Annual (PMA) for reference year 1988 and the Petroleum Marketing Monthly (PMM for reference years 1984 through 1987. The 1992 edition marks the ninth annual presentation of the results of the ongoing ``Annual Fuel Oil and Kerosene Sales Report`` survey. Except for the kerosene and on-highway diesel information, data presented in Tables 1 through 12 (Sales of Fuel Oil and Kerosene) present results of the EIA-821 survey. Tables 13 through 24 (Adjusted Sales of Fuel Oil and Kerosene) include volumes that are based on the EIA-821 survey but have been adjusted to equal the products supplied volumes published in the Petroleum Supply Annual (PSA).

  16. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    Prices U.S. Energy Information Administration | Petroleum Marketing Monthly Table 18. Domes c crude oil fi rst purchase prices dollars per barrel Year month U.S. Average PAD District 1 PAD District 2 U.S. Average Less AK North Slope Average NY PA WV Average IL IN KS KY MI NE 1990 20.03 21.57 22.06 23.32 23.00 22.16 22.88 23.36 23.46 23.21 23.20 22.92 21.94 1991 16.54 18.16 19.01 19.67 19.48 W 19.58 20.19 20.20 19.84 19.84 19.88 18.78 1992 15.99 17.38 18.52 19.05 19.01 18.09 18.63 19.26 19.27

  17. Petroleum Marketing Annual Archives

    U.S. Energy Information Administration (EIA) Indexed Site

    Petrolem Reports Petroleum Marketing Annual Archives The Petroleum Marketing Annual was discontinued in 2010. Choose the year from the archive Petroleum Marketing Annual you wish...

  18. Energy Imbalance Market Update

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    in CAISO Market Jim Price, Senior Advisor, Market Development & Analysis California ISO CAISO Public Market minimizes bid costs, while accounting for multiple transmission...

  19. Costs of Imported Crude Oil for Selected Crude Streams

    U.S. Energy Information Administration (EIA) Indexed Site

    18.19 17.14 18.84 20.97 See footnotes at end of table. 29. F.O.B. Costs of Imported Crude Oil for Selected Crude Streams Energy Information Administration Petroleum Marketing...

  20. ,"Total Fuel Oil Expenditures

    U.S. Energy Information Administration (EIA) Indexed Site

    . Fuel Oil Expenditures by Census Region for Non-Mall Buildings, 2003" ,"Total Fuel Oil Expenditures (million dollars)",,,,"Fuel Oil Expenditures (dollars)" ,,,,,"per...

  1. ,"Total Fuel Oil Consumption

    U.S. Energy Information Administration (EIA) Indexed Site

    0. Fuel Oil Consumption (gallons) and Energy Intensities by End Use for Non-Mall Buildings, 2003" ,"Total Fuel Oil Consumption (million gallons)",,,,,"Fuel Oil Energy Intensity...

  2. ,"Total Fuel Oil Expenditures

    U.S. Energy Information Administration (EIA) Indexed Site

    4. Fuel Oil Expenditures by Census Region, 1999" ,"Total Fuel Oil Expenditures (million dollars)",,,,"Fuel Oil Expenditures (dollars)" ,,,,,"per Gallon",,,,"per Square Foot"...

  3. ,"Total Fuel Oil Expenditures

    U.S. Energy Information Administration (EIA) Indexed Site

    A. Fuel Oil Expenditures by Census Region for All Buildings, 2003" ,"Total Fuel Oil Expenditures (million dollars)",,,,"Fuel Oil Expenditures (dollars)" ,,,,,"per Gallon",,,,"per...

  4. ,"Total Fuel Oil Consumption

    U.S. Energy Information Administration (EIA) Indexed Site

    A. Fuel Oil Consumption (gallons) and Energy Intensities by End Use for All Buildings, 2003" ,"Total Fuel Oil Consumption (million gallons)",,,,,"Fuel Oil Energy Intensity...

  5. Shale Oil Value Enhancement Research

    SciTech Connect (OSTI)

    James W. Bunger


    Raw kerogen oil is rich in heteroatom-containing compounds. Heteroatoms, N, S & O, are undesirable as components of a refinery feedstock, but are the basis for product value in agrochemicals, pharmaceuticals, surfactants, solvents, polymers, and a host of industrial materials. An economically viable, technologically feasible process scheme was developed in this research that promises to enhance the economics of oil shale development, both in the US and elsewhere in the world, in particular Estonia. Products will compete in existing markets for products now manufactured by costly synthesis routes. A premium petroleum refinery feedstock is also produced. The technology is now ready for pilot plant engineering studies and is likely to play an important role in developing a US oil shale industry.

  6. Marketing and Market Transformation | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Marketing and Market Transformation Presents how going green will grow your business, as ... Working with the Real Estate Sector Trends in Real Estate and Energy Efficiency

  7. Heavy oil development in Canada - The need for upgrading

    SciTech Connect (OSTI)

    Quinn, P.C.


    The author first reviews Canada's petroleum reserves, then summarizes the problem facing Canada regarding dwindling supplies of conventional light and medium crude oils and briefly describes Canada's refining capability. With that background, he attempts to analyze the problems that face heavy oil producers in attempting to market their product and propose a potential solution to these problems as illustrated by Husky Oil's approach - the construction of a heavy oil upgrader. He closes by sharing his views on the future of heavy oil development and the policy issues facing our governments.

  8. Impacts of the Venezuelan Crude Oil Production Loss

    Reports and Publications (EIA)


    This assessment of the Venezuelan petroleum loss examines two areas. The first part of the analysis focuses on the impact of the loss of Venezuelan crude production on crude oil supply for U.S. refiners who normally run a significant fraction of Venezuelan crude oil. The second part of the analysis looks at the impact of the Venezuelan production loss on crude markets in general, with particular emphasis on crude oil imports, refinery crude oil throughput levels, stock levels, and the changes in price differences between light and heavy crude oils.

  9. Impact of foreign LPG operations on domestic LPG markets

    SciTech Connect (OSTI)

    Jones, C.


    During 1978 the federal government passed legislation allowing a major increase in natural gas prices and offering hope that some portion of the supply will be allowed to reach free market levels. The mechanism for decontrol of crude oil was also put into effect. This favorable government action and higher world oil prices have led to a major resurgence in domestic exploration. In addition to the supply effects, there appears to have been a substantial demand response to the latest round of world oil price increases. The purpose of this paper is to discuss how these events have affected domestic LPG markets and pricing.

  10. Emulsified industrial oils recycling

    SciTech Connect (OSTI)

    Gabris, T.


    The industrial lubricant market has been analyzed with emphasis on current and/or developing recycling and re-refining technologies. This task has been performed for the United States and other industrialized countries, specifically France, West Germany, Italy and Japan. Attention has been focused at emulsion-type fluids regardless of the industrial application involved. It was found that emulsion-type fluids in the United States represent a much higher percentage of the total fluids used than in other industrialized countries. While recycling is an active matter explored by the industry, re-refining is rather a result of other issues than the mere fact that oil can be regenerated from a used industrial emulsion. To extend the longevity of an emulsion is a logical step to keep expenses down by using the emulsion as long as possible. There is, however, another important factor influencing this issue: regulations governing the disposal of such fluids. The ecological question, the respect for nature and the natural balances, is often seen now as everybody's task. Regulations forbid dumping used emulsions in the environment without prior treatment of the water phase and separation of the oil phase. This is a costly procedure, so recycling is attractive since it postpones the problem. It is questionable whether re-refining of these emulsions - as a business - could stand on its own if these emulsions did not have to be taken apart for disposal purposes. Once the emulsion is separated into a water and an oil phase, however, re-refining of the oil does become economical.

  11. Economic Effects of High Oil Prices (released in AEO2006)

    Reports and Publications (EIA)


    The Annual Energy Outlook 2006 projections of future energy market conditions reflect the effects of oil prices on the macroeconomic variables that affect oil demand, in particular, and energy demand in general. The variables include real gross domestic product (GDP) growth, inflation, employment, exports and imports, and interest rates.

  12. Methods of Managing Water in Oil Shale Development - Energy Innovation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Portal Methods of Managing Water in Oil Shale Development Colorado School of Mines Contact CSM About This Technology Technology Marketing SummaryThis invention is a system and method of providing water management and utilization during the process of dewatering and retorting of oil shale. More specifically, the process described relates to co-producing potable and non-potable water, for various uses, during the extraction of petroleum from shale oil deposits.DescriptionGenerally, the process

  13. Filamentous Carbon Particles for Cleaning Oil Spills - Energy Innovation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Portal Industrial Technologies Industrial Technologies Hydrogen and Fuel Cell Hydrogen and Fuel Cell Find More Like This Return to Search Filamentous Carbon Particles for Cleaning Oil Spills DOE Grant Recipients Contact GRANT About This Technology Technology Marketing Summary The invention provides methods and apparatus for the creation of carbon filaments used for cleaning oil spills. Crude oil and other petroleum products can cause severe damage to the environment and wildlife when spilled

  14. Southeast Asia: `A robust market`

    SciTech Connect (OSTI)

    Pagano, S.S.


    Southeast Asia is emerging as a robust market for exploration and field development activities. While much of the worldwide attention is focused on lucrative deep water drilling and production in the U.S. Gulf of Mexico, Brazil, and West Africa, the burgeoning Pacific Rim region is very much in the spotlight. As the industry approaches the next century. Southeast Asia is a key growth area that will be the focus of extensive drilling and development. Regional licensing activity is buoyant as oil and gas companies continue to express interest in Southeast Asian opportunities. During 1996, about 75 new license awards were granted. This year, at least an equal number of licenses likely will be awarded to international major and independent oil companies. In the past five years, the number of production-sharing contracts and concessions awarded declined slightly as oil companies apparently opted to invest in other foreign markets. Brunei government officials plan to open offshore areas to licensing in 1997, including what may prove to be attractive deep water areas. Indonesia`s state oil company Pertamina will offer 26 offshore tracts under production-sharing and technical assistance contracts this year. Malaysia expects to attract international interest in some 30 blocks it will soon offer under production-sharing terms. Bangladesh expects to call for tenders for an unspecified number of concessions later this year. Nearby, bids were submitted earlier this year to the Australian government for rights to explore 38 offshore areas. Results are expected to be announced by mid-year.

  15. North American Natural Gas Markets

    SciTech Connect (OSTI)

    Not Available


    This report summarizes die research by an Energy Modeling Forum working group on the evolution of the North American natural gas markets between now and 2010. The group's findings are based partly on the results of a set of economic models of the natural gas industry that were run for four scenarios representing significantly different conditions: two oil price scenarios (upper and lower), a smaller total US resource base (low US resource case), and increased potential gas demand for electric generation (high US demand case). Several issues, such as the direction of regulatory policy and the size of the gas resource base, were analyzed separately without the use of models.

  16. North American Natural Gas Markets

    SciTech Connect (OSTI)

    Not Available


    This report sunnnarizes the research by an Energy Modeling Forum working group on the evolution of the North American natural gas markets between now and 2010. The group's findings are based partly on the results of a set of economic models of the natural gas industry that were run for four scenarios representing significantly different conditions: two oil price scenarios (upper and lower), a smaller total US resource base (low US resource case), and increased potential gas demand for electric generation (high US demand case). Several issues, such as the direction of regulatory policy and the size of the gas resource base, were analyzed separately without the use of models.

  17. Oil and economic performance in industrial countries

    SciTech Connect (OSTI)

    Nordhaus, W.D.


    The Organization for Economic Co-operation and Development (OECD) countries have experienced slower economic growth and periods of discontinuity in the energy market since the 1973-74 oil embargo. A review of this phenomenon examines changes in the market during the 1960s and 70s, linkages between oil prices and economic performance, and appropriate policy responses. When price elasticities are calculated over time, recent US economic behavior appears to have both historical and cross-sountry consistency. Little flexibility is seen in the available energy-using technologies for producing goods and services, while energy-using capital has been sluggish. Dr. Nordhaus advocates high oil price and high tax policies as the best way to limit demand without slowing economic growth. (DCK)

  18. Heavy oil reservoirs recoverable by thermal technology. Annual report

    SciTech Connect (OSTI)

    Kujawa, P.


    The purpose of this study was to compile data on reservoirs that contain heavy oil in the 8 to 25/sup 0/ API gravity range, contain at least ten million barrels of oil currently in place, and are non-carbonate in lithology. The reservoirs within these constraints were then analyzed in light of applicable recovery technology, either steam-drive or in situ combustion, and then ranked hierarchically as candidate reservoirs. The study is presented in three volumes. Volume I presents the project background and approach, the screening analysis, ranking criteria, and listing of candidate reservoirs. The economic and environmental aspects of heavy oil recovery are included in appendices to this volume. This study provides an extensive basis for heavy oil development, but should be extended to include carbonate reservoirs and tar sands. It is imperative to look at heavy oil reservoirs and projects on an individual basis; it was discovered that operators, and industrial and government analysts will lump heavy oil reservoirs as poor producers, however, it was found that upon detailed analysis, a large number, so categorized, were producing very well. A study also should be conducted on abandoned reservoirs. To utilize heavy oil, refiners will have to add various unit operations to their processes, such as hydrotreaters and hydrodesulfurizers and will require, in most cases, a lighter blending stock. A big problem in producing heavy oil is that of regulation; specifically, it was found that the regulatory constraints are so fluid and changing that one cannot settle on a favorable recovery and production plan with enough confidence in the regulatory requirements to commit capital to the project.

  19. Fuel oil and kerosene sales 1994

    SciTech Connect (OSTI)


    This publication contains the 1994 survey results of the ``Annual Fuel Oil and Kerosene Sales Report`` (Form EIA-821). This is the sixth year that the survey data have appeared in a separate publication. Prior to the 1989 report, the statistics appeared in the Petroleum Marketing Annual (PMA)for reference year 1988 and the Petroleum Marketing Monthly (PMM) for reference years 1984 through 1987. The 1994 edition marks the 11th annual presentation of the results of the ongoing ``Annual Fuel Oil and Kerosene Sales Report`` survey. Distillate and residual fuel oil sales continued to move in opposite directions during 1994. Distillate sales rose for the third year in a row, due to a growing economy. Residual fuel oil sales, on the other hand, declined for the sixth year in a row, due to competitive natural gas prices, and a warmer heating season than in 1993. Distillate fuel oil sales increased 4.4 percent while residual fuel oil sales declined 1.6 percent. Kerosene sales decreased 1.4 percent in 1994.

  20. Sandia Energy - Solar Market Transformation

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Solar Market Transformation Home Stationary Power Energy Conversion Efficiency Solar Energy Photovoltaics Solar Market Transformation Solar Market TransformationTara...

  1. Stochastic Energy Deployment System (SEDS) World Oil Model (WOM)

    SciTech Connect (OSTI)


    The function of the World Oil Market Model (WOMM) is to calculate a world oil price. SEDS will set start and end dates for the forecast period, and a time increment (assumed to be 1 year in the initial version). The WOMM will then randomly select an Annual Energy Outlook (AEO) oil price case and calibrate itself to that case. As it steps through each year, the WOMM will generate a stochastic supply shock to OPEC output and accept a new estimate of U.S. petroleum demand from SEDS. The WOMM will then calculate a new oil market equilibrium for the current year. The world oil price at the new equilibrium will be sent back to SEDS. When the end year is reached, the process will begin again with the selection of a new AEO forecast. Iterations over forecasts will continue until SEDS has completed all its simulation runs.

  2. Stochastic Energy Deployment System (SEDS) World Oil Model (WOM)

    Energy Science and Technology Software Center (OSTI)


    The function of the World Oil Market Model (WOMM) is to calculate a world oil price. SEDS will set start and end dates for the forecast period, and a time increment (assumed to be 1 year in the initial version). The WOMM will then randomly select an Annual Energy Outlook (AEO) oil price case and calibrate itself to that case. As it steps through each year, the WOMM will generate a stochastic supply shock tomore » OPEC output and accept a new estimate of U.S. petroleum demand from SEDS. The WOMM will then calculate a new oil market equilibrium for the current year. The world oil price at the new equilibrium will be sent back to SEDS. When the end year is reached, the process will begin again with the selection of a new AEO forecast. Iterations over forecasts will continue until SEDS has completed all its simulation runs.« less

  3. Using Fuel Oil",,,"Fuel Oil Consumption",,"Fuel Oil Expenditures...

    U.S. Energy Information Administration (EIA) Indexed Site

    . Total Fuel Oil Consumption and Expenditures for Non-Mall Buildings, 2003" ,"All Buildings* Using Fuel Oil",,,"Fuel Oil Consumption",,"Fuel Oil Expenditures" ,"Number of Buildings...

  4. Using Fuel Oil",,,"Fuel Oil Consumption",,"Fuel Oil Expenditures...

    U.S. Energy Information Administration (EIA) Indexed Site

    A. Total Fuel Oil Consumption and Expenditures for All Buildings, 2003" ,"All Buildings Using Fuel Oil",,,"Fuel Oil Consumption",,"Fuel Oil Expenditures" ,"Number of Buildings...

  5. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... U.S. Energy Information Administration | Petroleum Marketing Monthly 30 May 2016 Table 18. ... U.S. Energy Information Administration | Petroleum Marketing Monthly 31 May 2016 Table 18. ...

  6. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    U.S. Energy Information Administration | Petroleum Marketing Monthly 86 May 2016 Table 43. ... U.S. Energy Information Administration | Petroleum Marketing Monthly 87 May 2016 Table 43. ...

  7. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... U.S. Energy Information Administration | Petroleum Marketing Monthly 16 May 2016 Table 7. ... Report." U.S. Energy Information Administration | Petroleum Marketing Monthly 17 May 2016

  8. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... U.S. Energy Information Administration | Petroleum Marketing Monthly 100 May 2016 Table ... U.S. Energy Information Administration | Petroleum Marketing Monthly 101 May 2016 Table ...

  9. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... U.S. Energy Information Administration | Petroleum Marketing Monthly 20 May 2016 Table 9. ... Report." U.S. Energy Information Administration | Petroleum Marketing Monthly 21 May 2016

  10. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... U.S. Energy Information Administration | Petroleum Marketing Monthly 6 May 2016 Table 3. ... U.S. Energy Information Administration | Petroleum Marketing Monthly 8 May 2016 Table 4. ...

  11. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... U.S. Energy Information Administration | Petroleum Marketing Monthly 104 May 2016 Table ... U.S. Energy Information Administration | Petroleum Marketing Monthly 105 May 2016 Table ...

  12. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    U.S. Energy Information Administration | Petroleum Marketing Monthly 53 May 2016 Table 33. ... U.S. Energy Information Administration | Petroleum Marketing Monthly 54 May 2016 Table 33. ...

  13. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... U.S. Energy Information Administration | Petroleum Marketing Monthly 24 May 2016 Table 11. ... Report." U.S. Energy Information Administration | Petroleum Marketing Monthly 25 May 2016

  14. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    Volume of Petroleum Products U.S. Energy Information Administration | Petroleum Marketing ... U.S. Energy Information Administration | Petroleum Marketing Monthly 58 May 2016 Table 39. ...

  15. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    U.S. Energy Information Administration | Petroleum Marketing Monthly 49 May 2016 Table 32. ... U.S. Energy Information Administration | Petroleum Marketing Monthly 50 May 2016 Table 32. ...

  16. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... U.S. Energy Information Administration | Petroleum Marketing Monthly 18 May 2016 Table 8. ... Report." U.S. Energy Information Administration | Petroleum Marketing Monthly 19 May 2016

  17. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... U.S. Energy Information Administration | Petroleum Marketing Monthly 78 May 2016 Table 41. ... U.S. Energy Information Administration | Petroleum Marketing Monthly 79 May 2016 Table 41. ...

  18. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... U.S. Energy Information Administration | Petroleum Marketing Monthly 58 May 2016 Table 39. ... U.S. Energy Information Administration | Petroleum Marketing Monthly 59 May 2016 Table 39. ...

  19. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... U.S. Energy Information Administration | Petroleum Marketing Monthly vii May 2016 Table ... U.S. Energy Information Administration | Petroleum Marketing Monthly viii May 2016 Figure ...

  20. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    Prices of Petroleum Products U.S. Energy Information Administration | Petroleum Marketing ... U.S. Energy Information Administration | Petroleum Marketing Monthly 45 May 2016 Table 31. ...

  1. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    U.S. Energy Information Administration | Petroleum Marketing Monthly 66 May 2016 Table 40. ... U.S. Energy Information Administration | Petroleum Marketing Monthly 67 May 2016 Table 40. ...

  2. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... U.S. Energy Information Administration | Petroleum Marketing Monthly 14 May 2016 Table 6. ... Report." U.S. Energy Information Administration | Petroleum Marketing Monthly 15 May 2016

  3. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    Information Administration | Petroleum Marketing Monthly Table 45. Prime supplier sales ... U.S. Energy Information Administration | Petroleum Marketing Monthly 92 May 2016 Table 45. ...

  4. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    U.S. Energy Information Administration | Petroleum Marketing Monthly 82 May 2016 Table 42. ... U.S. Energy Information Administration | Petroleum Marketing Monthly 83 May 2016 Table 42. ...

  5. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... U.S. Energy Information Administration | Petroleum Marketing Monthly 45 May 2016 Table 31. ... U.S. Energy Information Administration | Petroleum Marketing Monthly 46 May 2016 Table 31. ...

  6. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... U.S. Energy Information Administration | Petroleum Marketing Monthly 22 May 2016 Table 10. ... Report." U.S. Energy Information Administration | Petroleum Marketing Monthly 23 May 2016

  7. Petroleum Marketing Annual 2009

    U.S. Energy Information Administration (EIA) Indexed Site

    Petroleum Marketing Annual 2009 Released: August 6, 2010 Next Release Date: Discontinued find annual data in Petroleum Marketing Monthly Monthly price and volume statistics on...

  8. Market Transformation Fact Sheet

    Broader source: [DOE]

    This fact sheet describes the Fuel Cell Technologies Office's Market Transformation strategies and activities, which are aimed at accelerating early market adoption and advancing pre-competitive technologies.

  9. Northwest Energy Market Assessment

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Northwest Energy Market Assessment Pages Northwest-Energy-Market-Assessment Sign In About | Careers | Contact | Investors | Search News & Us Expand News & Us Projects &...

  10. Petroleum Marketing Annual

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    PDF 1.2MB . Front Matter . Petroleum Marketing Annual Cover Page, Preface, and Table of Contents PDF . Highlights . Petroleum Marketing Annual Highlights PDF . . Summary Statistics ...

  11. Petroleum Marketing Annual

    Gasoline and Diesel Fuel Update (EIA)

    PDF 2.9MB . . Front Matter . Petroleum Marketing Annual Cover Page, Contacts, Preface, and Table of Contents PDF . . Highlights . Petroleum Marketing Annual Highlights PDF . . ...

  12. Petroleum Marketing Annual 1997

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    PDF 1.2MB . . Front Matter . Petroleum Marketing Annual Cover Page, Contacts, Preface, and Table of Contents PDF . . Highlights . Petroleum Marketing Annual Highlights PDF . . ...

  13. International oil companies in the Far East

    SciTech Connect (OSTI)

    Mlotok, P.


    All of the major international oil companies have extensive operations in the Far East, and in most cases, these operations account for a significant part of their worldwide earnings. In the refining and marketing end of the business, near-term profitability could be hampered by problems in the Singapore refining center. An expansion of Indonesian refining capacity has reduced profits from processing arrangements, and new Saudi product exports will enter Singapore starting this year. Longer term, however, the strong economic growth in the region renders it a highly attractive area in which to operate. On the producing end, rising output will boost profits for the international oil companies in Indonesia and Malaysia. Caltex (a 50/50 joint venture between Chevron and Texaco) is one of the largest marketers in the Far East. It will not initially be affected greatly by the Singapore refinery problem, as its production from this area goes directly into its own marketing system rather than into the open market. Exxon is a medium-size marketer with especially strong positions in Japan, Malaysia and Thailand. However, the company could be vulnerable to near-term problems in Singapore. Mobil, another medium-size marketer, has a very strong position in Japan but problems in Australia. As those problems are corrected, earnings should grow over time. The Royal Dutch Shell Group is one of the largest marketers in the Far East, with good positions in Singapore, Malaysia and Australia. Shell will have difficulty adjusting to the changing conditions in Singapore, but once this is complete, downstream earnings growth should resume. British Petroleum (BP) has a smaller upstream and downstream presence than the other international oils. Estimated 1983 Far East earnings are tabulated for these five companies. 5 figures.

  14. PIA - Northeast Home Heating Oil Reserve System (Heating Oil) | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy Northeast Home Heating Oil Reserve System (Heating Oil) PIA - Northeast Home Heating Oil Reserve System (Heating Oil) PIA - Northeast Home Heating Oil Reserve System (Heating Oil) PDF icon PIA - Northeast Home Heating Oil Reserve System (Heating Oil) More Documents & Publications PIA - WEB Physical Security Major Application PIA - GovTrip (DOE data) PIA - WEB Unclassified Business Operations General Support

  15. Oil and Gas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Oil and Gas Oil and Gas R&D focus on the use of conventional and unconventional fossil fuels, including associated environmental challenges Contact thumbnail of Business ...

  16. Crude Oil | NISAC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    oil fields to fuel distribution terminals. Different components of this system (e.g., crude oil import terminals, refineries, transmission pipelines, and tank farms) can be ...

  17. Biochemically enhanced oil recovery and oil treatment

    DOE Patents [OSTI]

    Premuzic, Eugene T.; Lin, Mow


    This invention relates to the preparation of new, modified organisms, through challenge growth processes, that are viable in the extreme temperature, pressure and pH conditions and salt concentrations of an oil reservoir and that are suitable for use in microbial enhanced oil recovery. The modified microorganisms of the present invention are used to enhance oil recovery and remove sulfur compounds and metals from the crude oil.

  18. Biochemically enhanced oil recovery and oil treatment

    DOE Patents [OSTI]

    Premuzic, E.T.; Lin, M.


    This invention relates to the preparation of new, modified organisms, through challenge growth processes, that are viable in the extreme temperature, pressure and pH conditions and salt concentrations of an oil reservoir and that are suitable for use in microbial enhanced oil recovery. The modified microorganisms of the present invention are used to enhance oil recovery and remove sulfur compounds and metals from the crude oil. 62 figures.

  19. This Week In Petroleum Printer-Friendly Version

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    our eyes. Whether it is making things disappear or floating in the air, magicians test the limits of what we think we understand. In U.S. oil markets, some analysts are...

  20. Running Out of and Into Oil: Analyzing Global Oil Depletion and Transition Through 2050

    SciTech Connect (OSTI)

    Greene, D.L.


    This report presents a risk analysis of world conventional oil resource production, depletion, expansion, and a possible transition to unconventional oil resources such as oil sands, heavy oil and shale oil over the period 2000 to 2050. Risk analysis uses Monte Carlo simulation methods to produce a probability distribution of outcomes rather than a single value. Probability distributions are produced for the year in which conventional oil production peaks for the world as a whole and the year of peak production from regions outside the Middle East. Recent estimates of world oil resources by the United States Geological Survey (USGS), the International Institute of Applied Systems Analysis (IIASA), the World Energy Council (WEC) and Dr. C. Campbell provide alternative views of the extent of ultimate world oil resources. A model of oil resource depletion and expansion for twelve world regions is combined with a market equilibrium model of conventional and unconventional oil supply and demand to create a World Energy Scenarios Model (WESM). The model does not make use of Hubbert curves but instead relies on target reserve-to-production ratios to determine when regional output will begin to decline. The authors believe that their analysis has a bias toward optimism about oil resource availability because it does not attempt to incorporate political or environmental constraints on production, nor does it explicitly include geologic constraints on production rates. Global energy scenarios created by IIASA and WEC provide the context for the risk analysis. Key variables such as the quantity of undiscovered oil and rates of technological progress are treated as probability distributions, rather than constants. Analyses based on the USGS and IIASA resource assessments indicate that conventional oil production outside the Middle East is likely to peak sometime between 2010 and 2030. The most important determinants of the date are the quantity of undiscovered oil, the rate at which unconventional oil production can be expanded, and the rate of growth of reserves and enhanced recovery. Analysis based on data produced by Campbell indicates that the peak of non-Middle East production will occur before 2010. For total world conventional oil production, the results indicate a peak somewhere between 2020 and 2050. Key determinants of the peak in world oil production are the rate at which the Middle East region expands its output and the minimum reserves-to-production ratios producers will tolerate. Once world conventional oil production peaks, first oil sands and heavy oil from Canada, Venezuela and Russia, and later some other source such as shale oil from the United States must expand if total world oil consumption is to continue to increase. Alternative sources of liquid hydrocarbon fuels, such as coal or natural gas are also possible resources but not considered in this analysis nor is the possibility of transition to a hydrogen economy. These limitations were adopted to simplify the transition analysis. Inspection of the paths of conventional oil production indicates that even if world oil production does not peak before 2020, output of conventional oil is likely to increase at a substantially slower rate after that date. The implication is that there will have to be increased production of unconventional oil after that date if world petroleum consumption is to grow.

  1. Oil Production

    Energy Science and Technology Software Center (OSTI)


    A horizontal and slanted well model was developed and incorporated into BOAST, a black oil simulator, to predict the potential production rates for such wells. The HORIZONTAL/SLANTED WELL MODEL can be used to calculate the productivity index, based on the length and location of the wellbore within the block, for each reservoir grid block penetrated by the horizontal/slanted wellbore. The well model can be run under either pressure or rate constraints in which wellbore pressuresmore » can be calculated as an option of infinite-conductivity. The model can simulate the performance of multiple horizontal/slanted wells in any geometric combination within reservoirs.« less

  2. Microsoft Word - high-oil-price.doc

    Gasoline and Diesel Fuel Update (EIA)

    Short Term Energy Outlook 1 STEO Supplement: Why are oil prices so high? During most of the 1990s, the West Texas Intermediate (WTI) crude oil price averaged close to $20 per barrel, before plunging to almost $10 per barrel in late 1998 as a result of the Asian financial crisis slowing demand growth while extra supply from Iraq was entering the market for the first time since the Gulf War. Subsequently, as Organization of Petroleum Exporting Countries (OPEC) producers more closely adhered to a

  3. Eco Oil 4

    SciTech Connect (OSTI)

    Brett Earl; Brenda Clark


    This article describes the processes, challenges, and achievements of researching and developing a biobased motor oil.

  4. World Crude Oil Prices

    U.S. Energy Information Administration (EIA) Indexed Site

    World Crude Oil Prices (Dollars per Barrel) The data on this page are no longer available.

  5. Costs of U.S. Oil Dependence: 2005 Update

    SciTech Connect (OSTI)

    Greene, D.L.


    For thirty years, dependence on oil has been a significant problem for the United States. Oil dependence is not simply a matter of how much oil we import. It is a syndrome, a combination of the vulnerability of the U.S. economy to higher oil prices and oil price shocks and a concentration of world oil supplies in a small group of oil producing states that are willing and able to use their market power to influence world oil prices. Although there are vitally important political and military dimensions to the oil dependence problem, this report focuses on its direct economic costs. These costs are the transfer of wealth from the United States to oil producing countries, the loss of economic potential due to oil prices elevated above competitive market levels, and disruption costs caused by sudden and large oil price movements. Several enhancements have been made to methods used in past studies to estimate these costs, and estimates of key parameters have been updated based on the most recent literature. It is estimated that oil dependence has cost the U.S. economy $3.6 trillion (constant 2000 dollars) since 1970, with the bulk of the losses occurring between 1979 and 1986. However, if oil prices in 2005 average $35-$45/bbl, as recently predicted by the U.S. Energy Information Administration, oil dependence costs in 2005 will be in the range of $150-$250 billion. Costs are relatively evenly divided between the three components. A sensitivity analysis reflecting uncertainty about all the key parameters required to estimate oil dependence costs suggests that a reasonable range of uncertainty for the total costs of U.S. oil dependence over the past 30 years is $2-$6 trillion (constant 2000 dollars). Reckoned in terms of present value using a discount rate of 4.5%, the costs of U.S. oil dependence since 1970 are $8 trillion, with a reasonable range of uncertainty of $5 to $13 trillion.

  6. 2013 Vehicle Technologies Market Report

    SciTech Connect (OSTI)

    Davis, Stacy Cagle; Williams, Susan E; Boundy, Robert Gary; Moore, Sheila A


    This is the fifth edition of this report, which details the major trends in U.S. light-duty vehicle and medium/heavy truck markets as well as the underlying trends that caused them. This report is supported by the U.S. Department of Energy s (DOE) Vehicle Technologies Office (VTO), and, in accord with its mission, pays special attention to the progress of high-efficiency and alternative-fuel technologies. After opening with a discussion of energy and economics, this report features a section each on the light-duty vehicle and heavy/medium truck markets, and concluding with a section each on technology and policy. The first section on Energy and Economics discusses the role of transportation energy and vehicle markets on a national (and even international) scale. For example, Figures 12 through 14 discuss the connections between global oil prices and U.S. GDP, and Figures 21 and 22 show U.S. employment in the automotive sector. The following section examines Light-Duty Vehicle use, markets, manufacture, and supply chains. Figures 24 through 51 offer snapshots of major light-duty vehicle brands in the U.S. and Figures 56 through 64 examine the performance and efficiency characteristics of vehicles sold. The discussion of Medium and Heavy Trucks offers information on truck sales (Figures 73 through 75) and fuel use (Figures 78 through 81). The Technology section offers information on alternative fuel vehicles and infrastructure (Figures 84 through 95), and the Policy section concludes with information on recent, current, and near-future Federal policies like the Corporate Average Fuel Economy standard (Figures 106 through 110). In total, the information contained in this report is intended to communicate a fairly complete understanding of U.S. highway transportation energy through a series of easily digestible nuggets.

  7. The Outlook for U.S. Oil Dependence

    SciTech Connect (OSTI)

    Greene, D.L.


    Market share OPEC lost in defending higher prices from 1979-1985 is being steadily regained and is projected to exceed 50% by 2000. World oil markets are likely to be as vulnerable to monopoly influence as they were 20 years ago, as OPEC regains lost market share. The US economy appears to be as exposed as it was in the early 1970s to losses from monopoly oil pricing. A simulated 2-year supply reduction in 2005-6 boosts OPEC revenues by roughly half a trillion dollars and costs the US economy an approximately equal amount. The Strategic Petroleum Reserve appears to be of little benefit against such a determined, multi-year supply curtailment either in reducing OPEC revenues or protecting the US economy. Increasing the price elasticity of oil demand and supply in the US and the rest of the world, however, would be an effective strategy.

  8. Implications of lifting the ban on the export of Alaskan crude oil

    SciTech Connect (OSTI)

    Not Available


    Present legislation effectively bans the export of crude oil produced in the United States. The ban has been in effect for years and is particularly stringent with respect to crude oil produced in Alaska, particularly on the North Slope. The Alaska crude export ban is specifically provided for in the Trans-Alaska Pipeline Authorization Act of 1973 and in other legislation. It was imposed for two reasons. The first was to reduce US dependence on imported crude oil. The Arab oil embargo had been imposed shortly before the Act was passed and a greater measure of energy independence was considered imperative at that time. The second reason was to assure that funds expended in building an Alaskan pipeline would benefit domestic users rather than simply employed to facilitate shipments to other countries. The main objective of this report is to estimate the potential impacts on crude oil prices that would result from lifting the export ban Alaskan crude oil. The report focuses on the Japanese market and the US West Coast market. Japan is the principal potential export market for Alaskan crude oil. Exports to that market would also affect the price of Alaskan crude oil as well as crude oil and product prices on the West Coast and the volume of petroleum imported in that area. 3 figs., 8 tabs.

  9. Upgrading of Biomass Fast Pyrolysis Oil (Bio-oil) Presentation...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Upgrading of Biomass Fast Pyrolysis Oil (Bio-oil) March 22, 2015 Bio-Oil Technology Area Review Principal Investigator : Zia Abdullah Organization: Battelle Memorial Institute 1 ...

  10. ,"Total Fuel Oil Consumption (trillion Btu)",,,,,"Fuel Oil Energy...

    U.S. Energy Information Administration (EIA) Indexed Site

    A. Fuel Oil Consumption (Btu) and Energy Intensities by End Use for All Buildings, 2003" ,"Total Fuel Oil Consumption (trillion Btu)",,,,,"Fuel Oil Energy Intensity (thousand Btu...

  11. Proceedings of the 1998 oil heat technology conference

    SciTech Connect (OSTI)

    McDonald, R.J.


    The 1998 Oil Heat Technology Conference was held on April 7--8 at Brookhaven National Laboratory (BNL) under sponsorship by the US Department of Energy, Office of Building Technologies, State and Community Programs (DOE/BTS). The meeting was held in cooperation with the Petroleum Marketers Association of America (PMAA). Fourteen technical presentations was made during the two-day program, all related to oil-heat technology and equipment, these will cover a range of research, developmental, and demonstration activities being conducted within the United States and Canada, including: integrated oil heat appliance system development in Canada; a miniature heat-actuated air conditioner for distributed space conditioning; high-flow fan atomized oil burner (HFAB) development; progress in the development of self tuning oil burners; application of HFAB technology to the development of a 500 watt; thermophotovoltaic (TPV) power system; field tests of the Heat Wise Pioneer oil burner and Insight Technologies AFQI; expanded use of residential oil burners to reduce ambient ozone and particulate levels by conversion of electric heated homes to oilheat; PMAA`s Oil Heat Technician`s Manual (third edition); direct venting concept development; evolution of the chimney; combating fuel related problems; the effects of red dye and metal contamination on fuel oil stability; new standard for above ground and basement residential fuel oil storage; plastic and steel composite secondary contained tanks; and money left on the table: an economic analysis of tank cleaning.

  12. Process for Converting Algal Oil to Alternative Aviation Fuel - Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Innovation Portal Process for Converting Algal Oil to Alternative Aviation Fuel Los Alamos National Laboratory Contact LANL About This Technology The conversion process uses a Kolbe-based method of converting the fatty acids from the algal lipid triglycerides to fuel. The conversion process uses a Kolbe-based method of converting the fatty acids from the algal lipid triglycerides to fuel. Technology Marketing Summary Conversion of triglyceride oils extracted from algae-derived lipids into

  13. Clean Markets | Open Energy Information

    Open Energy Info (EERE)

    Markets Jump to: navigation, search Name: Clean Markets Place: Philadelphia, Pennsylvania Zip: 19118 Sector: Services Product: Philadelphia-based provider of market development...

  14. Going Global: Tight Oil Production

    U.S. Energy Information Administration (EIA) Indexed Site

    ... Thin target zone Disconnected target zones Controlled fractures GOING GLOBAL: TIGHT OIL PRODUCTION Tight Oil has Significant Energy Security Impacts Tight oil production growth ...

  15. Oil supply increase due in 1996`s second half

    SciTech Connect (OSTI)

    Beck, R.J.


    The crucial oil-market issue for this year`s second half is new supply. Production will increase again outside the Organization of Petroleum Exporting Countries. And Iraq has general approval to resume exports under limits set by the United Nations, although start of the exports has been delayed by at least 60 days. The big question is the market`s ability to absorb the supply gains. As usual, the market`s need for oil in the second half will depend on economies. So far in 1996, economic growth has pushed consumption to levels unexpected a year ago. Demand the rest of the year depends heavily on economic performances of the industrialized nations that make up the organization for Economic Cooperation and Development (OECD) and the rapidly growing nations of the Asia-Pacific region. Growth in countries elsewhere in the developing world, especially Latin America, remains a wild card. The paper discusses the worldwide outlook, crude oil prices, US product prices, natural gas prices, US economy, US energy demand, natural gas in the US, US oil demand, gasoline prices, distillate gains, resid slumps, LPG, ethane, US supply, production patterns, rise in refinery capacity, imports, stocks, and stock coverage.


    SciTech Connect (OSTI)



    The 1998 Oil Heat Technology Conference will be held on April 7--8 at Brookhaven National Laboratory (BNL) under sponsorship by the US Department of Energy, Office of Building Technologies, State and Community Programs (DOE/BTS). The meeting will be held in cooperation with the Petroleum Marketers Association of America (PMAA). The 1998 Oil Heat Technology Conference, will be the twelfth since 1984, is an important technology transfer activity and is supported by the ongoing Combustion Equipment Technology (Oilheat R and D) program at BNL. The reason for the conference is to provide a forum for the exchange of information and perspectives among international researchers, engineers, manufacturers and marketers of oil-fired space-conditioning equipment. They will provide a channel by which information and ideas can be exchanged to examine present technologies, as well as helping to develop the future course for oil heating advancement. These conferences also serve as a stage for unifying government representatives, researchers, fuel oil marketers, and other members of the oil-heat industry in addressing technology advancements in this important energy use sector. The specific objectives of the Conference are to: (1) Identify and evaluate the current state-of-the-art and recommend new initiatives for higher efficiency, a cleaner environment, and to satisfy consumer needs cost-effectively, reliably, and safely; and (2) Foster cooperative interactions among federal and industrial representatives for the common goal of sustained economic growth and energy security via energy conservation.

  17. World Bio Markets

    Broader source: [DOE]

    Held in Amsterdam, Netherlands, the 10th anniversary World Bio Markets convened from March 1– 4, 2015.

  18. Oil and gas development in East Siberia

    SciTech Connect (OSTI)

    Sagers, M.J.


    The East Siberian region, which comprises nearly 43% of Russia`s territory (including the Sakha (Yakut) republic), has substantial hydrocarbon potential that is impeded by significant logistical problems, the daunting physical environment, and technical challenges posed by the geological complexity of the region. The area`s three major oil and gas provinces are the Lena-Tunguska (with the greatest potential), Lena-Vilyuy, and Yenisey-Anabar. The paper focuses on assessment of reserves, production potential, and history, as well as joint-venture activity involving foreign capital. Foreign investment is targeting gas deposits in the Vilyuy basin and elsewhere in the Sakha republic and small oil deposits serving local markets in the Yakutsk and Noril`sk areas. Forecasts do not envisage substantial production of oil from the region before the year 2010. Future gas production levels are less predictable despite the ambitious plans to export gas from Sakha to South Korea. 14 refs., 1 fig., 1 tab.

  19. The United States remains unprepared for oil import disruptions. Volume I. summary: includes conclusions and recommendations. Report to the Congress

    SciTech Connect (OSTI)

    Not Available


    The U.S. Government is almost totally unprepared to deal with disruptions in oil imports. Oil import disruptions--such as the 1973 oil embargo and the 1979 Iranian shortfall--pose a significant threat to national security, and the lack of effective contingency planning and program development to data is serious and requires immediate attention. The Government must make a determined commitment to emergency preparedness now, while oil markets are slack, to prepare for any future disruption.

  20. Second AEO2014 Oil and Gas Working Group Meeting Summary

    U.S. Energy Information Administration (EIA) Indexed Site


  1. First AEO2015 Oil and Gas Working Group Meeting Summary

    U.S. Energy Information Administration (EIA) Indexed Site


  2. EIA model documentation: Documentation of the Oil and Gas Supply Module (OGSM)

    SciTech Connect (OSTI)


    The purpose of this report is to define the objectives of the Oil and Gas Supply Model (OGSM), to describe the model`s basic approach, and to provide detail on how the model works. This report is intended as a reference document for model analysts, users, and the public. Projected production estimates of US crude oil and natural gas are based on supply functions generated endogenously within National Energy Modeling System (NEMS) by the OGSM. OGSM encompasses domestic crude oil and natural gas supply by both conventional and nonconventional recovery techniques. Nonconventional recovery includes enhanced oil recovery (EOR), and unconventional gas recovery (UGR) from tight gas formations, Devonian shale and coalbeds. Crude oil and natural gas projects are further disaggregated by geographic region. OGSM projects US domestic oil and gas supply for six Lower 48 onshore regions, three offshore regions, and Alaska. The general methodology relies on forecasted drilling expenditures and average drilling costs to determine exploratory and developmental drilling levels for each region and fuel type. These projected drilling levels translate into reserve additions, as well as a modification of the production capacity for each region. OGSM also represents foreign trade in natural gas, imports and exports by entry region.

  3. Apparatus for distilling shale oil from oil shale

    SciTech Connect (OSTI)

    Shishido, T.; Sato, Y.


    An apparatus for distilling shale oil from oil shale comprises: a vertical type distilling furnace which is divided by two vertical partitions each provided with a plurality of vent apertures into an oil shale treating chamber and two gas chambers, said oil shale treating chamber being located between said two gas chambers in said vertical type distilling furnace, said vertical type distilling furnace being further divided by at least one horizontal partition into an oil shale distilling chamber in the lower part thereof and at least one oil shale preheating chamber in the upper part thereof, said oil shale distilling chamber and said oil shale preheating chamber communication with each other through a gap provided at an end of said horizontal partition, an oil shale supplied continuously from an oil shale supply port provided in said oil shale treating chamber at the top thereof into said oil shale treating chamber continuously moving from the oil shale preheating chamber to the oil shale distilling chamber, a high-temperature gas blown into an oil shale distilling chamber passing horizontally through said oil shale in said oil shale treating chamber, thereby said oil shale is preheated in said oil shale preheating chamber, and a gaseous shale oil is distilled from said preheated oil shale in said oil shale distilling chamber; and a separator for separating by liquefaction a gaseous shale oil from a gas containing the gaseous shale oil discharged from the oil shale preheating chamber.

  4. Microdrill Initiative - Initial Market Evaluation

    SciTech Connect (OSTI)

    Spears & Associates, Inc


    The U.S. Department of Energy (DOE) is launching a major research and development initiative to create a small, fast, inexpensive and environmentally friendly rig for drilling 5000 feet boreholes to investigate potential oil and gas reservoirs. DOE wishes to get input from petroleum industry operators, service companies and equipment suppliers on the operation and application of this coiled-tubing-based drilling unit. To that end, DOE has asked Spears & Associates, Inc. (SAI) to prepare a special state-of-the-market report and assist during a DOE-sponsored project-scoping workshop in Albuquerque near the end of April 2003. The scope of the project is four-fold: (1) Evaluate the history, status and future of demand for very small bore-hole drilling; (2) Measure the market for coiled tubing drilling and describe the state-of-the-art; (3) Identify companies and individuals who should have an interest in micro drilling and invite them to the DOE workshop; and (4) Participate in 3 concurrent workshop sessions, record and evaluate participant comments and report workshop conclusions.

  5. OPEC: 10 years after the Arab oil boycott

    SciTech Connect (OSTI)

    Cooper, M.H.


    OPEC's dominance over world oil markets is waning 10 years after precipitating world-wide energy and economic crises. The 1979 revolution in Iran and the start of the Iranian-Iraqi war in 1980 introduced a second shock that caused oil importers to seek non-OPEC supplies and emphasize conservation. No breakup of the cartel is anticipated, however, despite internal disagreements over production and price levels. Forecasters see OPEC as the major price setter as an improved economy increases world demand for oil. Long-term forecasts are even more optimistic. 24 references, 2 figures, 2 tables. (DCK)

  6. Market review - Market values summary/October market review/current market data

    SciTech Connect (OSTI)


    This article is the October 1995 uranium market summary. In this reporting period, there were four transactions in the natural uranium market, no activity in the spot UF6 market, no activity in the spot conversion market, and only a single activity in the enrichment services market. Spot uranium volume dropped sharply, and active uranium supply rose. The rise in demand, however, more than offset this increase. Unrestricted exchange prices rose slightly, as did the unrestricted UF6 value. All other prices remained steady.

  7. 2011 Vehicle Technologies Market Report

    SciTech Connect (OSTI)

    Davis, Stacy Cagle; Boundy, Robert Gary; Diegel, Susan W


    This report details the major trends in U.S. light-duty vehicle and medium/heavy truck markets as well as the underlying trends that caused them. This report is supported by the U.S. Department of Energy s (DOE) Vehicle Technologies Program (VTP), and, in accord with its mission, pays special attention to the progress of high-efficiency and alternative-fuel technologies. This third edition since this report was started in 2008 offers several marked improvements relative to its predecessors. Most significantly, where earlier editions of this report focused on supplying information through an examination of market drivers, new vehicle trends, and supplier data, this edition uses a different structure. After opening with a discussion of energy and economics, this report features a section each on the light-duty vehicle and heavy/medium truck markets, and concluding with a section each on technology and policy. In addition to making this sectional re-alignment, this year s edition of the report also takes a different approach to communicating information. While previous editions relied heavily on text accompanied by auxiliary figures, this third edition relies primarily on charts and graphs to communicate trends. Any accompanying text serves to introduce the trends communication by the graphic and highlight any particularly salient observations. The opening section on Energy and Economics discusses the role of transportation energy and vehicle markets on a national (and even international) scale. For example, Figures 11 through 13 discuss the connections between global oil prices and U.S. GDP, and Figures 20 and 21 show U.S. employment in the automotive sector. The following section examines Light-Duty Vehicle use, markets, manufacture, and supply chains. Figures 26 through 33 offer snapshots of major light-duty vehicle brands in the U.S. and Figures 38 through 43 examine the performance and efficiency characteristics of vehicles sold. The discussion of Medium and Heavy Trucks offers information on truck sales (Figures 58 through 61) and fuel use (Figures 64 through 66). The Technology section offers information on alternative fuel vehicles and infrastructure (Figures 68 through 77), and the Policy section concludes with information on recent, current, and near-future Federal policies like the Cash for Clunkers program (Figures 87 and 88) and the Corporate Automotive Fuel Economy standard (Figures 90 through 99) and. In total, the information contained in this report is intended to communicate a fairly complete understanding of U.S. highway transportation energy through a series of easily digestible nuggets.

  8. Fuel Oil Use in Manufacturing

    U.S. Energy Information Administration (EIA) Indexed Site

    logo Return to: Manufacturing Home Page Fuel Oil Facts Oil Price Effect Fuel Switching Actual Fuel Switching Storage Capacity Fuel Oil Use in Manufacturing Why Look at Fuel Oil?...

  9. Learning to live with OPEC oil: the Arab view

    SciTech Connect (OSTI)

    Not Available


    Either OPEC or a similar Middle East organizaiton will recapture the dominant role in oil market as non-OPEC oil sources are depleted. An interview with Ali Ahmed Attiga of the Organization of Arab Petroleum Exporting Countries (OAPEC) suggests the possibility of another embargo, but emphasizes the common bond that both oil-importing and oil-exporting countries have if they become over-dependent on oil. Attiga points out that OAPEC will produce 40% of the energy consumed at the end of 10 years. He credits the 1973 embargo with reminding the US of its vital interest in the Arab world, but admits it did not accomplish the withdrawal of Israel from occupied territory. In response to other questions Attiga doubts other producers will join OPEC, explains OPEC pricing and production policies, and describes its development programs. 1 figure.

  10. Fact #579: July 13, 2009 Oil Price and Economic Growth, 1970-2008

    Broader source: [DOE]

    Major oil price shocks have disrupted world energy markets five times in the past 30 years – 1973-74, 1979-80, 1990-1991, 1999-2000 and again in 2008. Most of the oil price shocks were followed by...

  11. South American oil

    SciTech Connect (OSTI)

    Not Available


    GAO reviewed the petroleum industries of the following eight South American Countries that produce petroleum but are not major exporters: Argentina, Bolivia, Brazil, Chile, Colombia, Ecuador, Peru, and Trinidad and Tobago. This report discusses the amount of crude oil the United States imports from the eight countries, expected crude oil production for these countries through the year 2010, and investment reforms that these countries have recently made in their petroleum industries. In general, although the United States imports some oil from these countries, as a group, the eight countries are currently net oil importers because combined domestic oil consumption exceeds oil production. Furthermore, the net oil imports are expected to continue to increase through the year 2010, making it unlikely that the United States will obtain increased oil shipments from these countries.

  12. Sound Oil Company

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Ward Oil Co., 24 DOE 81,002 (1994); see also Belcher Oil Co., 15 DOE 81,018 (1987) ... months relief because of flood); Utilities Bd. of Citronelle-Gas, 4 DOE 81,205 (1979) ...

  13. Residential heating oil price

    U.S. Energy Information Administration (EIA) Indexed Site

    heating oil price decreases The average retail price for home heating oil fell 7.5 cents from a week ago to 2.84 per gallon. That's down 1.22 from a year ago, based on the ...

  14. Residential heating oil price

    U.S. Energy Information Administration (EIA) Indexed Site

    heating oil price decreases The average retail price for home heating oil fell 7.6 cents from a week ago to 2.97 per gallon. That's down 1.05 from a year ago, based on the ...

  15. Residential heating oil price

    U.S. Energy Information Administration (EIA) Indexed Site

    heating oil price decreases The average retail price for home heating oil fell 3.6 cents from a week ago to 3.04 per gallon. That's down 99.4 cents from a year ago, based on the ...

  16. Residential heating oil price

    U.S. Energy Information Administration (EIA) Indexed Site

    heating oil price decreases The average retail price for home heating oil fell 6.3 cents from a week ago to 2.91 per gallon. That's down 1.10 from a year ago, based on the ...

  17. DOE Science Showcase - Oil Shale Research | OSTI, US Dept of Energy, Office

    Office of Scientific and Technical Information (OSTI)

    of Scientific and Technical Information Oil Shale Research Oil shale has been recognized as a potentially valuable U.S. energy resource for a century. Obstacles to its use have included the expense of current shale-oil production technologies and their effects on our environment. The energy landscape is evolving. Technology has advanced, global economic, political, and market conditions have changed and the regulatory landscape has matured. Recent efforts to realize the potential of this

  18. Vegetable oils for tractors

    SciTech Connect (OSTI)

    Moroney, M.


    Preliminary tests by the Agricultural Institute, show that tractors can be run on a 50:50 rape oil-diesel mixture or on pure rape oil. In fact, engine power actually increased slightly with the 50:50 blend but decreased fractionally with pure rape oil. Research at the North Dakota State University on using sunflower oil as an alternative to diesel fuel is also noted.

  19. SRC residual fuel oils

    SciTech Connect (OSTI)

    Tewari, K.C.; Foster, E.P.


    Coal solids (SRC) and distillate oils are combined to afford single-phase blends of residual oils which have utility as fuel oils substitutes. The components are combined on the basis of their respective polarities, that is, on the basis of their heteroatom content, to assure complete solubilization of SRC. The resulting composition is a fuel oil blend which retains its stability and homogeneity over the long term.

  20. SRC Residual fuel oils

    DOE Patents [OSTI]

    Tewari, Krishna C. (Whitehall, PA); Foster, Edward P. (Macungie, PA)


    Coal solids (SRC) and distillate oils are combined to afford single-phase blends of residual oils which have utility as fuel oils substitutes. The components are combined on the basis of their respective polarities, that is, on the basis of their heteroatom content, to assure complete solubilization of SRC. The resulting composition is a fuel oil blend which retains its stability and homogeneity over the long term.

  1. Petroleum Market Model of the National Energy Modeling System. Part 2

    SciTech Connect (OSTI)


    This report contains the following: Bibliography; Petroleum Market Model abstract; Data quality; Estimation methodologies (includes refinery investment recovery thresholds, gas plant models, chemical industry demand for methanol, estimation of refinery fixed costs, estimation of distribution costs, estimation of taxes gasoline specifications, estimation of gasoline market shares, estimation of low-sulfur diesel market shares, low-sulfur diesel specifications, estimation of regional conversion coefficients, estimation of SO{sub 2} allowance equations, unfinished oil imports methodology, product pipeline capacities and tariffs, cogeneration methodology, natural gas plant fuel consumption, and Alaskan crude oil exports); Matrix generator documentation; Historical data processing; and Biofuels supply submodule.

  2. Biochemical upgrading of oils

    DOE Patents [OSTI]

    Premuzic, Eugene T. (East Moriches, NY); Lin, Mow S. (Rocky Point, NY)


    A process for biochemical conversion of heavy crude oils is provided. The process includes contacting heavy crude oils with adapted biocatalysts. The resulting upgraded oil shows, a relative increase in saturated hydrocarbons, emulsions and oxygenates and a decrease in compounds containing in organic sulfur, organic nitrogen and trace metals. Adapted microorganisms which have been modified under challenged growth processes are also disclosed.

  3. Biochemical upgrading of oils

    DOE Patents [OSTI]

    Premuzic, E.T.; Lin, M.S.


    A process for biochemical conversion of heavy crude oils is provided. The process includes contacting heavy crude oils with adapted biocatalysts. The resulting upgraded oil shows, a relative increase in saturated hydrocarbons, emulsions and oxygenates and a decrease in compounds containing organic sulfur, organic nitrogen and trace metals. Adapted microorganisms which have been modified under challenged growth processes are also disclosed. 121 figs.

  4. Program Analyst (Contracting Officer Representative)

    Broader source: [DOE]

    This position reports directly to the Office Director for PBPE. The incumbent of this position analyzes, evaluates and/or advises management on the effectiveness of complex and overarching EIA...

  5. Student Trainee (Energy Industry Analyst)

    Broader source: [DOE]

    Are you seeking challenging assignments working for a dynamic agency while gaining real-world experience? We are looking for the best and brightest to help us shape the future of the energy...

  6. Patricia Hagerty, Aviation Program Analyst

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    United States. Pat has two bachelor's degrees from the University of Montana; she is a certified general aviation private pilot and a Vietnam Era Veteran of the U.S. Coast Guard.

  7. EIA model documentation: Petroleum Market Model of the National Energy Modeling System

    SciTech Connect (OSTI)


    The purpose of this report is to define the objectives of the Petroleum Market Model (PMM), describe its basic approach, and provide detail on how it works. This report is intended as a reference document for model analysts, users, and the public. Documentation of the model is in accordance with EIA`s legal obligation to provide adequate documentation in support of its models (Public Law 94-385, section 57.b.2). The PMM models petroleum refining activities, the marketing of products, the production of natural gas liquids and domestic methanol, projects petroleum provides and sources of supplies for meeting demand. In addition, the PMM estimates domestic refinery capacity expansion and fuel consumption.

  8. Utah Heavy Oil Program

    SciTech Connect (OSTI)

    J. Bauman; S. Burian; M. Deo; E. Eddings; R. Gani; R. Goel; C.K. Huang; M. Hogue; R. Keiter; L. Li; J. Ruple; T. Ring; P. Rose; M. Skliar; P.J. Smith; J.P. Spinti; P. Tiwari; J. Wilkey; K. Uchitel


    The Utah Heavy Oil Program (UHOP) was established in June 2006 to provide multidisciplinary research support to federal and state constituents for addressing the wide-ranging issues surrounding the creation of an industry for unconventional oil production in the United States. Additionally, UHOP was to serve as an on-going source of unbiased information to the nation surrounding technical, economic, legal and environmental aspects of developing heavy oil, oil sands, and oil shale resources. UHOP fulGilled its role by completing three tasks. First, in response to the Energy Policy Act of 2005 Section 369(p), UHOP published an update report to the 1987 technical and economic assessment of domestic heavy oil resources that was prepared by the Interstate Oil and Gas Compact Commission. The UHOP report, entitled 'A Technical, Economic, and Legal Assessment of North American Heavy Oil, Oil Sands, and Oil Shale Resources' was published in electronic and hard copy form in October 2007. Second, UHOP developed of a comprehensive, publicly accessible online repository of unconventional oil resources in North America based on the DSpace software platform. An interactive map was also developed as a source of geospatial information and as a means to interact with the repository from a geospatial setting. All documents uploaded to the repository are fully searchable by author, title, and keywords. Third, UHOP sponsored Give research projects related to unconventional fuels development. Two projects looked at issues associated with oil shale production, including oil shale pyrolysis kinetics, resource heterogeneity, and reservoir simulation. One project evaluated in situ production from Utah oil sands. Another project focused on water availability and produced water treatments. The last project considered commercial oil shale leasing from a policy, environmental, and economic perspective.

  9. US Crude oil exports

    U.S. Energy Information Administration (EIA) Indexed Site

    2014 EIA Energy Conference U.S. Crude Oil Exports July 14, 2014 By Lynn D. Westfall U.S. Energy Information Administration U.S. crude oil production has grown by almost 50% since 2008 and is up by 1.0 million b/d (14%) since April of 2013 U.S. crude oil production million barrels of oil per day Source: U.S. Energy Information Administration Lynn Westfall, 2014 EIA Energy Conference, U.S. Crude Oil Exports, July 14, 2014 2 0 2 4 6 8 10 12 1970 1972 1974 1976 1978 1980 1982 1984 1986 1988 1990

  10. Market Allocation (MARKAL) Model

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    MARket ALlocation (MARKAL) Model (International Energy Agency) Objectives Integrates hydrogen production, delivery and vehicle components for cost-benefit analysis and policy analysis and determines a market equilibrium solution. Key Attributes & Strengths Analysis is conducted in the context of overall U.S. energy supply and demand. The model incorporates learning curves and scale economies for cost analysis, and identifies major barriers to the market penetration of alternative vehicle

  11. World Bio Markets

    Broader source: [DOE]

    The World Bio Markets meeting will held from March 14-17, 2016 in Amsterdam, Netherlands. The meeting will gather experts in the bioenergy industry from all over the world. Bioenergy Technologies Office Demonstration and Market Transformation Program Manager Jim Spaeth will be giving a presentation entitled, “Policy updates and outlooks from key biofuel markets,” and will discuss technical, policy and investment developments, and success stories.

  12. Agricultural Marketing Toolkit

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Agricultural-Marketing-Toolkit Sign In About | Careers | Contact | Investors | Search Policy & Reporting Expand Policy & Reporting EE Sectors Expand EE Sectors...

  13. BPA Marketing Portal

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    BPA-Marketing-Portal Sign In About | Careers | Contact | Investors | Search Policy & Reporting Expand Policy & Reporting EE Sectors Expand EE Sectors Technology &...

  14. Commercial Marketing Toolkit

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Commercial-Marketing-Toolkit Sign In About | Careers | Contact | Investors | Search Policy & Reporting Expand Policy & Reporting EE Sectors Expand EE Sectors Technology...

  15. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    on Form EIA-782A, "Refi ners'Gas Plant Operators' Monthly Petroleum Product Sales Report." U.S. Energy Information Administration | Petroleum Marketing Monthly 27 May 2016

  16. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    U.S. Refi ner retail petroleum product volumes U.S. Energy Information Administration | Petroleum Marketing Monthly 9 May 2016

  17. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... on Form EIA-782A, "Refi ners'Gas Plant Operators' Monthly Petroleum Product Sales Report." U.S. Energy Information Administration | Petroleum Marketing Monthly 6 May 2016

  18. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... on Form EIA-782A, "Refi ners'Gas Plant Operators' Monthly Petroleum Product Sales Report." U.S. Energy Information Administration | Petroleum Marketing Monthly 10 May 2016

  19. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    on Administra on Form EIA-782A, "Refi ners'Gas Plant Operators' Monthly Petroleum Product Sales Report." U.S. Energy Information Administration | Petroleum Marketing Monthly 90

  20. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... on Form EIA-782A, "Refi ners'Gas Plant Operators' Monthly Petroleum Product Sales Report." U.S. Energy Information Administration | Petroleum Marketing Monthly 12 May 2016

  1. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    U.S. Refi ner retail petroleum product prices U.S. Energy Information Administration | Petroleum Marketing Monthly 7 May 2016

  2. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... on Form EIA-782A, "Refi ners'Gas Plant Operators' Monthly Petroleum Product Sales Report." U.S. Energy Information Administration | Petroleum Marketing Monthly 8 May 2016

  3. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    ... on Form EIA-782A, "Refi ners'Gas Plant Operators' Monthly Petroleum Product Sales Report." U.S. Energy Information Administration | Petroleum Marketing Monthly 26 May 2016

  4. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    U.S. Refi ner wholesale petroleum product volumes U.S. Energy Information Administration | Petroleum Marketing Monthly 13 May 20

  5. Petroleum Marketing Monthly

    U.S. Energy Information Administration (EIA) Indexed Site

    tration, Form EIA-782A, "Refi ners'Gas Plant Operators' Monthly Petroleum Product Sales Report." U.S. Energy Information Administration | Petroleum Marketing Monthly 28 May 2016

  6. Market Transformation Fact Sheet

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Adoption of fuel cells in emerging markets expands the growth of green jobs, with new opportunities in manufacturing, fuel cell maintenance and support systems, and domestic ...

  7. One Market Plaza

    SciTech Connect (OSTI)


    This is a combined heat and power (CHP) project profile on a 1.5 MW CHP system at One Market Plaza in San Francisco, California.

  8. Market Acceleration (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available


    The fact sheet summarizes the goals and activities of the DOE Solar Energy Technologies Program efforts within its market acceleration subprogram.

  9. Navigant Market Report 2014

    Energy Savers [EERE]

    2014 Annual Market Assessment Prepared for: U.S. Department of Energy Client Contact Michael Hahn, Patrick Gilman Award Number DE-EE0005360 Navigant Consulting, Inc. 77 Bedford Street Suite 400 Burlington, MA 01803-5154 781.270.8314 September 8, 2014 Offshore Wind Market and Economic Analysis Page ii Document Number DE-EE0005360 U.S. Offshore Wind Market and Economic Analysis 2014 Annual Market Assessment Document Number DE-EE0005360 Prepared for: U.S. Department of Energy

  10. Market Drivers for Biofuels

    Broader source: [DOE]

    This presentation, entitled "Market Drivers for Biofuels," was given at the Third Annual MSW to Biofuels Summit in February, 2013, by Brian Duff.

  11. North American Natural Gas Markets. Volume 1

    SciTech Connect (OSTI)

    Not Available


    This report sunnnarizes the research by an Energy Modeling Forum working group on the evolution of the North American natural gas markets between now and 2010. The group`s findings are based partly on the results of a set of economic models of the natural gas industry that were run for four scenarios representing significantly different conditions: two oil price scenarios (upper and lower), a smaller total US resource base (low US resource case), and increased potential gas demand for electric generation (high US demand case). Several issues, such as the direction of regulatory policy and the size of the gas resource base, were analyzed separately without the use of models.

  12. North American Natural Gas Markets. Volume 2

    SciTech Connect (OSTI)

    Not Available


    This report summarizes die research by an Energy Modeling Forum working group on the evolution of the North American natural gas markets between now and 2010. The group`s findings are based partly on the results of a set of economic models of the natural gas industry that were run for four scenarios representing significantly different conditions: two oil price scenarios (upper and lower), a smaller total US resource base (low US resource case), and increased potential gas demand for electric generation (high US demand case). Several issues, such as the direction of regulatory policy and the size of the gas resource base, were analyzed separately without the use of models.

  13. Proceedings of the 1993 oil heat technology conference and workshop

    SciTech Connect (OSTI)

    McDonald, R.J.


    This report documents the proceedings of the 1993 Oil Heat Technology Conference and Workshop, held on March 25--26 at Brookhaven National Laboratory (BNL), and sponsored by the US Department of Energy - Office of Building Technologies (DOE-OBT), in cooperation with the Petroleum Marketers Association of America. This Conference, which was the seventh held since 1984, is a key technology-transfer activity supported by the ongoing Combustion Equipment Technology (Oil-Heat R&D) program at BNL, and is aimed at providing a forum for the exchange of information among international researchers, engineers, manufacturers, and marketers of oil-fired space- conditioning equipment. Selected papers have been processed separately for inclusion in the Energy Science and Technology Database.

  14. Energy and Financial Markets Overview: Crude Oil Price Formation

    U.S. Energy Information Administration (EIA) Indexed Site

    John Maples 2011 EIA Energy Conference April 26, 2011 Transportation and the Environment Light-duty vehicle combined Corporate Average Fuel Economy Standards (CAFE) in three cases, 2005-2035 2 0 20 40 60 80 2005 2010 2015 2020 2025 2030 2035 miles per gallon Source: EIA, Annual Energy Outlook 2011 CAFE6 CAFE3 Reference John Maples, April 26, 2011 Light-duty vehicle delivered energy consumption and total transportation carbon dioxide emissions, 2005-2035 3 0 5 10 15 20 2005 2010 2015 2020 2025

  15. Energy and Financial Markets Overview: Crude Oil Price Formation

    Gasoline and Diesel Fuel Update (EIA)

    Energy Production and Trade: An Overview of Some Macroeconomic Issues Vipin Arora November 2014 Independent Statistics & Analysis U.S. Energy Information Administration Washington, DC 20585 This paper is released to encourage discussion and critical comment. The analysis and conclusions expressed here are those of the authors and not necessarily those of the U.S. Energy Information Administration. WORKING PAPER SERIES November 2014 Vipin Arora | U.S. Energy Information

  16. Notes from Financial and Physical Oil Market Linkages

    Gasoline and Diesel Fuel Update (EIA)

    13,352.4 12,748.2 12,503.0 11,795.7 12,204.5 12,694.8 1983-2016 East Coast (PADD 1) 2,101.0 2,145.8 1,954.0 1,882.0 1,899.2 2,116.4 1983-2016 New England (PADD 1A) 35.9 36.9 33.5 32.8 31.1 32.5 1983-2016 Connecticut W W W W W W 1983-2016 Maine - - - - - - 1983-2016 Massachusetts 25.4 26.2 W W W W 1983-2016 New Hampshire W W W W W W 1983-2016 Rhode Island W W W W W W 1983-2016 Vermont W W W W W W 1983-2016 Central Atlantic (PADD 1B) 647.4 723.3 614.4 579.1 592.3 690.1 1983-2016 Delaware W W W W W

  17. Crude Oil Analysis Database

    DOE Data Explorer [Office of Scientific and Technical Information (OSTI)]

    Shay, Johanna Y.

    The composition and physical properties of crude oil vary widely from one reservoir to another within an oil field, as well as from one field or region to another. Although all oils consist of hydrocarbons and their derivatives, the proportions of various types of compounds differ greatly. This makes some oils more suitable than others for specific refining processes and uses. To take advantage of this diversity, one needs access to information in a large database of crude oil analyses. The Crude Oil Analysis Database (COADB) currently satisfies this need by offering 9,056 crude oil analyses. Of these, 8,500 are United States domestic oils. The database contains results of analysis of the general properties and chemical composition, as well as the field, formation, and geographic location of the crude oil sample. [Taken from the Introduction to COAMDATA_DESC.pdf, part of the zipped software and database file at] Save the zipped file to your PC. When opened, it will contain PDF documents and a large Excel spreadsheet. It will also contain the database in Microsoft Access 2002.

  18. 200 Market Building

    High Performance Buildings Database

    Portland, Oregon The 200 Market Building is a high-rise built in 1973 and located in downtown Portland, Oregon. It was purchased in 1988 by its current owner, 200 Market Associates, primarily because of its optimal location in Portland's central business district. Since 1989 the building has undergone continuous improvements in multiple phases.

  19. Marketing Transformation (Fact Sheet)

    SciTech Connect (OSTI)

    DOE Solar Energy Technologies Program


    Through the SunShot Initiative, the U.S. Department of Energy (DOE) works with manufacturers, communities, states, utilities, and other partners to enable the solar market by reducing non-hardware balance-of-system (BOS) costs, developing a skilled workforce, and eliminating market barriers to widespread adoption of solar technologies.

  20. Deployment & Market Transformation (Brochure)

    SciTech Connect (OSTI)

    Not Available


    NREL's deployment and market transformation (D and MT) activities encompass the laboratory's full range of technologies, which span the energy efficiency and renewable energy spectrum. NREL staff educates partners on how they can advance sustainable energy applications and also provides clients with best practices for reducing barriers to innovation and market transformation.

  1. High temperature solar thermal technology: The North Africa Market

    SciTech Connect (OSTI)

    Not Available


    High temperature solar thermal (HTST) technology offers an attractive option for both industrialized and non-industrialized countries to generate electricity and industrial process steam. The purpose of this report is to assess the potential market for solar thermal applications in the North African countries of Algeria, Egypt, Morocco and Tunisia. North Africa was selected because of its outstanding solar resource base and the variety of applications to be found there. Diminishing oil and gas resources, coupled with expanding energy needs, opens a large potential market for the US industry. The US high temperature solar trough industry has little competition globally and could build a large market in these areas. The US is already familiar with certain solar markets in North Africa due to the supplying of substantial quantities of US-manufactured flat plate collectors to this region.

  2. Crude Oil Characteristics Research

    Broader source: [DOE]

    The Department of Energy Office of Fossil Energy is continuing to develop a better understanding of scientific questions associated with the production, treatment, and rail transportation of crude oils, including Bakken crude oil. To support this effort, the DOE - in collaboration with the Department of Transportation’s Pipeline and Hazardous Materials Safety Administration (PHMSA) will focus on the portion of the effort described in the Crude Oil Characteristics Sampling, Analysis and Experiment (SAE) Plan. The work contained in this SAE plan is intended to fill knowledge gaps based on recommendations on research needed to improve understanding of transport-critical crude oil and especially tight crude oil properties from the Literature Survey of Crude Oil Properties Relevant to Handling and Fire Safety in Transport recently completed by Sandia National Laboratory.

  3. Sandia Energy - Past Market Transformation Activities

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Past Market Transformation Activities Home Stationary Power Energy Conversion Efficiency Solar Energy Photovoltaics Solar Market Transformation Past Market Transformation...

  4. World oil - An essay on its spectacular 120-year rise (1859-1979), recent decline, and uncertain future

    SciTech Connect (OSTI)

    Linden, H.R.


    An analysis of the evolution of the oil security problems of import-dependent industrialized countries and of the rise and recent erosion of the market power of the major oil exporting countries, particularly those located in the Persian Gulf area. The counterproductive reaction of the United States and other large oil importers to the resulting oil supply and price instability, especially since the 1973-74 oil embargo, is critiqued. In addition, the synergism between the early commercialization of crude oil production and refining in the United States and the development of the automobile industry is discussed, and the long-term outlook for oil-base transportation fuels is assessed. OPEC's role in destabilizing the world oil market during the 1970s and its current efforts to restabilize it are evaluated, as is the likely future course of world oil prices and of U.S. and other non-OPEC production. An important finding of this study is that the share of oil in the world energy mix has peaked and will continue its downward trend and that recurring expectations for a sharp escalation of world oil prices and shortages are based on erroneous assessments of the fundamentals governing the oil business.

  5. Hot Oiling Spreadsheet

    Energy Science and Technology Software Center (OSTI)


    One of the most common oil-field treatments is hot oiling to remove paraffin from wells. Even though the practice is common, the thermal effectiveness of the process is not commonly understood. In order for producers to easily understand the thermodynamics of hot oiling, a simple tool is needed for estimating downhole temperatures. Such a tool has been developed that can be distributed as a compiled spreadsheet.

  6. Vegetable oil fuel

    SciTech Connect (OSTI)

    Bartholomew, D.


    In this article, the future role of renewable agricultural resources in providing fuel is discussed. it was only during this century that U.S. farmers began to use petroleum as a fuel for tractors as opposed to forage crop as fuel for work animals. Now farmers may again turn to crops as fuel for agricultural production - the possible use of sunflower oil, soybean oil and rapeseed oil as substitutes for diesel fuel is discussed.

  7. Interaction Between Carbon Markets and Renewable Energy Markets (Poster)

    SciTech Connect (OSTI)

    Carroll, G. L.; Milford, J.; Bird, L.


    This poster, submitted for the CU Energy Initiative/NREL Symposium on October 3, 2006 in Boulder, Colorado, discusses the interaction between carbon markets and renewable energy markets.

  8. NETL: Oil & Gas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Oil & Gas Efficient recovery of our nation's fossil fuel resources in an environmentally safe manner requires the development and application of new technologies that address the ...

  9. Refiner Crude Oil Inputs

    U.S. Energy Information Administration (EIA) Indexed Site

    Data Series: Refiner Crude Oil Inputs Refiner Gross Inputs Refiner Operable Capacity ... Download Series History Download Series History Definitions, Sources & Notes Definitions, ...

  10. Oil & Gas Research

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    needed to predict and quantify potential risks associated with oil and gas resources in shale reservoirs that require hydraulic fracturing or other engineering measures to produce. ...

  11. Upgrading heavy gas oils

    SciTech Connect (OSTI)

    Ferguson, S.; Reese, D.D.


    A method is described of neutralizing the organic acidity in heavy gas oils to produce a neutralization number less than 1.0 whereby they are rendered suitable as lube oil feed stocks which consists essentially of treating the heavy gas oils with a neutralizing amount of monoethanolamine to form an amine salt with the organic acids and then heating the thus-neutralized heavy gas oil at a temperature at least about 25/sup 0/F greater than the boiling point of water and for a time sufficient to convert the amine salts to amides.

  12. "2014 Retail Power Marketers Sales- Transportation"

    U.S. Energy Information Administration (EIA) Indexed Site

    "Direct Energy Business Marketing, LLC","DC","Power Marketer",1,148128,930... "Direct Energy Business Marketing, LLC","MD","Power Marketer",2,113058,660...

  13. Creating Market Pathways for Laboratory Research

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site


  14. Department of Energy to Release Oil from the Strategic Petroleum Reserve |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy to Release Oil from the Strategic Petroleum Reserve Department of Energy to Release Oil from the Strategic Petroleum Reserve June 23, 2011 - 12:00am Addthis Washington, DC - U.S. Energy Secretary Steven Chu announced today that the U.S. and its partners in the International Energy Agency have decided to release a total of 60 million barrels of oil onto the world market over the next 30 days to offset the disruption in the oil supply caused by unrest in the Middle East.

  15. Indonesia's Arun LPG plant production is unique in Far East markets

    SciTech Connect (OSTI)

    Naklie, M.M.; Penick, D.P.; Denton, L.A.; Kartiyoso, I.


    Entry of the Arun (Indonesia) LNG plant into the LPG Far East markets is significant because its supplies for those markets are not tied to gas being extracted in association with crude oil. Arun LPG products are extracted from gas that is processed into and marketed as LNG. This article on the Arun LNG plant analyzes its LPG process and the significance of the LPG project on the plant's markets. Particular attention is paid to: 1.) LPG recovery; 2.) LPG fractionation; and 3.) Far East trade.

  16. Rape oil methyl ester (RME) and used cooking oil methyl ester (UOME) as alternative fuels

    SciTech Connect (OSTI)

    Hohl, G.H.


    The author presents a review about the fleet tests carried out by the Austrian Armed Forces concerning the practical application of a vegetable oil, i.e Rape Oil Methyl Ester (RME) and Used Cooking Oil Methyl Ester (UOME) as alternative fuels for vehicles under military conditions, and reviews other research results carried out in Austria. As a result of over-production in Western European agriculture, the increase in crop yields has led to tremendous surpluses. Alternative agricultural products have been sought. One alternative can be seen in biological fuel production for tractors, whereby the farmer is able to produce his own fuel supply as was the case when he previously provided self-made feed for his horses. For the market introduction different activities were necessary. A considerable number of institutes and organizations including the Austrian Armed Forces have investigated, tested and developed these alternative fuels. The increasing disposal problems of used cooking oil have initiated considerations for its use. The recycling of this otherwise waste product, and its preparation for use as an alternative fuel to diesel oil, seems to be most promising.

  17. Oil shale mining studies and analyses of some potential unconventional uses for oil shale

    SciTech Connect (OSTI)

    McCarthy, H.E.; Clayson, R.L.


    Engineering studies and literature review performed under this contract have resulted in improved understanding of oil shale mining costs, spent shale disposal costs, and potential unconventional uses for oil shale. Topics discussed include: costs of conventional mining of oil shale; a mining scenario in which a minimal-scale mine, consistent with a niche market industry, was incorporated into a mine design; a discussion on the benefits of mine opening on an accelerated schedule and quantified through discounted cash flow return on investment (DCFROI) modelling; an estimate of the costs of disposal of spent shale underground and on the surface; tabulation of potential increases in resource recovery in conjunction with underground spent shale disposal; the potential uses of oil shale as a sulfur absorbent in electric power generation; the possible use of spent shale as a soil stabilizer for road bases, quantified and evaluated for potential economic impact upon representative oil shale projects; and the feasibility of co-production of electricity and the effect of project-owned and utility-owned power generation facilities were evaluated. 24 refs., 5 figs., 19 tabs.

  18. Deloitte MarketPoint.

    Energy Savers [EERE]

    Deloitte MarketPoint. Analysis of Economic Impact of LNG Exports from the United States i Contents Executive summary 1 Overview of Deloitte MarketPoint Reference Case 5 Potential impact of LNG exports 10 Comparison of results to other studies 18 Appendix A: Price Impact Charts for other Export Cases 20 Appendix B: DMP's World Gas Model and data 24 Executive summary 1 Executive summary Deloitte MarketPoint LLC ("DMP") has been engaged by Excelerate Energy L.P. ("Excelerate")

  19. Oil Shale and Oil Sands Development Robert Keiter; John Ruple...

    Office of Scientific and Technical Information (OSTI)

    Conjunctive Surface and Groundwater Management in Utah: Implications for Oil Shale and Oil Sands Development Robert Keiter; John Ruple; Heather Tanana; Rebecca Holt 29 ENERGY...

  20. 2015 Uranium Marketing Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    U.S. Energy Information Administration 2015 Uranium Marketing Annual Report 2015 Uranium Marketing Annual Report Release Date: May 24, 2016 Next Release Date: May 2017 thousand ...

  1. 2015 Uranium Marketing Annual Survey

    U.S. Energy Information Administration (EIA) Indexed Site

    5 2015 Uranium Marketing Annual Report Release Date: May 24, 2016 Next Release Date: May ... Source: U.S. Energy Information Administration, Form EIA-858 "Uranium Marketing Annual ...

  2. 2015 Uranium Marketing Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    Uranium Marketing Annual Report 2015 Uranium Marketing Annual Report Release Date: May 24, 2016 Next Release Date: May 2017 Deliveries 2011 2012 2013 2014 2015 Purchases of ...

  3. 2015 Uranium Marketing Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    Uranium Marketing Annual Report 2015 Uranium Marketing Annual Report Release Date: May 24, 2016 Next Release Date: May 2017 Delivery year Total purchased (weighted- average price) ...

  4. 2015 Uranium Marketing Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    Uranium Marketing Annual Report 2015 Uranium Marketing Annual Report Release Date: May 24, 2016 Next Release Date: May 2017 Purchases Weighted- average price Purchases Weighted- ...

  5. 2015 Uranium Marketing Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    7 2015 Uranium Marketing Annual Report Release Date: May 24, 2016 Next Release Date: May ... Source: U.S. Energy Information Administration, Form EIA-858 "Uranium Marketing Annual ...

  6. 2015 Uranium Marketing Annual Survey

    U.S. Energy Information Administration (EIA) Indexed Site

    U.S. Energy Information Administration, Form EIA-858 ""Uranium Marketing Annual Survey"" (2015)." " U.S. Energy Information Administration 2015 Uranium Marketing Annual Report 15

  7. 2015 Uranium Marketing Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    U.S. Energy Information Administration, Form EIA-858 ""Uranium Marketing Annual Survey"" (2015)." " U.S. Energy Information Administration 2015 Uranium Marketing Annual Report 25

  8. 2015 Uranium Marketing Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    1 2015 Uranium Marketing Annual Report Release Date: May 24, 2016 Next Release Date: May ... Source: U.S. Energy Information Administration, Form EIA-858 "Uranium Marketing Annual ...

  9. 2015 Uranium Marketing Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    9 2015 Uranium Marketing Annual Report Release Date: May 24, 2016 Next Release Date: May ... Source: U.S. Energy Information Administration: Form EIA-858 "Uranium Marketing Annual ...

  10. 2015 Uranium Marketing Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    3 2015 Uranium Marketing Annual Report Release Date: May 24, 2016 Next Release Date: May ... Source: U.S. Energy Information Administration, Form EIA-858 "Uranium Marketing Annual ...

  11. 2015 Uranium Marketing Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    U.S. Energy Information Administration 2015 Uranium Marketing Annual Report 2015 Uranium Marketing Annual Report Release Date: May 24, 2016 Next Release Date: May 2017 Origin of ...

  12. 2015 Uranium Marketing Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    3 2015 Uranium Marketing Annual Report Release Date: May 24, 2016 Next Release Date: May ... Source: U.S. Energy Information Administration: Form EIA-858 "Uranium Marketing Annual ...

  13. 2015 Uranium Market Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    U.S. Energy Information Administration 2015 Uranium Marketing Annual Report 2015 Uranium Marketing Annual Report Release Date: May 24, 2016 Next Release Date: May 2017 Purchase ...

  14. 2015 Uranium Marketing Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    2 U.S. Energy Information Administration 2015 Uranium Marketing Annual Report 2015 Uranium Marketing Annual Report Release Date: May 24, 2016 Next Release Date: May 2017 thousand ...

  15. 2015 Uranium Marketing Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    Energy Information Administration, Form EIA-858 ""Uranium Marketing Annual Survey"" (2013-15)." " U.S. Energy Information Administration 2015 Uranium Marketing Annual Report 33

  16. 2015 Uranium Marketing Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    8 U.S. Energy Information Administration 2015 Uranium Marketing Annual Report 2015 Uranium Marketing Annual Report Release Date: May 24, 2016 Next Release Date: May 2017 ...

  17. 2015 Uranium Marketing Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    5 2015 Uranium Marketing Annual Report Release Date: May 24, 2016 Next Release Date: May ... Source: U.S. Energy Information Administration, Form EIA-858 "Uranium Marketing Annual ...

  18. 2015 Uranium Marketing Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    Uranium Marketing Annual Report 2015 Uranium Marketing Annual Report Release Date: May 24, 2016 Next Release Date: May 2017 Number of purchasers Quantity with reported price ...

  19. 2015 Uranium Market Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    U.S. Energy Information Administration, Form EIA-858 ""Uranium Marketing Annual Survey"" (2015)." "16 U.S. Energy Information Administration 2015 Uranium Marketing Annual Report

  20. 2015 Uranium Marketing Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    U.S. Energy Information Administration 2015 Uranium Marketing Annual Report 2015 Uranium Marketing Annual Report Release Date: May 24, 2016 Next Release Date: May 2017 Minimum ...

  1. 2015 Uranium Marketing Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    7 2015 Uranium Marketing Annual Report Release Date: May 24, 2016 Next Release Date: May ... Source: U.S. Energy Information Administration: Form EIA-858 "Uranium Marketing Annual ...

  2. 2015 Uranium Marketing Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    1 2015 Uranium Marketing Annual Report Release Date: May 24, 2016 Next Release Date: May ... Source: U.S. Energy Information Administration: Form EIA-858 "Uranium Marketing Annual ...

  3. 2015 Uranium Marketing Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    9 2015 Uranium Marketing Annual Report Release Date: May 24, 2016 Next Release Date: May ... Source: U.S. Energy Information Administration, Form EIA-858 "Uranium Marketing Annual ...

  4. 2015 Uranium Marketing Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    Energy Information Administration: Form EIA-858 ""Uranium Marketing Annual Survey"" (2013-15)." " U.S. Energy Information Administration 2015 Uranium Marketing Annual Report 1

  5. 2015 Uranium Marketing Annual Report

    U.S. Energy Information Administration (EIA) Indexed Site

    Energy Information Administration: Form EIA-858 ""Uranium Marketing Annual Survey"" (2013-15)." "14 U.S. Energy Information Administration 2015 Uranium Marketing Annual Report

  6. 2011 Wind Technologies Market Report

    SciTech Connect (OSTI)

    Wiser, R.; Bolinger, M.


    This report describes the status of the U.S. wind energy industry market in 2011; its trends, performance, market drivers and future outlook.

  7. 2010 Wind Technologies Market Report

    SciTech Connect (OSTI)

    Wiser, R.; Bolinger, M.


    This report describes the status of the U.S. wind energy industry market in 2010; its trends, performance, market drivers and future outlook.

  8. 2013 Wind Technologies Market Report

    SciTech Connect (OSTI)

    Wiser, Ryan; Bolinger, Mark


    This report describes the status of the U.S. wind energy industry market in 2013; its trends, performance, market drivers and future outlook.

  9. 2012 Wind Technologies Market Report

    SciTech Connect (OSTI)

    Wiser, R.; Bolinger, M.; Barbose, G.; Darghouth, N.; Hoen, B.; Mills, A.; Weaver, S.; Porter, K.; Buckley, M.; Fink, S.; Oteri, F.; Tegen, S.


    This report describes the status of the U.S. wind energy industry market in 2012; its trends, performance, market drivers and future outlook.

  10. Energy Management and Marketing Specialist

    Broader source: [DOE]

    (See Frequently Asked Questions for more information). Where would I be working? Western Area Power Administration, Upper Great Plains Region (UGP), Power Marketing, Energy Management and Marketing...

  11. 2013 Distributed Wind Market Report

    Broader source: [DOE]

    This report describes the status of the U.S. distributed wind market in 2013; its trends, performance, market drivers and future outlook.

  12. An economical and market analysis of Canadian wood pellets.

    SciTech Connect (OSTI)

    Peng, J. [University of British Columbia, Vancouver


    This study systematically examined the current and future wood pellet market, estimated the cost of Canadian torrefied pellets, and compared the torrefied pellets with the conventional pellets based on literature and industrial data. The results showed that the wood pellet industry has been gaining significant momentum due to the European bioenergy incentives and the rising oil and natural gas prices. With the new bioenergy incentives in USA, the future pellets market may shift to North America, and Canada can potentially become the largest pellet production centre, supported by the abundant wood residues and mountain pine beetle (MPB) infested trees.

  13. Impacts of oil disturbances: lessons from experience. [1973-1974 Oil Crisis; 1978-1979 Iranian Revolution; 1980-1981 Iran-Iraq War

    SciTech Connect (OSTI)

    Curlee, T R


    An analysis of the impacts of previous oil distrubances can be used to suggest the impacts of future oil disturbances. This paper reviews how the 1973-1974 Oil Crisis, the 1978-1979 Iranian Revolution, and the 1980-1981 Iran-Iraq War impacted the US and world oil markets. Various measures of impacts are considered, such as impacts on physical flows of crude and products, crude and product price changes on the US and world markets, impacts on stocks of crude and products, and impacts on refiners' inputs and outputs. Various macroeconomic indicators, such as gross national product, inflation rates, and unemployment, are also considered. Of particular interest in this study are the impacts that oil disturbances have had (and could have) on the availabilities of particular crude types and the abilities of US refiners to process crudes of various types in the short run. In addition, this paper reviews how the actions of the consuming countries and the major oil companies affected the impacts of past disturbances. The paper briefly discusses the likely causes and impacts of future oil distrubances and summarizes the lessons to be learned from past reactions to oil disturbances.

  14. Vegetable oil as fuel

    SciTech Connect (OSTI)

    Not Available


    A review is presented of various experiments undertaken over the past few years in the U.S. to test the performance of vegetable oils in diesel engines, mainly with a view to on-farm energy self-sufficiency. The USDA Northern Regional Research Center in Peoria, Illinois, is screening native U.S. plant species as potential fuel oil sources.

  15. Oil Refund Decisions

    Broader source: [DOE]

    During the period 1973 through 1981, the Federal government imposed price and allocation controls of crude oil and refined petroleum products, such as gasoline and heating oil. During that period and for many years afterwards, the DOE had an enforcement program. When a firm was found to have overcharged, the DOE generally required the firm to make refunds to its customers.

  16. Energy Market Outlook

    Office of Energy Efficiency and Renewable Energy (EERE)

    Presentation covers the Federal Utility Partnership Working Group Energy Market Outlook: Helping Customers Meet Their Diverse Energy Goals, held on May 22-23, 2013 in San Francisco, California.

  17. Petroleum Marketing Annual

    U.S. Energy Information Administration (EIA) Indexed Site

    8 Entire . The entire report as a single file. PDF 1.2MB . Front Matter . Petroleum Marketing Annual Cover Page, Preface, and Table of Contents PDF . Highlights . Petroleum...

  18. Petroleum Marketing Annual

    U.S. Energy Information Administration (EIA) Indexed Site

    5 Entire . The entire report as a single file. PDF 2.9MB . . Front Matter . Petroleum Marketing Annual Cover Page, Contacts, Preface, and Table of Contents PDF . . Highlights ....

  19. Petroleum Marketing Annual 2009

    U.S. Energy Information Administration (EIA) Indexed Site

    cents per gallon to dollars per gallon later this year for the 2010 data. Petroleum Marketing Annual --- Full report in PDF (1.2 MB) Summary Statistics Summary Statistics Tables...

  20. Petroleum Marketing Annual 1997

    U.S. Energy Information Administration (EIA) Indexed Site

    7 Entire . The entire report as a single file. PDF 1.2MB . . Front Matter . Petroleum Marketing Annual Cover Page, Contacts, Preface, and Table of Contents PDF . . Highlights ....

  1. Petroleum Marketing Annual

    U.S. Energy Information Administration (EIA) Indexed Site

    6 Entire . The entire report as a single file. PDF 2.9MB . . Front Matter . Petroleum Marketing Annual Cover Page, Contacts, Preface, and Table of Contents PDF . . Highlights ....

  2. Petroleum Marketing Annual

    U.S. Energy Information Administration (EIA) Indexed Site

    9 Entire . The entire report as a single file. PDF 1.2MB . Front Matter . Petroleum Marketing Annual Cover Page, Preface, and Table of Contents PDF . Highlights . Petroleum...


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... fuel availability have been studied in CNG context but not well proven in the free market. ... technology development * Initial very low volume sales regime cannot be modeled except in ...

  4. Coal markets squeeze producers

    SciTech Connect (OSTI)

    Ryan, M.


    Supply/demand fundamentals seem poised to keep prices of competing fossil fuels high, which could cushion coal prices, but increased mining and transportation costs may squeeze producer profits. Are markets ready for more volatility?

  5. Solar Market Pathways

    Broader source: [DOE]

    The Solar Market Pathways website distributes key insights from 15 SunShot Initiative projects that are advancing solar deployment across the United States. These projects take a variety of...

  6. oil and gas portfolio reports

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Natural Gas & Oil Program Research Portfolio Reports The Office of Fossil Energy (FE)... focus areas: Unconventional Oil & Gas Resources; Ultra-Deepwater; and Small Producers. ...

  7. Balancing oil and environment... responsibly.

    SciTech Connect (OSTI)

    Weimer, Walter C.; Teske, Lisa


    Balancing Oil and Environment…Responsibly As the price of oil continues to skyrocket and global oil production nears the brink, pursuing unconventional oil supplies, such as oil shale, oil sands, heavy oils, and oils from biomass and coal has become increasingly attractive. Of particular significance to the American way is that our continent has significant quantities of these resources. Tapping into these new resources, however, requires cutting-edge technologies for identification, production, processing and environmental management. This job needs a super hero or two for a job of this size and proportion…

  8. Market review - market values summary/February market review/current market data

    SciTech Connect (OSTI)


    This article is the February 1996 uranium market report. As reflected by the rising demand and decreasing supply of uranium, prices for UF6 and U3O8 increased. Separation services and conversion services prices remained constant. Data is presented for the recent trades, blocks or uranium for sale or loan, inquiries to purchase or borrow uranium, SWUs available and inquiries to purchase SWUs, and market values of U3O8 and UF6 expressed in selected currencies.

  9. Forward capacity market CONEfusion

    SciTech Connect (OSTI)

    Wilson, James F.


    In ISO New England and PJM it was assumed that sponsors of new capacity projects would offer them into the newly established forward centralized capacity markets at prices based on their levelized net cost of new entry, or ''Net CONE.'' But the FCCMs have not operated in the way their proponents had expected. To clear up the CONEfusion, FCCM designs should be reconsidered to adapt them to the changing circumstances and to be grounded in realistic expectations of market conduct. (author)

  10. Corrosivity Of Pyrolysis Oils

    SciTech Connect (OSTI)

    Keiser, James R; Bestor, Michael A; Lewis Sr, Samuel Arthur; Storey, John Morse


    Pyrolysis oils from several sources have been analyzed and used in corrosion studies which have consisted of exposing corrosion coupons and stress corrosion cracking U-bend samples. The chemical analyses have identified the carboxylic acid compounds as well as the other organic components which are primarily aromatic hydrocarbons. The corrosion studies have shown that raw pyrolysis oil is very corrosive to carbon steel and other alloys with relatively low chromium content. Stress corrosion cracking samples of carbon steel and several low alloy steels developed through-wall cracks after a few hundred hours of exposure at 50 C. Thermochemical processing of biomass can produce solid, liquid and/or gaseous products depending on the temperature and exposure time used for processing. The liquid product, known as pyrolysis oil or bio-oil, as produced contains a significant amount of oxygen, primarily as components of water, carboxylic acids, phenols, ketones and aldehydes. As a result of these constituents, these oils are generally quite acidic with a Total Acid Number (TAN) that can be around 100. Because of this acidity, bio-oil is reported to be corrosive to many common structural materials. Despite this corrosive nature, these oils have the potential to replace some imported petroleum. If the more acidic components can be removed from this bio-oil, it is expected that the oil could be blended with crude oil and then processed in existing petroleum refineries. The refinery products could be transported using customary routes - pipelines, barges, tanker trucks and rail cars - without a need for modification of existing hardware or construction of new infrastructure components - a feature not shared by ethanol.

  11. Turkey Marine Lubricants Market is Expected to Reach USD 177...

    Open Energy Info (EERE)

    are primarily categorized into seven different applications including engine oils, hydraulic oils, grease, turbine oils, gear oils, compressor oils and heat transfer fluids....

  12. Estimating Price Elasticity using Market-Level Appliance Data

    SciTech Connect (OSTI)

    Fujita, K. Sydny


    This report provides and update to and expansion upon our 2008 LBNL report “An Analysis of the Price Elasticity of Demand for Appliances,” in which we estimated an average relative price elasticity of -0.34 for major household appliances (Dale and Fujita 2008). Consumer responsiveness to price change is a key component of energy efficiency policy analysis; these policies influence consumer purchases through price both explicitly and implicitly. However, few studies address appliance demand elasticity in the U.S. market and public data sources are generally insufficient for rigorous estimation. Therefore, analysts have relied on a small set of outdated papers focused on limited appliance types, assuming long-term elasticities estimated for other durables (e.g., vehicles) decades ago are applicable to current and future appliance purchasing behavior. We aim to partially rectify this problem in the context of appliance efficiency standards by revisiting our previous analysis, utilizing data released over the last ten years and identifying additional estimates of durable goods price elasticities in the literature. Reviewing the literature, we find the following ranges of market-level price elasticities: -0.14 to -0.42 for appliances; -0.30 to -1.28 for automobiles; -0.47 to -2.55 for other durable goods. Brand price elasticities are substantially higher for these product groups, with most estimates -2.0 or more elastic. Using market-level shipments, sales value, and efficiency level data for 1989-2009, we run various iterations of a log-log regression model, arriving at a recommended range of short run appliance price elasticity between -0.4 and -0.5, with a default value of -0.45.

  13. Propagation of prices in the oil industry. [Monograph

    SciTech Connect (OSTI)

    Kisselgoff, A.


    The main thrust of this report is the development of a price record that would provide a basis for the identification of the areas of activity in the oil industry in which significant price changes have occurred, with expectation that this type of information could serve as a useful ingredient in the policy-making process. The study presents estimates of the selling price of a barrel of oil at three stages of operations of the industry - the wellhead, the refinery, and the end-use levels. Prices of individual classes of petroleum products at refineries and at the end-use level were also estimated. The price data are provided for benchmark years 1958, 1963, 1967, and 1972, as well as for 1973, 1974, 1975, and 1976 when crude oil prices rose considerably. The estimating procedure is briefly described in the study. The examination of the transmission of prices from market to market within the oil industry shows that the steep rise in 1973-1974 prices paid by end-users of petroleum products was due not only to the large increases in crude oil prices but also to the sizable increases in gross operating margins-labor costs, transportation, profits, etc. - at the refinery and distribution levels. In the post-embargo years of 1975 and 1976, prices continued to advance but at a slower pace. The refiners' gross margins in 1975, however, declined somewhat; they rose significantly above the 1974 level in 1976. The marketers' margins made further gains in 1975, but exhibited a decrease in 1976. The study includes a short discussion of the effects of rising oil prices in 1973-1976 on the profitability of the petroleum industry and the general price level.

  14. Natural Gas and Crude Oil Prices in AEO (released in AEO2009)

    Reports and Publications (EIA)


    If oil and natural gas were perfect substitutes in all markets where they are used, market forces would be expected to drive their delivered prices to near equality on an energy-equivalent basis. The price of West Texas Intermediate (WTI) crude oil generally is denominated in terms of barrels, where 1 barrel has an energy content of approximately 5.8 million Btu. The price of natural gas (at the Henry Hub), in contrast, generally is denominated in million Btu. Thus, if the market prices of the two fuels were equal on the basis of their energy contents, the ratio of the crude oil price (the spot price for WTI, or low-sulfur light, crude oil) to the natural gas price (the Henry Hub spot price) would be approximately 6.0. From 1990 through 2007, however, the ratio of natural gas prices to crude oil prices averaged 8.6; and in the Annual Energy Outlook 2009 projections from 2008 through 2030, it averages 7.7 in the low oil price case, 14.6 in the reference case, and 20.2 in the high oil price case.

  15. Gas lines chasing huge northeastern market

    SciTech Connect (OSTI)

    Watts, J.


    Gas for the Northeastern US market is the driving force behind three proposed projects to bring Canadian gas to the New England-New York area: the 360-mile New England States pipeline (Algonquin Gas Transmission Co., Transcontinental Gas Pipe Line Corp., Texas Eastern Transmission Corp., and Nova, an Alberta Corp.); the 261-mile Boundary Gas project (with Boundary Gas Inc., a consortium of 14 gas utilities with Tennessee Gas Pipeline Co. providing transportation); and the 158-mile Niagara pipeline (Transcontinental Gas Pipe Line Corp.). Although none has yet received government (US and Canadian) approval, at least one project - the New England States line - is expected to be operational by 1984, bringing 305 million CF of natural gas daily for US residential and industrial markets. Both countries stand to benefit from the three projects. For Canada, the sale of gas to New England provides a steady market for massive quantities of gas makes building a pipeline from gas-rich Alberta (that will also serve eastern Canada) economically feasible, and ensures the existence of a transportation network in the Maritime provinces for use when production begins off Newfoundland and Nova Scotia. For the US, the gas from Canada will help reduce the nation's dependence on foreign oil and provide additional supplies during the peakload winter season.

  16. Guidelines for Transportation, Handling, and Use of Fast Pyrolysis Bio-Oil. Part 1. Flammability and Toxicity

    SciTech Connect (OSTI)

    Oasmaa, Anja; Kalli, Anssi; Lindfors, Christian; Elliott, Douglas C.; Springer, David L.; Peacocke, Cordner; Chiaramonti, David


    An alternative sustainable fuel, biomass-derived fast pyrolysis oil or 'bio-oil', is coming into the market. Fast pyrolysis pilot and demonstration plants for fuel applications producing tonnes of bio-oil are in operation, and commercial plants are under design. There will be increasingly larger amounts of bio-oil transportation on water and by land, leading to a need for specifications and supporting documentation. Bio-oil is different from conventional liquid fuels, and therefore must overcome both technical and marketing hurdles for its acceptability in the fuels market. A comprehensive Material Safety Data Sheet (MSDS) is required, backed with independent testing and certification. In order to standardise bio-oil quality specifications are needed. The first bio-oil burner fuel standard in ASTM (D7544) was approved in 2009. CEN standardisation has been initiated in Europe. In the EU a new chemical regulation system, REACH (Registration, Evaluation and Authorisation of Chemicals) is being applied. Registration under REACH has to be made if bio-oil is produced or imported to the EU. In the USA and Canada, bio-oil has to be filed under TOSCA (US Toxic Substances Control Act). In this paper the state of the art on standardisation is discussed, and new data for the transportation guidelines is presented. The focus is on flammability and toxicity.

  17. 2010 Solar Technologies Market Report

    SciTech Connect (OSTI)

    Not Available


    The U.S. Department of Energy (DOE) 2010 Solar Technologies Market Report details the market conditions and trends for photovoltaic (PV) and concentrating solar power (CSP) technologies. Produced by the National Renewable Energy Laboratory (NREL), the report provides a comprehensive overview of the solar electricity market and identifies successes and trends within the market from both global and national perspectives.

  18. China shows increasing interest in heavy oil and oil sands

    SciTech Connect (OSTI)

    Not Available


    China and Canadian and US groups are cooperating in several areas to develop the heavy oil, asphalt, and oil sand deposits of China. The agreements dealing with exploration and upgrading are briefly described. The majority of the paper describes the occurrences of heavy oil, asphalt, and oil sands in China. 1 figure.

  19. Chapter 11. Fuel Economy: The Case for Market Failure

    SciTech Connect (OSTI)

    Greene, David L; German, John; Delucchi, Mark A


    The efficiency of energy using durable goods, from automobiles to home air conditioners, is not only a key determinant of economy-wide energy use but also of greenhouse gas (GHG) emissions, climate change and energy insecurity. Energy analysts have long noted that consumers appear to have high implicit discount rates for future fuel savings when choosing among energy using durable goods (Howarth and Sanstad, 1995). In modeling consumers choices of appliances, the Energy Information Administration (EIA) has used discount rates of 30 percent for heating systems, 69 percent for choice of refrigerator and up to 111 percent for choice of water heater (U.S. DOE/EIA, 1996). Several explanations have been offered for this widespread phenomenon, including asymmetric information, bounded rationality and transaction costs. This chapter argues that uncertainty combined with loss aversion by consumers is sufficient to explain the failure to adopt cost effective energy efficiency improvements in the market for automotive fuel economy, although other market failures appear to be present as well. Understanding how markets for energy efficiency function is crucial to formulating effective energy policies (see Pizer, 2006). Fischer et al., (2004), for example, demonstrated that if consumers fully value the discounted present value of future fuel savings, fuel economy standards are largely redundant and produce small welfare losses. However, if consumers value only the first three years of fuel savings, then fuel economy standards can significantly increase consumer welfare. The nature of any market failure that might be present in the market for energy efficiency would also affect the relative efficacy of energy taxes versus regulatory standards (CBO, 2003). If markets function efficiently, energy taxes would generally be more efficient than regulatory standards in increasing energy efficiency and reducing energy use. If markets are decidedly inefficient, standards would likely be more effective. The chapter explores the roles of uncertainty and loss-aversion in the market for automotive fuel economy. The focus is on the determination of the technical efficiency of the vehicle rather than consumers choices among vehicles. Over the past three decades, changes in the mix of vehicles sold has played little if any role in raising the average fuel economy of new light-duty vehicles from 13 miles per gallon (mpg) in 1975 to 21 mpg today (Heavenrich, 2006). Over that same time period, average vehicle weight is up 2 percent, horsepower is up 60 percent, passenger car interior volume increased by 2 percent and the market share of light trucks grew by 31 percentage points. Historically, at least, increasing light-duty vehicle fuel economy in the United States has been a matter of manufacturers decisions to apply technology to increase the technical efficiency of cars and light trucks. Understanding how efficiently the market determines the technical fuel economy of new vehicles would seem to be critical to formulating effective policies to encourage future fuel economy improvement. The central issue is whether or not the market for fuel economy is economically efficient. Rubenstein (1998) lists the key assumptions of the rational economic decision model. The decision maker must have a clear picture of the choice problem he or she faces. He should be fully aware of the set of alternatives from which to choose and have the skill necessary to make complicated calculations needed to discover the optimal course of action. Finally, the decision maker should have the unlimited ability to calculate and be indifferent to alternatives and choice sets.

  20. Market Analyses | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Combined Heat & Power Deployment » Market Analyses Market Analyses Need information on the market potential for combined heat and power (CHP) in the U.S.? These assessments and analyses cover a wide range of markets including commercial and institutional buildings and facilities, district energy, and industrial sites. The market potential for CHP at federal sites and in selected states/regions is also examined. Commercial CHP and Bioenergy Systems for Landfills and Wastewater Treatment