National Library of Energy BETA

Sample records for officer fr doc

  1. V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy 5: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability June 25, 2013 - 12:41am Addthis PROBLEM: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability PLATFORM: Apache OpenOffice SDK 3.x ABSTRACT: Apache has acknowledged a vulnerability in Apache OpenOffice SDK REFERENCE LINKS: Apache OpenOffice Secunia Advisory SA53963 Secunia Advisory SA53846 CVE-2013-1571 IMPACT ASSESSMENT:

  2. V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerabilit...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    V-185: Apache OpenOffice SDK Oracle Java JavaDoc Spoofing Vulnerability June 25, 2013 - ... The vendor has issued a fix. Addthis Related Articles V-181: Oracle Java SE Critical Patch ...

  3. DOE/Grand Junction Office Bluewater LTSP July 1997 Doc. No. S00012AA, Page iii

    Office of Legacy Management (LM)

    DOE/Grand Junction Office Bluewater LTSP July 1997 Doc. No. S00012AA, Page iii Contents Page 1.0 Introduction .........................................................................................................................................1 1.1 Purpose ................................................................................................................................1 1.2 Legal and Regulatory Requirements

  4. webinar_innovation_net_metering_interconnection.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    netmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc webinarinnovationnetmeteringinterconnection.doc Microsoft Office document icon...

  5. webinar_innovation_organizing_strategizing.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    organizingstrategizing.doc webinarinnovationorganizingstrategizing.doc webinarinnovationorganizingstrategizing.doc Microsoft Office document icon webinarinnovationorganizi...

  6. webinar_innovation_permitting_inspections.doc | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    permittinginspections.doc webinarinnovationpermittinginspections.doc webinarinnovationpermittinginspections.doc Microsoft Office document icon webinarinnovationpermitting...

  7. fed_finance_facilities_ee_upgrades_deployment.doc | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc fedfinancefacilitieseeupgradesdeployment.doc Microsoft Office document icon ...

  8. webinar_innovation_financing.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    financing.doc webinarinnovationfinancing.doc webinarinnovationfinancing.doc Microsoft Office document icon webinarinnovationfinancing.doc More Documents & Publications...

  9. webinar_innovation_planning_zoning.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    planningzoning.doc webinarinnovationplanningzoning.doc webinarinnovationplanningzoning.doc Microsoft Office document icon webinarinnovationplanningzoning.doc More...

  10. finance_programs.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    financeprograms.doc financeprograms.doc financeprograms.doc Microsoft Office document icon financeprograms.doc More Documents & Publications Tools for Designing & Implementing ...

  11. interiorlightingefficiencyformunicipalities.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    interiorlightingefficiencyformunicipalities.doc Microsoft Office document icon interiorlightingefficiencyformunicipalities.doc More Documents & Publications Interior Lighting Efficiency for Municipalities States & Emerging Energy Technologies stateandemergingtechnologies.doc

  12. howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc Microsoft Office document icon howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc More Documents & Publications How to Design and Market Energy Efficiency Programs to Specific Neighborhoods Using Social Media to Engage the Community

  13. csep_transcript_arlington.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Office document icon cseptranscriptarlington.doc More Documents & Publications Tools for Designing & Implementing Better Finance Programs financeprograms.doc financeprograms

  14. exploringpowerpurchaseagreementsthebasicspart1.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    exploringpowerpurchaseagreementsthebasicspart1.doc Microsoft Office document icon exploringpowerpurchaseagreementsthebasicspart1.doc More Documents & Publications Exploring Power Purchase Agreements - The Basics Part 1

  15. Microsoft Word - Map and Directions to FrCt.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Frederiksen Court Housing Iowa State University Ames, IA 50011 Ames Laboratory - Public Affairs 111 TASF Iowa State University Ames, IA 50011-3020 Page 1 515.294.9557 1 Enter Ames from Interstate 35 using the 13 th Street Exit (mile marker 113) 2 Continue west on 13 th Street to Stange Rd 3 Turn left (S) on Stange for approx. ¼ mile. At the traffic lights turn left (E) again. Look for the Main Office straight ahead. (For GPS, use Stange Road & Hawthorne Court Drive, Ames, Iowa) Directions

  16. csep_transcript_aspen.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    aspen.doc csep_transcript_aspen.doc csep_transcript_aspen.doc Microsoft Office document icon csep_transcript_aspen.doc More Documents & Publications highperformanceleasingstrategiesforstateandlocalgovernments.doc Using Social Media to Engage the Community in Energy Efficiency Projects.doc webinar_innovation_permitting_inspections

  17. csep_transcript_minneapolis.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    minneapolis.doc csep_transcript_minneapolis.doc csep_transcript_minneapolis.doc Microsoft Office document icon csep_transcript_minneapolis.doc More Documents & Publications newguideforcommunityenergystrategicplanning.doc csep_transcript_aspen.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, 2011 (Text Version)

  18. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Microsoft Word - FOA cover sheet.doc Recovery Act, Office of the Biomass Program,Funding Opportunity Announcements Special Notice Microsoft Word - FOA cover sheet.doc...

  19. deepenergyretrofitsandstateapplications.doc | Department of Energy

    Energy Savers [EERE]

    deepenergyretrofitsandstateapplications.doc deepenergyretrofitsandstateapplications.doc deepenergyretrofitsandstateapplications.doc Microsoft Office document icon deepenergyretrofitsandstateapplications.doc More Documents & Publications Deep Energy Retrofits & State Applications Sustainable Energy Resources for Consumers Webinar on Residential Geothermal Heat Pump Retrofit Transcript Interior Lighting Efficiency for Municipalities

  20. Office of Electricity Delivery and Energy Reliability

    Energy Savers [EERE]

    Comments of Cisco Systems to Office of Electricity Delivery and Energy Reliability Department of Energy in Response to Request for Information: Addressing Policy and Logistical Challenges to Smart Grid Implementation Issued September 13, 2010 FR Doc. 2010-23251 November 30, 2010 Cisco Systems provides these Comments in response to the Request for Information ("RFI") issued by the Office of Electricity Delivery and Energy Reliability of the Department of Energy ("DOE") on

  1. csep_transcript_transportation.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    transportation.doc csep_transcript_transportation.doc csep_transcript_transportation.doc Microsoft Office document icon csep_transcript_transportation.doc More Documents & Publications csep_transcript_minneapolis.doc Marketing & Driving Demand: Social Media Tools & Strategies - January 16, 2011 (Text Version) Transcript: Biomass Clean Cities Webinar - Workforce Development

  2. Engaging Financial Institution Partners Transcript.doc | Department of

    Office of Environmental Management (EM)

    Energy Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Transcript.doc Microsoft Office document icon Engaging Financial Institution Partners Transcript.doc More Documents & Publications Engaging Financial Institution Partners Transcript.doc Engaging Financial Institution Partners Case Studies-Financing Energy Improvements on Utility Bills

  3. Microsoft Word - DOETTQuestions.doc | Department of Energy

    Office of Environmental Management (EM)

    DOETTQuestions.doc Microsoft Word - DOETTQuestions.doc PDF icon Microsoft Word - DOETTQuestions.doc More Documents & Publications Microsoft Word - 73FR72036_UC signed 1� Microsoft Word - SRNL Fed Register Response.doc Subcontractor Rights Under CRADAs and WFO Agreements

  4. 2009 Federal Register, 74 FR 50239; Centralized Library: U.S. Fish and Wildlife Service - FR Doc E9-23556

    National Nuclear Security Administration (NNSA)

    0239 Federal Register / Vol. 74, No. 188 / Wednesday, September 30, 2009 / Notices Dated: July 13, 2009. Cynthia K. Dohner, Acting Regional Director. [FR Doc. E9-23559 Filed 9-29-09; 8:45 am] BILLING CODE 4310-55-P DEPARTMENT OF THE INTERIOR Fish and Wildlife Service [FWS-R8-ES-2009-N141; 80221-1112- 0000-F2] Amendment of the Clark County Multiple Species Habitat Conservation Plan and Issuance of an Amended Incidental Take Permit, Clark County, NV AGENCY: Fish and Wildlife Service, Interior.

  5. leveraging_partnerships_with_faith-based_organizations.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy leveraging_partnerships_with_faith-based_organizations.doc leveraging_partnerships_with_faith-based_organizations.doc leveraging_partnerships_with_faith-based_organizations.doc Microsoft Office document icon leveraging_partnerships_with_faith-based_organizations.doc More Documents & Publications Leveraging Partnerships with Faith-Based Organizations Outreach to Faith--Based Organizations Using Social Media to Engage the Community in Energy Efficiency Projects.doc

  6. transcript_jedi_model.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    transcript_jedi_model.doc Microsoft Office document icon transcript_jedi_model.doc More Documents & Publications TAP Webcast Transcript July-29, 2009 Scenario Jedi Tools for Designing & Implementing Better Finance Programs

  7. UNITED STATES DEPARTMENT OF ENERGY OFFICE OF ELECTRICITY DELIVERY AND ENERGY RELIABILITY

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    UNITED STATES DEPARTMENT OF ENERGY OFFICE OF ELECTRICITY DELIVERY AND ENERGY RELIABILITY Improving Performance of Federal ) 78 Fed Reg. 53,436 (Aug. 29, 2013) Permitting and Review of ) FR Doc 2013 -- 21098 Infrastructure Projects ) COMMENTS OF WIRES ON THE DEPARTMENT OF ENERGY REQUEST FOR INFORMATION WIRES 1 respectfully submits these comments in response to the Request for Information ("RFI") issued by the Office of Electricity Delivery and Energy Reliability ("OEDER") of

  8. Edwin Parks (Doc) | Department of Energy

    Energy Savers [EERE]

    Edwin Parks (Doc) About Us Edwin Parks (Doc) Team Leader, Archives and Information Management Team Dr. Ed "Doc" Parks joined the Office of Legacy Management in September 2010, as a Program Analyst in the Records Management program. He provided ongoing analytical support for records and information programs, policies, procedures, plans, cost, and operational analyses. He now serves as LM's Program Records Official, the Authorizing Official and federal official accountable for the risk

  9. Residential Retrofit Program Design Guide Overview Transcript.doc |

    Broader source: Energy.gov (indexed) [DOE]

    Department of Energy Residential Retrofit Program Design Guide Overview Transcript.doc Microsoft Office document icon Residential Retrofit Program Design Guide Overview Transcript.doc More Documents & Publications Residential Retrofit Program Design Guide Overview Transcript.doc Residential Retrofit Design Guide Overview Sustainable Energy Resources for Consumers Webinar on Residential Geothermal Heat Pump Retrofit Transcript

  10. Microsoft Word - Cross Reference Matrix Introduction.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Cross Reference Matrix Introduction.doc Microsoft Word - Cross Reference Matrix Introduction.doc PDF icon Microsoft Word - Cross Reference Matrix Introduction.doc More Documents & Publications Quality Assurance Requirements USA RS Basic Contract - Contract No.: DE-RW0000005 Office of Civilian Radioactive Waste Management-Quality Assurance Requirements and Description

  11. Microsoft Word - CSATCourseCatalog_02.doc | Department of Energy

    Office of Environmental Management (EM)

    CSATCourseCatalog_02.doc Microsoft Word - CSATCourseCatalog_02.doc classroom-1008856_960_720.jpg PDF icon Microsoft Word - CSATCourseCatalog_02.doc More Documents & Publications CSAT Course Catalog Headquarters Facilities Master Security Plan - Chapter 17, Headquarters Security Officer Program Headquarters Facilities Master Security Plan - Chapter 8, Operations Security Program

  12. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Environmental Management (EM)

    cover sheet.doc Microsoft Word - FOA cover sheet.doc PDF icon Microsoft Word - FOA cover sheet.doc More Documents & Publications Vehicle Technologies Office Merit Review 2014: Moving North Texas Forward by Addressing Alternative Fuel Barriers Clean Cities Regional Support & Petroleum Displacement Awards Clean Cities 2009 Petroleum Displacement Awards

  13. expanding_chp_in_your_state.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc expanding_chp_in_your_state.doc Microsoft Office document icon expanding_chp_in_your_state.doc More Documents & Publications Combined Heat and Power: Expanding CHP in Your State Sustainable Energy Resources for Consumers (SERC) - Solar Hot Water Sustainable Energy Resources for Consumers (SERC) - Geothermal/Ground-Source Heat Pumps

  14. 20130226_sunshot_transcript_lbnl.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc 20130226_sunshot_transcript_lbnl.doc Microsoft Office document icon 20130226_sunshot_transcript_lbnl.doc More Documents & Publications Why Are Resiential PV Prices in Germany So Much Lower Than in the United States? text_alternative_stat_webinar_2012_7_25.docx An Analysis of Residential PV System Price Differences between the United States and Germany

  15. OFFICE,

    Office of Legacy Management (LM)

    OFFICE, . . . . . ..-..__. _ --.-.__.. .-..I............ !..-... bUmME. wArl&l ' rrsldu*. in the dw6lopmQt pmgrwh : Be ostiamts Uuat not man lf+ .b%'o,Q~~~ds. cik'e%ah of the eevenl reel&~ will be require& In : 'ri~ofthehereiabefor6notedeopreodo~ of puriata~tio.aadap :, Iv ve unbntend you vi11 not obj.& to:tha aoe " ai spoh +ant+lea of the mirloua real&es ,, ', ',"" ': ., .,.. i. : /~. ,".. .I,: /, . . ' .* ,; ., ,' ,:.' . .-;. ,-Y .b4 P-0 : ,.

  16. energyefficiencyink12schoolsandstateapplications.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    energyefficiencyink12schoolsandstateapplications.doc Microsoft Office document icon energyefficiencyink12schoolsandstateapplications.doc More Documents & Publications Energy Efficiency in K-12 Schools & State Applications CERTIFICATE OF AUTHENTICITY Successful Partnerships and Lessons from the Field, Part 1, Webinar Transcript

  17. Microsoft Word - 2005 FOIA ANNUAL REPORT.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2005 FOIA ANNUAL REPORT.doc Microsoft Word - 2005 FOIA ANNUAL REPORT.doc report2005.pdf PDF icon Microsoft Word - 2005 FOIA ANNUAL REPORT.doc More Documents & Publications U.S. Department of Energy 2008 Annual FOIA Report Office of Information Resources (MA-90) ANNUAL FOIA REPORT FOR 2009

  18. O:\IM-20\E-Government Program Office\FDMS\FDMS database\DOE\2012\Document List 03-02-2012 10-10-11-600\Document List 03-02-2012 10-10-11-600_docs\DOE-HQ-2012-0004-DRAFT-0005.html

    Energy Savers [EERE]

    5.html[2/3/2012 12:41:43 PM] PUBLIC SUBMISSION As of: February 03, 2012 Received: January 17, 2012 Status: Pending_Post Tracking No. 80f99189 Comments Due: January 20, 2012 Submission Type: Web Docket: DOE-HQ-2012-0004 U.S. Department of Energy Audit Guidance: For-Profit Recipients Comment On: DOE-HQ-2012-0004-0001 Audit Guidance: For-Profit Recipients Document: DOE-HQ-2012-0004-DRAFT-0005 Comment on FR Doc # 2011-32622 Submitter Information Name: Carol Hellmann Address: US Dept of Energy 1617

  19. O:\IM-20\E-Government Program Office\FDMS\FDMS database\DOE\2012\Document List 03-02-2012 10-10-11-600\Document List 03-02-2012 10-10-11-600_docs\Robin Hindel_ Comment -DRAFT-0003.html

    Energy Savers [EERE]

    Robin%20Hindel_%20Comment%20-DRAFT-0003.html[2/3/2012 12:39:35 PM] PUBLIC SUBMISSION As of: February 03, 2012 Received: January 11, 2012 Status: Pending_Post Tracking No. 80f93029 Comments Due: January 20, 2012 Submission Type: Web Docket: DOE-HQ-2012-0004 U.S. Department of Energy Audit Guidance: For-Profit Recipients Comment On: DOE-HQ-2012-0004-0001 Audit Guidance: For-Profit Recipients Document: DOE-HQ-2012-0004-DRAFT-0003 Comment on FR Doc # 2011-32622 Submitter Information Name: Robin

  20. advanced_biofuels_pathways_webinar_alt_text.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    advanced_biofuels_pathways_webinar_alt_text.doc advanced_biofuels_pathways_webinar_alt_text.doc advanced_biofuels_pathways_webinar_alt_text.doc Microsoft Office document icon advanced_biofuels_pathways_webinar_alt_text.doc More Documents & Publications Sustainability for the Global Biofuels Industry: Minimizing Risks and Maximizing Opportunities Webinar Transcript "The Promise and Challenge of Algae as Renewable Sources of Biofuels" 9-8-2010 - Transcript NABC Webinar

  1. Microsoft Word - Loan Guarantee NOPR -Final_5-09-07_FR 2 _2_...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Microsoft Word - Loan Guarantee NOPR -Final5-09-07FR 2 2.doc Microsoft Word - Loan Guarantee NOPR -Final5-09-07FR 2 2.doc Microsoft Word - Loan Guarantee NOPR...

  2. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Appendix A Monticello LTS&M Project Organization and Key Personnel U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page A-3 Utah Department of Transportation City of Monticello Monticello LM Representativ e Contractor General Manager Monticello LM Task Order Manager DOE Office of Legacy Managem ent Director U.S. EPA Region VIII Utah Departm ent of Environm

  3. Doc...~En.

    Office of Legacy Management (LM)

    ' : ,:#;: .' :.' . ,.:: :,; ..,' ... ..,,..,.... - .~~._ I&i3:scD .::-:, TO-340 .":: ..' . - ' - -. ' . .." ,.. .;.. Very traly yours;, -' .~X :, Doc...~En. ' Br.:Re&ng ';;a' : _, Div. Reading File ., ,, .~, ,.~-

  4. 2009 Federal Register, 74 FR 66147; Centralized Library: U.S. Fish and Wildlife Service - FR Doc E9-29639

    National Nuclear Security Administration (NNSA)

    6147 Federal Register / Vol. 74, No. 238 / Monday, December 14, 2009 / Notices * Mail: Gregory Helseth, BLM Southern Nevada District Office, 4701 North Torrey Pines Drive, Las Vegas, Nevada 89130-2301; * In person: At any EIS public scoping meeting. Documents pertinent to this proposal may be examined at the BLM Southern Nevada District Office. FOR FURTHER INFORMATION CONTACT: Gregory Helseth, Renewable Energy Project Manager, (702) 515-5173; or e-mail NorthSolar_Proj@blm.gov. You may also use

  5. Experimental Evaluation of DOC Performance Using Secondary Fuel Injection |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Evaluation of DOC Performance Using Secondary Fuel Injection Experimental Evaluation of DOC Performance Using Secondary Fuel Injection Poster presentation at the 2007 Diesel Engine-Efficiency & Emissions Research Conference (DEER 2007). 13-16 August, 2007, Detroit, Michigan. Sponsored by the U.S. Department of Energy's (DOE) Office of FreedomCAR and Vehicle Technologies (OFCVT). PDF icon deer07_Yetkin.pdf More Documents & Publications Engine Tests of an Active PM

  6. Design Potential of Metal Foil Substrates for Optimized DOC Performance |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Potential of Metal Foil Substrates for Optimized DOC Performance Design Potential of Metal Foil Substrates for Optimized DOC Performance Poster presentation at the 2007 Diesel Engine-Efficiency & Emissions Research Conference (DEER 2007). 13-16 August, 2007, Detroit, Michigan. Sponsored by the U.S. Department of Energy's (DOE) Office of FreedomCAR and Vehicle Technologies (OFCVT). PDF icon deer07_rice.pdf More Documents & Publications Components for Optimized SCR

  7. Doc.~:Ru.

    Office of Legacy Management (LM)

    .' , .' c,j .c; Distriblition:~ ;. <; ~..,:L.D.i&%.ay,FiN-OR00 Doc.~:Ru. ,.,. 75. ' Br..Reading 'ire' ,lliv. Read&q File ,: '. ~ ,, .-' . ...: - SURNAME..

  8. Microsoft Word - S06371_VMR_060210.doc

    Office of Legacy Management (LM)

    Naturita, Colorado, Processing Site May 2010 LMS/NAP/S06371 This page intentionally left blank LMS/NAP/S06371 Office of Legacy Management Verification Monitoring Report for the Naturita, Colorado, Processing Site May 2010 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report⎯Naturita, Colorado May 2010 Doc. No. S06371 Page i Contents 1.0 Introduction

  9. Microsoft Word - S01382_September2004.doc

    Office of Legacy Management (LM)

    S0138200 Verification Monitoring Report for the Gunnison, Colorado, UMTRCA Title I Processing Site September 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado U.S. Department of Energy Verification Monitoring Report-Gunnison, Colorado September 2004 Doc. No. S0138200 Page iii Contents Acronyms and Abbreviations

  10. Microsoft Word - S0131700_NOV04.doc

    Office of Legacy Management (LM)

    S0131700 DOE-LM/GJ757-2004 Office of Legacy Management Monument Valley Ground Water Remediation: Pilot Study Work Plan November 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy, Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Monument Valley GW Remediation Pilot Study Work Plan November 2004 Doc. No. S0131700 Page 3 Signature Page Authors: J. Waugh, S.

  11. Microsoft Word - S06713_SER.doc

    Office of Legacy Management (LM)

    09 August 2010 LMS/WEL/S06713 LMS/WEL/S06713 ENERGY Legacy Management U.S. DEPARTMENT OF U.S. Department of Energy Office of Legacy Management This page intentionally left blank LMS/WEL/S06713 U.S. Department of Energy Office of Legacy Management Weldon Spring Site Environmental Report for Calendar Year 2009 August 2010 This page intentionally left blank U.S. Department of Energy Weldon Spring Site Environmental Report for Calendar Year 2009 August 2010 Doc. No. S06713 Page i Contents

  12. Microsoft Word - U0194500July2005.doc

    Office of Legacy Management (LM)

    4500 GJO-2004-579-TAC Office of Legacy Management Refinement of Conceptual Model and Recommendations for Improving Remediation Efficiency at the Shiprock, New Mexico, Site July 2005 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Conceptual Model Refinement and Efficiency Recommendations July 2005 Doc. No.

  13. Microsoft Word - ContractManagementPlanningDRIVERS.doc | Department...

    Broader source: Energy.gov (indexed) [DOE]

    ContractManagementPlanningDRIVERS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS.doc Microsoft Word - ARRAMOModelMod.doc...

  14. transcript_pv_mapper.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    transcriptpvmapper.doc transcriptpvmapper.doc transcriptpvmapper.doc transcriptpvmapper.doc More Documents & Publications PVMapper: A Tool for Energy Siting...

  15. Microsoft Word - 07121310 DocProd.doc

    Office of Legacy Management (LM)

    613 2008 - - U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE AM01 07LM00060 - - December 2007 Groundwater Sampling at the Monument Valley, Arizona, Processing Site March 2008 This page intentionally left blank U.S. Department of Energy DVP-December 2007, Monument Valley, Arizona, Processing Site March

  16. Microsoft Word - 08021395 DocProd.doc

    Office of Legacy Management (LM)

    SHP/S04483 U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE AM01 07LM00060 - - March 2008 Groundwater and Surface Water Sampling at the Shiprock, New Mexico, Disposal Site July 2008 This page intentionally left blank U.S. Department of Energy DVP-March 2008, Shiprock, New Mexico, Disposal Site July

  17. Microsoft Word - 08031475_DocProd.doc

    Office of Legacy Management (LM)

    SAL/S04639 U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE AM01 07LM00060 - - April 2008 Groundwater and Surface Water Sampling at the Salmon, Mississippi, Site August 2008 U.S. Department of Energy DVP-April 2008, Salmon, Mississippi, Site August 2008 RIN 08031475 Page iii Contents Sampling Event

  18. Independent Activity Report, Livermore Site Office - January...

    Office of Environmental Management (EM)

    Safety and Security's (HSS) review of and participation in the Livermore Site Office Self-Assessment of the Facility Representative (FR) Program. This self-assessment was led...

  19. raising_investment_funds_for_clean_energy_programs.doc | Department...

    Broader source: Energy.gov (indexed) [DOE]

    raisinginvestmentfundsforcleanenergyprograms.doc raisinginvestmentfundsforcleanenergyprograms.doc More Documents & Publications Raising Investment Funds for Clean...

  20. spurring_local_economic_development_clean_energy_programs.doc...

    Broader source: Energy.gov (indexed) [DOE]

    spurringlocaleconomicdevelopmentcleanenergyprograms.doc spurringlocaleconomicdevelopmentcleanenergyprograms.doc More Documents & Publications Spurring Local Economic...

  1. Category:NEPA Doc | Open Energy Information

    Open Energy Info (EERE)

    NEPA Doc Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Category: NEPA Documents Collections Add.png Add a new NEPA Document Collection Pages in category "NEPA Doc"...

  2. Microsoft Word - AL2006-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2.doc Microsoft Word - AL2006-02.doc PDF icon Microsoft Word - AL2006-02.doc More Documents & Publications Microsoft Word - AL2006-03.doc Archived Financial Assistance Letters Microsoft Word - FAL2006-04.doc

  3. Microsoft Word - AL2008-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2008-06.doc Microsoft Word - AL2008-06.doc PDF icon Microsoft Word - AL2008-06.doc More Documents & Publications Chapter 9 - Contracting Qualifications Microsoft Word - PART 970.doc Microsoft Word - Matrixpart2.doc

  4. Microsoft Word - 98-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8-11.doc Microsoft Word - 98-11.doc PDF icon Microsoft Word - 98-11.doc More Documents & Publications Microsoft Word - AL2006-08.doc Microsoft Word - AL2005-01.doc Microsoft Word -...

  5. Office of the Executive Secretariat

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Executive Secretariat, MA-70 Acting Director Carol A. Matthews Special Projects Security Policy and Analysis Group Programmatic Expertise High-level Review and Analysis Correspondence Management Group Correspondence Control & Assignment Correspondence Support FOIA Management Special Projects Receiving and Delivery Administration and Executive Commitments Group eDOCS Executive Commitments Information Management Budget Personnel Administration Office of History and Heritage Resources

  6. Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Rev5functionalaccountabilityimplementationplan..doc Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc PDF icon Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc More Documents & Publications Microsoft Word - AL2007-01.doc module 4 Chapter 71 - Review and Approval of Contract and Financial Assistance Actions

  7. Microsoft Word - S03924_ITL STP Final RevisionA-3-1-10.doc

    Office of Legacy Management (LM)

    Office of Environmental Management and Office of Legacy Management Site Transition Plan for the Inhalation Toxicology Laboratory March 2010 This page intentionally left blank U.S. Department of Energy Site Transition Plan for the Inhalation Toxicology Laboratory March 2010 Doc. No. S03924 Rev. 0 Page i Contents Abbreviations...................................................................................................................................v Executive Summary

  8. Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy DOE E-Government Act Report 11.16.06 Final.doc Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc PDF icon Microsoft Word - DOE E-Government Act Report 11.16.06 Final.doc More Documents & Publications Electronic DOE Information Security System (eDISS) PIA, Office of Health Safety and Security FY 2010 E-Government Act Report DOE E-Government Act Report FY 2007

  9. Microsoft Word - Settlement Agreement - FINAL - 01-06-061.doc | Department

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy Settlement Agreement - FINAL - 01-06-061.doc Microsoft Word - Settlement Agreement - FINAL - 01-06-061.doc PDF icon Microsoft Word - Settlement Agreement - FINAL - 01-06-061.doc More Documents & Publications Memorandum of Understanding Between the United States Department of Energy and the Washington State Department of Ecology for Development of the Hanford Site Tank Closure and Waste Management EIS ("TC&WM EIS") EIS-0391: Record of Decision Richland/Office of

  10. 032102ASA.doc

    U.S. Energy Information Administration (EIA) Indexed Site

    ... MS. HUTZLER: My future plan is to resume my old job, which was Director of the Office of ... And we talked about the issues in the redesign. I think the recommendation was that we ...

  11. U0004500.DOC

    Office of Legacy Management (LM)

    155 Environmental Assessment of Ground-Water Compliance Activities at the Uranium Mill Tailings Site, Spook, Wyoming February 1997 DOE/EA-1155 Uranium Mill Tailing Remedial Action Project Environmental Assessment of Ground-Water Compliance Activities At the Uranium Mill Tailings Site Spook, Wyoming February 1997 Prepared by U.S. Department of Energy Albuquerque Operations Office Grand Junction Office Environmental Assessment of Ground-Water Compliance Activities at the Uranium Mill Tailings Site

  12. shprkEA.doc

    Office of Legacy Management (LM)

    EA-1388 Environmental Assessment of Ground Water Compliance at the Shiprock Uranium Mill Tailings Site Final September 2001 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract No. DE-AC13-96GJ87335 This Page Intentionally Blank DOE Grand Junction Office EA of Ground Water Compliance at the Shiprock Site September 2001 Final Page iii Contents Page Acronyms and Abbreviations

  13. U0174100.doc

    Office of Legacy Management (LM)

    4100 DOE/EA-1452 Environmental Assessment of Ground Water Compliance at the Durango, Colorado, UMTRA Project Site Final November 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junctio n, Colorado Work Performed Under DOE Contract Number DE-AC13-02GJ79491 DOE Grand Junction Office EA of Ground Water Compliance at the Durango Site November 2002 Final Page iii Contents Page Acronyms and Abbreviations

  14. Microsoft Word - SpecialTermsandConditions0506.doc | Department...

    Energy Savers [EERE]

    Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc Microsoft Word - SpecialTermsandConditions0506.doc More Documents &...

  15. Microsoft Word - FY2005finaliparhandbook.doc | Department of...

    Energy Savers [EERE]

    Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc Microsoft Word - FY2005finaliparhandbook.doc More Documents & Publications...

  16. Microsoft Word - ARRAAttachment2.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAAttachment2.doc Microsoft Word - ARRAAttachment2.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment3.rtf Microsoft Word -...

  17. Microsoft Word - ARRAMOModelMod.doc | Department of Energy

    Energy Savers [EERE]

    ARRAMOModelMod.doc Microsoft Word - ARRAMOModelMod.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAModelWAS...

  18. Microsoft Word - ARRAModelWAS.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ARRAModelWAS.doc Microsoft Word - ARRAModelWAS.doc More Documents & Publications Microsoft Word - ARRAAttachment2.doc Microsoft Word - ARRAMOModelMod...

  19. Microsoft Word - August06.doc | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    August06.doc Microsoft Word - August06.doc PDF icon Microsoft Word - August06.doc More Documents & Publications Microsoft Word - April

  20. Microsoft Word - S04674_2008VMR.doc

    Office of Legacy Management (LM)

    for the Durango, Colorado, Processing Site September 2008 LMS/DUP/S04674 This page intentionally left blank LMS/DUP/S04674 Office of Legacy Management Verification Monitoring Report for the Durango, Colorado, Processing Site September 2008 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report-Durango, Colorado, Processing Site September 2008 Doc. No. S0467400 Page iii Contents Acronyms and Abbreviations

  1. Microsoft Word - S07033_2nd qtr 2010.doc

    Office of Legacy Management (LM)

    Second Quarter Calendar Year 2010 October 2010 LMS/RFS/S07033 This page intentionally left blank LMS/RFS/S07033 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities Second Quarter Calendar Year 2010 October 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-2nd Quarter CY 2010 October 2010 Doc. No. S07033 Page i Contents

  2. Microsoft Word - S05551_1stqtr report.doc

    Office of Legacy Management (LM)

    09 July 2009 LMS/RFS/S05551 This page intentionally left blank LMS/RFS/S05551 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2009 July 2009 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2009 July 2009 Doc. No. S05551 Page i Contents

  3. Microsoft Word - S06528_1st qtr 2010.doc

    Office of Legacy Management (LM)

    10 July 2010 LMS/RFS/S06528 This page intentionally left blank LMS/RFS/S06528 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2010 July 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2010 July 2010 Doc. No. S06528 Page i Contents

  4. Report2003.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2003 Annual Report I. Basic Information Regarding Report. A. Abel Lopez, Director FOIA/Privacy Act Group, ME-73 Office of the Executive Secretariat U.S. Department of Energy 1000 Independence Avenue, SW Washington, DC 20585 202-586-5955 Sandi Beatty, Information Specialist FOIA/Privacy Act Group, ME-73 Office of the Executive Secretariat U.S. Department of Energy 1000 Independence Avenue, SW Washington, DC 20585 202-586-5955 B. The World Wide Web address to obtain an electronic copy of the

  5. U0083900.doc

    Office of Legacy Management (LM)

    GJO-2002-304-TAR MAC-GWTUB 11.11.2 Plan for Injection of Treated Ground Water at the Tuba City, Arizona, UMTRA Project Site March 2002 Prepared by U. S. Department of Energy Grand Junction Office Grand Junction, Colorado Project Number UGW-511-0023-17-000 Document Number U0083900 Work Performed Under DOE Contract No. DE-AC13-96GJ87335 Document Number U0083900 DOE/Grand Junction Office Plan for Injection of Treated Ground Water at the Tuba City UMTRA Site March 2002 Page 1 Introduction This plan

  6. N0057000.doc

    Office of Legacy Management (LM)

    000 GJO- 2002-380- TAC GJO-PIN 13.5.1-1 Pinellas Environmental Restoration Project Northeast Site Non-Aqueous Phase Liquids Interim Measures Progress Report July through September 2002 October 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-02GJ79491 Task Order Number ST03-107 Document Number N0057000 Contents DOE/Grand Junction Office Northeast Site NAPL Interim Measures Progress Report October 2002 Page

  7. OfficeGovernmentEthicsGuidanceEthicsandProcurementIntegrity.pdf |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy OfficeGovernmentEthicsGuidanceEthicsandProcurementIntegrity.pdf OfficeGovernmentEthicsGuidanceEthicsandProcurementIntegrity.pdf PDF icon OfficeGovernmentEthicsGuidanceEthicsandProcurementIntegrity.pdf More Documents & Publications POLICY FLASH 2016-04 Procurement Integrity AcqGuide3pt1.doc&#0;

  8. The Office of Environmental Management Non-Defense Environmental Cleanup |

    Energy Savers [EERE]

    Department of Energy Non-Defense Environmental Cleanup The Office of Environmental Management Non-Defense Environmental Cleanup PDF icon Microsoft Word - 8E2A4440.doc More Documents & Publications Microsoft Word - PSRP Updates 6-25-10_v2 The Office of Environmental Management (EM) Defense Environmental Cleanup The Office of Environmental Management Uranium Enrichment D&D

  9. Microsoft Word - Flash2007-43.doc | Department of Energy

    Office of Environmental Management (EM)

    43.doc Microsoft Word - Flash2007-43.doc Microsoft Word - Flash2007-43.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash...

  10. Microsoft Word - AL2006-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.doc Microsoft Word - AL2006-01.doc PDF icon Microsoft Word - AL2006-01.doc More Documents & Publications Microsoft Word - al2005-06.doc Chapter 19 - Small Business Programs OPAM Policy Acquisition Guides

  11. Microsoft Word - AL2005-10.doc | Department of Energy

    Office of Environmental Management (EM)

    10.doc Microsoft Word - AL2005-10.doc PDF icon Microsoft Word - AL2005-10.doc More Documents & Publications Microsoft Word - AL2005-16.doc Audit Report: IG-0860 Microsoft Word - AL2006-08

  12. Microsoft Word - Matrixpart1.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Matrixpart1.doc More Documents & Publications Part 1, Clauses Prescribed in FAR Part 52 Microsoft Word - Matrixpart2.doc...

  13. Microsoft Word - AL2002-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2-03.doc Microsoft Word - AL2002-03.doc PDF icon Microsoft Word - AL2002-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - FAL2004-01.doc Microsoft Word - ARRAAttachment12v1.doc

  14. Microsoft Word - AL2005-14.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4.doc Microsoft Word - AL2005-14.doc PDF icon Microsoft Word - AL2005-14.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc Microsoft Word - AL-Consolidated Approps FY 2008 as of feb 21 2008 final.doc Microsoft Word - AL2006-08.doc

  15. Microsoft Word - AL2007-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2007-01.doc Microsoft Word - AL2007-01.doc PDF icon Microsoft Word - AL2007-01.doc More Documents & Publications Microsoft Word - Rev5functionalaccountabilityimplementationplan..doc Microsoft Word - Corp Impl 10-05-06.final.doc Microsoft Word - AL2006-11.doc

  16. Microsoft Word - FWP- Fact Sheet.doc | Department of Energy

    Office of Environmental Management (EM)

    FWP- Fact Sheet.doc Microsoft Word - FWP- Fact Sheet.doc PDF icon Microsoft Word - FWP- Fact Sheet.doc More Documents & Publications Microsoft Word - FOA cover sheet.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - ARRAAttachment12v1.doc

  17. Microsoft Word - ITSI award doc 06-D0008 conformed to P00001.doc |

    Office of Environmental Management (EM)

    Department of Energy ITSI award doc 06-D0008 conformed to P00001.doc Microsoft Word - ITSI award doc 06-D0008 conformed to P00001.doc More Documents & Publications Policy Flash 2015-02 Acquisition Letter No. AL 2015-01R - 06/01/2015 FOA 148 Amendment

  18. Ammendment 2.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    Ammendment 2.doc More Documents & Publications Attachment 6 Volume V Pricing Matrix for Optional Enhancements.xls&0; RFQ DE-RQ01-04ME90001.doc&0; Attachment 3-Past Performance...

  19. HABadv-121.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 Subject: Principles for New and Existing Hanford Cleanup Contracts Adopted: June 8, 2001 Page 1 June 8, 2001 Keith Klein, Manager Department of Energy, Richland Operations P.O. 550 (A7-50) Richland, WA 99352 Harry Boston, Manager Department of Energy, Office of River Protection 2440 Stevens Richland, WA 99352 Re: Principles for New and Existing Hanford Cleanup Contracts The Hanford Advisory Board (HAB) has provided many pieces of advice in the past regarding contracts. The following not only

  20. titlepg.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    7 (Released October 8, 1997) Energy Information Administration DOE/EIA-0202(97/4Q) Distribution Category UC-950 Short-Term Energy Outlook Quarterly Projections Fourth Quarter 1997 Energy Information Administration Office of Energy Markets and End Use U.S. Department of Energy Washington, DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the Department of Energy. The information contained herein should not be

  1. 2010sr13.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    April 13, 2010 james-r.giusti@srs.gov DOE Announces Intention to Offer State of Georgia Additional Enviromental Monitoring Funds AIKEN, SC - The Department of Energy (DOE) today announced its intention to fund additional independent environmental monitoring of the Savannah River Site (SRS) by the State of Georgia. Through its grant program, DOE's Savannah River Operations Office will provide the Georgia Department of Natural Resources financial assistance to conduct independent environmental

  2. Microsoft Word - 45196.doc

    Office of Legacy Management (LM)

    24 Contaminant Boundary at the Faultless Underground Nuclear Test Prepared by Greg Pohll, Karl Pohlmann, Jeff Daniels, Ahmed Hassan and Jenny Chapman submitted to Nevada Site Office National Nuclear Security Administration U.S. Department of Energy Las Vegas, Nevada APRIL 2003 Publication No. 45196 Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise, does not necessarily constitute or imply its endorsement, recommendation,

  3. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    0 Doc. No. S06401 Page B-1 Annual Assessment of the Effectiveness of Site-Wide Institutional Controls U.S. Department of Energy Doc. No. S06401 June 2010 Page B-2 U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. No. S06401 Page B-3 Annual Assessment of the Effectiveness of Site-Wide Institutional Controls U.S. Department of Energy Doc. No. S06401 June 2010

  4. Index2.doc | Department of Energy

    Energy Savers [EERE]

    Index2.doc Index2.doc PDF icon Index2.doc More Documents & Publications Sylvania Corporation, Hicksville, NY and Bayside, NY - Addendum to July 8, 2004 O:\HOMEPAGE\FOIA\report99.PDF&#0; U.S. Department of Energy 2004 Annual Report

  5. SubcontractingGuidelines.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SubcontractingGuidelines.doc&#0; SubcontractingGuidelines.doc&#0; PDF icon SubcontractingGuidelines.doc&#0; More Documents & Publications Guidance of the Department of Energy Subcontracting Program Chapter 19 - Small Business Programs Business Opportunity Session Materials - December 14, 2011, Chicago

  6. Office of Enterprise Assessments Targeted Review of Radiological...

    Broader source: Energy.gov (indexed) [DOE]

    and Repair Area EA DOE Office of Enterprise Assessments EPD Electronic Pocket Dosimeter ESDH Environment, Safety and Health Division ES&H Environment, Safety and Health FR...

  7. sr0801.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Office, P.O. Box A, Aiken, S.C. 29802 NEWS MEDIA CONTACTS: For Immediate Release June 19, 2008 Julie Petersen (803) 952-7690 julie.petersen@srs.gov Jim Giusti (803) 952-7684 james-r.giusti@srs.gov DOE Marks Key Cleanup and Closure Milestones at its Savannah River Site AIKEN, S.C. - U.S. Department of Energy (DOE) Assistant Secretary for Environmental Management (EM) James A. Rispoli today marked the start of normal operations of interim salt waste processing facilities - the Actinide Removal

  8. Habadv-120.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    20 Subject: Fiscal Year 2002 and 2003 Budgets Adopted: June 8, 2001 Page 1 June 8, 2001 Keith Klein, Manager Department of Energy, Richland Operations P.O. 550 (A7-50) Richland, WA 99352 Harry Boston, Manager Department of Energy, Office of River Protection 2440 Stevens Richland, WA 99352 Re: Fiscal Year 2002 and 2003 Budgets Dear Messrs Klein and Boston, The U.S. Department of Energy (DOE) proposed fiscal year (FY) 2002 and preliminary FY 2003 budgets signal an intent to slow Hanford cleanup

  9. Microsoft Word - 1897.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    97 (9/12) Page 1 of 4 Form 1897 Onsite Non-US Government-Owned Controlled Article Authorization Form When properly executed, this form authorizes the described controlled article (see P217 Controlled Articles) to reside at, or be removed from, LANL during the specified period of time. No other controlled article may be substituted under this authorization. The original, signed form must be kept with the controlled article at all times, and a copy sent to the Information Security Office by fax at

  10. 2010sr26.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Thursday, September 2, 2010 james-r.giusti@srs.gov SRS Federal Employees Give to Area Food Bank Aiken, SC -- Representatives of the U.S. Department of Energy's Savannah River Operations Office (DOE-SR) at the Savannah River Site delivered the sixth and final truckload of food and non perishables to the Golden Harvest Food Bank today. The 335 federal employees at SRS donated 66,292 pounds of goods in just over 30 days to feed the needy in Georgia and South Carolina. If one does the math, the

  11. DOEF46001705.doc

    Office of Environmental Management (EM)

    F 4600.1# U.S. DEPARTMENT OF ENERGY (7/05) NOTICE OF FINANCIAL ASSISTANCE AWARD Under the authority of Public Law 1. PROJECT TITLE 2. INSTRUMENT TYPE GRANT COOPERATIVE AGREEMENT 4. INSTRUMENT NO. 5. AMENDMENT NO. 3. RECIPIENT (Name, address, zip code) 6. BUDGET PERIOD FROM: THRU: 7. PROJECT PERIOD FROM: THRU: 8. RECIPIENT PROJECT DIRECTOR (Name, phone and E-mail) 9. RECIPIENT BUSINESS OFFICER (Name, phone and E-mail) 10. TYPE OF AWARD NEW CONTINUATION RENEWAL REVISION INCREMENTAL FUNDING 11. DOE

  12. ATS Recertification Final.doc

    Office of Environmental Management (EM)

    Program Onsite Review January 7-17, 2008 U.S. Department of Energy Office of Health, Safety and Security Office of Health and Safety Office of Worker Safety and Health...

  13. Microsoft Word - CQA2003.doc

    Gasoline and Diesel Fuel Update (EIA)

    Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. ... Electric Power Division; Office of Coal, Nuclear, Electric and Alternate Fuels (CNEAF); ...

  14. Microsoft Word - S05773_2009 VerifMonRpt.doc

    Office of Legacy Management (LM)

    September 2009 LMS/DUP/S05773 This page intentionally left blank LMS/DUP/S05773 Office of Legacy Management Verification Monitoring Report for the Durango, Colorado, Processing Site September 2009 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report-Durango, Colorado, Processing Site September 2009 Doc. No. S05773 Page i Contents

  15. Office of International Affairs | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages

    International Affairs Search Search form Search Office of International Affairs Office of International Affairs Services Initiatives Initiatives Home Climate Action Plan Clean Energy Ministerial DOC-DOE Joint Trade Mission to China Energy and Climate Partnership of the Americas International Commitments International Commitments Home Primer Glossary & Acronyms International Energy Agency Turkey Near-Zero Zone U.S.-Africa Energy Ministerial U.S.-Canada Clean Energy Dialogue (CED) U.S.-China

  16. AcqGuide38pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8pt1.doc&#0; AcqGuide38pt1.doc&#0; PDF icon AcqGuide38pt1.doc&#0; More Documents & Publications Microsoft Word - AcqGuide38pt Nov 2010 Microsoft Word - AL2005-05Revised.doc AL2007-03.doc&#0;

  17. AcqGuide41pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1pt1.doc&#0; AcqGuide41pt1.doc&#0; PDF icon AcqGuide41pt1.doc&#0; More Documents & Publications Chapter 41 - Acquisition of Utility Services AcqGuide70pt28.doc&#0; AcqGuide9pt1.doc&#0;

  18. Microsoft Word - AL2000-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    .doc Microsoft Word - AL2000-05.doc PDF icon Microsoft Word - AL2000-05.doc More Documents & Publications al99-06.doc&#0; Microsoft Word - AL2000-05Attachment.doc AL2004-01r2.pdf

  19. Microsoft Word - AL2004-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4-02.doc Microsoft Word - AL2004-02.doc PDF icon Microsoft Word - AL2004-02.doc More Documents & Publications Microsoft Word - AL2005-02.doc Microsoft Word - al2005-04.doc Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections

  20. Microsoft Word - AL2005-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5-02.doc Microsoft Word - AL2005-02.doc PDF icon Microsoft Word - AL2005-02.doc More Documents & Publications Microsoft Word - AL-Omnibus FY 2009 Apr 22 2009 all sections.doc Microsoft Word - AL2004-02.doc Microsoft Word - AL-Consolidated Approps FY 2008 as of feb 21 2008 final

  1. Microsoft Word - AL2005-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3.doc Microsoft Word - AL2005-03.doc PDF icon Microsoft Word - AL2005-03.doc More Documents & Publications Microsoft Word - AL2005-01.doc Microsoft Word - AL2006-08.doc Microsoft Word - Chapter 10_2006_Jun

  2. Microsoft Word - FAL2004-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1.doc Microsoft Word - FAL2004-01.doc PDF icon Microsoft Word - FAL2004-01.doc More Documents & Publications Microsoft Word - FAL2004-03.doc Microsoft Word - FAL2004-02.doc Microsoft Word - FAL2003-03R

  3. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    SAR.doc Microsoft Word - PeerReview_SAR.doc PDF icon Microsoft Word - PeerReview_SAR.doc More Documents & Publications Microsoft Word - PeerReview_CCSP.doc Microsoft Word - Cross Reference Matrix Introduction.doc Assessment of the Effects of Climate Change on Federal Hydropower

  4. AL2007-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7-05.doc&#0; AL2007-05.doc&#0; PDF icon AL2007-05.doc&#0; More Documents & Publications Microsoft Word - AL2006-08.doc Department of Energy Microsoft Word - AL2006-10.doc

  5. Microsoft Word - AL2005-01.doc | Department of Energy

    Office of Environmental Management (EM)

    1.doc Microsoft Word - AL2005-01.doc PDF icon Microsoft Word - AL2005-01.doc More Documents & Publications Microsoft Word - AL2006-08.doc Acquisition Letter Archive listing AL2007-05.doc&#0;

  6. Microsoft Word - AL2006-08.doc | Department of Energy

    Office of Environmental Management (EM)

    6-08.doc Microsoft Word - AL2006-08.doc PDF icon Microsoft Word - AL2006-08.doc More Documents & Publications AL2007-05.doc&#0; Microsoft Word - AL2005-14.doc Microsoft Word - AL2006-03

  7. Microsoft Word - FAL2004-03.doc | Department of Energy

    Office of Environmental Management (EM)

    FAL2004-03.doc Microsoft Word - FAL2004-03.doc PDF icon Microsoft Word - FAL2004-03.doc More Documents & Publications Microsoft Word - FAL2004-01.doc Financial Assistance Letters No. FAL 2006-04 Microsoft Word - FAL2006-04.doc

  8. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    I Ground Water Management Policy for the MMTS and Adjacent Areas U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page I-3 U n c o n t r o l l e d c o p y Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites U.S. Department of Energy Doc. No. S0038700 Rev. 0 Page I-4 Rev. Date: June 25, 2007 U n c o n t r o l l e d c o p y U.S. Department of

  9. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    J Ground Water Remedy Performance Evaluation Plan U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page iii Contents Page J1.0 Plan Objective..................................................................................................................J-1 J2.0 Monitored Natural Attenuation Performance Evaluation Method...................................J-1 J2.1

  10. Microsoft Word - S00416.doc

    Office of Legacy Management (LM)

    Long-Term Management Plan for the Salt Lake City, Utah, (UMTRCA Title I) Processing Site September 2007 Office of Legacy Management DOE M/1541 2007 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy This page intentionally left blank DOE-LM/1541-2007 Office of

  11. Microsoft Word - S0180700.doc

    Office of Legacy Management (LM)

    Sites June 2005 Office of Legacy Management DOE M/GJ896-2005 -L U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management S0180700 DOE-LM/GJ896-2005 Office of Legacy Management Verification Monitoring Report for the Slick Rock, Colorado, Processing Sites June 2005 Work

  12. Microsoft Word - S0195200.doc

    Office of Legacy Management (LM)

    5 Office of Legacy Management U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management DOE-LM/GJ958-2005 This page intentionally left blank DOE-LM/GJ958-2005 Office of Legacy Management Verification Monitoring Report for the Durango, Colorado, Processing Site October 2005

  13. Microsoft Word - S0255900.doc

    Office of Legacy Management (LM)

    September 2006 Office of Legacy Management DOE M/1301-2006 -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy This page intentionally left blank DOE-LM/1301-2006 Office of Legacy Management Verification Monitoring Report for the Durango, Colorado, Processing Site

  14. Office of Information Resources (MA-90) | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Resources (MA-90) Office of Information Resources (MA-90) Freedom of Information 2007 Annual Report PDF icon Office of Information Resources (MA-90) More Documents & Publications ANNUAL FOIA REPORT FOR 2009 U.S. Department of Energy 2008 Annual FOIA Report Microsoft Word - 2005 FOIA ANNUAL REPORT.doc

  15. Microsoft Word - S0162200_VariationHydraulicConductivity-PRB.doc

    Office of Legacy Management (LM)

    GJ803-2005 ESL-RPT-2005-01 Variation in Hydraulic Conductivity Over Time at the Monticello Permeable Reactive Barrier February 2005 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado U.S. Department of Energy Variation in Hydraulic Conductivity Over Time at the Monticello Permeable Reactive Barrier February 2005 Doc. No. S0162200 Page v Contents Executive

  16. Microsoft Word - S01409.doc

    Office of Legacy Management (LM)

    GJ - - 724 2004 U.S. Department of Energy Interim Remedial Action Report Monticello Mill Tailings (USDOE) National Priorities List Site EPA CERCLIS Identification UT 3890090035 OU III - Surface Water and Ground Water Monitored Natural Attenuation Remedy September 2004 Office of Legacy Management Office of Legacy Management Office of Legacy Management Office of Legacy Management DOE-LM/GJ724-2004 Interim Remedial Action Report Monticello Mill Tailings (USDOE) National Priorities List Site EPA

  17. Associate Research Physicist (Post Doc, Experimental Research...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Post Doc, Experimental Research, NSTX-U, Radio Frequency Waves) Department: Research Staff: RM1 Requisition Number: 1500421 The Princeton Plasma Physics Laboratory (PPPL) seeks to...

  18. Property:NEPA TieredDoc | Open Energy Information

    Open Energy Info (EERE)

    TieredDoc Jump to: navigation, search Property Name NEPA TieredDoc Property Type Page This is a property of type Page. Pages using the property "NEPA TieredDoc" Showing 25 pages...

  19. Microsoft Word - AL2005-08.doc | Department of Energy

    Office of Environmental Management (EM)

    8.doc Microsoft Word - AL2005-08.doc Microsoft Word - AL2005-08.doc More Documents & Publications OPAM Policy Acquisition Guides Attachment FY2011-28 OPAM Microsoft Word -...

  20. Microsoft Word - FAC2005-19.doc | Department of Energy

    Office of Environmental Management (EM)

    FAC2005-19.doc Microsoft Word - FAC2005-19.doc Microsoft Word - FAC2005-19.doc More Documents & Publications Acquisitlon Letter No. AL 2008-06 AL2008-06.pdf fac2001-27.pdf...

  1. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word -...

  2. Microsoft Word - FORM46002.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2.doc Microsoft Word - FORM46002.doc Microsoft Word - FORM46002.doc More Documents & Publications DOE F 4600.2 ATTACHMENT FLASH 2011-46(6) Attachment FY2011-63 OPAM...

  3. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc Microsoft Word - AL2008-05.doc More Documents & Publications Microsoft Word - AL 2010-07 Acquistion Letters Remaining...

  4. Microsoft Word - AL2006-07.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7.doc Microsoft Word - AL2006-07.doc PDF icon Microsoft Word - AL2006-07.doc More Documents & Publications OPAM Policy Acquisition Guides Personal Property Management Certification Brochure Microsoft Word - AL2005-07

  5. Microsoft Word - AL2008-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8-05.doc Microsoft Word - AL2008-05.doc PDF icon Microsoft Word - AL2008-05.doc More Documents & Publications Department of Energy OPAM Policy Acquisition Guides Microsoft PowerPoint - Executive Order13423rbl

  6. Microsoft Word - May2009.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May2009.doc Microsoft Word - May2009.doc PDF icon Microsoft Word - May2009.doc More Documents & Publications Special Resource Study/Environmental Assessment for Manhattan Project Sites, DOE/EA-1868 (September 2010) Microsoft Word - April06

  7. DOC-DOE Joint China Mission Statement | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Joint China Mission Statement DOC-DOE Joint China Mission Statement DOC-DOE Joint China Mission Statement PDF icon DOC-DOE Joint China Mission Statement More Documents &...

  8. Microsoft Word - al2006-12.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2006-12.doc Microsoft Word - al2006-12.doc PDF icon Microsoft Word - al2006-12.doc More Documents & Publications Department of Energy Special Report: DOE/IG-0934

  9. Microsoft Word - al95-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    06.doc Microsoft Word - al95-06.doc PDF icon Microsoft Word - al95-06.doc More Documents & Publications ppl970-1.pdf Audit Report: IG-0589 Inspection Report: INS-O-02-01

  10. Microsoft Word - CMPTemplate031307.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CMPTemplate031307.doc Microsoft Word - CMPTemplate031307.doc PDF icon Microsoft Word - CMPTemplate031307.doc More Documents & Publications Chapter 42 - Contract Administration Chapter 71 - Review and Approval of Contract and Financial Assistance Actions Chapter 43 - Contract Modifications

  11. Operating Guidelines Appendix C D.DOC | Department of Energy

    Energy Savers [EERE]

    Operating Guidelines Appendix C D.DOC&0; Operating Guidelines Appendix C D.DOC&0; PDF icon Operating Guidelines Appendix C D.DOC&0; More Documents & Publications Operating...

  12. Microsoft Word - April06.doc | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    April06.doc Microsoft Word - April06.doc PDF icon Microsoft Word - April06.doc More Documents & Publications Secretary Directs FPO to Prepare Strategic Plan Microsoft Word - August

  13. Microsoft Word - AL2006-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2006-11.doc Microsoft Word - AL2006-11.doc PDF icon Microsoft Word - AL2006-11.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis...

  14. Microsoft Word - GJPPGPracticesDraft.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    GJPPGPracticesDraft.doc Microsoft Word - GJPPGPracticesDraft.doc PDF icon Microsoft Word - GJPPGPracticesDraft.doc More Documents & Publications 1 DOE Purchase Card Policy Natural Oils - The Next Generation of Diesel Engine Lubricants?

  15. al99-06.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    .doc&#0; More Documents & Publications Microsoft Word - AL2000-05.doc AL2007-05.doc&#0; AL2004-01r2.pdf

  16. Microsoft Word - competitionincontractingguidev2.doc | Department of Energy

    Office of Environmental Management (EM)

    competitionincontractingguidev2.doc Microsoft Word - competitionincontractingguidev2.doc PDF icon Microsoft Word - competitionincontractingguidev2.doc More Documents & Publications AcqGuide 5.2-OPAM Microsoft Word - AG Chapter 6 1 Nov 2010 Competition Requirements

  17. Microsoft Word - ACQUISITION LETTER.doc | Department of Energy

    Office of Environmental Management (EM)

    ACQUISITION LETTER.doc Microsoft Word - ACQUISITION LETTER.doc PDF icon Microsoft Word - ACQUISITION LETTER.doc More Documents & Publications ACQUISITION LETTER DEAR Part 933 OPAM Policy Acquisition Guides Chapter 33 - Protests, Disputes and Appeals

  18. Microsoft Word - ARRAAttachment12v1.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAAttachment12v1.doc Microsoft Word - ARRAAttachment12v1.doc More Documents & Publications Microsoft Word - DRAFT CRB Interview Guidance.doc Microsoft Word - ARRAGuideAttachment10v1

  19. Microsoft Word - FORM46001.doc | Department of Energy

    Office of Environmental Management (EM)

    FORM46001.doc Microsoft Word - FORM46001.doc PDF icon Microsoft Word - FORM46001.doc More Documents & Publications DOE F 4600.1 Archived Financial Assistance Letters American Recovery and Reinvestment Act, Financial Assistance Award: 212 Degrees Consulting, LLC

  20. Operating Guidelines Appendix A B.DOC | Department of Energy

    Energy Savers [EERE]

    Operating Guidelines Appendix A B.DOC&#0; Operating Guidelines Appendix A B.DOC&#0; PDF icon Operating Guidelines Appendix A B.DOC&#0; More Documents & Publications Operating Guidelines Appendix C D.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; DOE HR Guidebook 12_15_05.DOC&#0;

  1. Microsoft Word - S0244800.doc

    Office of Legacy Management (LM)

    5 Through March 2006 for the Shiprock, New Mexico, Site July 2006 Office of Legacy Management DOE M/GJ1212-2006 -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy DOE-LM/GJ1212-2006 Annual Performance Report April 2005 Through March 2006 for the Shiprock, New

  2. Microsoft Word - S02996.doc

    Office of Legacy Management (LM)

    Riverton, Wyoming, Processing Site Update for 2006 March 2007 Office of Legacy Management DOE M/1442 2007 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy This page intentionally left blank DOE-LM/1442-2007 Verification Monitoring Report for the Riverton,

  3. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    y Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Office of Legacy Management DOE M/1465 2007 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy U n c o n t r o l l e d c o p y Copy No. _______ Long-Term Surveillance and Maintenance

  4. Microsoft Word - S0150800.doc

    Office of Legacy Management (LM)

    Evaluation of Ground Water Remediation From March 2004 Through March 2005 at the Tuba City, Arizona, Disposal Site July 2005 Office of Legacy Management DOE M/GJ881-2005 -L U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management S0150800 DOE-LM/GJ881-2005 Annual

  5. Microsoft Word - PeerReview_SAR.doc | Department of Energy

    Energy Savers [EERE]

    & Publications Microsoft Word - PeerReviewCCSP.doc Microsoft Word - Cross Reference Matrix Introduction.doc Assessment of the Effects of Climate Change on Federal Hydropower...

  6. Experimental Evaluation of DOC Performance Using Secondary Fuel...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Evaluation of DOC Performance Using Secondary Fuel Injection Experimental Evaluation of DOC Performance Using Secondary Fuel Injection Poster presentation at the 2007 Diesel ...

  7. DOE EIR FM.doc | Department of Energy

    Office of Environmental Management (EM)

    EIR FM.doc PDF icon DOE EIR FM.doc More Documents & Publications Contractor Statement of Work (SOW) Template (for EIR) External Independent Review (EIR) Standard Operating...

  8. Design Potential of Metal Foil Substrates for Optimized DOC Performanc...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Potential of Metal Foil Substrates for Optimized DOC Performance Design Potential of Metal Foil Substrates for Optimized DOC Performance Poster presentation at the 2007 Diesel...

  9. RetTrendReport1205.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PDF icon RetTrendReport1205.doc&0; More Documents & Publications Pension Plans for Contractor Workers April 1-10 comments.doc&0; POLICY GUIDANCE MEMORANDUM...

  10. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    B Document Control and Records Management Procedures U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page B-3 B1.0 Document Control and Records Management Procedures Administrative procedures have been developed to define responsibilities, establish documentation and change control requirements, and employ standard work processes in implementing the monitoring,

  11. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    F Radiological Survey Procedures U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page F-3 F.1 Radiological Survey Procedures This section describes the actions and method used by the Monticello Legacy Management (LM) Representative when conducting radiological surveys for the purpose of identifying radiologically contaminated material and determining the Radium-226

  12. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    G Uranium Scanning Procedure U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page G-3 Uranium Scanning Procedure for Property MP-00211 1. Select a Ludlum Model 12 ratemeter with a 44-9 pancake Geiger-Mueller beta-gamma detector or equivalent instrument capable of meeting detection limit criteria. 2. Check that the ratemeter and the detector have calibration

  13. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    Appendix H Procedures for the Transportation of Radioactive Materials U n c o n t r o l l e d c o p y U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for the Monticello NPL Sites Rev. 0 Doc. No. S0038700 Rev. Date: June 25, 2007 Page H-3 H1.0 Purpose The purpose of this procedure is to ensure that radioactive material is transported (1) using best management practices, (2) in compliance with U.S. Department of Transportation (DOT) requirements, and (3) with minimal risk to

  14. Microsoft Word - Appendix N_Historical.doc

    Office of Legacy Management (LM)

    N Example Historical Marker and Plaque U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page N-3 Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page N-4

  15. Microsoft Word - meritrev.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Procurement and Assistance Policy Office of Procurement and Assistance Management August 2007 ii TABLE OF CONTENTS I. INTRODUCTION ......................................................................................................................1 II. MERIT REVIEWS......................................................................................................................1 III. MERIT REVIEWER

  16. Microsoft Word - Award.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and Engineering, Inc. has been awarded a five-year contract to provide specialized environmental technical support services to the Carlsbad Field Office, located in...

  17. Microsoft Word - S0079000.doc

    Office of Legacy Management (LM)

    85-2005 Long-Term Surveillance and Maintenance Plan for the U.S. Department of Energy Weldon Spring, Missouri, Site July 2005 Long-Term Surveillance and Maintenance Plan for the U.S. Department of Energy Weldon Spring, Missouri, Site July 2005 Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy

  18. TO: Procurement Directors/Contracting Officers FROM: Director

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    POLICY FLASH 2014-31 DATE: May 30, 2014 TO: Procurement Directors/Contracting Officers FROM: Director Contract and Financial Assistance Policy Division Office of Policy Office of Acquisition and Project Management SUBJECT: Federal Acquisition Circulars (FACs) 2005-73 and 2005-74 SUMMARY: Attached for your information is a brief summary of Federal Acquisition Regulation (FAR) amendments, published in the April 29, 2014 Federal Register at 79 FR 24192 and the May 30, 2014 Federal Register at 79 FR

  19. Microsoft Word - n0021500.doc

    Office of Legacy Management (LM)

    PIN 16.2 Environmental Restoration Program Wastewater Neutralization Area/Building 200 Area Corrective Measures Implementation Plan Addendum January 2000 Environmental Restoration Program Wastewater Neutralization Area/Building 200 Area Corrective Measures Implementation Plan Addendum January 2000 Prepared for U.S. Department of Energy Albuquerque Operations Office Grand Junction Office Prepared by MACTEC Environmental Restoration Services, LLC Grand Junction, Colorado Project Number

  20. Microsoft Word - AL2000-01.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2000-01.doc Microsoft Word - AL2000-01.doc PDF icon Microsoft Word - AL2000-01.doc More Documents & Publications AL/FAL 99-01 Department of Energy No Microsoft Word - al2005-04.doc

  1. Microsoft Word - AL2005-11.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    11.doc Microsoft Word - AL2005-11.doc PDF icon Microsoft Word - AL2005-11.doc More Documents & Publications Audit Report: OAS-L-13-08 Microsoft Word - AL2005-12.doc CHAPTER 7 FINANCIAL MANAGEMENT

  2. AcqGuide42pt3.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2pt3.doc&#0; AcqGuide42pt3.doc&#0; PDF icon AcqGuide42pt3.doc&#0; More Documents & Publications Chapter 42 - Contract Administration AcqGuide9pt2.doc&#0; Chapter 9 - Contracting Qualifications

  3. AcqGuide47pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7pt1.doc&#0; AcqGuide47pt1.doc&#0; PDF icon AcqGuide47pt1.doc&#0; More Documents & Publications Chapter 47 - Transportation TEC Working Group Topic Groups Manual Review Key Documents AcqGuide3pt1.doc&#0;

  4. AcqGuide9pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt1.doc&#0; AcqGuide9pt1.doc&#0; PDF icon AcqGuide9pt1.doc&#0; More Documents & Publications Chapter 9 - Contracting Qualifications AcqGuide3pt1.doc&#0; OPAM Policy Acquisition Guides

  5. AcqGuide9pt2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt2.doc&#0; AcqGuide9pt2.doc&#0; PDF icon AcqGuide9pt2.doc&#0; More Documents & Publications Chapter 9 - Contracting Qualifications Audit Report: IG-0432 AcqGuide42pt3.doc&#0;

  6. Microsoft Word - al2005-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2005-04.doc Microsoft Word - al2005-04.doc PDF icon Microsoft Word - al2005-04.doc More Documents & Publications AL2005-04ClassDeviation.pdf Microsoft Word - Matrixpart2.doc 2014-02 Acquistion Letter 2014-01: Management and Operating Contractors' Audit Coverage of Cost-Reimbursement Subcontracts

  7. Microsoft Word - al2005-06.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2005-06.doc Microsoft Word - al2005-06.doc PDF icon Microsoft Word - al2005-06.doc More Documents & Publications Microsoft Word - AL2006-01.doc OPAM Policy Acquisition Guides Acquisition Letter: AL2005-08

  8. Microsoft Word - 99-04.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    9-04.doc Microsoft Word - 99-04.doc PDF icon Microsoft Word - 99-04.doc More Documents & Publications Policy Flash 2014-18 Complex-Wide Strategic Sourcing Microsoft Word - AL2000-01.doc Microsoft Word - AL2005-1

  9. Microsoft Word - AL2005-16.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    6.doc Microsoft Word - AL2005-16.doc PDF icon Microsoft Word - AL2005-16.doc More Documents & Publications Microsoft Word - AL2005-10.doc Policy Flash 2013-33 Department of Energy Order 206.2 Identity, Credential and Access Managment (ICAM) Audit Report: IG-0860

  10. Microsoft Word - AL2006-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3.doc Microsoft Word - AL2006-03.doc PDF icon Microsoft Word - AL2006-03.doc More Documents & Publications Microsoft Word - AL2006-02.doc Archived Financial Assistance Letters Financial Assistance Letters No. FAL 2006-04

  11. Microsoft Word - AL2006-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    9.doc Microsoft Word - AL2006-09.doc PDF icon Microsoft Word - AL2006-09.doc More Documents & Publications Microsoft PowerPoint - Executive Order13423rbl Sample Contract Language for Construction Using Energy-Efficient Products AL2007-05.doc&#0;

  12. AcqGuide39pt1.doc | Department of Energy

    Energy Savers [EERE]

    9pt1.doc&#0; AcqGuide39pt1.doc&#0; PDF icon AcqGuide39pt1.doc&#0; More Documents & Publications Chapter 39 - Acquisition of Information Technology AcqGuide38pt1.doc&#0; Microsoft Word - AcqGuide16pt1 Nov 2010

  13. Microsoft Word - AL2005-12.doc | Department of Energy

    Energy Savers [EERE]

    2.doc Microsoft Word - AL2005-12.doc PDF icon Microsoft Word - AL2005-12.doc More Documents & Publications Acquisition Letter No. AL 2012-05 Microsoft Word - AL2005-11.doc OPAM Policy Acquisition Guides

  14. Microsoft Word - FAL2006-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FAL2006-03.doc Microsoft Word - FAL2006-03.doc PDF icon Microsoft Word - FAL2006-03.doc More Documents & Publications Financial Assistance Letter No. FAL 2006-03 Microsoft Word - FAL2006-03.doc For-Profit Audit Guidance (FY 2010)

  15. Microsoft Word - PART 970.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    PART 970.doc Microsoft Word - PART 970.doc PDF icon Microsoft Word - PART 970.doc More Documents & Publications Searchable Electronic Department of Energy Acquisition Regulation Microsoft Word - Matrixpart2.doc AcqGuide70.52Matrixpart2Redo-OPAM

  16. Microsoft Word - PeerReview_CCSP.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    CCSP.doc Microsoft Word - PeerReview_CCSP.doc PDF icon Microsoft Word - PeerReview_CCSP.doc More Documents & Publications Microsoft Word - PeerReview_SAR.doc EIS-0402: Advance Notice of Intent to Prepare an Environmental Impact Statement URTAC Meeting - January 2008

  17. Microsoft Word - al2007-11.doc | Department of Energy

    Office of Environmental Management (EM)

    al2007-11.doc Microsoft Word - al2007-11.doc PDF icon Microsoft Word - al2007-11.doc More Documents & Publications Acquisition Letter: AL2005-08 Microsoft Word - al2004-03.doc OPAM Policy Acquisition Guides

  18. Microsoft Word - AL2003-04.doc | Department of Energy

    Office of Environmental Management (EM)

    3-04.doc Microsoft Word - AL2003-04.doc PDF icon Microsoft Word - AL2003-04.doc More Documents & Publications Microsoft Word - AL2006-08.doc AL2004-01r2.pdf City of Tulare Renewable Biogas Fuel Cell Project

  19. Microsoft Word - AL2005-07.doc | Department of Energy

    Office of Environmental Management (EM)

    07.doc Microsoft Word - AL2005-07.doc PDF icon Microsoft Word - AL2005-07.doc More Documents & Publications Microsoft Word - AL2006-07.doc OPAM Policy Acquisition Guides Microsoft Word - 1_2011_CEG_Update_v2

  20. Microsoft Word - CERFDOE Final Report - 071204.doc | Department of Energy

    Office of Environmental Management (EM)

    CERFDOE Final Report - 071204.doc Microsoft Word - CERFDOE Final Report - 071204.doc PDF icon Microsoft Word - CERFDOE Final Report - 071204.doc More Documents & Publications Integrated Project Team RM DOE EIR FM.doc Independent Oversight Activity Report, Hanford Sludge Treatment Project - September 2013

  1. Microsoft Word - FAL2006-04.doc | Department of Energy

    Office of Environmental Management (EM)

    FAL2006-04.doc Microsoft Word - FAL2006-04.doc PDF icon Microsoft Word - FAL2006-04.doc More Documents & Publications Financial Assistance Letters No. FAL 2006-04 Microsoft Word - AL2006-03.doc Microsoft Word - FAL2004-01

  2. Microsoft Word - Federal Register Response _Jan09_.doc | Department of

    Office of Environmental Management (EM)

    Energy Federal Register Response _Jan09_.doc Microsoft Word - Federal Register Response _Jan09_.doc PDF icon Microsoft Word - Federal Register Response _Jan09_.doc More Documents & Publications Microsoft Word - Document2 Microsoft Word - Intellectual Property Provisions _NRD-1003_.doc Microsoft Word - SRNL Fed Register Response

  3. Microsoft Word - Final Sample Participant Profile November 2008.doc |

    Office of Environmental Management (EM)

    Department of Energy Final Sample Participant Profile November 2008.doc Microsoft Word - Final Sample Participant Profile November 2008.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc Microsoft Word - DRAFT CRB Interview Guidance

  4. Microsoft Word - S03274.DOC

    Office of Legacy Management (LM)

    Office of Legacy Management - - Work Performed Under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. U.S. Department of Energy DOE-LM/1461-2007 Annual Performance Report April 2006 Through March 2007 for the Shiprock, New Mexico, Site June 2007 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management,

  5. Microsoft Word - U0197300.doc

    Office of Legacy Management (LM)

    MSE Cores Tuba City, Arizona, Site March 2004 GJO-2004-591-TAC ESL-RPT-2004-03 ESL-RPT-2004-03 U0197300 Office of Legacy Management Analysis of MSE Cores Tuba City, Arizona, Site March 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado Signature Page Document Number U0197300 Analysis of MSE Cores DOE/Office of Legacy Management Page iv March 2004 End of current text

  6. Office | Open Energy Information

    Open Energy Info (EERE)

    Office Jump to: navigation, search Building Type Office Definition Buildings used for general office space, professional office, or administrative offices. Medical offices are...

  7. AcqGuide70pt31.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt31.doc&#0; AcqGuide70pt31.doc&#0; PDF icon AcqGuide70pt31.doc&#0; More Documents & Publications Microsoft Word - AcqGuide70pt31A.doc Policy Flash 2014-26 Acquisition Guide Chapter 70.31A - Costs Associated with Whistleblower Actions Microsoft Word - AcqGuide70pt31B.doc

  8. WNR Offices

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Lloyd's old Office 406102 665-6300 MPF-407 Student Office 407108 667-4285 MPF-541 (Trailer) 541100 665-4129 Central Control Room 4201 667-5729 Health Physics (RCT) 3R...

  9. CMTA Office

    High Performance Buildings Database

    Prospect, KY When CMTA outgrew their old office space, the consultant engineering company decided to construct a new building. Not only does the structure provide offices for the firm, it also showcases progressive design elements and allows the firm to test new technologies and demonstrate their effectiveness to clients. The new CMTA office building is located in a live-work development on the outskirts of Louisville, KY. The location was selected to place the office close to where the employees live.

  10. Merit Review System | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Supplementary Information: An amendment to the DOE Financial Assistance Rules (54 FR ... requirements of the Office of Science Financial Program Rule (10 CFR Part 605) or an SC ...

  11. AL2007-02.doc

    Broader source: Energy.gov (indexed) [DOE]

    (FAR) or Department of Energy Acquisition Regulation (DEAR) policy. Contact Rose Johnson at Rosemary.Johnson@hq.doe.gov or (202) 287-1552 in the Office of Contract and...

  12. Microsoft Word - Matrixpart1.doc

    Energy Savers [EERE]

    or (g) Exempt under regulations of the Secretary of Labor (29 CFR 5.15). 52.222-6 Davis-Bacon Act Jul 2005 A A I 22.407(a)(1) The contracting officer shall insert the...

  13. Microsoft Word - LLNLHRPfinal062606.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HUMAN RELIABILITY PROGRAM AT LAWRENCE LIVERMORE NATIONAL LABORATORY U.S. Department of Energy Office of Inspector General Office of Inspections and Special Inquiries Inspection Report The Human Reliability Program at Lawrence Livermore National Laboratory DOE/IG-0732 June 2006 THE HUMAN RELIABILITY PROGRAM AT LAWRENCE LIVERMORE NATIONAL LABORATORY TABLE OF CONTENTS OVERVIEW Introduction and Objective 1 Observations and Conclusions 2 DETAILS OF FINDINGS Drug and Alcohol Test Random Selection

  14. Microsoft Word - U0163300.doc

    Office of Legacy Management (LM)

    EA-1458 Environmental Assessment of Ground Water Compliance at the Slick Rock, Colorado, UMTRA Project Sites Final February 2003 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract No. DE-AC13-02GJ79491 This page intentionally left blank DOE Grand Junction Office EA of Ground Water Compliance at the Slick Rock Sites February 2003 Final Page iii Contents Page Acronyms and Abbreviations

  15. Microsoft Word - U0179700.doc

    Office of Legacy Management (LM)

    700 DOE/EA-1466 Environmental Assessment of Ground Water Compliance at the Naturita, Colorado, UMTRA Project Site April 2003 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract No. DE-AC13-02GJ79491 This page intentionally left blank DOE Grand Junction Office EA of Ground Water Compliance at the Naturita Site April 2003 Page iii Contents Page Acronyms and Abbreviations

  16. Microsoft Word - U01866.doc

    Office of Legacy Management (LM)

    186600 GJO-2003-489-TAC GJO-GWDUR 2.0 UMTRA Ground Water Project Verification Monitoring Report for the Durango, Colorado, UMTRA Project Site September 2003 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract No. DE-AC13-02GJ79491 Document Number U0186600 Contents DOE/Grand Junction Office Verification Monitoring Report-Durango, Colorado September 2003 Page iii Contents 1.0

  17. L. Brooks Release.DOC

    National Nuclear Security Administration (NNSA)

    01-17 National Nuclear Security Administration NEWS MEDIA CONTACT: FOR IMMEDIATE RELEASE Jonathan Kiell, 202/586-7371 October 30, 2001 Linton Brooks Assumes Post as Deputy Administrator for NNSA Defense Nuclear Nonproliferation Office Ambassador Linton F. Brooks was sworn in today as the Deputy Administrator for the National Nuclear Security Administration's (NNSA) Defense Nuclear Nonproliferation Office. Ambassador Brooks was nominated by President Bush on July 19, 2001 and was confirmed by the

  18. Microsoft Word - August06.doc

    Office of Environmental Management (EM)

    August 2006 Office of History and Heritage Resources Volume 2, Number 2 In This Issue * B-Reactor Study for Deputy Secretary * Museum and Visitor Center Conference * National Park Service Manhattan Project Resource Study * DOE Headquarters Museum/Visitor Center * Want to Receive Partners in Preservation? * 2007 DOE Cultural Resources Forum: Hanford, Washington * 2006 DOE Cultural Resources Forum: Oak Ridge, Tennessee * K-25 Racetrack? * FPO Funds Field Office Preservation * Pantex Donates Cold

  19. Microsoft Word - IG-0780.doc

    Office of Environmental Management (EM)

    Inspection Report Work Order Estimate and Cost Issues for Site Support Services at Los Alamos National Laboratory DOE/IG-0780 October 2007 U.S. Department of Energy Office of Inspector General Office of Inspections and Special Inquiries WORK ORDER ESTIMATE AND COST ISSUES FOR SITE SUPPORT SERVICES AT LOS ALAMOS NATIONAL LABORATORY TABLE OF CONTENTS OVERVIEW Introduction and Objectives 1 Observations and Conclusions 2 DETAILS OF FINDINGS Estimated Cost 4 Labor and Material Charges 5 Internal

  20. Microsoft Word - IG-0784.doc

    Office of Environmental Management (EM)

    Inspection Report The Department of Energy's Pandemic Influenza Planning DOE/IG-0784 December 2007 U.S. Department of Energy Office of Inspector General Office of Inspections and Special Inquiries THE DEPARTMENT OF ENERGY'S PANDEMIC INFLUENZA PLANNING TABLE OF CONTENTS OVERVIEW Introduction and Objective 1 Observations and Conclusions 2 Background 3 DETAILS OF FINDINGS Pandemic Plans 4 Coordination of Vaccines and Antivirals 6 Monitoring Team Positions 7 Attendance Process 7 Social Distancing

  1. Microsoft Word - Clay Memo PMC Coburn Obama 11_9_06.doc | Department...

    Office of Environmental Management (EM)

    Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc Microsoft Word - Clay Memo PMC Coburn Obama 11906.doc More Documents & Publications...

  2. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of...

    Office of Environmental Management (EM)

    TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc Microsoft Word - TSLCC 200750508 rev 1.doc More Documents & Publications FY 2007 Total System Life...

  3. Form:NEPA Doc | Open Energy Information

    Open Energy Info (EERE)

    NEPA Doc Jump to: navigation, search Input the name of a NEPA Document below. If the document already exists, you will be able to edit its information. AddEdit a NEPA Document...

  4. Microsoft Word - S06087_3rd qtr 2009 rpt - final.doc

    Office of Legacy Management (LM)

    Third Quarter Calendar Year 2009 January 2010 LMS/RFS/S06087 This page intentionally left blank LMS/RFS/S06087 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities Third Quarter Calendar Year 2009 January 2010 This page intentionally left blank U.S. Department of Energy Quarterly Report of Site Surveillance and Maintenance Activities-3rd Quarter CY 2009 January 2010 Doc. No. S06087 Page i Contents

  5. Microsoft Word - 08041519_08051593_DocProd.doc

    Office of Legacy Management (LM)

    LMS/GUP/S04641 U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE AM01 07LM00060 - - May and June 2008 Groundwater and Surface Water Sampling at the Gunnison, Colorado, Processing, Site August 2008 This page intentionally left blank U.S. Department of Energy DVP-May and June 2008, Gunnison, Colorado,

  6. Microsoft Word - RIN07050889_ DocProd.doc

    Office of Legacy Management (LM)

    512 2007 - - U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE-AC01-02GJ79491 May 2007 Ground Water and Surface Water Sampling at the Durango, Colorado, Disposal and Processing Sites August 2007 This page intentionally left blank U.S. Department of Energy DVP-May 2007, Durango, Colorado, Disposal and

  7. Microsoft Word - RIN 06110582_DocProd.doc

    Office of Legacy Management (LM)

    448 2007 - - U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE-AC01-02GJ79491 December 2006, Monument Valley, Arizona This page intentionally left blank U.S. Department of Energy DVP⎯December 2006, Monument Valley, Arizona March 2007 RIN 06110582 Page iii Contents Sampling Event Summary

  8. Microsoft Word - RIN 07081119 DocProd.doc

    Office of Legacy Management (LM)

    85 2008 - - U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE-AC01-02GJ79491 September 2007 Groundwater and Surface Water Sampling at the Shiprock, New Mexico, Disposal Site January 2008 This page intentionally left blank U.S. Department of Energy DVP-September 2007, Shiprock, New Mexico, Disposal Site

  9. DOE NEPA Compliance Officers

    Broader source: Energy.gov [DOE]

    NEPA Compliance Officers are listed by program office. Field offices are listed under their primary program office.

  10. Offices | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Offices Offices All Offices Program Offices Advanced Research Projects Agency - Energy Loan Programs Office Office of Electricity Delivery & Energy Reliability Office of Energy Efficiency & Renewable Energy Office of Environmental Management Office of Fossil Energy Office of Indian Energy Policy and Programs Office of Legacy Management Office of Nuclear Energy Office of Science Staff Offices Office of Congressional and Intergovernmental Affairs Office of Economic Impact and Diversity

  11. Microsoft Word - RIN 07040836 DocProd.doc

    Office of Legacy Management (LM)

    Data Validation Package - - U.S. Department of Energy Office of Legacy Management This page intentionally left blank U.S. Department of Energy DVPMay 2007, Gunnison, Colorado, Processing Site August 2007 RIN 07040836 Page iii Contents Sampling Event Summary ...............................................................................................................1 Gunnison, Colorado, Processing Site Sample Location Map ..........................................................3 Data

  12. Office Buildings - Types of Office Buildings

    U.S. Energy Information Administration (EIA) Indexed Site

    administration building Insurance company headquarters building Local insurance agency Social services office Attorney's office Real estate sales office Government office State...

  13. Division, NN-43, Office of Arms Control

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8 10 CFR Ch. III (1-1-10 Edition) § 810.14 Division, NN-43, Office of Arms Control and Nonproliferation. [51 FR 44574, Dec. 10, 1986, as amended at 58 FR 39639, July 16, 1993; 65 FR 16128, Mar. 27, 2000] § 810.14 Additional information. The Department of Energy may at any time require a person engaging in any generally or specifically author- ized activity to submit additional in- formation. § 810.15 Violations. (a) The Atomic Energy Act provides that: (1) Permanent or temporary injunc- tions

  14. Microsoft Word - U01804.doc

    Office of Legacy Management (LM)

    0400 GJO-2003-422-TAC GJO-GWTUB 30.13.2-2 UMTRA Ground Water Project Tuba City UMTRA Project Site Semi-Annual Performance Evaluation through August 2002 May 2003 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract No. DE-AC13-02GJ79491 This page intentionally left blank Document Number U0180400 Contents DOE/Grand Junction Office Tuba City UMTRA Project Site Semi-Annual Performance Evaluation May 2003 Page iii Contents 1.0

  15. Microsoft Word - U0186500.doc

    Office of Legacy Management (LM)

    500 GJO-2003-487-TAC GJO-GWSHP 11.7 UMTRA Ground Water Project Wildlife Management Plan for the Evaporation Pond at the Shiprock, New Mexico, UMTRA Site September 2003 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC-13-02GJ79491 Document Number U0186500 DOE/Grand Junction Office Wildlife Management PlanShiprock Evaporation Pond September 2003 Page 1 1.0 Introduction The Proposed Action in the Environmental

  16. Microsoft Word - U0195900.doc

    Office of Legacy Management (LM)

    Diffusion Multilayer Sampling of Ground Water in Five Wells at the Tuba City, Arizona, Site February 2004 GJO-2004-589-TAC ESL-RPT-2004-02 ESL-RPT-2004-02 U0195900 Office of Legacy Management Diffusion Multilayer Sampling of Ground Water in Five Wells at the Tuba City, Arizona, Site February 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy, Grand Junction, Colorado Document Number U0195900 Contents DOE/Office of Legacy

  17. n0053200-sitewide.doc

    Office of Legacy Management (LM)

    3200 GJO-PIN 11.6.2 Pinellas Environmental Restoration Project Sitewide Environmental Monitoring Quarterly Progress Report for the Young-Rainey STAR Center April through June 2002 July 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-02GJ79491 Task Order Number ST02-107 Document Number N0053200 Contents DOE/Grand Junction Office Pinellas Environmental Restoration Project July 2002 Page iii Contents Page

  18. Microsoft Word - N0049800.doc

    Office of Legacy Management (LM)

    49800 GJO-2002-306-TAR MAC-PIN 14.5.2 Pinellas Environmental Restoration Project at the Young-Rainey STAR Center Building 100 Area Plume Control Technology Selection Report February 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract Number DE-AC13-96GJ87335 Task Order Number MAC02-10 This page intentionally left blank Document Number N0049800 Contents DOE/Grand Junction Office Building 100 Area Plume Control Technology

  19. Microsoft Word - n0045000.doc

    Office of Legacy Management (LM)

    Pinellas STAR Center Building 100 Area Remediation Technology Screening Report August 2001 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Project Number PIN-041-0004-04-000 Document Number N0045000 Work Performed Under DOE Contract Number DE-AC13-96GJ87335 Task Order Number MAC01-10 This page intentionally left blank Document Number N0045000 Contents DOE/Grand Junction Office Building 100 Area Remediation Technology Screening Report August 2001 Page iii

  20. Microsoft Word - Summary.doc

    National Nuclear Security Administration (NNSA)

    The Summary S-5 * Waste Management - The Nevada Site Office placed the Area 3 Radioactive Waste Management Site on standby, and expects to close it within a few years. By permit, the Nevada Test Site is limited to receipt of no more than 20,000 cubic meters (710,000 cubic feet) of mixed low-level radioactive waste from offsite generators and must close the mixed waste disposal unit (in the Area 5 Radioactive Waste Management Site) by December 2010. The Nevada Site Office has made progress in

  1. Microsoft Word - OPC Security WP 3 _Version 1-3c_.doc

    Office of Environmental Management (EM)

    intrinsically secure po box 178 #5 - 7217 Lantzville rd lantzville, bc canada v0r 2h0 office 250.390.1333 fax 250.390.3899 www.byressecurity.com Digital Bond suite 130 1580 sawgrass corp pkwy sunrise, FL 33323 office 954.315.4633 www.digitalbond.com OPC Security Whitepaper #3 Hardening Guidelines for OPC Hosts PREPARED BY: Digital Bond British Columbia Institute of Technology Byres Research November 13, 2007 OPC Security WP 3 (Version 1-3c).doc OPC Security Whitepaper #3 Hardening Guidelines for

  2. Fellows' Officers

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Officers Fellows' Officers Current officers and listing of coordinators from 1982 to present. Current and past officers, coordinators 2015-2016 Dipen Sinha, Coordinator Chuck Farrar, Deputy Coordinator Secretary (vacant) Past coordinators 2014-2015: Brad Meyer 2013-2014: Toni Taylor 2012-2013: Pat Colestock 2011-2012:Quanxi Jia 2010-2011: Joyce Guzik 2009-2010: Darryl L. Smith 2008-2009: S. Peter Gary 2007-2008: R. S. Hixson 2006-2007: W. C. Priedhorsky 2005-2006: G. T. Gray III 2004-2005: M. M.

  3. Microsoft Word - Flash2008-09Attachment.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    9Attachment.doc More Documents & Publications Flash2007-02Attachment.doc&0; Microsoft Word - AL2000-05Attachment.doc Flash2007-03Attachment.doc&0;...

  4. Microsoft Word - Policy Flash 2008-04.doc | Department of Energy

    Office of Environmental Management (EM)

    4.doc Microsoft Word - Policy Flash 2008-04.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  5. Microsoft Word - Policy Flash 2008-06.doc | Department of Energy

    Office of Environmental Management (EM)

    6.doc Microsoft Word - Policy Flash 2008-06.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy Flash 2008-10.doc Microsoft Word -...

  6. Microsoft Word - DRAFT CRB Interview Guidance.doc | Department of Energy

    Office of Environmental Management (EM)

    DRAFT CRB Interview Guidance.doc Microsoft Word - DRAFT CRB Interview Guidance.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc Microsoft Word - Document2

  7. Microsoft Word - Policy Flash 2008-07.doc | Department of Energy

    Office of Environmental Management (EM)

    07.doc Microsoft Word - Policy Flash 2008-07.doc More Documents & Publications Microsoft Word - Policy Flash 2008-10...

  8. Microsoft Word - Policy Flash 2008-10.doc | Department of Energy

    Office of Environmental Management (EM)

    10.doc Microsoft Word - Policy Flash 2008-10.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07...

  9. Office of Chief Financial Officer

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Ultra-Deepwater and Unconventional Natural Gas Elk Hills School Lands Fund Clean Coal Technology Advanced Tech. Vehicles Manufacturing Loan Program Title 17 Innovative Tech. Loan Guarantee Program Tribal Indian Energy Loan Guarantee Program Office of Indian Energy Policy and Programs Energy Information Administration February 2015 Office of Chief Financial Officer Volume 3 DOE/CF-0109 Volume 3 Printed with soy ink on recycled paper Department of Energy FY 2016 Congressional Budget Request Energy

  10. Fermilab | Directorate | Offices

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Offices Office of Integrated Planning & Performance Management (IPPM) (authentication required) Office of Project Support Services (PSS) Office of Partnerships and Technology Transfer (OPTT) Office of Communication Program Planning Office Legal Office Last modified: 02/19

  11. fleetappforms04f1298.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    fleetappforms04f1298.doc&#0; More Documents & Publications pocforms06a0399.doc&#0; Inspection Report: INS-O-09-04 Inspection Report: INS-O-06-01

  12. Q1 1998 STEO Docs

    Gasoline and Diesel Fuel Update (EIA)

    8 (Released January 12, 1998) Energy Information Administration DOE/EIA-0202(98/1Q) Distribution Category UC-950 Short-Term Energy Outlook Quarterly Projections First Quarter 1998 Energy Information Administration Office of Energy Markets and End Use U.S. Department of Energy Washington, DC 20585 This report was prepared by the Energy Information Administration, the independent statistical and analytical agency within the U.S. Department of Energy. The information contained herein should be

  13. Microsoft Word - Paper 1.doc

    Energy Savers [EERE]

    April 19-20, 2011 Editors: Joseph H. Eto Lawrence Berkeley National Laboratory Robert J. Thomas Cornell University Proceedings Computational Needs for the Next Generation Electric Grid LBNL-5105E Computational Needs for the Next Generation Electric Grid Proceedings April 19-20, 2011 Editors: Joseph H. Eto, Lawrence Berkeley National Laboratory Robert J. Thomas, Cornell University The work described in this report was funded by the Office of Electricity Delivery and Energy Reliability of the U.S.

  14. Microsoft Word - U0127400.doc

    Office of Legacy Management (LM)

    12-TAR MAC-GWMON 1.8 Chemistry of Phase I Phytoremediation Soils: Work Plan for the Monument Valley, Arizona, UMTRA Project Site September 2001 This page intentionally left blank UMTRA Ground Water Project Chemistry of Phase I Phytoremediation Soils: Work Plan for the Monument Valley, Arizona, UMTRA Project Site September 2001 Prepared for U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Project Number UGW-511-0015-37-000 Document Number U0127400 Work Performed Under DOE

  15. Microsoft Word - s0070700.doc

    Office of Legacy Management (LM)

    Report Second Five-Year Review Report for Monticello Mill Tailings (U.S. Department of Energy) City of Monticello San Juan County, Utah June 2002 Work Performed Under DOE Contract No. DE-AC13-96GJ87335 for the U.S. Department of Energy Approved forpvbJic release; dislribution is unlimifed. DOE/Grand Junction Office Second Five-Year Report for MMTS June 2002 Page ii Five-Year Review Report Table of Contents List of Acronyms

  16. Microsoft Word - IG-0576.doc

    Office of Environmental Management (EM)

    Inspections Inspection Report Inspection of Nuclear Safety At The Ashtabula Environmental Management Project DOE/IG-0576 November 2002 U.S. DEPARTMENT OF ENERGY Washington, DC 20585 November 26, 2002 MEMORANDUM FOR THE SECRETARY FROM: Gregory H. Friedman /s/ Inspector General SUBJECT: INFORMATION: Report on "Inspection of Nuclear Safety at the Ashtabula Environmental Management Project" BACKGROUND The Office of Inspector General, U.S. Department of Energy (DOE), conducted an inspection

  17. Microsoft Word - IG-0660.doc

    Office of Environmental Management (EM)

    and Special Inquiries Inspection Report Internal Controls Over the Accountability of Computers at Sandia National Laboratory, New Mexico DOE/IG-0660 August 2004 This inspection complements similar work performed by the Office of Inspector General at several other DOE sites. MANAGEMENT REACTION Management concurred with our recommendations and has taken or initiated corrective actions. Management's comments are provided in their entirety in Appendix B of the report. We found management's comments

  18. Microsoft Word - Summary.doc

    National Nuclear Security Administration (NNSA)

    The alternative fuel demonstration project was transferred to the U.S. Department of Energy's Golden Field Office. The Nevada Desert Free Air Carbon Dioxide Enrichment Facility was built. S.3.1.5 Work-for-Others Programs The Weapons of Mass Destruction First Responder Training Program was transferred to the Federal Emergency Management Agency. The Defense Threat Reduction Agency Hard Target Defeat Program is inactive other than tests of small air-dropped munitions against tunnel targets. The

  19. DOCS System Configuration Management Plan | Department of Energy

    Office of Environmental Management (EM)

    DOCS System Configuration Management Plan DOCS System Configuration Management Plan The DOCS Systems Configuration Management Plan (SCMP), from an actual DOE systems engineering project, can be used as a template to facilitate the creation of the CMP for your particular project. PDF icon DOCS System Configuration Management Plan More Documents & Publications OPC Security Whitepaper #3Hardening Guidelines for OPC Hosts NMMSS Software Quality Assurance Plan ABB SCADA/EMS System INEEL Baseline

  20. Office of Chief Financial Officer

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    6 DOE/CF-0101 Volume 6 Power Marketing Administrations Southeastern Power Administration Southwestern Power Administration Western Area Power Administration Bonneville Power Administration Department of Energy FY 2015 Congressional Budget Request March 2014 Office of Chief Financial Officer Volume 6 DOE/CF-0101 Volume 6 Power Marketing Administrations Southeastern Power Administration Southwestern Power Administration Western Area Power Administration Bonneville Power Administration Printed with

  1. Office of Chief Financial Officer

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5 DOE/CF-0111 Volume 5 Environmental Management Department of Energy FY 2016 Congressional Budget Request February 2015 Office of Chief Financial Officer Volume 5 DOE/CF-0111 Volume 5 Environmental Management Printed with soy ink on recycled paper Department of Energy FY 2016 Congressional Budget Request Volume 5 Table of Contents Page Appropriation Account Summary

  2. Office of Chief Financial Officer

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    6 DOE/CF-0112 Volume 6 Power Marketing Administrations Southeastern Power Administration Southwestern Power Administration Western Area Power Administration Bonneville Power Administration Department of Energy FY 2016 Congressional Budget Request February 2015 Office of Chief Financial Officer Volume 6 DOE/CF-0112 Volume 6 Power Marketing Administrations Southeastern Power Administration Southwestern Power Administration Western Area Power Administration Bonneville Power Administration Printed

  3. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    Photos of T Building Rooms with Special ICs This page intentionally left blank U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. No. S06401 Page D-1 Figure D-1. T Building Rooms with Special ICs Annual Assessment of the Effectiveness of Site-Wide Institutional Controls U.S. Department of Energy Doc. No. S06401 June 2010 Page D-2 Figure D-2. T Bldg. Room 16 View A Figure D-3. T Bldg. Room 16 View B Figure D-4. T Bldg. Room 16 View

  4. Microsoft Word - FAL2004-05.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FAL2004-05.doc Microsoft Word - FAL2004-05.doc PDF icon Microsoft Word - FAL2004-05.doc More Documents & Publications Archived Financial Assistance Letters Microsoft Word - Section 311 AL FAL Feb 17 2010 Financial Assistance Letter No. FAL 2006-03

  5. Microsoft Word - al2004-03.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    al2004-03.doc Microsoft Word - al2004-03.doc PDF icon Microsoft Word - al2004-03.doc More Documents & Publications Acquisition Letter: AL2005-08 OPAM Policy Acquisition Guides Presentations, Women-Owned Small Business Forum (May 2013)

  6. Microsoft Word - meritrev.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    meritrev.doc Microsoft Word - meritrev.doc PDF icon Microsoft Word - meritrev.doc More Documents & Publications Policy Flash 2013-38 Revised Merit Review Guide For Financial Assistance Application Content and Evaluation Criteria/Process Application Content and Evaluation Criteria/Process

  7. AcqGuide37pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7pt1.doc&#0; AcqGuide37pt1.doc&#0; PDF icon AcqGuide37pt1.doc&#0; More Documents & Publications Chapter 37 - Service Contracting Microsoft Word - AcqGuide37pt1 binney Nov 2010 Special Review: OAS-M-15-05

  8. AcqGuide4pt1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt1.doc&#0; AcqGuide4pt1.doc&#0; PDF icon AcqGuide4pt1.doc&#0; More Documents & Publications Source Selection Guide Source Selection Guide Policy Flash 2013-46 Awardee in STRIPES

  9. AcqGuide70pt5.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt5.doc&#0; AcqGuide70pt5.doc&#0; PDF icon AcqGuide70pt5.doc&#0; More Documents & Publications Chapter 70 - DOE Management and Operating Contracts CHAPTER 3 Policy Flash 2013-62 Acquisition Letter 09 - Revision of Department of Energy (DOE) Order 350.1 and Special H Clause

  10. Microsoft Word - al96-09.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    6-09.doc Microsoft Word - al96-09.doc PDF icon Microsoft Word - al96-09.doc More Documents & Publications Subject: Cost and Price Analysis Subject: Cost and Price Analysis Policy Flash 2013-30 Acquisition Letter on Acquisition Planning Considerations for Management and Operating Contracts

  11. Microsoft Word - AL2005-15.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5.doc Microsoft Word - AL2005-15.doc PDF icon Microsoft Word - AL2005-15.doc More Documents & Publications Appendix A. Notice of Inquiry: Preparation of Report to Congress on Price-Anderson Act. 62 Federal Register 68,272 (December 31, 1997) Public comment re Price-Anderson Act Public Comment on Price Anderson Act from the University of Chicago

  12. Microsoft Word - AL2006-10.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    0.doc Microsoft Word - AL2006-10.doc PDF icon AL2006-10 More Documents & Publications Microsoft Word - Matrixpart2.doc Microsoft Word - AcqGuide70pt52Matrixpart2Redo AcqGuide70.52Matrixpart2Redo-OPAM

  13. Microsoft Word - FOA cover sheet.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    cover sheet.doc Microsoft Word - FOA cover sheet.doc PDF icon Microsoft Word - FOA cover sheet.doc More Documents & Publications Recovery Act: Wind Energy Consortia between Institutions of Higher Learning and Industry Microsoft Word - kDE-FOA-0000090.rtf DISCLAIMER:

  14. AcqGuide3pt1.doc | Department of Energy

    Energy Savers [EERE]

    pt1.doc&#0; AcqGuide3pt1.doc&#0; PDF icon AcqGuide3pt1.doc&#0; More Documents & Publications POLICY FLASH 2016-04 Procurement Integrity PI Brief 6 15 07 final2&#0;

  15. Microsoft Word - Matrixpart2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Matrixpart2.doc Microsoft Word - Matrixpart2.doc PDF icon Microsoft Word - Matrixpart2.doc More Documents & Publications AcqGuide70.52Matrixpart2Redo-OPAM Microsoft Word - AcqGuide70pt52Matrixpart2Redo Part 2, Clauses Prescribed in DEAR Parts 952 and 970

  16. CompleteProject List.doc | Department of Energy

    Office of Environmental Management (EM)

    CompleteProject List.doc&#0; CompleteProject List.doc&#0; PDF icon CompleteProject List.doc&#0; More Documents & Publications Tribal Energy Program February 2012 Award Project Descriptions CX-008525: Categorical Exclusion Determination 2010 Program Review Meeting

  17. al99-06attachment.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    attachment.doc&#0; More Documents & Publications Microsoft Word - AL2000-05Attachment.doc Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc EXHIBIT A: CRADA, WFO, PUA and NPUA Comparison Table, with suggested changes

  18. Microsoft Word - Political Activity and the Federal Employee.doc |

    Office of Environmental Management (EM)

    Department of Energy Political Activity and the Federal Employee.doc Microsoft Word - Political Activity and the Federal Employee.doc PDF icon Microsoft Word - Political Activity and the Federal Employee.doc More Documents & Publications Audit Report: IG-0473 PROCESSING INVITATIONS FOR A PRESIDENTIAL APPOINTEE EIS-0307: Withdrawal of Notice of Intent to Prepare an Environmental Impact Statement

  19. Microsoft Word - al95-14.doc | Department of Energy

    Office of Environmental Management (EM)

    al95-14.doc Microsoft Word - al95-14.doc PDF icon Microsoft Word - al95-14.doc More Documents & Publications Cooperation with the New Independent States of the Former Soviet Union CDLB-1003.PDF&#0; 10 CFR 600.325 - Intellectual Property Provisions (GDLB-1003) Grant

  20. Microsoft Word - fal2004-04.doc | Department of Energy

    Office of Environmental Management (EM)

    fal2004-04.doc Microsoft Word - fal2004-04.doc PDF icon Microsoft Word - fal2004-04.doc More Documents & Publications Financial Assistance Guide (2013) For Profit Audits - Information Related to 12/21/11 Federal Register Notice Policy Flash Search Listing (2001-2014)

  1. Microsoft Word - FAC2005-27.doc | Department of Energy

    Office of Environmental Management (EM)

    FAC2005-27.doc Microsoft Word - FAC2005-27.doc PDF icon Microsoft Word - FAC2005-27.doc More Documents & Publications Policy Flash 2015-07 - FAC 2005-78 Policy Flash Search Listing (2001-2014) POLICY FLASH 2015-32 - FAC 2005-83

  2. Microsoft Word - LibraryofPriorRulemakings.doc | Department of Energy

    Office of Environmental Management (EM)

    LibraryofPriorRulemakings.doc Microsoft Word - LibraryofPriorRulemakings.doc PDF icon Microsoft Word - LibraryofPriorRulemakings.doc More Documents & Publications Solar Background Document 1 Natural Gas Imports and Exports First Quarter Report 2014 Natural Gas Imports and Exports Second Quarter Report 2014

  3. Director's Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Director's Office Director's Office Print Roger Falcone Director, Advanced Light Source, Ernest Orlando Lawrence Berkeley National Laboratory and Professor of Physics, University of California, Berkeley. Roger Falcone Web page at the University of California, Berkeley Advanced Light Source Lawrence Berkeley National Laboratory 1 Cyclotron Road, MS 80R0114 Berkeley, CA 94720 USA Tel. (510) 486-6692 Fax (510) 486-4960 Email: This e-mail address is being protected from spambots. You need JavaScript

  4. Microsoft Word - Figure_01.doc

    Gasoline and Diesel Fuel Update (EIA)

    3 Figure 1. Selected average prices of natural gas in the United States, 2010-2014 0 1 2 3 4 5 6 7 2010 2011 2012 2013 2014 E xports Im ports C itygate dollars per thousand cubic feet Note: Prices are in nominal dollars. Sources: Energy Information Administration (EIA), Form EIA-895, "Annual Quantity and Value of Natural Gas Report"; Form EIA-914, "Monthly Natural Gas Production Report"; Office of Fossil Energy, U.S. Department of Energy, Natural Gas Imports and Exports; Form

  5. Microsoft Word - FORM46001.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DOE F 4600.1# U.S. DEPARTMENT OF ENERGY (11/04) NOTICE OF FINANCIAL ASSISTANCE AWARD Under the authority of Public Law 1. PROJECT TITLE 2. INSTRUMENT TYPE GRANT COOPERATIVE AGREEMENT 4. INSTRUMENT NO. 5. AMENDMENT NO. 3. RECIPIENT (Name, address, zip code) 6. BUDGET PERIOD FROM: THRU: 7. PROJECT PERIOD FROM: THRU: 8. RECIPIENT PROJECT DIRECTOR (Name, phone and E-mail) 9. RECIPIENT BUSINESS OFFICER (Name, phone and E-mail) 10. TYPE OF AWARD NEW CONTINUATION RENEWAL REVISION INCREMENTAL FUNDING

  6. Microsoft Word - cover.doc

    Office of Legacy Management (LM)

    1999-90-TAR MAC-GWGRJ 1.9 Ground Water Compliance Action Plan for the Grand Junction, Colorado, UMTRA Project Site May 2001 GJO-1999-90-TAR MAC-GWGRJ 1.9 Ground Water Compliance Action Plan for the Grand Junction, Colorado, UMTRA Project Site May 2001 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Project Number UGW-511-0008-09-000 Document Number U0050100 Work Performed under DOE Contract No. DE-AC13-96GJ87335 Document Number U0050100 Contents DOE/Grand

  7. Microsoft Word - toc.doc

    Office of Legacy Management (LM)

    K MMTS and MVP Site Inspection Checklists U n c o n t r o l l e d c o p y MMTS Annual Inspection Checklist U n c o n t r o l l e d c o p y MMTS Annual Inspection Checklist Page 1 of 38 I. MMTS Site Information Site name: Monticello Mill Tailings (USDOE) Site; Operable Units I, II, and III Date of inspection: Site Location: Monticello, Utah: EPA Region 8 EPA ID: UT 3890090035 Lead Agency: U.S. Department of Energy Office of Legacy Management (DOE-LM) PCOR Date: September 2004 Operational and

  8. Microsoft Word - S0171500.doc

    Office of Legacy Management (LM)

    DOE-LM/GJ850-2005 ESL-RPT-2005-03 Alternatives for Mending a Permeable Reactive Barrier at a Former Uranium Milling Site: Monticello, Utah April 2005 Prepared for U. S. Environmental Protection Agency Region 8, Denver, Colorado Under Interagency Agreement DW89953767018 By U. S. Department of Energy Grand Junction, Colorado Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado

  9. Microsoft Word - S02808.doc

    Office of Legacy Management (LM)

    Sciences Laboratory Environmental Sciences Laboratory Prepared for U.S. Department of Energy Grand Junction, Colorado Third (March 2006) Coring and Analysis of Zero-Valent Iron Permeable Reactive Barrier, Monticello, Utah November 2006 DOE-LM/1379-2006 ESL-RPT-2006-03 Work Performed nder DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. by the S.M. Stoller Corporation u DE AC01 02GJ79491 - - Approved for public release; distribution is unlimited. This page

  10. Microsoft Word - U0197800.doc

    Office of Legacy Management (LM)

    Contaminant Rebound in Ground Water in Extraction Wells at the Tuba City, Arizona, Site April 2004 DOE-LM/GJ625-2004 ESL-RPT-2004-04 ESL-RPT-2004-04 U0197800 Analysis of Contaminant Rebound in Ground Water in Extraction Wells at the Tuba City, Arizona, Site April 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado Signature Page Document Number U0197800 Analysis of

  11. OFFICE FOR EMERGENCY MANAGEMENT

    Office of Legacy Management (LM)

    OFFICE FOR EMERGENCY MANAGEMENT 155OP STREETNW. WiSHINGTON. D.C. ' , iQns 25,19&L At-t :. I' .' ~ at l530 P Btmat, IO&, XtwMn&m, 0. 6., at 9130 A.Jb Sa 1 llmbemupoftbaaomlttaal8~f~r :::i.: :;::j:/ :::.,:.,::: . . . -2, . -3- .,... .:.:. . . ,::;:: 2. lktlv4rsityof-ta ?oral8rtbnsfoaofth4~cnlLmd farumd4rContraotO~~9 t4a : lwlnde the d4v4logmullt. construotion j andop4ratloaofadditl~auls, s~tNm4t4ln. /; ./ 3. alllY4rsltyofcb.l4s&o on4fth4w*callyd sar tmdor OoBtroct OEUS~ 7 :;::.

  12. Microsoft Word - CQA2005W.doc

    Gasoline and Diesel Fuel Update (EIA)

    Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. ... Electric Power Division; Office of Coal, Nuclear, Electric and Alternate Fuels (CNEAF); ...

  13. Microsoft Word - CQA2006W.doc

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. ... Electric Power Division; Office of Coal, Nuclear, Electric and Alternate Fuels (CNEAF); ...

  14. Microsoft Word - CQA2004_20060727.doc

    Gasoline and Diesel Fuel Update (EIA)

    Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. ... Electric Power Division; Office of Coal, Nuclear, Electric and Alternate Fuels (CNEAF); ...

  15. Microsoft Word - CQA2008_FINAL.doc

    Gasoline and Diesel Fuel Update (EIA)

    Administration Office of Coal, Nuclear, Electric and Alternate Fuels U.S. ... Electric Power Division; Office of Coal, Nuclear, Electric and Alternate Fuels (CNEAF); U. ...

  16. Microsoft Word - S06692_VMR.doc

    Office of Legacy Management (LM)

    Gunnison, Colorado, Processing Site September 2010 LMS/GUP/S06692 This page intentionally left blank LMS/GUP/S06692 2010 Verification Monitoring Report for the Gunnison, Colorado, Processing Site September 2010 This page intentionally left blank U.S. Department of Energy 2010 Verification Monitoring Report-Gunnison, Colorado, Processing Site September 2010 Doc. No. S06692 Page i Contents

  17. Microsoft Word - Appendix A_Background.doc

    Office of Legacy Management (LM)

    Background Information, Remedial Action Histories, Present Site Conditions U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page A-iii Contents A1.1 Location and Property Ownership ................................................................................1 A1.2 Physiography and Topography.....................................................................................4 A1.3 Hydrogeology

  18. Office of Chief Financial Officer

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2001-01-19

    This Order implements the provisions of the Chief Financial Officers Act of 1990 within the Department of Energy. Cancels SEN 34-91. Canceled by DOE O 520.1A.

  19. Office of Chief Financial Officer

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4 DOE/CF-0099 Volume 4 Science Advanced Research Projects Agency-Energy Department of Energy FY 2015 Congressional Budget Request March 2014 Office of Chief Financial Officer Volume 4 DOE/CF-0099 Volume 4 Science Advanced Research Projects Agency-Energy Printed with soy ink on recycled paper Department of Energy FY 2015 Congressional Budget Request FY 2015 Congressional Budget Volume 4 Table of Contents Page Appropriation Account Summary

  20. Office of Chief Financial Officer

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1 DOE/CF-0107 Volume 1 National Nuclear Security Administration Federal Salaries and Expenses Weapons Activities Defense Nuclear Nonproliferation Naval Reactors Department of Energy FY 2016 Congressional Budget Request February 2015 Office of Chief Financial Officer Volume 1 DOE/CF-0107 Volume 1 National Nuclear Security Administration Federal Salaries and Expenses Weapons Activities Defense Nuclear Nonproliferation Naval Reactors Printed with soy ink on recycled paper Department of Energy FY

  1. Office of Chief Financial Officer

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2 DOE/CF-0108 Volume 2 Other Defense Activities Departmental Administration Inspector General Working Capital Fund Crosscutting Activities Pensions Department of Energy FY 2016 Congressional Budget Request February 2015 Office of Chief Financial Officer Volume 2 DOE/CF-0108 Volume 2 Other Defense Activities Departmental Administration Inspector General Working Capital Fund Crosscutting Activities Pensions Department of Energy FY 2016 Congressional Budget Request Printed with soy ink on recycled

  2. Office of Chief Financial Officer

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4 DOE/CF-0110 Volume 4 Science Advanced Research Projects Agency-Energy Department of Energy FY 2016 Congressional Budget Request February 2015 Office of Chief Financial Officer Volume 4 DOE/CF-0110 Volume 4 Science Advanced Research Projects Agency-Energy Printed with soy ink on recycled paper Department of Energy FY 2016 Congressional Budget Request Volume 4 Table of Contents Page Appropriation Account Summary

  3. Office Buildings - Full Report

    U.S. Energy Information Administration (EIA) Indexed Site

    administration building Insurance company headquarters building Local insurance agency Social services office Attorney's office Real estate sales office Government office State...

  4. Microsoft Word - DOENV--FY2007.doc

    National Nuclear Security Administration (NNSA)

    Office Las Vegas, Nevada This page intentionally left blank TABLE OF CONTENTS 1.0 INTRODUCTION......

  5. Microsoft Word - B996F741.doc

    Broader source: Energy.gov (indexed) [DOE]

    UEDD) Office of Environmental Management PSRP Name: The Office of Environmental Management Uranium Enrichment D&D PSRP Lead Program Office and/or Laboratory/Site Office: The Office of Environmental Management PSRP Lead Manager: Cynthia Anderson, Recovery Act Program Manager phone: (202) 586-2083 e-mail: Cynthia.Anderson@em.doe.gov address: 1000 Independence Ave., SW Washington, DC 20585 1. Objectives: Program Purpose The Uranium Enrichment Decontamination and Decommissioning (UED&D)

  6. Microsoft Word - TR12-14.doc

    Office of Legacy Management (LM)

    of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2006 Office of Legacy Management DOE M/1399 2006 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy U.S. Department of Energy 2006 Annual

  7. Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Energy Speech 082508 FINAL.doc Microsoft Word - Fact Sheet Energy Speech 082508 FINAL.doc More Documents & Publications Microsoft Word - Press Release RECOMP 2-8-08 REV FINAL.doc Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - Final Sample Participant Profile November 2008.doc

  8. Microsoft Word - ADR-Provisions-FederalAcquisitionReg.doc | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy ADR-Provisions-FederalAcquisitionReg.doc Microsoft Word - ADR-Provisions-FederalAcquisitionReg.doc PDF icon Microsoft Word - ADR-Provisions-FederalAcquisitionReg.doc More Documents & Publications ADR Provisions in Federal Acquisition Regulation (FAR) Microsoft Word - ACQUISITION LETTER.doc Microsoft Word - ADR Revised Policy82508Reformatted.doc

  9. Microsoft Word - AL2000-05Attachment.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Attachment.doc Microsoft Word - AL2000-05Attachment.doc PDF icon Microsoft Word - AL2000-05Attachment.doc More Documents & Publications al99-06attachment.doc&#0; EXHIBIT A: CRADA, WFO, PUA and NPUA Comparison Table, with suggested changes Microsoft Word - NSRC precompetitive User Agreement amended 1-18-07.doc

  10. Microsoft Word - AL2005-05Revised.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AL2005-05Revised.doc Microsoft Word - AL2005-05Revised.doc PDF icon Microsoft Word - AL2005-05Revised.doc More Documents & Publications AL2007-03.doc&#0; 2011-31 Attachment Aquisition Letter AcqGuide38pt1.doc&#0;

  11. Building Technologies Office Overview

    SciTech Connect (OSTI)

    2013-04-01

    Building Technologies Office Overview Presentation for the 2013 Building Technologies Office's Program Peer Review

  12. Microsoft Word - S05428_VMR.doc

    Office of Legacy Management (LM)

    2008 and 2009 Update July 2010 LMS/SRE-SRW/S05428 This page intentionally left blank LMS/SRE-SRW/S05428 Verification Monitoring Report for the Slick Rock, Colorado, Processing Sites 2008 and 2009 Update July 2010 This page intentionally left blank U.S. Department of Energy Verification Monitoring Report-Slick Rock, Colorado, 2008 and 2009 Update July 2010 Doc. No. S05428 Page i Contents

  13. Microsoft Word - S05527_VMR 2009.DOC

    Office of Legacy Management (LM)

    Report for the Gunnison, Colorado, Processing Site August 2009 LMS/GUP/S05527 This page intentionally left blank LMS/GUP/S05527 2009 Verification Monitoring Report for the Gunnison, Colorado, Processing Site August 2009 This page intentionally left blank U.S. Department of Energy 2009 Verification Monitoring Report-Gunnison, Colorado, Processing Site August 2009 Doc. No. S05527 Page i Contents

  14. Microsoft Word - S07050_WM.doc

    Office of Legacy Management (LM)

    Monitoring Report for Wetland Area near the Naturita, Colorado, Processing Site September 2010 LMS/NAP/S07050 This page intentionally left blank LMS/NAP/S07050 Monitoring Report for Wetland Area near the Naturita, Colorado, Processing Site September 2010 This page intentionally left blank U.S. Department of Energy Naturita-Monitoring Report for Wetland Area September 2010 Doc. No. S07050 Page i Contents 1.0 Introduction

  15. Microsoft Word - S03736_ FMP010609.doc

    Office of Legacy Management (LM)

    Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 LMS/CNT/S03736 This page intentionally left blank LMS/CNT/S03736 Fluid Management Plan Central Nevada Test Area Corrective Action Unit 443 January 2009 This page intentionally left blank U.S. Department of Energy Fluid Management Plan For CAU 443: CNTA, Subsurface, Nevada January 2009 Doc. No. S0373600 Page i Contents Acronyms and Abbreviations

  16. Microsoft Word - S04019_GSB.doc

    Office of Legacy Management (LM)

    Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 LMS/GSB/S04019 This page intentionally left blank LMS/GSB/S04019 Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009 This page intentionally left blank U.S. Department of Energy Gasbuggy, New Mexico Long-Term Hydrologic Monitoring Program Evaluation Report June 2009, Rev. 3 Doc. No. S04019 Page i Contents Abbreviations

  17. Microsoft Word - S05094_VMR.doc

    Office of Legacy Management (LM)

    08 May 2009 LMS/RVT/S05094 This page intentionally left blank LMS/RVT/S05094 Verification Monitoring Report for the Riverton, Wyoming, Processing Site Update for 2008 May 2009 This page intentionally left blank U.S. Department of Energy Riverton, Wyoming, Verification Monitoring Report May 2009 Doc. No. S05094 Page i Contents 1.0 Introduction ........................................................................................................................1-1 2.0 Site Conditions

  18. Microsoft Word - S05575_AP.doc

    Office of Legacy Management (LM)

    8 through March 2009 for the Shiprock, New Mexico, Site December 2009 LMS/SHP/S05575 This page intentionally left blank LMS/SHP/S05575 Annual Performance Report April 2008 through March 2009 for the Shiprock, New Mexico, Site December 2009 This page intentionally left blank U.S. Department of Energy Annual Performance Report, Shiprock, New Mexico December 2009 Doc. No. S05575 Page i Contents

  19. Microsoft Word - S05949_IR.doc

    Office of Legacy Management (LM)

    Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2009 LMS/MNT/S05949 This page intentionally left blank LMS/MNT/S05949 2009 Annual Inspection of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2009 This page intentionally left blank U.S. Department of Energy 2009 Annual Inspection-Monticello, Utah December 2009 Doc. No. S05949 Page i Contents Executive

  20. Microsoft Word - S06093_VMR.doc

    Office of Legacy Management (LM)

    09 April 2010 LMS/RVT/S06093 This page intentionally left blank LMS/RVT/S06093 Verification Monitoring Report for the Riverton, Wyoming, Processing Site Update for 2009 April 2010 This page intentionally left blank U.S. Department of Energy Riverton, Wyoming, Verification Monitoring Report April 2010 Doc. No. S06093 Page i Contents 1.0 Introduction ........................................................................................................................1-1 2.0 Site Conditions

  1. Microsoft Word - S06178_MP.doc

    Office of Legacy Management (LM)

    Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited LMS/RUL/S06178 This page intentionally left blank LMS/RUL/S06178 Rulison Monitoring Plan July 2010 Approved for public release; further dissemination unlimited This page intentionally left blank U.S. Department of Energy Rulison Monitoring Plan July 2010 Doc. No. S06178 Page i Contents 1.0

  2. Microsoft Word - S06182_GCAP.doc

    Office of Legacy Management (LM)

    Groundwater Compliance Action Plan for the Lakeview, Oregon, Processing Site June 2010 LMS/LKP/S06182 This page intentionally left blank LMS/LKP/S06182 Groundwater Compliance Action Plan for the Lakeview, Oregon, Processing Site June 2010 This page intentionally left blank U.S. Department of Energy Groundwater Compliance Action Plan for the Lakeview, Oregon, Processing Site June 2010 Doc. No.S06182 Page i Contents

  3. Microsoft Word - S06596_GW.doc

    Office of Legacy Management (LM)

    Annual Groundwater Report May 2009 through April 2010 September 2010 LMS/MNT/S06596 This page intentionally left blank LMS/MNT/S06596 Monticello Mill Tailings Site Operable Unit III Annual Groundwater Report May 2009 through April 2010 September 2010 This page intentionally left blank U.S. Department of Energy Monticello Mill Tailings Site OU III Annual Groundwater Report May 2009-April 2010 September 2010 Doc. No. S06596 Page i Contents

  4. Microsoft Word - aser_rev0.doc

    Office of Legacy Management (LM)

    Weiss Associates Environmental Science, Engineering and Management ANNUAL SITE ENVIRONMENTAL REPORT CALENDAR YEAR 2007 for the LABORATORY FOR ENERGY-RELATED HEALTH RESEARCH UNIVERSITY OF CALIFORNIA, DAVIS Submitted to: S.M. Stoller Corporation 2597 B ¾ Road Grand Junction, Colorado 81503 Prepared by: Weiss Associates 5801 Christie Avenue, Suite 600 Emeryville, California 94608-1827 September 30, 2008 Rev. 0 J:\DOE_STOLLER\4110\137\ASER 2007\REV. 0\ASER_REV0.DOC WEISS ASSOCIATES Project Number:

  5. Microsoft Word - S06654_ESL.doc

    Office of Environmental Management (EM)

    and Geochemical Modeling of Vanadium Contamination in Groundwater New Rifle Processing Site, Colorado July 2010 LMS/RFN/S06654 ESL-RPT-2010-01 This page intentionally left blank LMS/RFN/S06654 ESL-RPT-2010-01 Analysis and Geochemical Modeling of Vanadium Contamination in Groundwater New Rifle Processing Site, Colorado July 2010 This page intentionally left blank U.S. Department of Energy Analysis and Geochemical Modeling of Vanadium Contamination in Groundwater, Rifle, Colorado July 2010 Doc.

  6. Microsoft Word - Appendix A.doc

    Office of Legacy Management (LM)

    Background Information, Remedial Action Histories, Final Site Conditions U.S. Department of Energy Weldon Spring Site LTS&M Plan February 2005 Second Draft Final Doc. No. S00790AG Page A-iii Contents A1.0 Weldon Spring Site Description and History................................................................... A-1 A1.1 Location and Property Ownership .......................................................................... A-1 A1.2 Physiography and

  7. Microsoft Word - Appendix B.doc

    Office of Legacy Management (LM)

    Risk Assessment Information U.S. Department of Energy Weldon Spring Site LTS&M Plan February 2005 Second Draft Final Doc. No. S00790AG Page B-3 Summary of Post-Remediation Risk Status at the Weldon Spring Site Baseline risk assessments addressing both human health and ecological risks were performed as part of the remedial investigation phase of the remedial investigation/feasibility study processes conducted. A limited assessment was performed for the Quarry Bulk Waste Operable Unit (OU)

  8. Microsoft Word - S06350_EA.doc

    Office of Legacy Management (LM)

    Draft Environmental Assessment Photovoltaic Solar Project at the Durango, Colorado, Site August 2010 LMS/DUD/S06350 DOE/EA 1770 This page intentionally left blank LMS/DUD/S06350 DOE/EA 1770 Draft Environmental Assessment Photovoltaic Solar Project at the Durango, Colorado, Disposal Site August 2010 This page intentionally left blank U.S. Department of Energy Photovoltaic Solar Project at the Durango, Colorado, Site August 2010 Doc. No. S06350 Page i Contents Summary

  9. Microsoft Word - BreakoutSummary.doc

    Office of Environmental Management (EM)

    H:/TECWG/January 2002/Breakout Worksheets.doc *The number appearing in brackets refer to the number of participants with the same comment. 1. On a scale of 1 (lowest) to 10 (highest), how would you rate TEC's effectiveness relative to other comparable organizations? Average score = 7.51 2. The TEC mission is to "serve as a mechanism to provide continuing and improved coordination between appropriate DOE elements, other levels of government, and outside organizations having a responsibility

  10. Microsoft Word - DOE RFI.doc

    Office of Environmental Management (EM)

    Ms. Patricia Hoffman Assistant Secretary United States Department of Energy 1000 Independence Avenue, SW, Room 8H033 Washington, DC 20585 RE: Smart Grid RFI Dear Assistant Secretary Hoffman, Thank you for the opportunity to provide information to the Department of Energy Federal Register Doc. 2010-23251 filed September 16, 2010. With our recent acquisition of Ventyx, ABB is one of the few companies in the smart grid space that can approach the entire smart grid value chain, from distributed

  11. Office of Chief Financial Officer

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2001-11-27

    Page Change 1 to DOE O 520.1 modifies the responsibility statement to include NNSA Field CFO positions, modifies Heads of Field Elements responsibilities for consistency with the CFO responsibilities, and makes a minor change to reflect the establishment of the Office of Management, Budget and Evaluation. Cancels SEN 34-9.

  12. Microsoft Word - S0171800August.doc

    Office of Legacy Management (LM)

    Office of Legacy Management Grand Junction, Colorado, Site Site Environmental Report for Calendar Year 2004 August 2005 Office of Legacy Management DOE M/GJ885-2005 -L U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management DOE-LM/GJ885-2005 U.S. Department of Energy

  13. Microsoft Word - S03347_final.doc

    Office of Legacy Management (LM)

    7 July 2007 Office of Legacy Management DOE M/1495 2007 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy DOE-LM/1495-2007 U.S. Department of Energy Office of Legacy Management Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities

  14. Microsoft Word - S09330_2ndQtr2012.doc

    Office of Legacy Management (LM)

    Second Quarter Calendar Year 2012 October 2012 LMS/RFS/S09930 This page intentionally left blank LMS/RFS/S09930 U.S. Department of Energy Office of Legacy Management Rocky Flats, Colorado, Site Quarterly Report of Site Surveillance and Maintenance Activities Second Quarter Calendar Year 2012 October 2012 This page intentionally left blank U.S. Department of Energy Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities-2nd Quarter CY 2012 October 2012 Doc. No. S09330

  15. Microsoft Word - S09187_1stQtr2012.doc

    Office of Legacy Management (LM)

    First Quarter Calendar Year 2012 July 2012 LMS/RFS/S09187 This page intentionally left blank LMS/RFS/S09187 U.S. Department of Energy Office of Legacy Management Rocky Flats, Colorado, Site Quarterly Report of Site Surveillance and Maintenance Activities First Quarter Calendar Year 2012 July 2012 This page intentionally left blank U.S. Department of Energy Rocky Flats Site Quarterly Report of Site Surveillance and Maintenance Activities-1st Quarter CY 2012 July 2012 Doc. No. S09187 Page i

  16. Microsoft Word - U0200600-Semi-Annual Report Sept 03 to March 04.doc

    Office of Legacy Management (LM)

    200600 DOE-LM/GJ725-2004 Semiannual Performance Report September 2003 through March 2004 for the Shiprock, New Mexico, Site September 2004 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand Junction, Colorado This page intentionally left blank U.S. Department of Energy Semi-Annual Performance Report, Shiprock, New Mexico September 2004 Doc. No. U0200600 Page iii Contents 1.0

  17. Header Sheet Doc ID Z OAK RIDGE NATIONAL LABORATORY M. E. Murray

    Office of Legacy Management (LM)

    Dames & Moore Header Sheet Doc ID Z OAK RIDGE NATIONAL LABORATORY M. E. Murray MANAGED BY LOCKHEED MARTIN rNERGY RESEARCH CORPORATION PHONE: (423) 574-5838 FOR THE U.S. DEPARTMENT OF ENERGY FAX: (423) POST OFFICE Box 2 INTERNET: r'0 March 31, 1997 Mr. Andrew Meloy DuPont Environmental Remediation Services DuPont Chambers Works Route 130, Anti-Knocks Building G Deepwater, New Jersey 08023 Dear Mr. Meloy: Radiological Sampling Requirements for the B Ditch Remediation Project, DuPont Chamber

  18. TO: Procurement Directors/Contracting Officers FROM: Chief

    Energy Savers [EERE]

    10 DATE: January 4, 2016 TO: Procurement Directors/Contracting Officers FROM: Chief Contract and Financial Assistance Policy Division Office of Policy Office of Acquisition Management SUBJECT: Federal Acquisition Circular (FAC) 2005-86 SUMMARY: Attached for your information is a brief summary of Federal Acquisition Regulation (FAR) amendments, published in the December 31, 2015 Federal Register at 80 FR 81886. FAC 2005- 86 issued 3 final rules and 1interim rule. This Flash will be available

  19. TO: Procurement Directors/Contracting Officers FROM: Director

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3 DATE: June 26, 2013 TO: Procurement Directors/Contracting Officers FROM: Director Contract and Financial Assistance Policy Division Office of Policy Office of Acquisition and Project Management SUBJECT: Federal Acquisition Circular (FAC) 2005-67 SUMMARY: Attached for your information is a list of Federal Acquisition Regulation (FAR) amendments, published in the June 21, 2013 Federal Register at 78 FR 37668. This FAC issued 8 final rules, 2 interim rules, and a technical amendment. This Flash

  20. TO: Procurement Directors/Contracting Officers FROM: Director

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7 DATE: July 12, 2013 TO: Procurement Directors/Contracting Officers FROM: Director Contract and Financial Assistance Policy Division Office of Policy Office of Acquisition and Project Management SUBJECT: Federal Acquisition Circular (FAC) 2005-68 SUMMARY: Attached for your information is a list of Federal Acquisition Regulation (FAR) amendments, published in the June 26, 2013 Federal Register at 78 FR 38535. This FAC issued 1 interim rule. To view this rule go to Federal Register site then

  1. TO: Procurement Directors/Contracting Officers FROM: Director

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5 DATE: August 16, 2013 TO: Procurement Directors/Contracting Officers FROM: Director Contract and Financial Assistance Policy Division Office of Policy Office of Acquisition and Project Management SUBJECT: Federal Acquisition Circular (FAC) 2005-69 SUMMARY: Attached for your information is a list of Federal Acquisition Regulation (FAR) amendments, published in the August 1, 2013 Federal Register at 78 FR 46779. This FAC issued 6 final rules and a technical amendment. This Flash will be

  2. TO: Procurement Directors/Contracting Officers FROM: Director

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3 DATE: October 15, 2013 TO: Procurement Directors/Contracting Officers FROM: Director Contract and Financial Assistance Policy Division Office of Policy Office of Acquisition and Project Management SUBJECT: Federal Acquisition Circular (FAC) 2005-70 SUMMARY: Attached for your information is a list of Federal Acquisition Regulation (FAR) amendments, published in the September 30, 2013 Federal Register at 78 FR 60168. This FAC issued 2 interim rules. This Flash will be available online at the

  3. TO: Procurement Directors/Contracting Officers FROM: Director

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1 DATE: December 4 , 2013 TO: Procurement Directors/Contracting Officers FROM: Director Contract and Financial Assistance Policy Division Office of Policy Office of Acquisition and Project Management SUBJECT: Federal Acquisition Circular (FAC) 2005-71 SUMMARY: Attached for your information is a list of Federal Acquisition Regulation (FAR) amendments, published in the November 25, 2013 Federal Register at 78 FR 70476. This FAC issued 2 final rules and 1 technical amendment. The final rule on

  4. TO: Procurement Directors/Contracting Officers FROM: Director

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4 DATE: January 15, 2014 TO: Procurement Directors/Contracting Officers FROM: Director Contract and Financial Assistance Policy Division Office of Policy Office of Acquisition and Project Management SUBJECT: Federal Acquisition Circular (FAC) 2005-72 SUMMARY: Attached for your information is a list of Federal Acquisition Regulation (FAR) amendments, published in the December 31, 2014 Federal Register at 78 FR 80368. This FAC issued 4 final rules. Please note that the final rule on Service

  5. TO: Procurement Directors/Contracting Officers FROM: Director

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    6 DATE: July 9, 2014 TO: Procurement Directors/Contracting Officers FROM: Director Contract and Financial Assistance Policy Division Office of Policy Office of Acquisition and Project Management SUBJECT: Federal Acquisition Circular (FAC) 2005-75 SUMMARY: Attached for your information is a brief summary of Federal Acquisition Regulation (FAR) amendments, published in the June 24, 2014 Federal Register at 79 FR 35858. FAC 2005-75 issued 1 final rule and 2 interim rules

  6. TO: Procurement Directors/Contracting Officers FROM: Director

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8 DATE: August 11, 2014 TO: Procurement Directors/Contracting Officers FROM: Director Contract and Financial Assistance Policy Division Office of Policy Office of Acquisition and Project Management SUBJECT: Federal Acquisition Circular (FAC) 2005-76 SUMMARY: Attached for your information is a brief summary of Federal Acquisition Regulation (FAR) amendments, published in the July 25, 2014 Federal Register at 79 FR 43574. FAC 2005-76 issued 2 final rules, 1 interim rule and 1 technical amen

  7. TO: Procurement Directors/Contracting Officers FROM: Director

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    07 DATE: December 12, 2014 TO: Procurement Directors/Contracting Officers FROM: Director Contract and Financial Assistance Policy Division Office of Policy Office of Acquisition and Project Management SUBJECT: Federal Acquisition Circular (FAC) 2005-78 SUMMARY: Attached for your information is a brief summary of Federal Acquisition Regulation (FAR) amendments, published in the November 25, 2014 Federal Register at 79 FR 70340. FAC 2005- 78 issued 4 final rules and 1 technical amendment.. This

  8. TO: Procurement Directors/Contracting Officers FROM: Director

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7 DATE: December 19, 2012 TO: Procurement Directors/Contracting Officers FROM: Director Contract and Financial Assistance Policy Division Office of Policy Office of Acquisition and Project Management SUBJECT: Federal Acquisition Circular 2005-62 SUMMARY: Attached for your information is a list and summary of FAR amendments published in the November 20, 2012 Federal Register at 77 FR 69714. If you are issuing any acquisitions for supplies and/or services on behalf of the Department of Defense

  9. TO: Procurement Directors/Contracting Officers FROM: Director

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    8 DATE: December 19, 2012 TO: Procurement Directors/Contracting Officers FROM: Director Contract and Financial Assistance Policy Division Office of Policy Office of Acquisition and Project Management SUBJECT: Federal Acquisition Circular 2005-63 SUMMARY: The Federal Acquisition Regulation (FAR) amendment published in the December 10, 2012 Federal Register at 77 FR 73516 implements FAR Case 2012-030 Iran Threat Reduction. This interim rule amends the FAR to require certifications that implement

  10. TO: Procurement Directors/Contracting Officers FROM: Director

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    9 DATE: December 27, 2012 TO: Procurement Directors/Contracting Officers FROM: Director Contract and Financial Assistance Policy Division Office of Policy Office of Acquisition and Project Management SUBJECT: Federal Acquisition Circular 2005-64 SUMMARY: The Federal Acquisition Regulation (FAR) amendment, published in the December 21, 2012 Federal Register at 77 FR 75766, implements FAR Case 2011-028 Nondisplacement of Qualified Workers Under Service Contracts. This final rule amends the FAR to

  11. TO: Procurement Directors/Contracting Officers FROM: Director

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7 DATE: February 05, 2013 TO: Procurement Directors/Contracting Officers FROM: Director Contract and Financial Assistance Policy Division Office of Policy Office of Acquisition and Project Management SUBJECT: Federal Acquisition Circular (FAC) 2005-65 SUMMARY: Attached for your information is a list of Federal Acquisition Regulation (FAR) amendments, published in the January 29, 2013 Federal Register at 78 FR 6184. This FAC issued 4 final rules and a technical amendment. This Flash will be

  12. TO: Procurement Directors/Contracting Officers FROM: Director

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7 DATE: March 11, 2013 TO: Procurement Directors/Contracting Officers FROM: Director Contract and Financial Assistance Policy Division Office of Policy Office of Acquisition and Project Management SUBJECT: Federal Acquisition Circular (FAC) 2005-66 SUMMARY: Attached for your information is a list of Federal Acquisition Regulation (FAR) amendments, published in the February 28, 2013 Federal Register at 78 FR 13764. This FAC issued 3 final rules, 1 interim rule, and a technical amendment.

  13. The Office

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Office of Energy Efficiency and Renewable Energy (EERE) is leading the U.S. Department of Energy's efforts to deliver market-driven solutions for energy- saving homes, buildings, and manufacturing; sustainable transportation; and renewable power. Sustainable TRANSPORTATION Renewable ENERGY Energy EFFICIENCY EERE research has helped reduce production costs of automotive lithium-ion batteries by ~70% since 2008 More than electric charging units 20,000 http://www.afdc.energy.gov/fuels/

  14. Director's Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Director's Office Print Roger Falcone Director, Advanced Light Source, Ernest Orlando Lawrence Berkeley National Laboratory and Professor of Physics, University of California, Berkeley. Roger Falcone Web page at the University of California, Berkeley Advanced Light Source Lawrence Berkeley National Laboratory 1 Cyclotron Road, MS 80R0114 Berkeley, CA 94720 USA Tel. (510) 486-6692 Fax (510) 486-4960 Email: This e-mail address is being protected from spambots. You need JavaScript enabled to view

  15. Director's Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Director's Office Print Roger Falcone Director, Advanced Light Source, Ernest Orlando Lawrence Berkeley National Laboratory and Professor of Physics, University of California, Berkeley. Roger Falcone Web page at the University of California, Berkeley Advanced Light Source Lawrence Berkeley National Laboratory 1 Cyclotron Road, MS 80R0114 Berkeley, CA 94720 USA Tel. (510) 486-6692 Fax (510) 486-4960 Email: This e-mail address is being protected from spambots. You need JavaScript enabled to view

  16. Director's Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Director's Office Print Roger Falcone Director, Advanced Light Source, Ernest Orlando Lawrence Berkeley National Laboratory and Professor of Physics, University of California, Berkeley. Roger Falcone Web page at the University of California, Berkeley Advanced Light Source Lawrence Berkeley National Laboratory 1 Cyclotron Road, MS 80R0114 Berkeley, CA 94720 USA Tel. (510) 486-6692 Fax (510) 486-4960 Email: This e-mail address is being protected from spambots. You need JavaScript enabled to view

  17. AL2007-02.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2.doc&#0; AL2007-02.doc&#0; PDF icon AL2007-02.doc&#0; More Documents & Publications Attached is Policy Flash 2013-34 Department of Energy Acquisition Letter 2013-04 on Executive Compensation Acquisition Letter No. AL 2014-07 Policy Flash 2014-29 Acquisition Letter 2014-07 - Benchmark Compensation Amount for Individual Executive Salary Actions

  18. AcqGuide70pt4.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    pt4.doc&#0; AcqGuide70pt4.doc&#0; PDF icon AcqGuide70pt4.doc&#0; More Documents & Publications Chapter 70 - DOE Management and Operating Contracts 2014-02 Acquistion Letter 2014-01: Management and Operating Contractors' Audit Coverage of Cost-Reimbursement Subcontracts Acquisition Letter No. AL 2014-01

  19. Microsoft Word - AL2005-13.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3.doc Microsoft Word - AL2005-13.doc PDF icon Microsoft Word - AL2005-13.doc More Documents & Publications PBA2007 Presentation-short-6-19-07DOE&#0; Accident Investigation of the February 7, 2013, Scissor Lift Accident in the West Hackberry Brine Tank-14 Resulting in Injury, Strategic Petroleum Reserve West Hackberry, LA Microsoft Word - AcqGuide37pt1 binney Nov 2010

  20. Microsoft Word - cover-pi.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    FY04-FY05 WORK PROPOSAL March 2003 Submitted to: Office of Fusion Energy Sciences Office of Energy Research U.S. Department of Energy Germantown, MD 20874 Alcator Project Principal...

  1. Microsoft Word - AL2008-06.doc

    Broader source: Energy.gov (indexed) [DOE]

    or (202) 287-1332 in the Office of Procurement and Assistance Policy or for NNSA, Stephen Law at Stephen.law@nnsa.doe.gov or (202) 586-4321 in the Office of Acquisition and...

  2. Microsoft Word - AL2006-09.doc

    Broader source: Energy.gov (indexed) [DOE]

    Policy, MA-61, (202) 287-1339 or Richard.Langston@hq.doe.gov or for NNSA, Mr. Stephen Law, Office of Acquisition and Supply Management Office, NA-63, (202) 586-4321 or...

  3. Microsoft Word - CBFO Manager Transition.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Carlsbad Field Office Manager Transition CARLSBAD, N.M., September 7, 2010 - Dr. Dave Moody has been selected to lead DOE's Office of Environmental Management at the Savannah River...

  4. Microsoft Word - SF30 A053.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    TITLE OF SIGNER (Type or print) 16A NAME AND TITLE OF CONTRACTING OFFICER (Type or print) Michael K. Barrett, Contracting Officer 15B. CONTRACTOROFFEROR 15C. DATE SIGNED 16B....

  5. Enter the Post-Doc: The Untapped Sourcing Pipeline

    SciTech Connect (OSTI)

    Boscow, Ryan B.

    2011-07-30

    This article addresses the potential formulation and utilization of an industry-based Post-Doc program in order to create workforce candidate pipelines with targeted universities.

  6. Microsoft Word - DOE_Staffing_Study_Cover.doc | Department of...

    Office of Environmental Management (EM)

    Word - DOEStaffingStudyCover.doc More Documents & Publications 2010 DOE Strategic Sustainability Performance Plan - Report to the White House Council on Environmental...

  7. Doc Cambell's Post Greenhouse Low Temperature Geothermal Facility...

    Open Energy Info (EERE)

    Low Temperature Geothermal Facility Facility Doc Cambell's Post Sector Geothermal energy Type Greenhouse Location Las Cruces, New Mexico Coordinates 32.3123157,...

  8. DOC-DOE China Mission Announcement Press Release | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Press Release More Documents & Publications DOC-DOE Joint China Mission Statement China 2015 Business Development Mission Marketing Flyer DOE-LPOEmail-Update001Through11

  9. pocforms06a0399.doc | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    More Documents & Publications fleetappforms04f1298.doc&0; OPC Security Whitepaper 3Hardening Guidelines for OPC Hosts Critical Decision 2 (CD-2) Approval Template...

  10. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    09 Doc. No. S05767 Page A-1 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page A-2 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page A-3 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page A-4 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009

  11. Microsoft Word - S05827_WCR_Final.doc

    Office of Legacy Management (LM)

    Response to Comments This page intentionally left blank U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page G-1 Well Completion Report for CAU 443 CNTA U.S. Department of Energy Doc. No. S05827 December 2009 Page G-2 U.S. Department of Energy Well Completion Report for CAU 443 CNTA December 2009 Doc. No. S05827 Page G-3 Well Completion Report for CAU 443 CNTA U.S. Department of Energy Doc. No. S05827 December 2009 Page G-4

  12. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    NRC Concurrence with Completion of Remedial Action This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page A-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page A-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No.

  13. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    Real Estate Documentation This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page B-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page B-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page B-6

  14. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    NRC Technical Evaluation Report on Revised LTSP This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page D-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page D-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page D-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No.

  15. Microsoft Word - S0130700_Mar 2008Rev June 2008.doc

    Office of Legacy Management (LM)

    Agency Notification Agreements This page intentionally left blank U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-3 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008 Page E-4 U.S. Department of Energy LTSP for the Falls City, Texas, Disposal Site March 2008 Doc. No. S0130700 Page E-5 LTSP for the Falls City, Texas, Disposal Site U.S. Department of Energy Doc. No. S0130700 March 2008

  16. Microsoft Word - FFATA Memo 30 March 2007.doc | Department of...

    Broader source: Energy.gov (indexed) [DOE]

    FFATA Memo 30 March 2007.doc More Documents & Publications Policy Flash 2014-35 Rescission of American Recovery and Reinvestment Act Reporting Requirements. Flash2008-44attachment....

  17. Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc | Department...

    Energy Savers [EERE]

    ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc Microsoft Word - AL-ARRAGAODeviation 6.12.09.doc More Documents & Publications Microsoft Word -...

  18. Microsoft Word - Flash2009dashxxFAC34.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc Microsoft Word - Flash2009dashxxFAC34.doc More Documents & Publications Federal Acquisition Regulation; Federal...

  19. Microsoft Word - Flash2008-08attachmentFAC22.doc | Department...

    Energy Savers [EERE]

    Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc Microsoft Word - Flash2008-08attachmentFAC22.doc More Documents & Publications Policy Flash 2013-75...

  20. Microsoft Word - Flash2007-61FACAttachment.doc | Department of...

    Energy Savers [EERE]

    Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc Microsoft Word - Flash2007-61FACAttachment.doc More Documents & Publications Microsoft Word -...

  1. Microsoft Word - PolicyFlash2007-10Attch2.doc | Department of...

    Energy Savers [EERE]

    PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc Microsoft Word - PolicyFlash2007-10Attch2.doc More Documents & Publications Policy Flash 2013-37 Federal...

  2. Microsoft Word - Policy Flash 2008-02.doc | Department of Energy

    Energy Savers [EERE]

    Microsoft Word - Policy Flash 2008-02.doc Microsoft Word - Policy Flash 2008-02.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  3. Microsoft Word - Policy Flash 2008-03.doc | Department of Energy

    Energy Savers [EERE]

    Microsoft Word - Policy Flash 2008-03.doc Microsoft Word - Policy Flash 2008-03.doc More Documents & Publications Microsoft Word - Policy Flash 2008-07.doc Microsoft Word - Policy...

  4. Microsoft Word - ARRAGuideAttachment10v1.doc | Department of Energy

    Office of Environmental Management (EM)

    ARRAGuideAttachment10v1.doc Microsoft Word - ARRAGuideAttachment10v1.doc More Documents & Publications Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - DRAFT CRB Interview Guidance

  5. Office of Chief Financial Officer

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3 DOE/CF-0098 Volume 3 Department of Energy FY 2015 Congressional Budget Request Energy Efficiency and Renewable Energy Electricity Delivery and Energy Reliability Nuclear Energy Fossil Energy Research and Development Naval Petroleum and Oil Shale Reserves Strategic Petroleum Reserve Northeast Home Heating Oil Reserve Elk Hills School Lands Fund Advanced Tech. Vehicles Manufacturing Loan Program Title 17 Innovative Tech. Loan Guarantee Program Office of Indian Energy Policy and Programs Energy

  6. Operations Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    (~ii~,Richland Operations Office ~Z4TESO~Richland, Washington 99352 SEP 2 2009 CERTIFIED MAIL Ms. Sarah Washburn Heart of America Northwest 1314 N.E. 5 6 th Street Suite 100 Seattle, Washington 98105 Dear Ms. Washburn: FREEDOM OF INFORMATION ACT REQUEST (FOI 2009-0067) You requested, pursuant to the Freedom of Information Act (FOJA), the following documents relating to: 1 . "The authorization, decision to use, and actual use of any and all pesticides and herbicides anywhere within the

  7. DOE HR Guidebook 12_15_05.DOC | Department of Energy

    Office of Environmental Management (EM)

    DOE HR Guidebook 12_15_05.DOC&#0; DOE HR Guidebook 12_15_05.DOC&#0; PDF icon DOE HR Guidebook 12_15_05.DOC&#0; More Documents & Publications Operating Guidelines Appendix A B.DOC&#0; 2 Jun 03 Roles and Responsibilities _CSO Highlighted_.doc&#0; Operating Guidelines Appendix C D.DOC&#0;

  8. Microsoft Word - S01918-VMR 2005.doc

    Office of Legacy Management (LM)

    Management Verification Monitoring Report for the Gunnison, Colorado, Processing Site September 2005 Office of Legacy Management DOE M/GJ969-2005 -L U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management This page intentionally left blank S0191800 DOE-LM/GJ969-2005

  9. Microsoft Word - S0106300-December2004.DOC

    Office of Legacy Management (LM)

    704 U.S. Department of Energy Long-Term Surveillance and Maintenance Plan for Site A/Plot M, Illinois, Decommissioned Reactor December 2004 Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management S0106300 DOE-LM/GJ704-2004 U.S. Department of Energy Office of Legacy Management Long-Term

  10. Microsoft Word - S0217900_April.doc

    Office of Legacy Management (LM)

    Update for 2005 April 2006 Office of Legacy Management DOE M/GJ1127-2006 -L U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management This page intentionally left blank DOE-LM/GJ1127-2006 Verification Monitoring Report for the Riverton, Wyoming, Processing Site Update for

  11. Microsoft Word - S0221000_072606.doc

    Office of Legacy Management (LM)

    Soil and Ground Water Phytoremediation Pilot Studies at Monument Valley, Arizona 2005 Status Report July 2006 Office of Legacy Management DOE M/1254-2006 -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy This page intentionally left blank DOE LM/1254-2006 Soil

  12. Microsoft Word - S0224300 September 2006.doc

    Office of Legacy Management (LM)

    Third Five-Year Review September 2006 Office of Legacy Management DOE M/GJ1158-2006 -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy DOE-LM/GJ1158-2006 Weldon Spring Site Third Five-Year Review September 2006 Work Performed by S.M. Stoller Corporation under DOE

  13. Microsoft Word - S0226100June 2006.doc

    Office of Legacy Management (LM)

    5 July 2006 Office of Legacy Management DOE M/GJ1213-2006 -L DOE M/GJ1213-2006 -L U.S. Department of Energy Office of Legacy Management U.S. Department of Energy Office of Legacy Management Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. DOE-LM/GJ1213-2006 U.S. Department of Energy Office of Legacy Management Weldon Spring Site Environmental Report for Calendar Year 2005

  14. Microsoft Word - S02997_mmts 2007.doc

    Office of Legacy Management (LM)

    Third Five-Year Review Report for Monticello Mill Tailings (USDOE) Site City of Monticello San Juan County, Utah June 2007 Office of Legacy Management DOE M/1472 2007 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy U.S. Department of Energy MMTS Third

  15. Microsoft Word - S03729_Dec2007.doc

    Office of Legacy Management (LM)

    of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2007 Office of Legacy Management DOE M/1554 2007 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy DOE-LM/1554-2007 2007 Annual Inspection of the

  16. Microsoft Word - S04200VMR.doc

    Office of Legacy Management (LM)

    Update for 2007 Office of Legacy Management DOE M/1603 2008 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AM01-07LM00060 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy This page intentionally left blank DOE-LM/1603-2008 Verification Monitoring Report for the Riverton, Wyoming, Processing Site Update for 2007 April

  17. Microsoft Word - TR01-18.doc

    Office of Legacy Management (LM)

    Report for the Weldon Spring, Missouri, Site January 2007 Office of Legacy Management DOE M/1425 2007 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy U.S. Department of Energy 2006 Annual Inspection - Weldon Spring, Missouri January 2007 Page 1 2006 Annual

  18. Microsoft Word - TR02-23.doc

    Office of Legacy Management (LM)

    Report for the Weldon Spring, Missouri, Site February 2006 Office of Legacy Management DOE M/GJ1137-2006 -L U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy 2005 Annual Inspection - Weldon Spring, Missouri February 2006 Page 1 2005 Annual

  19. Microsoft Word - TR12-17.doc

    Office of Legacy Management (LM)

    Report for the Weldon Spring, Missouri, Site December 2007 Office of Legacy Management DOE M/1561 2007 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy U.S. Department of Energy 2007 Annual Inspection - Weldon Spring, Missouri December 2007 Page 1 2007 Annual

  20. Microsoft Word - TR12-30.doc

    Office of Legacy Management (LM)

    of the Monticello Mill Tailings (USDOE) and Monticello Radioactively Contaminated Properties Sites December 2005 Office of Legacy Management DOE M/GJ1065-2005 -L U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy 2005 Annual

  1. Microsoft Word - s00400-sept2004.doc

    Office of Legacy Management (LM)

    U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management Long-Term Surveillance Plan for the U.S. Department of Energy L-Bar, New Mexico, (UMTRCA Title II) Disposal Site, Seboyeta, New Mexico September 2004 DOE LM/GJ709 2004 - - S00400 DOE-LM/GJ709-2004 Office of Legacy

  2. Microsoft Word - s00799-december-2004.doc

    Office of Legacy Management (LM)

    GJ766-2004 -L U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management Long-Term Surveillance Plan for the U.S. Department of Energy Shirley Basin South (UMTRCA Title II) Disposal Site, Carbon County, Wyoming December 2004 S00799 DOE-LM/GJ766-2004 Office of Legacy

  3. Microsoft Word - dec-may07.doc

    Office of Legacy Management (LM)

    December 2006 through May 2007 June 2007 Office of Legacy Management DOE M/1493 2007 - -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy DOE-LM/1493-2007 Pinellas Environmental Restoration Project Semiannual Progress Report 4.5 Acre Site December 2006 through

  4. Microsoft Word - s00583_January2005.doc

    Office of Legacy Management (LM)

    Lowman, Idaho, (UMTRCA Title I) Disposal Site Long-Term Surveillance Plan for the U.S. Department of Energy Lowman, Idaho, (UMTRCA Title I) Disposal Site January 2005 Office of Legacy Management DOE M/GJ 2005 - -L 771 U.S. Department of Energy Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy

  5. Microsoft Word - S0123800_050107.doc

    Office of Environmental Management (EM)

    Legacy Management CERCLA Sites Quality Assurance Project Plan Office of Legacy Management DOE M/GJ1232-2006 -L Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy Management Office of Legacy Management U.S. Department of Energy U n c o n t r o l l e d C o p y CERCLA Sites QAPP Summary of Changes May 3, 2007 Page i Summary of

  6. Office of the Chief Financial Officer .:. Lawrence Berkeley National...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Office of the Chief Financial Officer Office of the Cheif Financial Officer Lawrence Berkeley Naitonal Laboratory Department of Energy Quicklinks: ---...

  7. Office of Electricity Delivery and Energy Reliability Recovery Program Plan

    Energy Savers [EERE]

    | Department of Energy Electricity Delivery and Energy Reliability Recovery Program Plan Office of Electricity Delivery and Energy Reliability Recovery Program Plan PDF icon Microsoft Word - OE PSRP June 5 2009 _OE_ Final.doc More Documents & Publications Microsoft Word - PSRP Updates 6-25-10_v2 Update to the 2008 EAC Report: "Smart Grid: Enabler of the New Energy Economy Report Recommendations" Microsoft Word - PSRP Updates 6-25-10_v2

  8. Office of Fossil Energy

    Broader source: Energy.gov (indexed) [DOE]

    Terminal (Bcf) (Bcf) (Bcf) LNG Imports by Company Office of Fossil Energy Office of Oil & Natural Gas Office of Regulation and International Engagement Division of Natural Gas...

  9. Microsoft Word - US_Japan_REE_agenda_ver7.doc | Department of...

    Office of Environmental Management (EM)

    Microsoft Word - USJapanREEagendaver7.doc Microsoft Word - USJapanREEagendaver7.doc U.S. - Japan Roundtable on Rare Earth Elements Research PDF icon Microsoft Word -...

  10. OP-PR-0015.001.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    OP-PR-0015.001.doc Begin Shutdown Date: 2000/12/08 To eliminate the possibility of going into a state of operations when people may be working on ladders or in the ring, the following SOP's are required of every shutdown. A shutdown is defined as a period wherein there are no accelerator operations. This procedure is in effect for all scheduled shutdowns and for non-scheduled shutdowns lasting more than 24 hours. 1. The accelerator staff must inform the CAMD staff of a shutdown via e-mail. In

  11. Microsoft Word - S03273_Rev1.doc

    Office of Legacy Management (LM)

    Surface, Hot Creek Valley, Nevada, for Calendar Year 2007 September 2008 Rev. 1 DOE-LM/1558-2007 This page intentionally left blank DOE-LM/1558-2008 Post-Closure Inspection and Monitoring Report for Corrective Action Unit 417: Central Nevada Test Area Surface, Hot Creek Valley, Nevada for Calendar Year 2007 September 2008 Rev. 1 This page intentionally left blank U.S. Department of Energy CY 2007 Post-Closure Inspection & Monitoring Report for CAU 417 September 2008, Rev. 1 Doc. No. S0327300

  12. Microsoft Word - S05069_ROD.doc

    Office of Legacy Management (LM)

    Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 LMS/LEH/S05069 This page intentionally left blank LMS/LEH/S05069 Record of Decision for DOE Areas at the Laboratory for Energy-Related Health Research University of California, Davis September 2009 This page intentionally left blank U.S. Department of Energy ROD for DOE Areas for LEHR September 2009 Doc. No. S05069, Rev. 0 Page i Contents Acronyms and Abbreviations

  13. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    Annual Assessment Checklists For Parcels D, H, 4, and 3 and Phase I Land Parcel (Physical Walkover Conducted on April 14, 2009) This page intentionally left blank CHECKLIST WORKSHEET - COMBINED - ALL PARCELS Review of Effectiveness of Institutional Controls U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. No. S06401 Page A-1 Parcels reviewed: D, H, 3, 4, 6, 7, 8, and Phase I (A, B, and C) Preliminary inspections performed on:

  14. Microsoft Word - S06401_IC.doc

    Office of Legacy Management (LM)

    Effectiveness of Site-Wide Institutional Controls Applied to the Former DOE Mound Site Property June 2010 LMS/MND/S06401 This page intentionally left blank LMS/MND/S06401 Annual Assessment of the Effectiveness of Site-Wide Institutional Controls Applied to the Former DOE Mound Site Property June 2010 This page intentionally left blank U.S. Department of Energy Annual Assessment of the Effectiveness of Site-Wide Institutional Controls June 2010 Doc. No. S06401 Page i Contents

  15. Microsoft Word - Q00336-Sept- 2004.doc

    Office of Legacy Management (LM)

    652 U.S. Department of Energy Remedial Action Report for the Interim Remedial Action Record of Decision Operable Unit III, Surface Water and Ground Water Monticello Mill Tailings (USDOE) Site, Monticello, Utah EPA CERCLIS Identification Number UT 3890090035 September 2004 Work Performed Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. DE-AC01-02GJ79491 Approved for public release; distribution is unlimited. Office of Legacy Management Office of Legacy

  16. Microsoft Word - Yucca PCard Report.doc

    Office of Environmental Management (EM)

    AAAAAAAAAAAAAAAAA Inspection Report Yucca Mountain Project Purchase Card Programs INS-O-09-04 August 2009 U.S. Department of Energy Office of Inspector General Office of Inspections MEMORANDUM FOR DIRECTOR, OFFICE OF CILIVIAN RADIOACTIVE WASTE MANAGEMENT FROM: Herbert Richardson Principal Deputy Inspector General SUBJECT: INFORMATION: Inspection Report on "Yucca Mountain Purchase Card Programs" BACKGROUND Yucca Mountain Project (Project) is the Nation's first proposed storage facility

  17. Microsoft Word - 12189a.doc

    Office of Environmental Management (EM)

    2 Conference, February 26 - March 1, 2012, Phoenix, Arizona, USA 1 Overview of the U.S. Department of Energy Formerly Utilized Sites Remedial Action Program - 12189 Christopher Clayton*, Vijendra Kothari**, Ken Starr***, Joey Gillespie****, and Michael Widdop**** * U.S. Department of Energy Office of Legacy Management, Washington, DC ** U.S. Department of Energy Office of Legacy Management, Morgantown, West Virginia *** U.S. Department of Energy Office of Legacy Management, Westminster, Colorado

  18. Microsoft Word - BPA Personal Property.doc

    Office of Environmental Management (EM)

    U.S. Department of Energy Office of Inspector General Office of Audit Services Audit Report Management Controls over the Bonneville Power Administration's Personal Property Accountability OAS-M-08-01 October 2007 Department of Energy vvasnlngron, UL LUSU:, October 1 , 2007 MEMORANDUM FOR TQ-YADMINISTRATOR, BONNEVILLE POWER ADNIINISTRATION [?L&& < / ( ' F'IIOM. or" Collard / Assistant Inspector General for Performance Audits Office of Inspector General INFORMATION: Audit Report

  19. Microsoft Word - AL2005-12.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    principles. Second, the contracting officer determines if the costs are reasonable in nature and amount. The Standards for Reimbursement of Contractor Meal Costs The standards for...

  20. Microsoft Word - DOE Document _2_.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    OF ENERGY OFFICE OF ELECTRICITY DELIVERY AND ENERGY RELIABILITY NORTHERN PASS TRANSMISSION LLC DOCKET NO. PP- ... cover the costs of, and investment in, the Project. 1.5 ...

  1. Microsoft Word - AL2006-01.doc

    Broader source: Energy.gov (indexed) [DOE]

    in effect until superseded or canceled. What are the Points of Contact? Contact Stephen Zvolensky, Department of Energy (DOE) Office of Procurement and Assistance Policy, at...

  2. AcqGuide4pt2.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    activities. The Office of Public Affairs establishes guidelines for the review and coordination of activities for that mission. These activities include coordination on contacts...

  3. Microsoft Word - al2006-12.doc

    Broader source: Energy.gov (indexed) [DOE]

    AL-2006-12 (092906) 7 III. What Procedures Ensure Effective Audit Management? Some strategies for managing required audit activity include: 1. Contracting officers should...

  4. SR-09-01 _SWPF_.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    using proven separation technologies of filtration and centrifugal contactors. -MORE- SR-08-01 Savannah River Operations Office SWPF CONSTRUCTION 2-2-2-2 After separation, the...

  5. Microsoft Word - SF30 A050.DOC

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contractor is not, is required to sign this document and return copies to the issuing office. 14. DESCRIPTION OF AMENDMENTMODIFICATION (Organized by UCF section headings,...

  6. Microsoft Word - Report Cover _2_.doc

    Office of Environmental Management (EM)

    Audit Report Management Controls over Small Business Opportunities at Oak Ridge National Laboratory OAS-M-08-08 July 2008 U.S. Department of Energy Office of Inspector General Office of Audit Services Department of Energy Washington, DC 2 0 5 8 5 July 2 , 2 0 0 8 MEMORANDUM FOR T H ~ ~ ~ A N A G E R , OAK RIDGE OFFICE FROM: - ~ s s i s t a n ~ ~ n s ~ e c t o r General for NNSA and Energy Audits Office of Inspector General SUBJECT: INFORMATION: Audit Report on "Management Controls over

  7. GSA GSA Office of Governmentwide Policy

    Broader source: Energy.gov (indexed) [DOE]

    GSA Office of Governmentwide Policy CIVILIAN AGENCY ACQUISITION LETTER 201 0-0 1 MEMORANDUM FOR CIVILIAN AGENCIES OTHER THAN NASA FROM: SUBJECT: CHATRMAN CIVILIAN AGENCY ACQUISITION COUNCIL Class Deviation from the Federal Acquisition Regulation (FAR) to implement new increased thresholds for the Trade Agreements On December 29,2009 (74 FR 68907), the United States Trade Representative established new procurement thresholds. These thresholds became effective on January 1,2010. An expedited FAR

  8. Microsoft Word - 09012033_DVP.doc

    Office of Legacy Management (LM)

    Grand Junction, Colorado, Office Site April 2009 LMS/GJO/S00209 This page intentionally left blank U.S. Department of Energy DVP-February 2009, Grand Junction, Colorado, Office Site April 2009 RIN 09012033 Page i Contents Sampling Event Summary ...............................................................................................................1 Grand Junction Site, Sample Location Map ....................................................................................4 Data Assessment

  9. Microsoft Word - IG-0659 pdf.doc

    Office of Environmental Management (EM)

    U.S. Department of Energy Office of Inspector General Office of Audit Operations Audit Report The Stabilization of Nuclear Materials at Los Alamos National Laboratory DOE/IG-0659 August 2004 REPORT ON THE STABILIZATION OF NUCLEAR MATERIALS AT LOS ALAMOS NATIONAL LABORATORY TABLE OF CONTENTS Nuclear Materials Stabilization Program Details of Finding................................................... 1 Recommendations and Comments................................ 3 Appendices 1. Objective, Scope,

  10. Geothermal Technologies Office - Webmaster | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Technologies Office - Webmaster Geothermal Technologies Office - Webmaster

  11. Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    TSLCC 2007_5_05_08 rev 1.doc Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc PDF icon Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc More Documents & Publications FY 2007 Total System Life Cycle Cost, Pub 2008 Microsoft Word - TSLCC 2007_5_05_08 rev 1.doc FY 2007 Fee Adequacy, Pub 2008

  12. AcqGuideChapter39pt2.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AcqGuideChapter39pt2.doc&#0; AcqGuideChapter39pt2.doc&#0; PDF icon AcqGuideChapter39pt2.doc&#0; More Documents & Publications Chapter 39 - Acquisition of Information Technology Department of Energy (DOE) Acquisition Guide Microsoft Word - AL2006-08.doc

  13. Microsoft Word - ALonEO13423Last.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ALonEO13423Last.doc Microsoft Word - ALonEO13423Last.doc PDF icon Microsoft Word - ALonEO13423Last.doc More Documents & Publications Microsoft Word - AL2008-05.doc Tri-Party Agreement for Energy Savings Performance Contracts Photovoltaics at DOE's National Renewable Energy Laboratory License

  14. Microsoft Word - FAL2003-03R.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3-03R.doc Microsoft Word - FAL2003-03R.doc PDF icon Microsoft Word - FAL2003-03R.doc More Documents & Publications Microsoft Word - FAL2003-03Rattach.doc FAL2003-03Attachment.pdf FAL2003-03.pdf

  15. Microsoft Word - FY08AnnualReport.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    FY08AnnualReport.doc Microsoft Word - FY08AnnualReport.doc PDF icon Microsoft Word - FY08AnnualReport.doc More Documents & Publications Microsoft Word - FY09AnnualReportv1.doc Audit Report: IG-0857 Audit Report: OAS-M-13-07

  16. Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

    Broader source: Energy.gov [DOE]

    Energy Savings Performance Contracting-Savings Measurement and Verification Transcript 2-24-2011.doc

  17. Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

    Office of Energy Efficiency and Renewable Energy (EERE)

    Community Development Finance Institutions-Opportunities for Partnerships with Energy Efficiency Programs Transcript.doc

  18. Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc | Department of

    Office of Environmental Management (EM)

    Energy PPL 970-Materials and Inventory 5-9-05.doc Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc PDF icon Microsoft Word - PPL 970-Materials and Inventory 5-9-05.doc More Documents & Publications Microsoft Word - al95-06.doc DOE-HDBK-1139-2006 ppl970-3.pdf

  19. Microsoft Word - 1_2011_CEG_Update_v2.doc | Department of Energy

    Office of Environmental Management (EM)

    1_2011_CEG_Update_v2.doc Microsoft Word - 1_2011_CEG_Update_v2.doc PDF icon Microsoft Word - 1_2011_CEG_Update_v2.doc More Documents & Publications OPAM Policy Acquisition Guides Microsoft Word - AL2006-07.doc IT Project Management Profile

  20. Microsoft Word - GC Mediation Evaluation _2-06-09_.doc | Department of

    Office of Environmental Management (EM)

    Energy GC Mediation Evaluation _2-06-09_.doc Microsoft Word - GC Mediation Evaluation _2-06-09_.doc PDF icon Microsoft Word - GC Mediation Evaluation _2-06-09_.doc More Documents & Publications Mediation Survey Form Microsoft Word - ARRAAttachment12v1.doc Microsoft Word - DRAFT CRB Interview Guidance

  1. Microsoft Word - S05767_PostClosureInspRpt.doc

    Office of Legacy Management (LM)

    NDEP Correspondence and Record of Review This page intentionally left blank U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page D-1 Post-Closure Inspection & Monitoring Report for CAU 417 U.S. Department of Energy Doc. No. S05767 October 2009 Page D-2 U.S. Department of Energy Post-Closure Inspection & Monitoring Report for CAU 417 October 2009 Doc. No. S05767 Page D-3 Due Date 12-23-09 Review No. 1 Project Offsites -

  2. Microsoft Word - Appendix M_ContingencyTrees.doc

    Office of Legacy Management (LM)

    M Groundwater Operable Unit Contingency Trees U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page M-3 Figure M-1. Validation and Statistical Evaluation Scheme Weldon Spring Site LTS&M Plan U.S. Department of Energy Doc. No. S0079000 July 2005 Page M-4 Figure M-2. Decision Tree for Objective 1 Data U.S. Department of Energy Weldon Spring Site LTS&M Plan July 2005 Doc. No. S0079000 Page M-5 Figure M-3. Decision Tree for Objective 2 Data Weldon

  3. Microsoft Word - FOIA Log FY 2002.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 FOIA - Request Log 1 Closed/ Date No. Dated Date Rec'd HQ or Dir. Subject Yes/ 1/30/02 001 12/3/02 12/21/02 Richland Transfer Richland Operation Office search for records they located documents originated by the DOE Carlsbad Field Office that may be responsive to Mr. Hongs request. By transfer of this letter they forwarded Mr. Hong request, along with the documents located at Richland to the Carlsbad FOIA Office. CBFO will respond directly to Mr. Hong with a release determination Yes/ 2/13/02

  4. Microsoft Word - Final Report.doc

    Office of Environmental Management (EM)

    Management Controls over Operations of the Integrated Disposal Facility at the Hanford Site OAS-M-08-04 December 2007 Department of Energy VVashington, DC 20585 December 18, 2 0 0 7 MEMORANDUM FOR THE CHIEF OPERATING OFFICER, OFFICE OF FROM: " , . / l r , &&~2.[.(~ &r"gr&. Collard . ~ s s i s i a n t Inspector General for NNSA and Energy Audits Office of Inspector General SUBJECT: INFORMATION: Audit Report on "Management Controls over Operations of the Integrated

  5. Microsoft Word - THILLY, Ludovic - Abstract.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ludovic Thilly Institut Pprime, CNRS-University of Poitiers-ENSMA SP2MI, 86962 Futuroscope, France Ludovic.thilly@univ-poitiers.fr Cu/Nb nanocomposite wires processed by severe plastic deformation for high pulsed magnets: effects of the nanostructure on the resistance to high stress, high temperature and irradiation Copper-based high strength and high electrical conductivity nanocomposite wires reinforced by Nb nanotubes are prepared by severe plastic deformation, applied with an Accumulative

  6. Microsoft Word - AcqGuide70pt31A.doc | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AcqGuide70pt31A.doc Microsoft Word - AcqGuide70pt31A.doc PDF icon Microsoft Word - AcqGuide70pt31A.doc More Documents & Publications AcqGuide70pt31.doc&#0; Policy Flash 2014-26 Acquisition Guide Chapter 70.31A - Costs Associated with Whistleblower Actions Microsoft Word - AcqGuide70pt31B.doc

  7. Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc |

    Office of Environmental Management (EM)

    Department of Energy NationalPolicyAssurancesAwardTermsFinal81804.doc Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc PDF icon Microsoft Word - NationalPolicyAssurancesAwardTermsFinal81804.doc More Documents & Publications Microsoft Word - National Policy AssurancesAwardTermsREVJuly2005.doc National Policy Assurances to be Incorporated as Award Terms Microsoft Word - NationalPolicyAssurances5-06.doc

  8. Richland Operations Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    deliberative material could adversely affect DOE's ability to obtain straightforward and fr-ank recommendations and opinions in the future. This would stifle the free...

  9. OFFICE OF THE CHIEF INFORMATION OFFICER (OCIO)

    Energy Savers [EERE]

    OFFICE OF THE CHIEF INFORMATION OFFICER (OCIO) FY 2013 HUMAN CAPITAL MANAGEMENT PLAN Executive Summary: The mission of the Office of the Chief Information Officer (OCIO) is to enable the Department of Energy's urgent missions in energy, science, and nuclear security through the power of information and technology in a manner that balances risk with required outcomes in programs that span from open science to national security. DOE promotes effective operations by encouraging performance-based

  10. Office of the Chief Financial Officer

    Broader source: Energy.gov [DOE]

    Welcome to the U.S. Department of Energy, Office of the Chief Financial Officer. The mission of the Office of the Chief Financial Officer is to assure the effective management and financial integrity of Department of Energy programs, activities, and resources by developing and implementing and monitoring Department-wide policies and systems in the areas of budget administration, program analysis and evaluation, finance and accounting, internal controls, corporate financial systems, and strategic planning.

  11. Microsoft Word - 12-1568.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    68:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 December 12, 2012 Mr. John E. Kieling, Chief Hazardous Waste Bureau New Mexico...

  12. Microsoft Word - 09-1690.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MAG:09-1690:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 September 22, 2009 Mr. Steve Zappe, Project Leader Hazardous Materials...

  13. AcqGuide70pt28.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    70.28 (April 2005) 1 Contractor Insurance Reference: FAR 28.3 and 42.302; DEAR 970.28; DOE Order 350.1 Overview This section provides guidance to Contracting Officers who are...

  14. Microsoft Word - 12-1433.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    have any questions, please contact Mr. Randy Unger, Director of the Office of Quality Assurance at (575) 234-7065. Sincerely, Original Signature on File Jose R. Franco, Manager...

  15. Microsoft Word - FOIA Log FY 2003.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    to scope of work, and the like Yes 12403 003 11503 12203 Direct Requested that you forward to this office your latest organizational chart, andor staff directory at your...

  16. Microsoft Word - SF30_A007.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    U.S. Department of Energy Office of River Protection P. O. Box 450, MS H6-60 Richland, WA 99352 8. NAME AND ADDRESS OF CONTRACTOR (No., street, county, State and ZIP code) 9A....

  17. Microsoft Word - Cooling Tower Report.doc

    Office of Environmental Management (EM)

    Electricity Reliability Impacts of a Mandatory Cooling Tower Rule for Existing Steam Generation Units U.S. Department of Energy Office of Electricity Delivery and Energy Reliability October 2008 ii iii TABLE OF CONTENTS EXECUTIVE SUMMARY ........................................................................................................................... i

  18. Microsoft Word - P04-00147.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ARM-0401 Tropical Warm Pool International Cloud Experiment (TWP-ICE): Cloud and Rain Characteristics in the Australian Monsoon May 2004 P. T. May and C. Jakob Bureau of Meteorology Research Centre Victoria 3001, Australia J. H. Mather Pacific Northwest National Laboratory Richland, Washington Work supported by the U.S. Department of Energy, Office of Science, Office of Biological and Environmental Research DOE/ER/ARM-0401 iii SUMMARY The impact of oceanic convection on its environment and the

  19. AcqGuide4pt2.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    2 (August 2004) Requirements for Contracting with Public Relations Firms Overview This section discusses the Department of Energy's procedures when obtaining contractual services from public relations firms. Background The Office of Public Affairs is responsible for collecting and disseminating information about the Department's programs, missions, and activities. The Office of Public Affairs establishes guidelines for the review and coordination of activities for that mission. These activities

  20. AcqGuide70pt3270.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    70.3270 (April 2007) 1 Guide Chapter 70.32 Contract Financing Guide Subchapter 70.3270 Alternative Financing Guiding Principle The contracting officer should assist program officials in ensuring that neither the contract's statement of work nor any other direction to the contractor precludes qualifying the alternative financing endeavor as an operating lease. Background: The Office of Engineering and Construction Management (MA-50) manages the Department's Alternative Financing policy. It has

  1. Microsoft Word - RM Procedures.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Records Management Procedures for Storage, Transfer and Retrieval of Records from WNRC RETIREMENT OF RECORDS 1. The Program Office is responsible for originating the Records Transmittal and Receipt Form (SF-135), and sending them to IM-23 for approval. 2. IM-23 reviews the SF-135 for completeness/correctness (Coordinates with the originating office by email if more information is required.). 3. IM-23 sends the SF-135 for approval to WNRC. PREPARING RECORDS FOR THE TRANSFER TO THE WNRC 1. Use

  2. Microsoft Word - EmrE.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SSRL is supported by the U.S. Department of Energy, Office of Basic Energy Sciences. The SSRL Structural Molecular Biology Program is supported by the National Institutes of Health, National Center for Research Resources, Biomedical Technology Program and by the U.S. DOE, Office of Biological and Environmental Research. Crystal Structure of the EmrE Multidrug Transporter with a Substrate O. Pornillos, Y-J. Chen, A. P. Chen and G. Chang Department of Molecular Biology, The Scripps Research

  3. Microsoft Word - 08-0370.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    0:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 July 2, 2008 Mr. Steve Zappe, Project Leader Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Subject: Transmittal of the Carlsbad Field Office Final Audit Report for Audit A-08-22 of the Idaho National Laboratory Central Characterization Project Analytical Laboratories Dear Mr. Zappe: This letter transmits the Idaho

  4. Microsoft Word - 12-1433.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    433:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 August 15, 2012 Mr. John Kieling, Chief Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Building 1 Santa Fe, NM 87505-6303 Subject: Transmittal of the Recertification Audit Report for the Oak Ridge National Laboratory/ Central Characterization Project Audit A-12-08 Dear Mr. Kieling: This letter transmits the final audit report for Carlsbad Field Office (CBFO)

  5. Microsoft Word - 2527B.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    5 Description of the ARM Operational Objective Analysis System June 2001 Minghua Zhang State University of New York at Stony Brook, New York Shaocheng Xie Richard T. Cederwall J. John Yio Lawrence Livermore National Laboratory, Livermore, California Work supported by the U.S. Department of Energy, Office of Science, Office of Biological and Environmental Research Zhang et al., June 2001, ARM TR-005 iii Contents 1

  6. Guneafinal-for laser printer.doc

    Office of Legacy Management (LM)

    11900 DOE/EA-1399 Environmental Assessment of Ground Water Compliance at the Gunnison, Colorado, UMTRA Project Site Final July 2002 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work performed Under DOE Contract No. DE-AC13-96GJ87355 DOE Grand Junction Office EA of Ground Water Compliance at the Gunnison Site July 2002 Final Page iii Contents Page Acronyms and Abbreviations

  7. Microsoft Word - Management Control Cover1.doc

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Management Controls over the State Energy Program's Formula Grants OAS-M-06-05 April 2006 2 meaningful performance metrics to determine the cost benefit of the Program in meeting its goals. Furthermore, it is unclear at this time how a recent reorganization of EERE's field structure will impact monitoring of the Program. Monitoring EERE Regional Offices were not regularly visiting State Energy Offices to monitor the use of funds or the results of Program activities. We reviewed monitoring

  8. y12 performance test final012604.doc

    Broader source: Energy.gov (indexed) [DOE]

    Department of Energy Office of Inspector General Office of Inspections and Special Inquiries Inspection Report Protective Force Performance Test Improprieties DOE/IG-0636 January 2004 PROTECTIVE FORCE PERFORMANCE TEST IMPROPRIETIES TABLE OF CONTENTS OVERVIEW Introduction and Objectives 1 Observations and Conclusions 3 DETAILS OF FINDINGS June 26, 2003, Performance Test 4 Performance Testing 5 Performance Measurement 8 RECOMMENDATIONS 9 MANAGEMENT COMMENTS 9 INSPECTOR COMMENTS 9 APPENDICES A.

  9. Microsoft Word - Title X Reimbursements.doc

    Office of Environmental Management (EM)

    U.S. Department of Energy Office of Inspector General Office of Audit Operations Audit Report Management Controls Over Title X Claims Reimbursement at the West Chicago Thorium Processing Facility OAS-M-04-08 September 2004 previously approved by the Department from the 1994 through 2001 claims. This occurred because the Department had not developed an assurance strategy that included both adequate technical and financial reviews of the Kerr-McGee claims. As a result, the Department could pay

  10. Microsoft Word - 0068.TEE.doc

    Office of Environmental Management (EM)

    24, 2010 DEPARTMENT OF ENERGY OFFICE OF HEARINGS AND APPEALS Application for Exception Case Name: Bowlin Travel Centers, Inc. Filing Date: March 10, 2010 Case No.: TEE-0068 Bowlin Travel Centers, Inc., filed an Application for Exception with the Department of Energy's (DOE) Office of Hearings and Appeals (OHA). The firm requests permanent relief from its requirement to prepare and file the Energy Information Administration (EIA) Form EIA-782B, entitled "Resellers'/Retailers' Monthly

  11. Microsoft Word - 0069tee.doc

    Office of Environmental Management (EM)

    April 5, 2010 DEPARTMENT OF ENERGY OFFICE OF HEARINGS AND APPEALS Application for Exception Name of Case: Severson Oil & LP Co., Inc. Date of Filing: March 23, 2010 Case No.: TEE-0069 On March 23, 2010, Severson Oil & LP Co., Inc. (Severson) filed an Application for Exception with the Office of Hearings and Appeals (OHA) of the Department of Energy (DOE). The firm requests that it be relieved of the requirement to prepare and file the Energy Information Administration (EIA) Form

  12. Microsoft Word - 0073.tee.doc

    Office of Environmental Management (EM)

    February 14, 2011 DEPARTMENT OF ENERGY OFFICE OF HEARINGS AND APPEALS Application for Exception Name of Case: Cole Distributing, Inc. Date of Filing: December 13, 2010 Case No.: TEE-0073 On December 13, 2010, Cole Distributing, Inc. (Cole) filed an Application for Exception with the Office of Hearings and Appeals (OHA) of the Department of Energy (DOE). The firm requests that it be permanently relieved of the requirement to prepare and file the Energy Information Administration (EIA) Form

  13. Microsoft Word - 0076.tee.doc

    Office of Environmental Management (EM)

    27, 2011 DEPARTMENT OF ENERGY OFFICE OF HEARINGS AND APPEALS Application for Exception Name of Case: Brodeur's Oil Service, Inc. Date of Filing: February 18, 2011 Case No.: TEE-0076 On February 18, 2011, Brodeur's Oil Service, Inc. (Brodeur's) filed an Application for Exception with the Office of Hearings and Appeals (OHA) of the Department of Energy (DOE). The firm requests temporary relief from its requirement to prepare and file the Energy Information Administration (EIA) Form EIA-782B,

  14. Microsoft Word - 11319 Final.doc

    Office of Environmental Management (EM)

    Phoenix, AZ Pre-MARSSIM Surveys in a MARSSIM World: Demonstrating How Pre-MARSSIM Radiological Data Demonstrate Protectiveness at Formerly Utilized Sites Remedial Action Program Sites - 11319 Christopher Clayton*, Vijendra Kothari**, Michael Widdop***, Susan Kamp***, Laura Cummins***, and Joey Gillespie*** *U.S. Department of Energy Office of Legacy Management, Washington, DC 20585 **U.S. Department of Energy Office of Legacy Management, Morgantown, West Virginia 26505 ***S.M. Stoller

  15. Microsoft Word - 12184b.doc

    Office of Environmental Management (EM)

    WM2012 Conference, February 26 - March 1, 2012, Phoenix, Arizona, USA 1 Evaluation of Final Radiological Conditions at Areas of the Niagara Falls Storage Site Remediated under the Formerly Utilized Sites Remedial Action Program -12184 Christopher Clayton*, Vijendra Kothari**, Ken Starr***, Michael Widdop ****, and Joey Gillespie**** *U.S Department of Energy Office of Legacy Management, Washington, DC; ** U.S Department of Energy Office of Legacy Management, Morgantown, West Virginia; *** U.S

  16. Microsoft Word - HEIS Report.doc

    Office of Environmental Management (EM)

    the Hanford Environmental Information System OAS-M-07-06 September 2007 Department of Energy Washington, DC 2 0 5 8 5 September 17, 2007 MEMORANDUM RICHLAND OPERATIONS OFFICE FROM: / Assistant Inspector General for Perfonnance Audits Office of Inspector General SUBJECT: INFORMATION: Audit Report on "Management Controls over the Hanford Environmental Information System" BACKGROUND The Hanford Environmental Information System (HEIS) database is the official repository of data from soil,

  17. Microsoft Word - Management Challenges Final.doc

    Office of Environmental Management (EM)

    U.S. Department of Energy Office of Inspector General Office of Audit Services Special Report Management Challenges at the Department of Energy DOE/IG-0712 December 2005 SPECIAL REPORT ON MANAGEMENT CHALLENGES AT THE DEPARTMENT OF ENERGY TABLE OF CONTENTS Analysis of Management Challenges Background 1 Department Successes in Meeting the President's Management Agenda 1 Management Challenges 2 Appendices 1. Watch List 16 2. Comparison of Management Challenges Reported by Various Groups 19 3.

  18. Microsoft Word - ROD.FinalEdit.doc

    National Nuclear Security Administration (NNSA)

    RECORD OF DECISION FINAL ENVIRONMENTAL IMPACT STATEMENT LAS VEGAS VALLEY DISPOSAL BOUNDARY FES-04-48 I. Introduction This document constitutes the Record of Decision (ROD) of the Department of Interior, Bureau of Land Management (BLM), Las Vegas Field Office, Nevada, regarding the preferred alternative for the Las Vegas Valley Disposal Boundary Final Environmental Impact Statement (FEIS). The Las Vegas Field Office plans to dispose of BLM managed land in the Las Vegas Valley, consistent with the

  19. Microsoft Word - S08266_App_A-3.doc

    Office of Legacy Management (LM)

    Score 0 Fernald Preserve, Ohio, Wetland Mitigation Monitoring Report U.S. Department of Energy Doc. No. S08266 Appendix A-3, 2011 Amphibian Index of Biotic Integrity Data...

  20. Microsoft Word - ex15-ITER-sept10.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    - ITER UT-B Contracts Div Sept 2010 Page 1 of 1 ex15-ITER-sept10.doc Exhibit 15-ITER Ref: FAR 52.227-17 RIGHTS IN DATA SPECIAL WORKS ITER (Sept 2010) (a) Definitions. (1)...

  1. SITE OFFICE CONSOLIDATION

    Broader source: Energy.gov [DOE]

    Paul Golan, Site Office Manager, SLAC/LBNL, presented on the role of the DOE Site Office. Paul covered the role of the DOE Site Office, operating model, and vision.

  2. Petascale Post-Doc Project a Supercomputing Success Story

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Petascale Post-Doc Project a Supercomputing Success Story Petascale Post-Doc Project a Supercomputing Success Story ARRA-funded program takes petascale computing researchers to the next level March 24, 2014 Contact: Kathy Kincade, +1 510 495 2124, kkincade@lbl.gov petascalepostdocs.jpg From left: Jihan Kim, Filipe Maia, Alice Koniges, Robert Preissl, Brian Austin, Wangyi (Bobby) Liu , Kirsten Fagnan and Praveen Narayanan. The first post-doctoral research project centered at the Department of

  3. Geothermal Technologies Office: Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Geothermal Technologies Office Details Bookmark & Share View Related Welcome to the Energy Department's Geothermal Technologies Office Publication and Product Library. Here...

  4. livermore field office

    National Nuclear Security Administration (NNSA)

    donation to those in need.

    Livermore Field Office sets core values as part of continuous improvement process http:nnsa.energy.govbloglivermore-field-office-sets-cor...

  5. Ombuds Office Location & Hours

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ombuds Office Location & Hours Ombuds Office Location & Hours Committed to the fair and equitable treatment of all employees, contractors, and persons doing business with the...

  6. Badging, Badge Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Office Badging, Badge Office The central point where badges are issued to employees and official visitors. Contact Badge Office (505) 667-6901 Email Badge Office location As the central point where badges are issued to employees and official visitors, the Badge Office is located on the second floor of the Otowi Building (TA-3, Bldg. 261). Badge Office map Printable 2-page map to the Badge Office (pdf) More maps and directions Badge Office hours Monday-Friday: 7:30 am - 4 pm Wednesday: Closed

  7. Office of Executive Resources Office of the Chief Human Capital...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Executive Resources Office of the Chief Human Capital Officer U.S. Department of Energy ... and performance awards. c. Chief Human Capital Officer (CHCO) and Office of Executive ...

  8. Microsoft Word - Audit Report Repost.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    6:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 July 15, 2008 Steve Zappe, Project Leader Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Bldg. 1 Santa Fe, New Mexico 87505-6303 Subject: Transmittal of the Carlsbad Field Office Final Audit Report A-08-09 of the Advanced Mixed Waste Treatment Project Dear Mr. Zappe: This letter transmits the Advanced Mixed Waste Treatment Project (AMWTP) Audit Report for the

  9. Microsoft Word - 09-1595.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9-1595:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 July 27, 2009 Mr. Steve Zappe, Project Leader Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Subject: Transmittal of the Final Audit Report A-09-13, Idaho National Laboratory Central Characterization Project Dear Mr. Zappe: Enclosed is the Carlsbad Field Office (CBFO) Final Audit Report for Audit A-09-13 of the

  10. Microsoft Word - 090713HanfordARRAupdate.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Backgrounder Contacts: July 13, 2009 Geoff Tyree, DOE (509) 376-4171, Geoff_Tyree@rl.gov Cameron Hardy, DOE (509) 376-5365, Cameron_M_Hardy@rl.gov Update on Hiring and Recovery Act Funding at the Hanford Site, Richland Operations Office Projects Total Number of Jobs Saved/Created The total number of jobs saved to date with Recovery Act funding for DOE Richland Operations Office projects is approximately 300. The total number of jobs created to date is approximately 900. New Hires in June

  11. Microsoft Word - 12-1584.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    84:UFC 2300.00 Department of Energy Carlsbad Field Office P. O. Box 3090 Carlsbad, New Mexico 88221 January 23, 2013 Mr. John E. Kieling, Chief Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Bldg. 1 Santa Fe, NM 87505-6303 Subject: Transmittal of the Final Audit Report for the INL/CCP Recertification Audit A-12-13 Dear Mr. Kieling: This letter transmits the Final Audit Report for Carlsbad Field Office (CBFO) Audit A-12-13 of the Idaho National Laboratory

  12. Microsoft Word - RIN05050192_DVP.doc

    Office of Legacy Management (LM)

    GJ962-2005 Data Validation Package June 2005 Surface Water and Ground Water Sampling at the Durango, Colorado, Disposal and Processing Sites September 2005 - U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation under DOE Contract No. DE-AC01-02Gj79491 for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. U.S. Department of Energy DVPJune 2005 Durango, Colorado, Disposal and

  13. Microsoft Word - EA March 05.doc

    Office of Legacy Management (LM)

    DOE/EA-1313 Rev. 0 Environmental Assessment of Ground Water Compliance at the Monument Valley, Arizona, Uranium Mill Tailings Site Final March 2005 Prepared by U.S. Department of Energy Office of Legacy Management Grand Junction, Colorado Work Performed Under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Document Number U0069700 This Page Intentionally Blank DOE Office of Legacy Management EA of Ground Water Compliance at the Monument Valley Site March 2005 Final Page iii

  14. Microsoft Word - RIN 06080459 DVP_112806.doc

    Office of Legacy Management (LM)

    383 2006 - - U.S. Department of Energy Office of Legacy Management Work Performed by the S.M. Stoller Corporation Under DOE Contract No. for the U.S. Department of Energy Office of Legacy Management. Approved for public release; distribution is unlimited. DE-AC01-02GJ79491 September 2006 Shiprock, New Mexico, Disposal Site December 2006 U.S. Department of Energy DVP-Shiprock, New Mexico, Disposal Site December 2006 RIN 06080459 Page ii Contents Sampling Event Summary

  15. Microsoft Word - S06010_Ltr.doc

    Office of Legacy Management (LM)

    6010 Task Order LM00-502 Control Number 10-0184 January 21, 2010 U.S. Department of Energy Office of Legacy Management ATTN: Jack Craig Site Manager 3600 Collins Ferry Road Morgantown, WV 26505 SUBJECT: Rulison Long-Term Hydrologic Monitoring Program Sampling and Analysis Results for 2009 Dear Mr. Craig: The U.S. Department of Energy (DOE) Office of Legacy Management conducted annual sampling at the Rulison, Colorado, Site for the Long-Term Hydrologic Monitoring Program (LTHMP) on May 11 and 12,

  16. Microsoft Word - U0184800-September 2003.doc

    Office of Legacy Management (LM)

    4800 GJO-2003-483-TAC GJO-GWTUB 30.13.2 UMTRA Ground Water Project Tuba City, Arizona, UMTRA Project Site Semi-Annual Performance Evaluation September 2002 through February 2003 September 2003 Prepared by U.S. Department of Energy Grand Junction Office Grand Junction, Colorado Work Performed Under DOE Contract No. DE-AC13-02GJ79491 This page intentionally left blank Document Number U0184800 Contents DOE/Grand Junction Office Tuba City UMTRA Project Site Semi-Annual Performance Evaluation

  17. Microsoft Word - S00790AG.doc

    Office of Legacy Management (LM)

    Website: http://www.lm.doe.gov/land/sites/mo/weldon/weldon.htm DOE office in Grand Junction 24-hour toll free security telephone number: (877) 695-5322 DOE-WSS local telephone number: (636) 300-0012 S00790AG DOE-LM/GJ688-2004 Long-Term Surveillance and Maintenance Plan for the U.S Department of Energy Weldon Spring, Missouri, Site February 2005 Work Performed by S.M. Stoller Corporation under DOE Contract No. DE-AC01-02GJ79491 for the U.S. Department of Energy Office of Legacy Management, Grand

  18. Microsoft Word - 0060.tee.doc

    Office of Environmental Management (EM)

    June 30, 2009 DEPARTMENT OF ENERGY OFFICE OF HEARINGS AND APPEALS Application for Exception Name of Case: 7 Oil Co., Inc. Date of Filing: June 11, 2009 Case No.: TEE-0060 On June 11, 2009, 7 Oil Co., Inc. (7 Oil) filed an Application for Exception with the Office of Hearings and Appeals (OHA) of the Department of Energy (DOE). The firm requests that it be permanently relieved of the requirement to prepare and file the Energy Information Administration (EIA) Form EIA-782B, entitled

  19. Microsoft Word - 0067.TEE.doc

    Office of Environmental Management (EM)

    December 17, 2009 DEPARTMENT OF ENERGY OFFICE OF HEARINGS AND APPEALS Application for Exception Name of Case: North Side Coal & Oil Co., Inc. Date of Filing: December 2, 2009 Case No.: TEE-0067 On December 2, 2009, North Side Coal & Oil Co., Inc. (North Side) filed an Application for Exception with the Office of Hearings and Appeals (OHA) of the Department of Energy (DOE). The firm requests that it be permanently relieved of the requirement to prepare and file the Energy Information

  20. Advanced Manufacturing Office News

    SciTech Connect (OSTI)

    2013-08-08

    News stories about advanced manufacturing, events, and office accomplishments. Subscribe to receive updates.