National Library of Energy BETA

Sample records for office mailing addresses

  1. Headquarters Program & Staff Office Mailing Addresses | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000

  2. Site Office Contracting Officer E-mail address Ames Site Office Jackie York

    National Nuclear Security Administration (NNSA)

    Site Office Contracting Officer E-mail address Ames Site Office Jackie York Argonne Site Office Jacquelyn York Brookhaven Site Office Evelyn Landini Jennifer Hartmann Idaho Site Office Paul Allen Kansas City Site Office Ralph Tennant Lawrence Livermore Site Office Homer Williamson Los Alamos Site Office Barbara Romero Robert M. Poole

  3. Site Office Contracting Officer E-mail address Ames Site Office...

    National Nuclear Security Administration (NNSA) Sandia Site Office Dave Ferguson Savannah River Site Office Carol Elliot Y-12 Site Office Jill ...

  4. Mailing Addresses and Information Numbers for Operations, Field, and Site

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Offices | Department of Energy About » Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Mailing Addresses and Information Numbers for Operations, Field, and Site Offices Name Telephone Number U.S. Department of Energy Ames Site Office 111 TASF, Iowa State University Ames, Iowa 50011 515-294-9557 U.S. Department of Energy Argonne Site Office 9800 S. Cass Avenue Argonne, IL 60439 630-252-2000 U.S. Department of Energy Berkeley Site Office Berkeley

  5. Keynote Address: Cristin Dorgelo, White House Office of Science...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Cristin Dorgelo, White House Office of Science and Technology Policy Keynote Address: Cristin Dorgelo, White House Office of Science and Technology Policy May 21, 2014 2:20PM to ...

  6. Keynote Address: Cristin Dorgelo, White House Office of Science and

    Office of Environmental Management (EM)

    Technology Policy | Department of Energy Cristin Dorgelo, White House Office of Science and Technology Policy Keynote Address: Cristin Dorgelo, White House Office of Science and Technology Policy May 21, 2014 2:20PM to 2:30PM PDT Pacific Ballroom Cristin Dorgelo, Assistant Director of Grand Challenges for The White House Office of Science and Technology Policy will deliver a keynote address

  7. Sign Up for E-mail Updates | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Sign Up for E-mail Updates Materials Sciences and Engineering (MSE) Division MSE Home About Staff What's New Research Areas Reports and Activities Science Highlights Principal Investigators' Meetings BES Home What's New Sign Up for E-mail Updates Print Text Size: A A A FeedbackShare Page The Division has a "Dear Colleague" email list, which is used to circulate general information such as funding opportunity announcements and administrative information such as position openings. To

  8. Minutes from the November 01, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 1, 2012 Mail discussion Al Majors opened the meeting by introducing Derrick Milner, Program Manager from the General Services Administration, Office of Government-wide Policy. Mr. Majors and Mr. Miliner discussed the pending Official Mail Management Report for the FY-2012. The question on where to put data relating to certified and registered mail was addressed. It should be placed under the others section or under first class, standard delivery. Mr. Majors also discussed the pending

  9. Mail Services | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and secure management of incoming, internal, and outgoing mail in Federal agencies. These requirements pertain to all DOE offices, and may also apply to national laboratories and other contractor facilities, depending on whether they qualify as Federal facilities as defined in the regulations. PDF icon Mail Management

  10. Bechtel National, Inc. Engineers Constructors Oak Ridge Office

    Office of Legacy Management (LM)

    389 Bechtel National, Inc. Engineers - Constructors Oak Ridge Office Jackson Plaza Tower 800 Oak Ridge Turnpike Oak Ridge, Tennessee Mail Address: P. O. Box 350, Oak Ridge. TN...

  11. By Certified Mail May

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By Certified Mail May 4,2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestLand Transfer Dear Ms. Riehle: Pursuant to the...

  12. By E-Mail

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    By E-Mail May 29, 2012 Dorothy Riehle FOIA Office U.S. Department of Energy P. O. Box 550 Richland, WA 99352 Re: FOIA RequestTank Inventories Dear Ms. Riehle: Pursuant to the...

  13. mail_paycheck_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)


  14. Director's Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Director's Office Director's Office Print Roger Falcone Director, Advanced Light Source, Ernest Orlando Lawrence Berkeley National Laboratory and Professor of Physics, University of California, Berkeley. Roger Falcone Web page at the University of California, Berkeley Advanced Light Source Lawrence Berkeley National Laboratory 1 Cyclotron Road, MS 80R0114 Berkeley, CA 94720 USA Tel. (510) 486-6692 Fax (510) 486-4960 Email: This e-mail address is being protected from spambots. You need JavaScript

  15. Bioimaging Technology Homepage | U.S. DOE Office of Science ...

    Office of Science (SC) Website

    ... Prem C. Srivastava, Ph.D. (301) 903-4071 Mailing Address Office of Science Office of Biological and Environmental Research Biological Systems ...

  16. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  17. Staff Listing - Office of Regulation and International Engagement, Division

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Natural Gas Regulation, Division of International Engagement | Department of Energy Staff Listing - Office of Regulation and International Engagement, Division of Natural Gas Regulation, Division of International Engagement Staff Listing - Office of Regulation and International Engagement, Division of Natural Gas Regulation, Division of International Engagement Office of Regulation and International Engagement Mailing Address: Office of Regulation and International Engagement Office of

  18. Contact the Building Technologies Office | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    About » Contact the Building Technologies Office Contact the Building Technologies Office The Building Technologies Office always welcomes your feedback and suggestions. Contact us via mail, phone or email. Address U.S. Department of Energy Building Technologies Office (BTO) Mail Stop EE-2J 1000 Independence Ave, SW Washington, DC 20585 Phone Number 202.586.9127 Media Inquiries For media inquiries, please email the EERE communications team at Web Requests If you have a

  19. Director's Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Director's Office Print Roger Falcone Director, Advanced Light Source, Ernest Orlando Lawrence Berkeley National Laboratory and Professor of Physics, University of California, Berkeley. Roger Falcone Web page at the University of California, Berkeley Advanced Light Source Lawrence Berkeley National Laboratory 1 Cyclotron Road, MS 80R0114 Berkeley, CA 94720 USA Tel. (510) 486-6692 Fax (510) 486-4960 Email: This e-mail address is being protected from spambots. You need JavaScript enabled to view

  20. Director's Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Director's Office Print Roger Falcone Director, Advanced Light Source, Ernest Orlando Lawrence Berkeley National Laboratory and Professor of Physics, University of California, Berkeley. Roger Falcone Web page at the University of California, Berkeley Advanced Light Source Lawrence Berkeley National Laboratory 1 Cyclotron Road, MS 80R0114 Berkeley, CA 94720 USA Tel. (510) 486-6692 Fax (510) 486-4960 Email: This e-mail address is being protected from spambots. You need JavaScript enabled to view

  1. Contact | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Contact BER Home Contact Print Text Size: A A A FeedbackShare Page Program Manager Prem C. Srivastava, Ph.D. (301) 903-4071 Mailing Address Office...

  2. Vehicle Technologies Office Merit Review 2014: Moving North Texas Forward by Addressing Alternative Fuel Barriers

    Broader source: [DOE]

    Presentation given by North Central Texas Council of Governments at 2014 DOE Hydrogen and Fuel Cells Program and Vehicle Technologies Office Annual Merit Review and Peer Evaluation Meeting about...

  3. Challenges to be Addressed | U.S. DOE Office of Science (SC)

    Office of Science (SC) Website

    Challenges to be Addressed Advanced Scientific Computing Research (ASCR) ASCR Home About Research Applied Mathematics Computer Science Exascale Tools Workshop Programming ...

  4. Minutes from the January 10, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 10, 2013 Mail discussion Al Majors opened the meeting by discussing the Mail Management Report and latest update on status. One final report is yet to be submitted, after which close out will be accomplished. Copies will be provided to the Mail Managers once completed. Al introduced Derrick Miliner, Program Manager from the General Services Administration, Office of Government-wide Policy, and acknowledged Mr. Miliner's role in completing the Mail Management Report. Mail Security Plans A

  5. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 21, 2013 Mail Managers discussion Joe Whitford opened the meeting by introducing Tony Nellums to talk about mail related items. 1) Mr. Nellums introduced Derek Milner, Policy Advisor from the GSA Office of Government-wide policy. a. Mr. Milner stated that he is being replaced as primary policy contact by Linda Willoughby ( or (202) 219-1083. b. Initiatives discussed by Mr. Milner included: Upcoming mail reports. The SMART system is online and available now.

  6. Richland Operations Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    :4Tsc1 ~Richland, Washington 99352 December 18, 2009 CERTIFIED MAIL Ms. Shannon Dininny The Associated Press P.O. Box 1349 Yakima, Washington 98901 Dear Ms. Dininny: FREEDOM OF INFORMATION ACT REQUEST (FOI 20 10-00644) Your Freedom of Information Act (FOIA) request dated December 2, 2009, addressed to the U.S. Department of Energy, Headquarters FOJA Office has been forwarded to this office for response as well as to the DOE Office of Environmental Management (EM), the Oak Ridge Operations Office

  7. Golden Field Office Contacts | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Golden Field Office » Golden Field Office Contacts Golden Field Office Contacts On this page you will find address and contact information for the Golden Field Office. Mailing Address U.S. Department of Energy Golden Field Office 15013 Denver West Parkway Golden, Colorado 80401 Main Number: 720-356-1800 Main Fax: 720-356-1750 Media Inquiries For media inquiries, please email the EERE communications team at Golden Field Office Key Contacts Deputy Assistant Secretary For

  8. Minutes from the Print and Mail Managers Exchange Forum Teleconferences

    Broader source: [DOE]

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences.  Contact the Office of Administrative Management and Support at (202) 586-4318 with any questions.

  9. Electronic Mail Analysis Capability

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    Establishes the pilot program to test the Department of Energy (DOE) Electronic Mail Analysis Capability (EMAC), which will be used to monitor and analyze outgoing and incoming electronic mail (e-mail) from the National Nuclear Security Administration (NNSA) and DOE laboratories that are engaged in nuclear weapons design or work involving special nuclear material. No cancellation.

  10. Mail Services User's Manual

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    This Manual provides detailed information on using the Department of Energy (DOE) mail services. Canceled by DOE G 573.1-1.

  11. Fuel Cell Technologies Office: Publications

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fuel Cell Technologies Office EERE Fuel Cell Technologies Office Share this resource Publications Advanced Search Browse by Topic Mail Requests Help Feature featured product...

  12. Request Repository Mailing List

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Policies User Surveys NERSC Users Group User Announcements Help Staff Blogs Request Repository Mailing List Operations for: Passwords & Off-Hours Status 1-800-66-NERSC, option 1 or 510-486-6821 Account Support 1-800-66-NERSC, option 2 or 510-486-8612 Consulting 1-800-66-NERSC, option 3 or 510-486-8611 Home » For Users » Request Repository Mailing List Request Repository Mailing List Use this form to request a

  13. Mail and Distribution | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail and Distribution Mail and Distribution The DOE Mail Center provides a variety of mail services for all official and other authorized mail for the Department of Energy and its employees. The services provided include the processing of all incoming postal mail, outgoing official mail, internal mail processing, accountable mail processing, pouch mail, a variety of overnight express mail services, directory services, and pick-up and delivery services. The Mail Management Memorandum (pdf)

  14. Minutes from the July 21, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    July 21, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Government Printing Office revisions to the Standard Form one (SF!), Twenty-five

  15. Minutes from the June 28, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    June 28, 2012 Mail discussion Al Majors opened the meeting by introducing United Parcel Service (UPS) Representative Shelly Scott. Ms. Scott's contact information is: Shelly Scott 404 402-9827 (cell) Ms. Scott discussed issues relating to various UPS services available to the department. Next Al introduced Michael R. Sanders, President and Chief Executive Officer of Intra-Mail Network, an innovative, information Technology Company that improves the delivery of mail or email

  16. Vehicle Technologies Office: Organization and Contacts | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Organization and Contacts Vehicle Technologies Office: Organization and Contacts Vehicle Technologies Office: Organization and Contacts General Information Vehicle Technologies Office Telephone: (202) 586-8055 Fax: (202) 586-7409 Mailing Address: EE-3V Room 5G-030 1000 Independence Ave, SW Washington, DC 20585 Program Contacts Acting Director Christy Cooper Operations Supervisor Christy Cooper Analysis Jacob Ward

  17. PDSF Mailing Lists

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing Lists PDSF Mailing Lists This is voluntary. You have to subscribe to it. This list can be chatty, since major and minor problems are sent to this list. Also multiple status updates will be sent for extended outages. Subscribe: Send email to with subscribe in the subject of the message. Unsubscribe: Send email to with unsubscribe in the subject of the message. Users are subscribed to

  18. Minutes from the February 23, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes Printing and Mail Managers Exchange Forum Teleconference February 23, 2012 Participants: Headquarters (5) National Energy Technology Laboratory, PA National Security Complex Y-12 (2) Oak Ridge National Laboratory Y-12 Site Office (2) Hanford Site Office Oak Ridge Association University Oak Ridge Operations Office BWXT Pantex Site Office JanTec Corporation, Richland, Washington Los Alamos National Laboratory Chicago Office Bettis Atomic Power Laboratory National Security Technology C1,

  19. Mail Services User's Guide

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    This Guide provides information on using Department of Energy (DOE) mail services in accordance with U.S. Postal Service, General Services Administration (GSA), and DOE regulations. Cancels DOE M 573.1-1. Canceled by DOE N 251.89.

  20. Field-Based Site Characterization Technologies Short Course Presented by the U.S. Environmental Protection Agency's Technology Innovation Office

    Office of Environmental Management (EM)

    Ferrin Moore Title: Senior Aviation Policy Officer Organization: Office of Aviation Management/MA-30 Address: Headquarters, United States Department of Energy 1000 Independence Avenue S.W. Washington, D.C. 20585 E-mail Address: Phone Number: Office: (202) 586-6171, Mobile: Fax Number: (202) 586-6008 Biographical Summary: Ferrin Moore is a highly experience aviation manager and leader with 30 years of aviation experience in the private and government sector. Prior to

  1. OFFICE,

    Office of Legacy Management (LM)

    OFFICE, . . . . . ..-..__. _ --.-.__.. .-..I............ !..-... bUmME. wArl&l ' rrsldu*. in the dw6lopmQt pmgrwh : Be ostiamts Uuat not man lf+ .b%'o,Q~~~ds. cik'e%ah of the eevenl reel&~ will be require& In : 'ri~ofthehereiabefor6notedeopreodo~ of puriata~tio.aadap :, Iv ve unbntend you vi11 not obj.& to:tha aoe " ai spoh +ant+lea of the mirloua real&es ,, ', ',"" ': ., .,.. i. : /~. ,".. .I,: /, . . ' .* ,; ., ,' ,:.' . .-;. ,-Y .b4 P-0 : ,.

  2. Privacy Impact Assessment | OSTI, US Dept of Energy, Office of Scientific

    Office of Scientific and Technical Information (OSTI)

    and Technical Information Privacy Impact Assessment Name of Project: Web Domains Maintained by the Office of Scientific and Technical Information (OSTI) Bureau: U.S. Department of Energy, Office of Science Project's Unique ID: N/A Contact Information: [Mailing address for 1 through 5 below is: DOE Office of Scientific and Technical Information, P.O. Box 62, Oak Ridge, TN 37831.] Who is the person completing this document? (Name, title, organization, and contact information.) Valerie S.

  3. Mailing List Subscription

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mailing List Subscription Jefferson Lab Home Search Contact JLab Descriptions A - C autocad: No description available briefs: On-Target Briefs cctest-alert: No description available clas_drift_chambers: Hall B Drift Chambers Group clas_offline: Discussion group for CLAS RECSIS group clas_slow_control: CLAS slow control working group clas_strangep: Hall B Strange Particles using CLAS discussion group clas_tof: CLAS Time of Flight Collaboration credit-card: List of JLab Credit Card buyers csc_all:

  4. Printing and Mail Managers Exchange Forum Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    May 16, 2013 Mail discussion Joe Whitford opened the meeting by introducing Al Majors to talk about mail related items. 1) Update on the USPS mail name changes. If approved by the Postal Regulatory Commission the following name changes will go into effective July 28, 2013: a. Express Mail will be called Priority Mail Express b. Express Mail International will be Priority Mail International c. Express Mail Corporate Account will become USPS Express Corporate Account Only the names of these

  5. The Future of Electric Vehicles and Arizona State University's MAIL

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  6. Brinkman Addresses JLab | Jefferson Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Brinkman Addresses JLab Brinkman Addresses JLab Brinkman Addresses JLab Dr. William F. Brinkman, Director of the Department of Energy's Office of Science, addressed Jefferson Lab staff on the Office of Science perspective during his visit Monday. Dr. William F. Brinkman, Director of the Department of Energy's Office of Science, addressed Jefferson Lab staff on the Office of Science perspective during his visit Monday. "There is still a lot of interesting nuclear physics that we want to do

  7. Rich land Operations Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Rich land Operations Office P.O. Box 550 July 10, 2009 CERTIFIED MAIL Mr. Ryan Jarvis Heart of America Northwest 1314 N.E. 56h" Street Suite 100 Seattle, Washington 98105 Dear Mr....

  8. Mailing Addresses and Information Numbers for Operations, Field...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Energy National Nuclear Security Administration ... Rocky Mountain Oilfield Testing Center 907 N. Poplar, ... Contractors News & Blog Data Phonebook Web Policies History

  9. Report Period: EIA ID NUMBER: Appendix A: Mailing Address: Appendix...

    U.S. Energy Information Administration (EIA) Indexed Site

    This report is mandatory under the Federal Energy Administration Act of 1974 (Public Law 93-275). Failure to comply may result in criminal fines, civil penalties and other ...

  10. Mailing Addresses for National Laboratories and Technology Centers...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ... Livermore, CA 94551-0969 925-294-3000 U.S. Department of Energy Savannah River Ecology Laboratory Building 737-A, Drawer E Aiken, SC 29802 803-725-2472 U.S. Department of Energy ...


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    HQ F 1410.2 (06-93) U.S. DEPARTMENT OF ENERGY RECEIPT FOR CONTROLLED MAIL PARCEL SERVICE (Receipt No.) MAIL STATION: DATE: TO: NAME: ROUTING SYMBOL: FROM: DOE Mail Facility, Office of Administration Services 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. ITEM NO. ITEM NO. ITEM NO. SIGN AND RETURN WITHIN 24 HOURS TO AVOID TRACER ACTION TO DOE MAIL FACILITY (Stamp Location) RECEIVED BY: DATE: Printed with soy ink on recycled paper

  12. LLNL E-Mail Utilities

    Energy Science and Technology Software Center (OSTI)


    The LLNL E-mail Utilities software library is a Java API that simplifies the creation and delivery of email in Java business applications. It consists of a database-driven template engine, various strategies for composing, queuing, dispatching email and a Java Swing GUI for creating and editing email templates.

  13. ASER Web Addresses and Points of Contact at DOE Sites

    Office of Environmental Management (EM)

    ASER Web Addresses and Points of Contact at DOE Sites March 29, 2013 Site and Web Address ASER Contact Name Phone E-mail Ames Laboratory http:www.ameslab.govoperationsesha...

  14. Mail Management Memorandum, July 2, 2010 | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Mail Management Memorandum, July 2, 2010 Mail Management Memorandum, July 2, 2010 Mail Management Memorandum prescribing policy and requirements for the effective, economical, and ...

  15. Minutes from the Print and Mail Managers Exchange Forum Teleconference...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail Managers Exchange Forum Teleconferences Minutes from the Print and Mail...

  16. Office of EERE: Fiscal Year 2016 Request Budget

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    EERE Office of EERE About Share this resource Send a link to Office of EERE: Fiscal Year 2016 Request Budget to someone by E-mail Share Office of EERE: Fiscal Year 2016...

  17. Operations Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    (~ii~,Richland Operations Office ~Z4TESO~Richland, Washington 99352 SEP 2 2009 CERTIFIED MAIL Ms. Sarah Washburn Heart of America Northwest 1314 N.E. 5 6 th Street Suite 100 Seattle, Washington 98105 Dear Ms. Washburn: FREEDOM OF INFORMATION ACT REQUEST (FOI 2009-0067) You requested, pursuant to the Freedom of Information Act (FOJA), the following documents relating to: 1 . "The authorization, decision to use, and actual use of any and all pesticides and herbicides anywhere within the

  18. Keynote Address

    Broader source: [DOE]

    An overview and update on Environmental Management given by Alice Williams, Associate Principal Deputy Assistant Secretary of the Office of Environmental Management.

  19. Field Facilities Contacts for Printing and Mail

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Print and Mail Contacts Site Printing Contact Mail Contact NNSA, Albuquerque Deborah Miller (505) 845-6049 Thomas H. Clinkenbeard NNSA Service Center PO Box 5400 Albuquerque, NM 87185-5400 (505) 845-4602 ( Argonne National Laboratory Doreen Schoening Argonne National Laboratory U.S. Department of Energy 9700 South Cass Avenue Blvd 340 Lemonmt, IL 60439 (630) 840-6399

  20. Addressing Cybersecurity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Addressing Cybersecurity Addressing Cybersecurity Los Alamos National Lab partners with the private sector to develop better cybersecurity tools, introducing quantum mechanics. March 17, 2016 Los Alamos National Lab partners with the private sector to develop better cybersecurity tools, introducing quantum mechanics. Contact Richard P. Feynman Center for Innovation (505) 665-9090 Email Recent cyberattacks in the private and government sectors have shined a spotlight on cybersecurity and the

  1. Staff | U.S. DOE Office of Science (SC)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    About » Staff Safety and Security Policy (SSP) SSP Home About Staff Organization Chart .pdf file (103KB) Jobs Frequently Used Resources NEPA Documents Continuity of Operations (COOP) Implementation Plan Contact Information Safety and Security Policy U.S. Department of Energy SC-31/Germantown Building 1000 Independence Ave., SW Washington, DC 20585 P: (301) 903-6800 F: (301) 903-7047 More Information » About Staff Print Text Size: A A A FeedbackShare Page Mailing Address: Office of Safety and

  2. DOE - Office of Legacy Management -- Directions

    Office of Legacy Management (LM)

    Mailing: U.S. Department of Energy 10995 Hamilton-Cleves Hwy. Harrison, OH 45030 U.S. Department of Energy Office of Legacy Management Contractor Navarro Research and Engineering, ...

  3. Addressing Cybersecurity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Addressing Cybersecurity March 17, 2016 Recent cyberattacks in the private and government sectors have shined a spotlight on cybersecurity and the challenges organizations face in trying to protect their data. According to Experian, the risk of a data breach is higher than ever with almost half of organizations suffering at least one security incident in the last 12 months. It's no wonder industry and government are looking for more tools to keep their data safe. To this end, in 2015, Los Alamos

  4. BLM Alaska State Office | Open Energy Information

    Open Energy Info (EERE)

    Alaska State Office Jump to: navigation, search Logo: BLM Alaska State Office Name: BLM Alaska State Office Abbreviation: Alaska Address: 222 West Seventh Ave., 13 Place:...

  5. BLM Colorado State Office | Open Energy Information

    Open Energy Info (EERE)

    Colorado State Office Jump to: navigation, search Logo: BLM Colorado State Office Name: BLM Colorado State Office Abbreviation: Colorado Address: 2850 Youngfield Street Place:...

  6. BLM Idaho State Office | Open Energy Information

    Open Energy Info (EERE)

    Idaho State Office Jump to: navigation, search Logo: BLM Idaho State Office Name: BLM Idaho State Office Abbreviation: Idaho Address: 1387 S. Vinnell Way Place: Boise, Idaho Zip:...

  7. California State Historic Preservation Officer | Open Energy...

    Open Energy Info (EERE)

    Historic Preservation Officer Jump to: navigation, search Logo: California State Historic Preservation Officer Name: California State Historic Preservation Officer Address: Dept....

  8. BLM Nevada State Office | Open Energy Information

    Open Energy Info (EERE)

    Office Jump to: navigation, search Logo: BLM Nevada State Office Name: BLM Nevada State Office Abbreviation: Nevada Address: 1340 Financial Blvd Place: Reno, NV Zip: 89502 Phone...

  9. BLM Wyoming State Office | Open Energy Information

    Open Energy Info (EERE)

    Office Jump to: navigation, search Logo: BLM Wyoming State Office Name: BLM Wyoming State Office Abbreviation: Wyoming Address: 5353 Yellowstone Place: Cheyenne, WY Zip: 82009...

  10. BLM Montana State Office | Open Energy Information

    Open Energy Info (EERE)

    Montana State Office Jump to: navigation, search Logo: BLM Montana State Office Name: BLM Montana State Office Abbreviation: Montana Address: 5001 Southgate Drive Place: Billings,...

  11. BLM California State Office | Open Energy Information

    Open Energy Info (EERE)

    Office Jump to: navigation, search Logo: BLM California State Office Name: BLM California State Office Abbreviation: California Address: 2800 Cottage Way, Suite W-1623 Place:...

  12. Texas General Land Office | Open Energy Information

    Open Energy Info (EERE)

    Land Office Jump to: navigation, search Logo: Texas General Land Office Name: Texas General Land Office Address: 1700 Congress Ave Place: Austin, Texas Zip: 78701 Website:...

  13. The INL Seismic Risk Assessment Project: Requirements for Addressing DOE

    Office of Environmental Management (EM)

    Battery | Department of Energy The Future of Electric Vehicles and Arizona State University's MAIL Battery The Future of Electric Vehicles and Arizona State University's MAIL Battery August 11, 2010 - 4:26pm Addthis Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Cody Friesen and his team at Arizona State University | Photo Credit Arizona State University Andy Oare Andy Oare Former New Media Strategist, Office of Public Affairs What does this

  14. Legal and policy issues associated with monitoring employee E-mail

    SciTech Connect (OSTI)

    Segura, M.A.; Rither, A.C.


    This paper examines the legal issues involved with employer monitoring of employee e-mail. In addition to identifying pertinent legal issues, the paper provides guidelines that will help the Pacific Northwest National Laboratory (PNNL) establish a program for monitoring outgoing e-mail to insure compliance with company policies, particularly those regarding protection of trade secrets and proprietary information, and to comply with the Department of Energy`s (DOE) procedures for protecting Export Controlled Information (ECI). Electronic communication has allowed companies to enhance efficiency, responsiveness and effectiveness. E-mail allows employees to transmit all types of data to other individuals inside and outside of their companies. The ease with which information can be transmitted by e-mail has placed trade secrets, proprietary information, and other sensitive data at risk from inadvertent disclosure by employees. As employers attempt to protect their interests through measures such as monitoring e-mail, they may expose themselves to liability under federal and state laws for violating employee privacy. Business use of e-mail has proliferated so rapidly that the federal and state legal systems have not been able to adequately address the issues arising out of its use in the workplace.

  15. Field Facilities Contacts for Printing and Mail | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Facilities Contacts for Printing and Mail Field Facilities Contacts for Printing and Mail This is the list of DOE field facilities contacts for Printing and Mail as of April 27, 2011. Go to Mail Services Go to Printing Services PDF icon Field_Facilities_Contacts_Print-Mail.pdf More Documents & Publications Director's Perspective by George Miller Tenant Education and Training Fire Safety Committee Membership List

  16. Addressing Policy and Logistical Challenges to Smart Grid Implementati...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Smart Grid Implementation: Comments by the Office of the Ohio Consumers' Counsel Addressing Policy and Logistical Challenges to Smart Grid Implementation: Comments by the Office of ...

  17. Office of Environmental Management | Department of Energy

    Office of Environmental Management (EM)

    your e-mail address below. * indicates required Email * Subscribe Stay Connected YouTube Icon EM FISCAL YEAR 2016 BUDGET The EM Fiscal Year 2016 budget request places a...

  18. Keynote Address: Future Vision | Department of Energy

    Office of Environmental Management (EM)

    Future Vision Keynote Address: Future Vision May 20, 2014 1:00PM to 1:30PM PDT Pacific Ballroom Tuesday's keynote address by Raffi Garabedian, Chief Technology Officer, First Solar

  19. Office of Information Resources

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Freedom of Information and Privacy Act Database Bureau: DOE-ID Project Unique ID: Date: May 8,2008 A. CONTACT INFORMATION 1. Who is the person completing this document? Nicole Brooks Title: FOIA/PA Officer Organization: DOE-ID Public Affairs Office Address: 1955 N. Fremont Ave, MS 1203 Idaho Falls, Idaho 83415 2. Who is the system owner? Nicole Brooks, FOIA/PA Officer U.S. DOE, Idaho Operations Office DOE-ID Public Affairs Office Address: 1955 N. Fremont Ave, MS 1203 Idaho Falls, Idaho 834 15 3.

  20. Read Your E-mail | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Read Your E-mail All Argonne employees can read their e-mail through the web. Argonne E-Mail service is a robust, reliable electronic communication solution for supporting day-to-day business activities. Features include e-mail, calendar, task lists, and contact lists. While it is designed to work Microsoft Outlook, it also works with other POP- and IMAP-based clients. All employees can read their e-mail through the web. Use the login link at right to get started. Login to E-mail

  1. Office of Energy Efficiency and Renewable Energy Contacts | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Office of Energy Efficiency and Renewable Energy Contacts Office of Energy Efficiency and Renewable Energy Contacts Contact information for the Office of Energy Efficiency and Renewable Energy (EERE) and the EERE technology areas and offices is listed below. Office of Energy Efficiency and Renewable Energy Office of the Assistant Secretary Energy Efficiency and Renewable Energy Mail Stop EE-1 Department of Energy Washington, DC 20585 Department of Energy Phonebook Website Contact

  2. T-618: Debian update for exim4: Mail Transport Agent

    Broader source: [DOE]

    It was discovered that Exim, the default mail transport agent in Debian, uses DKIM data obtain from DNS directly in a format string, potentially allowing malicious mail senders to execute arbitrary code.

  3. By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency

    Energy Savers [EERE]

    June 19, 2012 By E-Mail Daniel Cohen Assistant General Counsel for Legislation, Regulation, and Energy Efficiency U.S. Department of Energy Office of the General Counsel 1000 Independence Ave., SW Washington, D.C. 20585 Re: Regulatory Burden RFI Dear Mr. Cohen: The Association of Home Appliance Manufacturers (AHAM) respectfully submits the following comments to the Department of Energy (DOE) on its Regulatory Burden RFI, 77 Fed. Reg. 28518 (May 15, 2012). AHAM

  4. BLM Pocatello Field Office | Open Energy Information

    Open Energy Info (EERE)

    Field Office Jump to: navigation, search Name: BLM Pocatello Field Office Address: 4350 Cliffs Drive Place: Pocatello, ID Zip: 83204 Phone Number: 208-478-6340 Website:...

  5. BLM Stillwater Field Office | Open Energy Information

    Open Energy Info (EERE)

    Stillwater Field Office Jump to: navigation, search Name: BLM Stillwater Field Office Abbreviation: Stillwater Address: 5665 Morgan Mill Road Place: Carson City, NV Zip: 89701...

  6. Golden Field Office | Open Energy Information

    Open Energy Info (EERE)

    DOE Golden Field Office) Jump to: navigation, search Name: DOE Golden Field Office Abbreviation: DOE GFO Address: 15013 Denver West Parkway Place: Golden, Colorado Zip: 80401 Phone...

  7. BLM Winnemucca District Office | Open Energy Information

    Open Energy Info (EERE)

    Winnemucca District Office Jump to: navigation, search Name: BLM Winnemucca District Office Abbreviation: Winnemucca Address: 5100 E. Winnemucca Blvd. Place: Winnemucca, Nevada...

  8. Colorado Energy Office | Open Energy Information

    Open Energy Info (EERE)

    Office Jump to: navigation, search Name: Colorado Energy Office Address: 1580 Logan Street, Suite 100 Place: Denver, CO Zip: 80203 Website: www.colorado.govenergy Coordinates:...

  9. BLM Bishop Field Office | Open Energy Information

    Open Energy Info (EERE)

    Bishop Field Office Jump to: navigation, search Name: BLM Bishop Field Office Address: 351 Pacu Lane, Suite 100 Place: Bishop, CA Zip: 93514 Website: www.blm.govcastenfobishop...

  10. LANSCE Training Office Process Improvement Form

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Training Office Process Improvement Form You recently contacted our training service department. We want to assure that you're satisfied with our service. Please complete this short survey. Your feedback will be used to improve our service. How did you contact the TA-53 Training office for training? In Person Telephone E-Mail Response Time What was the reason for your request? Badge reader access Proctoring Training Report/Status Other______________ The Training Office handled my request

  11. New Mexico Office of the State Engineer | Open Energy Information

    Open Energy Info (EERE)

    Office of the State Engineer Jump to: navigation, search Logo: New Mexico Office of the State Engineer Name: New Mexico Office of the State Engineer Abbreviation: NMOSE Address:...

  12. Utah Public Lands Policy Coordination Office | Open Energy Information

    Open Energy Info (EERE)

    Lands Policy Coordination Office Jump to: navigation, search Name: Governor's Public Lands Policy Coordination Office Address: 5110 State Office Building Place: Salt Lake City,...

  13. BLM Battle Mountain District Office | Open Energy Information

    Open Energy Info (EERE)

    Mountain District Office Jump to: navigation, search Logo: BLM Battle Mountain District Office Name: BLM Battle Mountain District Office Abbreviation: Battle Mountain Address: 50...

  14. Oregon State Historic Preservation Office | Open Energy Information

    Open Energy Info (EERE)

    Historic Preservation Office Jump to: navigation, search Logo: Oregon State Historic Preservation Office Name: Oregon State Historic Preservation Office Address: 725 Summer St NE,...

  15. Nevada State Historic Preservation Office | Open Energy Information

    Open Energy Info (EERE)

    Office Jump to: navigation, search Logo: Nevada State Historic Preservation Office Name: Nevada State Historic Preservation Office Address: 901 S. Stewart St. Place: Carson City,...

  16. FTCP Site Specific Information - Chicago Office | Department of Energy

    Energy Savers [EERE]

    Chicago Office FTCP Site Specific Information - Chicago Office FTCP Agent Organization Name Phone E-Mail Chicago Office Patrick N. Smith (OR) (Interim FTCP Agent) 865/574-0960 Annual Workforce Analysis and Staffing Plan Reports Calendar Year

  17. Idaho Operations Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    31,2010 Rod Wetsch 420 County Road 26 Beulah, ND 58523 SUBJECT: FOIA Response (10-035) (ID-2010-01986-F) (OM-PA-I0-061) Dear Mr. Wetsch: This is in final response from the Idaho Operations Office (DOE-ID), regarding your June 2, 2010, Freedom of Information Act Request. In that e-mail you requested documents relating to: "vulnerabilities of running desktop applications (Word, Excel, and PowerPoint) on the same platform as the process control systems applications." The administrator for

  18. Richland Operations Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ESO~Richland, Washington 99352 August 4, 2009 Certified Mail Mr. Thomas Zeilman Law Office of Thomas Zeilamn P.O. Box 34 Yakima, Washington 98907 Dear Mr. Zeilman: FREEDOM OF INFORMATION ACT REQUEST (FOI 2009-0041) You requested, pursuant to the Freedom of Information Act (FOJA), documents regarding any decisions made by the U.S. Department of Energy (DOE) to prohibit hunting or trapping of the Rattlesnake Hills Elk Herd within the Fitzner-Eberhart Arid Lands Ecology Reserve at the Hanford

  19. Richland Operations Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    E Richland, Washington 99352 Certified Mail Mr. Thomas Zeilman Law Office of Thomas Zeilamn JUN 1 5 2009 P.O. Box 34 Yakima, Washington 98907 Dear Mr. Zeilman: FREEDOM OF INFORMATION ACT REQUEST (FOI 2009-0041) You requested, pursuant to the Freedom of Information Act (FOJA), documents regarding any decisions made by the U.S. Department of Energy (DOE) to prohibit hunting or trapping of the Rattlesnake Hills Elk Herd within the Fitzner-Eberhart Arid Lands Ecology Reserve at the Hanford Reach

  20. BLM Utah State Office | Open Energy Information

    Open Energy Info (EERE)

    Utah State Office Jump to: navigation, search Logo: BLM Utah State Office Name: BLM Utah State Office Abbreviation: Utah Address: 440 West 200 South, Suite 500 Place: Salt Lake...

  1. BLM Oregon State Office | Open Energy Information

    Open Energy Info (EERE)

    Oregon State Office Jump to: navigation, search Logo: BLM Oregon State Office Name: BLM Oregon State Office Abbreviation: Oregon Address: 333 S.W. 1st Avenue Place: Portland, OR...

  2. Minutes from the January 19, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    January 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide FY-2010 Three-Year Plan Dallas Woodruff, Headquarters in formed the group that the Department-wide Printing and Publishing Activities is currently in the concurrence

  3. Minutes from the January 20, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    , 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-one individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the Department-wide Printing and Publishing Activities Report Three-Year Plan. Dallas Woodruff,

  4. Minutes from the May 26, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    26, 2010 Printing and Mail Managers Exchange Forum Teleconference Seventeen individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Update on the FY 2010, Congressional Joint Committee on Printing Commercial Printing Report "JCP

  5. Minutes from the November 17, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    November 17, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty seven individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors Comments/Additions to last Months Minutes No comments. Printing Agenda Items......... Update on the Department-wide "Three-Year Plan" Dallas Woodruff, Headquarters opened the meeting by thanking everyone for providing their sites Three-Year Plan data to Headquarters in

  6. Minutes from the September 15, 2010 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    September 15, 2010 Printing and Mail Managers Exchange Forum Teleconference Twenty-four individuals participated in the Printing and Mail Managers Exchange Forum, which included Printing and Mail Managers and Contractors. Comments/Additions to last Months Minutes Dallas Woodruff, Headquarters opened the meeting by thanking everyone for participating in the today's teleconference. Printing Agenda Items... Upcoming FY 2010 Department-wide Three-Year Plan Dallas Woodruff, Headquarters informed the

  7. Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mail-Order Metal-Organic Frameworks (MOFs): Designing Isoreticular MOF-5 Analogues Comprising Commercially Available Organic Molecules Previous Next List R. L. Martin, L.-C. Lin,...

  8. Minutes from the May 3, 2012 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    http:www.gsa.govmailpolicy (for training options) ... discussion Brainstorming discussion on methodsapproaches to reduce printing expenses: ...

  9. Fermilab Office of General Counsel - Ethics Program - Submit a Question

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Submit a Question Ask the Ethicist Ask the Ethicist Questions & Answers Submit a Question Annual Reminders Reporting Fraud Holiday Parties Fermilab employees can complete the form below to submit a question to an ethicist. Names and e-mails will not be posted. If you'd like a personal reply or want to be notified if your submitted question and answer are posted, please include an e-mail address. Required fields are marked with an asterisk (*). Name: Email address: *Question:

  10. OSTI, US Dept of Energy, Office of Scientific and Technical Informatio...

    Office of Scientific and Technical Information (OSTI)

    Walt Warnick, Director of OSTI, recently had the honor of speaking at two events at the ... address. The e-mail address is not made public and will only be used if you wish to ...

  11. FTCP Site Specific Information - Oak Ridge Office | Department of Energy

    Energy Savers [EERE]

    Office FTCP Site Specific Information - Oak Ridge Office FTCP Agent Organization Name Phone E-Mail Oak Ridge Patrick Smith 865/574-0960 Annual Workforce Analysis and Staffing Plan Reports Calendar Year 2013 Calendar Year 2012 Calendar Year 2011 Calendar Year 2010 TQP Self-Assessment ORO TQP Self-Assessment, March 2014

  12. Natural Gas Industry Comments on Smart Grid RFI: Addressing Policy...

    Energy Savers [EERE]

    Natural Gas Industry Comments on Smart Grid RFI: Addressing Policy and Logistical Challenges to Smart Grid ... to the U.S. Department of Energy, Office of Electricity Delivery ...

  13. Enron Documents received from Office of Congressional and Intergovernmental Affairs

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Congressional Documents received from Office of Congressional and Intergovernmental Affairs 1. Document entitled "Texas Electricity Reliability Summit Agenda." 3 pages. (F2001-00630) 2. E-mail to Richard Glick from Michael Fourcher, dated May 22, 2000. Subject: RE: May 26. 1 page. (F2001-00630) 3. E-mail to Arlene Estep from Doreen Williams, dated June 11, 2002. 1 page. (F2001- 00630) 4. E-mail to Arlene Estep from Michael Ivahnenko, dated June 11, 2002. 1 page with one enclosure.

  14. Minutes from the October 26, 2011 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Woodruff also said the files are due back to Headquarters no later November 11, 2011, and the report is due to congress by February 10, 2012. Mail Agenda Items...... Fiscal ...

  15. Minutes from the March 14, 2013 Printing and Mail Teleconference

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 14, 2013 Mail discussion Al Majors is on leave today. Ellsworth Howell Jr. and Tony Nellums are sitting for Al. There are no agenda items for the Mail portion. A discussion period for questions, comments, or suggestions was opened without response Printing discussion Discussed suggestions for reducing printing expenses Presidential Executive Order 13589 and reducing hard copy printing in favor of electronic publishing Sec. 5. Printing. Agencies are encouraged to limit the publication and

  16. BLM California Desert District Office | Open Energy Information

    Open Energy Info (EERE)

    California Desert District Office Jump to: navigation, search Name: California Desert District Office Address: 22835 Calle San Juan De Los Lagos Place: Moreno Valley, CA Zip: 92553...

  17. BLM Central California District Office | Open Energy Information

    Open Energy Info (EERE)

    Central California District Office Jump to: navigation, search Name: BLM Central California District Office Address: 2800 Cottage Way, Suite W-1623 Place: Sacramento, CA Zip: 95825...

  18. BLM Sierra Front Field Office | Open Energy Information

    Open Energy Info (EERE)

    Front Field Office Jump to: navigation, search Name: BLM Sierra Front Field Office Abbreviation: Sierra Front Address: 5665 Morgan Mill Road Place: Carson City, NV Zip: 89701 Phone...

  19. BLM Humboldt River Field Office | Open Energy Information

    Open Energy Info (EERE)

    River Field Office Jump to: navigation, search Name: BLM Humboldt River Field Office Abbreviation: Humboldt River Address: 5100 E. Winnemucca Blvd. Place: Winnemucca, Nevada Zip:...

  20. MENTEE QUESTIONNAIRE Name: Title: Email: Office Phone Number...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Title: Email: Office Phone Number: Office Address: Why are you interested in the mentoring program? (This information will be included with the invitation to your potential...

  1. Frequently Asked Questions on Filing EISs with EPA's Office of...

    Office of Environmental Management (EM)

    Filing EISs with EPA's Office of Federal Activities This letter from the Director of the Environmental Protection Agency's Office of Federal Activities addresses common questions...

  2. Arizona State Historic Preservation Office | Open Energy Information

    Open Energy Info (EERE)

    Historic Preservation Office Jump to: navigation, search Name: Arizona State Historic Preservation Office Abbreviation: SHPO Address: 1300 West Washington Street Place: Phoenix,...

  3. Wyoming State Historic Preservation Office | Open Energy Information

    Open Energy Info (EERE)

    Historic Preservation Office Jump to: navigation, search Name: Wyoming State Historic Preservation Office Abbreviation: SHPO Address: 2301 Central Avenue Place: Cheyenne, Wyoming...

  4. Hawaii Department of Health Office of Environmental Quality Control...

    Open Energy Info (EERE)

    Office of Environmental Quality Control Jump to: navigation, search Name: Hawaii Department of Health Office of Environmental Quality Control Address: 235 S. Beretania Suite 702...

  5. CMTA Office

    High Performance Buildings Database

    Prospect, KY When CMTA outgrew their old office space, the consultant engineering company decided to construct a new building. Not only does the structure provide offices for the firm, it also showcases progressive design elements and allows the firm to test new technologies and demonstrate their effectiveness to clients. The new CMTA office building is located in a live-work development on the outskirts of Louisville, KY. The location was selected to place the office close to where the employees live.

  6. Office | Open Energy Information

    Open Energy Info (EERE)

    Office Jump to: navigation, search Building Type Office Definition Buildings used for general office space, professional office, or administrative offices. Medical offices are...

  7. change_address_111609

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CHANGE OF ADDRESS and EMERGENCY NOTIFICATION TO: HUMAN RESOURCES DATE: Z Social Security Print First Name Print Middle Name or Initial Print Last Name (Currently in Payroll...

  8. Contact Us | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Find mailing addresses, phone numbers, and contact information for NREL staff. Mailing Address and Phone Numbers Golden, Colorado Laboratories and Offices National...

  9. LOCATION: Johnson County Sheriff's Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    LOCATION: Johnson County Sheriff's Office Criminalistics Laboratory 11890 Sunset Drive Olathe, Kansas 66061 DATE: JULY 15TH - JULY 18TH, 2013 TUITION: MAFS MEMBERS: $550 Non-MAFS Members: $650 HOW TO ENROLL: Follow this link and complete on-line registration. Pay- ment may be made online via PayPal or a company check may be mailed to MAFS Treasurer. Payment information is all located at the registration site: LODGING AND TRAVEL: Training Rate $107.77 per night

  10. BLM Burley Field Office | Open Energy Information

    Open Energy Info (EERE)

    Burley Field Office Jump to: navigation, search Name: BLM Burley Field Office Address: 15 East 200 South Place: Burley, ID Zip: 83318 Phone Number: 208-677-6600 Website:...

  11. BLM Ukiah Field Office | Open Energy Information

    Open Energy Info (EERE)

    Ukiah Field Office Jump to: navigation, search Name: BLM Ukiah Field Office Address: 2550 North State Street Place: Ukiah, CA Zip: 95482 Phone Number: (707) 468-4000 Website:...

  12. Burley Field Office | Open Energy Information

    Open Energy Info (EERE)

    Field Office Jump to: navigation, search Name: BLM Burley Field Office Address: 15 East 200 South Place: Burley, ID Zip: 83318 Phone Number: 208-677-6600 Website: www.blm.govid...

  13. Contact Nonproliferation Program Offices | National Nuclear Security...

    National Nuclear Security Administration (NNSA)

    and are not part of the media*, feel free to call the program office's main ... Office of Fissile Materials Disposition (202) 586-2695 Address: U.S. Department of Energy ...

  14. BLM Field Offices | Open Energy Information

    Open Energy Info (EERE)

    Field Offices Jump to: navigation, search Name: BLM Field Offices Address: 1849 C Street NW, Rm. 5665 Place: Washington, District of Columbia Zip: 20240 Phone Number: 202-208-3801...

  15. Addressing Policy and Logistical Challenges to Smart Grid Implementation:

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Comments by the Office of the Ohio Consumers' Counsel | Department of Energy Smart Grid Implementation: Comments by the Office of the Ohio Consumers' Counsel Addressing Policy and Logistical Challenges to Smart Grid Implementation: Comments by the Office of the Ohio Consumers' Counsel The Office of the Ohio Consumers' Counsel ("OCC") hereby submits the following comments in response to the United States Department of Energy ("DOE") Request for Information

  16. Financing Innovation to Address Global Climate Change

    Broader source: [DOE]

    The U.S. Department of Energy’s Loan Programs Office (LPO) is helping address the global challenge of climate change by providing critical financing needed to deploy some of the world’s largest and most innovative clean energy and advanced technology vehicles manufacturing projects, preventing more than 25 million metric tons of CO2 emissions to date.

  17. Golden Field Office | Open Energy Information

    Open Energy Info (EERE)

    DOE Golden Field Office Abbreviation: DOE GFO Address: 15013 Denver West Parkway Place: Golden, Colorado Zip: 80401 Phone Number: 720-356-1800 ParentHolding Organization: US...

  18. Hawaii State Energy Office | Open Energy Information

    Open Energy Info (EERE)

    Hawaii State Energy Office Jump to: navigation, search Name: Dept. of Business, Economic Development & Tourism Address: 235 S. Beretania, 5th Floor Place: Honolulu, Hawaii Zip:...

  19. TCEQ Regional Offices | Open Energy Information

    Open Energy Info (EERE)

    Environmental Quality provides a map, list of managers, addresses, and phone numbers of its regional offices. Published NA Year Signed or Took Effect 2014 Legal Citation TCEQ...

  20. Office Buildings - Types of Office Buildings

    U.S. Energy Information Administration (EIA) Indexed Site

    administration building Insurance company headquarters building Local insurance agency Social services office Attorney's office Real estate sales office Government office State...

  1. BLM New Mexico State Office | Open Energy Information

    Open Energy Info (EERE)

    Office Jump to: navigation, search Logo: BLM New Mexico State Office Name: BLM New Mexico State Office Abbreviation: New Mexico Address: 301 Dinosaur Trail Place: Santa Fe, NM Zip:...

  2. BLM Fire and Aviation Office | Open Energy Information

    Open Energy Info (EERE)

    Fire and Aviation Office Jump to: navigation, search Logo: BLM Fire and Aviation Office Name: BLM Fire and Aviation Office Address: 1849 C Street NW, Rm. 5665 Place: Washington, DC...

  3. Fellows' Officers

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Officers Fellows' Officers Current officers and listing of coordinators from 1982 to present. Current and past officers, coordinators 2015-2016 Dipen Sinha, Coordinator Chuck Farrar, Deputy Coordinator Secretary (vacant) Past coordinators 2014-2015: Brad Meyer 2013-2014: Toni Taylor 2012-2013: Pat Colestock 2011-2012:Quanxi Jia 2010-2011: Joyce Guzik 2009-2010: Darryl L. Smith 2008-2009: S. Peter Gary 2007-2008: R. S. Hixson 2006-2007: W. C. Priedhorsky 2005-2006: G. T. Gray III 2004-2005: M. M.

  4. Security Officer

    Broader source: [DOE]

    This position is located in the Security and Continuity of Operations (NN) organization of the Chief Administrative Office (N), Bonneville Power Administration. The Security and Continuity of...

  5. U Department of Energy Richland Operations Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    T01 U Department of Energy Richland Operations Office P.O. Box 550 STESo Richland, Washington 99352 April 29, 2010 Certified Mail Mr. Dvija Bertish Director of Environmnental & Conservation Rosemere Neighborhood Association P.O. Box 61471 Vancouver, Washington 98666 Dear Mr. Bertish: FREEDOM OF INFORMATION ACT REQUEST (FOI 2010-013 19) You requested, pursuant to the Freedom of Information Act (FOIA), a copy of the Court Reporter's transcript of the public hearing held in Portland Oregon on

  6. E-mail et Web : pour une navigation sans risque

    ScienceCinema (OSTI)



    Présentation orale en français, support visuel en anglais. À travers des exemples concrets, vous consoliderez vos connaissances et pourrez ainsi réajuster vos habitudes concernant l?utilisation sécurisée de votre boîte e-mail et de votre navigateur Web.

  7. OSTI, US Dept of Energy, Office of Scientific and Technical Informatio...

    Office of Scientific and Technical Information (OSTI)

    expertise and world-class scientific facilities and ... Thorium - An Element with Promise 2 weeks ago Climate Change ... All e-mails from the system will be sent to this address. ...

  8. OSTI, US Dept of Energy, Office of Scientific and Technical Informatio...

    Office of Scientific and Technical Information (OSTI)

    is responsible for world-class biological and ... the impacts of energy production and use on climate change). ... All e-mails from the system will be sent to this address. ...

  9. OSTI, US Dept of Energy, Office of Scientific and Technical Informatio...

    Office of Scientific and Technical Information (OSTI)

    shows us they are in a class by themselves with ... Thorium - An Element with Promise 2 weeks ago Climate Change ... All e-mails from the system will be sent to this address. ...

  10. OSTI, US Dept of Energy, Office of Scientific and Technical Informatio...

    Office of Scientific and Technical Information (OSTI)

    and the first in a new class of two-dimensional ... Thorium - An Element with Promise 2 weeks ago Climate Change ... All e-mails from the system will be sent to this address. ...

  11. OSTI, US Dept of Energy, Office of Scientific and Technical Informatio...

    Office of Scientific and Technical Information (OSTI)

    Now we are taking a step to help change that perspective. We ... world-class information can accompany ... All e-mails from the system will be sent to this address. ...

  12. OSTI, US Dept of Energy, Office of Scientific and Technical Informatio...

    Office of Scientific and Technical Information (OSTI)

    Students of the NXS class of 2014 talked about their ... Thorium - An Element with Promise 2 weeks ago Climate Change ... All e-mails from the system will be sent to this address. ...

  13. Fermilab | Directorate | Offices

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Offices Office of Integrated Planning & Performance Management (IPPM) (authentication required) Office of Project Support Services (PSS) Office of Partnerships and Technology Transfer (OPTT) Office of Communication Program Planning Office Legal Office Last modified: 02/19

  14. WNR Offices

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Offices, Experimental Areas, Buildings, and Contacts Description Contact Name Bldg/Room Phone Pager/Alt. Phone Group Office Julie Quintana 622/220 667-5377 665-5390 User Office Tanya Herrera 622/212 667-6797 MPF-31 Building Manager Kenny Madrid 31/125 665-0944 664-8327 MPF-17 Building Manager Gene Cartelli 6/133 667-2127 664-4234 MPF-7 Building Manager Bruce Wheeler 622/248 667-6715 664-8336 Property Julie Martinez 24/110 665-2058 664-6775 Waste Manager Lance Kloefkorn 6/236 665-3288 664-5972

  15. V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    7: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets V-147: IBM Lotus Notes Mail Client Lets Remote Users Execute Java Applets May 2, 2013 - 6:00am Addthis...

  16. Bioenergy Technologies Office: Publications

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Advanced Search Browse by Topic Mail Requests Help Key Publications Newsletter Biomass Basics Multimedia Webinars Databases Analytical Tools Glossary Student & Educator Resources...

  17. Office of Chief Financial Officer

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    This Order implements the provisions of the Chief Financial Officers Act of 1990 within the Department of Energy. Cancels SEN 34-91. Canceled by DOE O 520.1A.

  18. Mail-Order Metal-Organic Frameworks (MOFs) | Center for Gas

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    SeparationsRelevant to Clean Energy Technologies | Blandine Jerome Mail-Order Metal-Organic Frameworks (MOFs)

  19. Office Buildings - Full Report

    U.S. Energy Information Administration (EIA) Indexed Site

    administration building Insurance company headquarters building Local insurance agency Social services office Attorney's office Real estate sales office Government office State...

  20. Office of Energy Efficiency & Renewable Energy Advanced Manufacturing Office

    Energy Savers [EERE]

    Office of Energy Efficiency & Renewable Energy Advanced Manufacturing Office Quadrennial Technology Review (QTR): Technology Assessment - Sustainable Manufacturing/Flow of Materials Through Industry Joe Cresko - Sustainable Manufacturing Workshop Portland, OR January 6, 2016 2 Quadrennial Technology Review-2015 hOp:// The QTR is a comprehensive assessment of science and energy technology R&D opportuniHes to address

  1. Vehicle Technologies Office Fall 2015 Quarterly Analysis Review |

    Office of Environmental Management (EM)

    55 Jefferson Ave. Valley Forge Corporate Center Norristown, PA 19403-2497 Pauline Foley Assistant General Counsel 610.666.8248 | Fax - 610.666.8211 October 30, 2013 Via Electronic Mail: Julie A. Smith Office of Electricity Delivery and Energy Reliability Mail Code: OE-20 U.S. Department of Energy 1000 Independence Avenue, SW Washington, D.C. 20585 Re: Department of Energy - Improving Performance of Federal Permitting and

  2. Office of the Ombudsman | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Office of the Ombudsman Office of the Ombudsman What is the Office of the Ombudsman? The Office of the Ombudsman is an independent, neutral, confidential and informal resource available to all Department of Energy (DOE) federal employees. The Ombudsman staff increases organizational focus on mission critical activities by helping senior leaders, managers, supervisors, and staff to: Minimize unwarranted distractions in the workplace Increase employee engagement Expeditiously address individual

  3. Office of Executive Resources Office of the Chief Human Capital Officer

    Office of Environmental Management (EM)

    Office of Energy Efficiency & Renewable Energy Advanced Manufacturing Office Quadrennial Technology Review (QTR): Technology Assessment - Sustainable Manufacturing/Flow of Materials Through Industry Joe Cresko - Sustainable Manufacturing Workshop Portland, OR January 6, 2016 2 Quadrennial Technology Review-2015 hOp:// The QTR is a comprehensive assessment of science and energy technology R&D opportuniHes to address

  4. Office of Chief Financial Officer

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    Page Change 1 to DOE O 520.1 modifies the responsibility statement to include NNSA Field CFO positions, modifies Heads of Field Elements responsibilities for consistency with the CFO responsibilities, and makes a minor change to reflect the establishment of the Office of Management, Budget and Evaluation. Cancels SEN 34-9.

  5. Building Technologies Office Overview

    SciTech Connect (OSTI)


    Building Technologies Office Overview Presentation for the 2013 Building Technologies Office's Program Peer Review

  6. Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology Plenary IV: Advances in Bioenergy Feedstocks-From Field to Fuel Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology Allen Julian, Chief Business Officer, MBI PDF icon julian_biomass_2014.pdf More Documents & Publications 2015 Peer Review Presentations-Biochemical Conversion 2015 Peer Review Report Process Design and

  7. Expanding Opportunity and Addressing Unique Challenges Facing Women and

    Energy Savers [EERE]

    Girls of Color | Department of Energy Expanding Opportunity and Addressing Unique Challenges Facing Women and Girls of Color Expanding Opportunity and Addressing Unique Challenges Facing Women and Girls of Color November 17, 2014 - 11:35am Addthis When President Obama founded the White House Council on Women and Girls (CWG) within the first two months of taking office, he charged us with working to address inequalities and barriers facing women and girls in our schools, workplaces, and

  8. The Office

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Office of Energy Efficiency and Renewable Energy (EERE) is leading the U.S. Department of Energy's efforts to deliver market-driven solutions for energy- saving homes, buildings, and manufacturing; sustainable transportation; and renewable power. Sustainable TRANSPORTATION Renewable ENERGY Energy EFFICIENCY EERE research has helped reduce production costs of automotive lithium-ion batteries by ~70% since 2008 More than electric charging units 20,000

  9. Prototype Programmatic Agreement Between DOE, State Energy Offices, and State Historic Preservation Offices

    Broader source: [DOE]

    Prototype programmatic agreement between the U.S. Department of Energy, state energy offices and state historic preservation offices regarding the DOE Office of Energy Efficiency and Renewable Energy (EERE) State Energy Program (SEP), Weatherization Assistance Program, and Energy Efficiency and Conservation Block Grant Program regarding the responsibility to address historic preservation requirements.

  10. Office of Information Resources

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    I m ~ a c t Assessment (PIA) Name of Project: SEC-2 Bureau: US Department of Energy (DOE) Project Unique ID: DOE-ID Security clearance work tracking and budget system. Date: April 4,2008 A. CONTACT INFORMATION 1. Who is the person completing this document? Name: Jeffrey R. Lascheid Title: Program Manager Organization: Westech International, Inc. Address: 1955 N. Fremont Ave, MS 1170 Idaho Falls, ID 8341 5 2. Who is the system owner? Name: M. Christine Ott, Chief Information Officer US DOE, Idaho

  11. BLM Twin Falls District Office | Open Energy Information

    Open Energy Info (EERE)

    Falls District Office Jump to: navigation, search Name: BLM Twin Falls District Office Address: 2536 Kimberly Road Place: Twin Falls, ID Zip: 83301 Phone Number: 208-735-2060...

  12. BLM Las Cruces District Office | Open Energy Information

    Open Energy Info (EERE)

    Cruces District Office Jump to: navigation, search Name: BLM Las Cruces District Office Address: 1800 Marquess Street Place: Las Cruces, NM Zip: 88005 Phone Number: (575) 525-4300...

  13. BLM Four Rivers Field Office | Open Energy Information

    Open Energy Info (EERE)

    Four Rivers Field Office Jump to: navigation, search Name: BLM Four Rivers Field Office Address: 3948 Development Ave. Place: Boise, ID Zip: 83705 Phone Number: 208-384-3300...

  14. BLM Idaho Falls District Office | Open Energy Information

    Open Energy Info (EERE)

    Falls District Office Jump to: navigation, search Name: BLM Idaho Falls District Office Address: 1405 Hollipark Drive Place: Idaho Falls, ID Zip: 83401 Phone Number: 208-524-7500...

  15. Nevada State Office of Energy | Open Energy Information

    Open Energy Info (EERE)

    Energy Jump to: navigation, search Logo: Nevada State Office of Energy Name: Nevada State Office of Energy Address: 755 North Roop St., Suite 202 Place: Carson City, Nevada Zip:...

  16. Utah State Historic Preservation Office | Open Energy Information

    Open Energy Info (EERE)

    Office Jump to: navigation, search Name: Utah State Historic Preservation Offic Address: 300 S. Rio Grande Street Place: Salt Lake City, Utah Zip: 84101 Website:

  17. Environmental Management Los Alamos Field Office Corrective Action...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Office (NA-LA) continues with the responsibility for the management of LANL's national ... and EM-LA Field Offices, with joint responsibility for addressing the Judgements of Need ...

  18. Office of UNF Disposition International Program- Strategic Plan

    Broader source: [DOE]

    The Department of Energy’s Office of Nuclear Energy, Used Nuclear Fuel Disposition Research and Development Office (UFD), performs the critical mission of addressing the need for an integrated...

  19. Office of the Chief Financial Officer .:. Lawrence Berkeley National...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Office of the Chief Financial Officer Office of the Cheif Financial Officer Lawrence Berkeley Naitonal Laboratory Department of Energy Quicklinks: ---...

  20. Office of Fossil Energy

    Broader source: (indexed) [DOE]

    Terminal (Bcf) (Bcf) (Bcf) LNG Imports by Company Office of Fossil Energy Office of Oil & Natural Gas Office of Regulation and International Engagement Division of Natural Gas...

  1. U-157: Ruby Mail Gem Directory Traversal and Shell Command Injection Vulnerabilities

    Broader source: [DOE]

    Some vulnerabilities have been reported in the Mail gem for Ruby, which can be exploited by malicious people to manipulate certain data and compromise a vulnerable system.

  2. Wyoming Office of State Lands and Investments | Open Energy Informatio...

    Open Energy Info (EERE)

    Investments Jump to: navigation, search Name: Wyoming Office of State Lands and Investments Abbreviation: OSLI Address: 122 West 25th Street 3W Place: Cheyenne, Wyoming Zip: 82001...

  3. Utah Office of Energy Development | Open Energy Information

    Open Energy Info (EERE)

    Jump to: navigation, search Name: Utah Office of Energy Development Address: PO Box 144845 Place: Salt Lake City, Utah Zip: 84114 Phone Number: 801-538-8732 Website:...

  4. Hawaii Department of Land and Natural Resources Office of Conservation...

    Open Energy Info (EERE)

    to: navigation, search Name: Hawaii Department of Land and Natural Resources Office of Conservation and Coastal Lands From Open Energy Information Address: P.O. Box 261 Place:...

  5. Subscribe Today to E-mail Alerts from GTO

    Broader source: [DOE]

    Sign up today to get the most up-to-date information on Geothermal Technologies Office (GTO)-sponsored webinars and funding announcements as they become available—delivered right to your inbox for free.

  6. FTCP Site Specific Information - Office of Environment, Health, Safety &

    Energy Savers [EERE]

    Security | Department of Energy Environment, Health, Safety & Security FTCP Site Specific Information - Office of Environment, Health, Safety & Security FTCP Agent Organization Name Phone E-Mail EHSS HQ Pat Worthington Mark Blackburn 301-903-5926 301-903-8396 Annual Workforce Analysis and Staffing Plan Reports Calendar Year 2015 Calendar Year 2014 Calendar Year 2013 Calendar Year 2012 Calendar Year 2011 Calendar Year 2010 TQP

  7. Ms. Julie Smith Office of Electricity Delivery and Energy Reliability

    Energy Savers [EERE]

    5, 2013 Ms. Julie Smith Office of Electricity Delivery and Energy Reliability Mail Code OE-20 U.S. Department of Energy 1000 Independence Avenue Washington, D.C. 20585; Re: DOE RFI "Improving Performance of Federal Permitting and Review of Infrastructure Projects The American people support increased production and consumption of renewable energy according to credible public opinion polls. Too often the most appropriate sites for wind,

  8. Office of the Chief Financial Officer Organization Chart | Department...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    About Us Office of the Chief Financial Officer Organization Chart Office of the Chief Financial Officer Organization Chart OCFOFrontOffice2015.jpg Leadership Organization ...

  9. Address:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Additive Manufacturing for Ceramics Citation Details In-Document Search Title: Additive Manufacturing for Ceramics Authors: Peterson, Dominic S. [1] + Show Author Affiliations Los Alamos National Laboratory [Los Alamos National Laboratory Publication Date: 2014-01-29 OSTI Identifier: 1119593 Report Number(s): LA-UR-14-20523 DOE Contract Number: AC52-06NA25396 Resource Type: Technical Report Research Org: Los Alamos National Laboratory (LANL) Sponsoring Org: DOE/LANL Country of Publication:

  10. Keynote Address | Department of Energy

    Office of Environmental Management (EM)

    40PM to 2:05PM PDT Pacific Ballroom Wednesday keynote address by Dan Arvizu, Director, National Renewable Energy Laboratory

  11. Biosurveillance panel to address essential science for public health

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Panel to address essential science for public health Biosurveillance panel to address essential science for public health A team of national experts across varied disciplines will be gathering Feb. 17 in Chicago, prepared to explore the most critical aspects of international disease awareness. February 17, 2014 Basil Swanson Basil Swanson Contact Nancy Ambrosiano Communications Office (505) 699-1149 Email "It is absolutely essential that nations are able to quickly detect and characterize a

  12. {open_quotes}Media-On-Demand{close_quotes} multimedia electronic mail: A tool for collaboration on the web

    SciTech Connect (OSTI)

    Tsoi, Kei Nam; Rahman, S.M.


    Undoubtedly, multimedia electronic mail has many advantages in exchanging information electronically in a collaborative work. The existing design of e-mail systems architecture is inefficient in exchanging multimedia message which has much larger volume, and requires more bandwidth and storage space than the text-only messages. This paper presents an innovative method for exchanging multimedia mail messages in a heterogeneous environment to support collaborative work over YAW on the Internet. We propose a {open_quotes}Parcel Collection{close_quotes} approach for exchanging multimedia electronic mail messages. This approach for exchanging multimedia electronic mail messages integrates the current WWW technologies with the existing electronic mail systems.

  13. Geothermal Technologies Office - Webmaster | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Technologies Office - Webmaster Geothermal Technologies Office - Webmaster

  14. Office of the Chief Financial Officer

    Broader source: [DOE]

    Welcome to the U.S. Department of Energy, Office of the Chief Financial Officer. The mission of the Office of the Chief Financial Officer is to assure the effective management and financial integrity of Department of Energy programs, activities, and resources by developing and implementing and monitoring Department-wide policies and systems in the areas of budget administration, program analysis and evaluation, finance and accounting, internal controls, corporate financial systems, and strategic planning.

  15. Keynote Address | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    10PM to 1:40PM PDT Pacific Ballroom Wednesday's keynote address by Dr. David Danielson, Assistant Secretary for Energy Efficiency and Renewable Energy, U.S. Department of Energy

  16. Office of Information Resources

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Joanne Csordas (HS-1.21), Office of Business Operations, Office of Resource Management, Office of Health, Safety and Security, U.S. Department of Energy, HS-1.21, 1000 Independence ...

  17. Office of Fossil Energy

    Office of Environmental Management (EM)

    LNG Imports by Country of Origin LNG Imports by Receiving Terminal (Bcf) (Bcf) (Bcf) LNG Imports by Company Office of Fossil Energy Office of Oil & Natural Gas Office of Regulation ...


    Broader source: [DOE]

    Paul Golan, Site Office Manager, SLAC/LBNL, presented on the role of the DOE Site Office. Paul covered the role of the DOE Site Office, operating model, and vision.

  19. Office of Executive Resources Office of the Chief Human Capital...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Office of Executive Resources Office of the Chief Human Capital Officer U.S. Department of ... The request must be submitted to the Office of the Chief Human Capital Officer, Office of ...

  20. Ombuds Office Location & Hours

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Ombuds Office Location & Hours Ombuds Office Location & Hours Committed to the fair and equitable treatment of all employees, contractors, and persons doing business with the...

  1. Geothermal Technologies Office: Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Geothermal Technologies Office Details Bookmark & Share View Related Welcome to the Energy Department's Geothermal Technologies Office Publication and Product Library. Here...

  2. livermore field office

    National Nuclear Security Administration (NNSA)

    donation to those in need.

    Livermore Field Office sets core values as part of continuous improvement process

  3. Building Technologies Office Overview

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Technologies Office Roland Risser Director, Building Technologies Office National Energy Consumption 40% 60% Reducing consumption or improving performance calls for cutting-edge ...

  4. Badging, Badge Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Office Badging, Badge Office The central point where badges are issued to employees and official visitors. Contact Badge Office (505) 667-6901 Email Badge Office location As the central point where badges are issued to employees and official visitors, the Badge Office is located on the second floor of the Otowi Building (TA-3, Bldg. 261). Badge Office map Printable 2-page map to the Badge Office (pdf) More maps and directions Badge Office hours Monday-Friday: 7:30 am - 4 pm Wednesday: Closed

  5. Office of Executive Resources Office of the Chief Human Capital...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Executive Resources Office of the Chief Human Capital Officer U.S. Department of Energy ... and performance awards. c. Chief Human Capital Officer (CHCO) and Office of Executive ...

  6. Office of Policy | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Office of Policy

  7. Livermore Field Office | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Livermore Field Office

  8. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  9. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  10. Contacts for the Advanced Manufacturing Office | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Contacts for the Advanced Manufacturing Office Contacts for the Advanced Manufacturing Office Welcome to the Advanced Manufacturing Office (AMO). Our address, email, and phone number are provided below. U.S. Department of Energy - Advanced Manufacturing Office (formerly Industrial Technologies Program) Room 5F-065, MS EE-5A 1000 Independence Ave, SW Washington, DC 20585 Phone: (202) 586-9488 Nearest Metro stop: Smithsonian (blue/orange line) Get directions Website Contact: Send us your comments,

  11. FAQS Reference Guide - Aviation Safety Officer | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Safety Officer FAQS Reference Guide - Aviation Safety Officer This reference guide addresses the competency statements in the January 2010 edition of DOE-STD-1164-2003 Chg 1, Aviation Safety Officer Functional Area Qualification Standard. PDF icon Aviation Safety Officer Qualification Standard Reference Guide, March 2010 More Documents & Publications FAQS Reference Guide - Aviation Manager DOE-STD-1165-2003 DOE-STD-1164

  12. Advanced Manufacturing Office News

    SciTech Connect (OSTI)


    News stories about advanced manufacturing, events, and office accomplishments. Subscribe to receive updates.

  13. State of the Lab Address

    ScienceCinema (OSTI)

    King, Alex


    In his third-annual State of the Lab address, Ames Laboratory Director Alex King called the past year one of "quiet but strong progress" and called for Ames Laboratory to continue to build on its strengths while responding to changing expectations for energy research.

  14. Office of Inspector General

    Energy Savers [EERE]

    Office of Inspector General Office of Audits and Inspections Work Plan for FY 2013 Audits Central Audits Division  Ecotality  Funding Overlap  Follow-up on Smart Grid Investment Grant  DOE's Loan Program Office's Portfolio Management  Office of Fossil Energy's Regional Carbon Sequestration Partnerships  Advanced Manufacturing Office's Combined Heat and Power Systems  DOE's Management of Contaminated Non-EM Facilities  Unneeded Real Estate  Review of For-Profit Grantees

  15. Office of Electricity Delivery and Energy Reliability

    Energy Savers [EERE]

    Comments of Cisco Systems to Office of Electricity Delivery and Energy Reliability Department of Energy in Response to Request for Information: Addressing Policy and Logistical Challenges to Smart Grid Implementation Issued September 13, 2010 FR Doc. 2010-23251 November 30, 2010 Cisco Systems provides these Comments in response to the Request for Information ("RFI") issued by the Office of Electricity Delivery and Energy Reliability of the Department of Energy ("DOE") on

  16. Addressing Deferred Maintenance, Infrastructure Costs, and Excess...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addressing Deferred Maintenance, Infrastructure Costs, and Excess Facilities at Portsmouth and Paducah Addressing Deferred Maintenance, Infrastructure Costs, and Excess Facilities ...

  17. Office of Executive Resources Office of the Chief Human Capital...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Office of Executive Resources Office of the Chief Human Capital Officer U.S. Department of ... and performance awards. c. Chief Human Capital Officer (CHCO) and Office of Executive ...

  18. February 2016 Office of Chief Financial Officer

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    6 DOE/CF-0124 Volume 6 Power Marketing Administrations Southeastern Power Administration Southwestern Power Administration Western Area Power Administration Bonneville Power Administration Department of Energy FY 2017 Congressional Budget Request February 2016 Office of Chief Financial Officer Volume 6 DOE/CF-0124 Volume 6 Power Marketing Administrations Southeastern Power Administration Southwestern Power Administration Western Area Power Administration Bonneville Power Administration Printed

  19. Contact | OSTI, US Dept of Energy, Office of Scientific and Technical

    Office of Scientific and Technical Information (OSTI)

    Information Contact (If you're a human, don't change the following field) Enter your name: 79807606a798 Your first name. Please enable Javascript to use this form. Your name: * Your e-mail address: * Subject: * Category: * - Please choose - STIP Website Subscribe to the Newsletter Message: * Send message

  20. DOE to Address Small Businesses Barriers in Government Contracting at Waste Management Conference

    Broader source: [DOE]

    PHOENIX – EM and the DOE Office of Small and Disadvantaged Business Utilization (OSDBU) are working to address barriers that hinder small businesses from competing for prime contracts for work in the Cold War cleanup program.

  1. Final Report on Internet Addressable Lightswitch

    SciTech Connect (OSTI)

    Rubinstein, Francis; Pettler, Peter


    This report describes the work performed to develop and test a new switching system and communications network that is useful for economically switching lighting circuits in existing commercial buildings. The first section of the report provides the general background of the IBECS (Integrated Building Environmental Communications System) research and development work as well as the context for the development of the new switching system. The research and development effort that went into producing the first proof-of-concept (the IBECS Addressable Power Switch or APS) and the physical prototype of that concept is detailed in the second section. In the third section of the report, we detail the refined Powerline Carrier Based IBECS Title 24 Wall Switch system that evolved from the APS prototype. The refined system provided a path for installing IBECS switching technology in existing buildings that may not be already wired for light level switching control. The final section of the report describes the performance of the IBECS Title 24 Switch system as applied to a small demonstration in two offices at LBNL's Building 90. We learned that the new Powerline Carrier control systems (A-10 technology) that have evolved from the early X-10 systems have solved most of the noise problems that dogged the successful application of X-10 technologies in commercial buildings. We found that the new A-10 powerline carrier control technology can be reliable and effective for switching lighting circuits even in electrically noisy office environments like LBNL. Thus we successfully completed the task objectives by designing, building and demonstrating a new switching system that can provide multiple levels of light which can be triggered either from specially designed wall switches or from a digital communications network. By applying commercially available powerline carrier based technologies that communicate over the in-place lighting wiring system, this type of control can be economi cally installed even in existing buildings that were not wired for dual-level lighting.

  2. Richland Operations Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    4TES~Richland, Washington 99352 August 5, 2010 Certified Mail Mr. Alec Osenbach Heart of America Northwest 1314 NE 56 th Street Suite 100 Seattle, Washington 98105 Dear Mr. Osenbach: FREEDOM OF INFORMATION ACT REQUEST (FOI 2010-01599) You requested, pursuant to the Freedom of Information Act (FOIA), the following informnation: 1 . Documents and records relating to the potential duration of storage for soil excavated since 2009 from the Environmental Restoration Disposal Facility (ERDF) at the

  3. Richland Operations Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Richland, Washington 99352 May 3, 2012 CERTIFIED MAIL Mr. Thomas Carpenter Hanford Challenge 219 1 St Avenue South, Suite 120 Seattle, Washington 98104 Dear Mr. Carpenter: FREEDOM OF INFORMATION ACT REQUEST (FOI 20 12-00870) You requested, pursuant to the Freedom of Information Act (FOLA), the following records generated in connection with a surveillance report entitled, "Review of the 100 K Infrastructure Utilities Upgrade Project:" 1. "A copy of the Surveillance report." 2.

  4. Carlsbad Field Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    CarlsbtfAfef ~ettJl~ 88221 Mr. John E. Kieling , Bureau Chief Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Building 1 Santa Fe, NM 87508-6303 Mr. Tom Blaine, Division Director Environmental Health Division Harold Runnels Building 1190 Saint Francis Drive, Room Santa Fe , NM 87502-5469 Subject: The Waste Isolation Pilot Plant Nitrate Salt Bearing Waste Container Isolation Plan Reference: New Mexico Environment Department E-Mail from Ryan Flynn to Jose

  5. Office of Management | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Office of Management The mission of the Department of Energy is to assure America’s security and prosperity by addressing its energy, environmental and nuclear challenges through transformative science and technology solutions. The mission of the Department of Energy is to assure America's security and prosperity by addressing its energy, environmental and nuclear challenges through transformative science and technology solutions. Featured Initiatives Fiscal Year 2015 - Conference Reporting

  6. Chicago Operations Office: Technology summary

    SciTech Connect (OSTI)

    Not Available


    This document has been prepared by the Department of Energy`s (DOE) Environmental Management (EM) Office of Technology Development (OTD) to highlight its research, development, demonstration, testing, and evaluation (RDDT and E) activities funded through the Chicago Operations Office. Technologies and processes described have the potential to enhance DOE`s cleanup and waste management efforts, as well as improve US Industry`s competitiveness in global environmental markets. The information has been assembled from recently produced OTD documents which highlight technology development activities within each of the OTD program elements. OTD technologies addresses three specific problem areas: (1) groundwater and soils cleanup; (2) waste retrieval and processing; and (3) pollution prevention. These problems are not unique to DOE, but are associated with other Federal agency and industry sites as well. Thus, technical solutions developed within OTD programs will benefit DOE, and should have direct applications in outside markets.

  7. Addressing the workforce pipeline challenge

    SciTech Connect (OSTI)

    Leonard Bond; Kevin Kostelnik; Richard Holman


    A secure and affordable energy supply is essential for achieving U.S. national security, in continuing U.S. prosperity and in laying the foundations to enable future economic growth. To meet this goal the next generation energy workforce in the U.S., in particular those needed to support instrumentation, controls and advanced operations and maintenance, is a critical element. The workforce is aging and a new workforce pipeline, to support both current generation and new build has yet to be established. The paper reviews the challenges and some actions being taken to address this need.

  8. Director, Building Technologies Office

    Broader source: [DOE]

    This position is located in the Building Technologies Office (BTO) of the Office of Energy Efficiency and Renewable Energy (EERE). The mission of EERE is to create and sustain American leadership...

  9. Office of Information Management

    Broader source: [DOE]

    The Office of Information Management provides a broad range of information technology services in support of the Associate Under Secretary for the Office of Environment, Health, Safety and Security (AU).

  10. Office of Information Resources

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    manager for this system or application? Raymond Holmer (HS-1.22), Director, Office of ... D a t e ) e: Raymond Holmer itle: i r i c t o r , Office of Information Management, ...

  11. DEPARTMENT OF I Office

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DEPARTMENT OF I Office of ENERGY Science SLAC Site Office SLAC National Accelerator Laboratory 2575 Sand Hill Road, MS-8A Menlo Park, CA 94025 DATE: January 11, 2012 MEMORANDUM ...

  12. Office of Science

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ... Social Twitter Google + Vimeo GovDelivery SlideShare Office of Science HomeOffice of Science Controlled Self-Assembly in Ternary Polymers Top Left: Schematic of ternary polymer ...

  13. Office Buildings: Consumption Tables

    U.S. Energy Information Administration (EIA) Indexed Site

    and Type of Office Building Total (trillion Btu) per Building (million Btu) per Square Foot (thousand Btu) Dollars per Million Btu All Office Buildings 1,089 1,475 90.5 16.32...

  14. Carlsbad Field Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of the CBFO Office of Quality Assurance, at (575) 234-7476. Sincerely, signature on file Jose R. Franco, Manager Carlsbad Field Office Enclosure CBFO:OQA:MPN:MAG:14-1052...

  15. Geothermal Technologies Office April

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Annual Report Geothermal Technologies Office April 2016 1 2015 Annual Report | Geothermal Technologies Office Director's Message Geothermal Technologies Office FY 2016 Budget at a Glance Enhanced Geothermal Systems Hydrothermal Program Low-Temperature and Coproduced Resources Systems Analysis Events and Highlights People Acronyms Resources Table of Contents 2 2 3 7 13 17 19 23 26 28 2015 Achievements Geothermal Technologies Office Steam, West Flank of Coso, NV The 2015 Annual Report of the

  16. Building Technologies Office Overview

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Office (BTO) Ecosystem Emerging Technologies ... Heat Flow + Air Flow + Water Flow Ventilation Thermal ... and related services 3. Enable buildings to ...

  17. LANSCE | Users | User Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    User Office LANSCE User Office and Visitor Center The LANSCE User Office is responsible for coordinating the users with LANSCE instrument scientist and the facility. Users contact the User Office weeks before they arrive at the LANSCE Visitor Center at Technical Area 53. Among their many responsibilities, the team issues the call for proposals, coordinates proposal experiment schedules, directs users to the training center, issues badges and dosimeters, helps to arrange tours of the facilities,


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    It is anticipated that the outcome of the 120-day study may ... control; i.e., medical emergencies, travel schedules, etc. ... Acting Director, Customer Care Office (IM-61). (FY 13 Q1 - ...

  19. February 2016 Office of Chief Financial Officer

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    4 DOE/CF-0122 Volume 4 Science Advanced Research Projects Agency-Energy Department of Energy FY 2017 Congressional Budget Request February 2016 Office of Chief Financial Officer Volume 4 DOE/CF-0122 Volume 4 Science Advanced Research Projects Agency-Energy Printed with soy ink on recycled paper Department of Energy FY 2017 Congressional Budget Request Volume 4 Table of Contents Page Appropriation Account Summary

  20. February 2016 Office of Chief Financial Officer

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    1 DOE/CF-0119 Volume 1 National Nuclear Security Administration Weapons Activities Defense Nuclear Nonproliferation Naval Reactors Federal Salaries and Expenses Department of Energy FY 2017 Congressional Budget Request February 2016 Office of Chief Financial Officer Volume 1 DOE/CF-0119 Volume 1 National Nuclear Security Administration Weapons Activities Defense Nuclear Nonproliferation Naval Reactors Federal Salaries and Expenses Printed with soy ink on recycled paper Department of Energy FY

  1. February 2016 Office of Chief Financial Officer

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    5 DOE/CF-0123 Volume 5 Environmental Management Department of Energy FY 2017 Congressional Budget Request February 2016 Office of Chief Financial Officer Volume 5 DOE/CF-0123 Volume 5 Environmental Management Printed with soy ink on recycled paper Department of Energy FY 2017 Congressional Budget Request Volume 5 FY 2017 Congressional Budget Justification Environmental Management Table of Contents Page Funding by Appropriation Summary

  2. POLICY GUIDANCE MEMORANDUM #03 Addressing Missclassified Positions |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy 3 Addressing Missclassified Positions POLICY GUIDANCE MEMORANDUM #03 Addressing Missclassified Positions This memorandum provides policy guidance on how to consistently address misclassified positions within the Department and is effective immediately. There are several different circumstances that affect how a misclassified position will be addressed. PDF icon POLICY GUIDANCE MEMORANDUM #3A Addressing Missclassified Positions Responsible Contacts Jennifer Ackerman

  3. Office of Personnel Management (OPM) Billing System PIA, Office...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Personnel Management (OPM) Billing System PIA, Office of Health, Safety and Security Office of Personnel Management (OPM) Billing System PIA, Office of Health, Safety and Security ...

  4. Addressing failures in exascale computing

    SciTech Connect (OSTI)

    Snir, Marc; Wisniewski, Robert W.; Abraham, Jacob A.; Adve, Sarita; Bagchi, Saurabh; Balaji, Pavan; Belak, Jim; Bose, Pradip; Cappello, Franck; Carlson, William; Chien, Andrew A.; Coteus, Paul; Debardeleben, Nathan A.; Diniz, Pedro; Engelmann, Christian; Erez, Mattan; Saverio, Fazzari; Geist, Al; Gupta, Rinku; Johnson, Fred; Krishnamoorthy, Sriram; Leyffer, Sven; Liberty, Dean; Mitra, Subhasish; Munson, Todd; Schreiber, Robert; Stearly, Jon; Van Hensbergen, Eric


    We present here a report produced by a workshop on Addressing Failures in Exascale Computing held in Park City, Utah, August 411, 2012. The charter of this workshop was to establish a common taxonomy about resilience across all the levels in a computing system; discuss existing knowledge on resilience across the various hardware and software layers of an exascale system; and build on those results, examining potential solutions from both a hardware and software perspective and focusing on a combined approach. The workshop brought together participants with expertise in applications, system software, and hardware; they came from industry, government, and academia; and their interests ranged from theory to implementation. The combination allowed broad and comprehensive discussions and led to this document, which summarizes and builds on those discussions.

  5. Addressing Chromium in Groundwater | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addressing Chromium in Groundwater Addressing Chromium in Groundwater From 1956 to 1972, a non-nuclear power plant at Los Alamos National Laboratory periodically flushed water out ...

  6. Deputy Secretary Poneman Addresses Nuclear Deterrence Summit...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addresses Nuclear Deterrence Summit Deputy Secretary Poneman Addresses Nuclear Deterrence Summit February 17, 2010 - 12:00am Addthis Alexandria, VA - U.S. Deputy Secretary of ...

  7. EPA -- Addressing Children's Health through Reviews Conducted...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    EPA -- Addressing Children's Health through Reviews Conducted Pursuant to the National Environmental Policy Act and Section 309 of the Clean Air Act EPA -- Addressing Children's ...

  8. Expanding Opportunity and Addressing Unique Challenges Facing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Expanding Opportunity and Addressing Unique Challenges Facing Women and Girls of Color Expanding Opportunity and Addressing Unique Challenges Facing Women and Girls of Color ...

  9. Field Offices | U.S. DOE Office of Science (SC)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Field Office Programs for Workplace Disputes Field Office Programs for Workplace Disputes Each field office uses mediation to varying degrees to resolve their workplace disputes. For more information, contact Pamela Pontillo or the Employee Concerns Program Contacts (PDF) at each Field Office.

    Field Offices Field Offices Albuquerque U.S. Department of Energy Office of Inspector General P.O. Box 5400 Albuquerque, NM 87185-5400 Audit Services: (505) 845-5558 Inspections: (505) 845-5153 Office

  10. Oak Ridge Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    July 30, 2008 Oak Ridge Associated Universities Attn: Mr. Ivan Boatner, General Counsel P.O. Box 117 Oak Ridge, Tennessee 37831 Dear Mr. Boatner: SUBJECT: CONTRACT NO. DE-AC05-060R231 00, MODIFICATION A049 Enclosed is one fully executed copy of the subject document. This modification obligates the sum of $14,265 ,839.77, resulting in total obligations to this contract of $515,743,782 .56 . If you have any questions regarding this action, you may contact me at 576-0757 or via e-mail at

  11. Oak Ridge Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    September 30, 2008 Oak Ridge Associated Universities Attn: Mr. Ivan Boatner, General Counsel P.O. Box 117 Oak Ridge , Tennessee 37831 Dear Mr. Boatner: SUBJECT: CONTRACT NO. DE-AC05-060R23100, MODIFICATION A051 Enclosed is one fully executed copy of the subject document. This modification obligates the sum of $32,445,437.04, resulting in total obligations to this contract of $573,728,398.65. If you have any questions regarding this action, you may contact me at 576-0757 or via e-mail at

  12. Oak Ridge Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    October 1, 2008 Oak Ridge Associated Universities Attn: Mr. Ivan Boatner, General Counsel P.O. Box 117 Oak Ridge, Tennessee 37831 Dear Mr. Boatner: SUBJECT: CONTRACT NO. DE-AC05-060R23100, MODIFICATION A052 Enclosed is one fully executed copy of the subject document. This modification obligates the sum of $1,231,037.73, resulting in total obligations to this contract of $574,959,436.38 . If you have any questions regarding this action, you may contact me at 576-0757 or via e-mail at

  13. Oak Ridge Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    October 31, 2008 Oak Ridge Associated Universities Attn : Mr. Ivan Boatner, General Counsel P.O. Box 117 Oak Ridge, Tennessee 37831 Dear Mr. Boatner: SUBJECT: CONTRACT NO. DE-AC05-060R23100, MODIFICATION A054 Enclosed is one fully executed copy of the subject document. This modification obligates the sum of $10,799,1 39.34, resulting in total obligations to this contract of $585,758,575.72. If you have any questions regarding this action, you may contact me at 576-0757 or via e-mail at

  14. Richland Operations Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ATES Richland, Washington 99352 CERTIFIED MAIL SEP 1 4 2009 Mr. Ryan Jarvis Heart of America Northwest 1314 N.E. 5 6 th Street Suite 100 Seattle, Washington 98105 Dear Mr. Jarvis: FREEDOM OF INFORMATION ACT REQUEST (FOI 2009-0054) This letter is a partial response to your letters dated June 22, 2009, and July 15, 2009. In response to item 8, you requested "any records and documents relating to the contingency plan required pursuant to Washington Administrative Code Sections 173-303-806,

  15. Frequently Asked Questions on Filing EISs with EPA's Office of Federal Activities

    Broader source: [DOE]

    This letter from the Director of the Environmental Protection Agency's Office of Federal Activities addresses common questions related to the timing for filing EISs.

  16. Partially Superceded- Frequently Asked Questions on Filing EISs with EPA's Office of Federal Activities (EPA, 1994)

    Broader source: [DOE]

    This letter from the Director of the Environmental Protection Agency's Office of Federal Activities addresses common questions related to the timing for filing EISs.

  17. Vehicle Technologies Office: 2014 DEER Overview of the U.S. DOE...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Vehicle Technologies Office: 2014 DEER Overview of the U.S. DOE Vehicle Technologies Program DOE rationale for addressing transportation oil dependency, programs, specifically ...

  18. Carlsbad Field Office (CBFO) Corrective Action Plan - Truck Fire and

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Radiological Release | Department of Energy Carlsbad Field Office (CBFO) Corrective Action Plan - Truck Fire and Radiological Release Carlsbad Field Office (CBFO) Corrective Action Plan - Truck Fire and Radiological Release The purpose of this Corrective Action Plan (CAP) is to specify U.S. Department of Energy (DOE) Carlsbad Field Office (CBFO) actions for addressing issues identified in the March 2014, accident investigation report for the Underground Salt Haul Truck Fire at the Waste

  19. Independent Oversight Review, Savannah River Operations Office - July 2013

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    | Department of Energy Operations Office - July 2013 Independent Oversight Review, Savannah River Operations Office - July 2013 July 2013 Review of the Employee Concerns Program at the Savannah River Operations Office The purpose of this Independent Oversight targeted review was to evaluate DOE-SR processes and their implementation for addressing safety concerns reported by DOE, contractor, and subcontractor employees at the Savannah River Site (SRS). This targeted review was performed at

  20. Subscribe to Building Technologies Office Updates | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Subscribe to Building Technologies Office Updates Subscribe to Building Technologies Office Updates Sign up to receive email notices of funding opportunities, special events, live webinars, and news from the Building Technologies Office (BTO). These periodic notices include the following topics: New energy-saving technology Energy efficient commercial buildings Energy efficient residential buildings Appliance standards Building energy codes Buildings-to-Grid Integration Enter your email address


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    APP-005 Planning for and Measuring Office of Inspector General Results FY 2002 Annual Performance Report and FY 2003 Annual Performance Plan Office of Inspector General U.S. Department of Energy Inspector General's Message We are pleased to present the Office of Inspector General's (OIG) consolidated Fiscal Year 2002 Annual Performance Report and Fiscal Year 2003 Annual Performance Plan. This document evaluates our actual Fiscal Year (FY) 2002 performance and establishes the performance goals

  2. Office Of Nuclear Energy

    Energy Savers [EERE]

    Office Energy Checklist Office Energy Checklist This checklist outlines actions that conserve energy at the office. Checkbox Replace incandescent lights with compact fluorescent lights (CFLs) or light-emitting diodes (LEDs) for desk lamps and overhead lighting. Using CFLs instead of comparable incandescent bulbs can save about 50% on your lighting costs. CFLs use only one-fourth the energy and last up to 10 times longer. Checkbox Switch off all unnecessary lights. Use dimmers, motion sensors, or

  3. User Liaison Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    User Liaison Please upgrade your browser. This site's design is only visible in a graphical browser that supports web standards, but its content is accessible to any browser. Concerns? User Liaison Office User Liaison Home Users Group Program Advisory Committee User/Researcher Information print version ULO Services Driving in VA Housing Accomodations Office Space Student Affairs Office Telephone Services ULO Staff Lorelei Chopard User Liaison (ULO) (757) 269-6388 Bldg 12 L111 Hari Areti Head of

  4. Major Program Offices

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    101 Major Program Offices Doing Business with... Energy Efficiency and Renewable Energy Office of Environmental Management National Nuclear Security Administration Office of Science Gary G. Lyttek, Business Source Manager FY2010 DOE Procurement Base: $22.9B $1,556 $5,701 $9,523 $3,793 $2,304 $'s - Millions EE EM NNSA SC Other 2 Presentation for the DOE Small Business Conference EERE Funding Opportunity Announcements (FOA) May 2011 3 Office of Energy Efficiency and Renewable Energy 4 * The

  5. LANSCE | Training Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Users User Office User Program LANSCE User Group Rosen Scholar Rosen Prize News & Multimedia News Multimedia Events Profiles Highlights Seminars Activity Reports The Pulse User ...

  6. Nevada Site Office News

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NNSA/NSO Office of Public Affairs P.O. Box 98518 Las Vegas, NV 89193-8518 News Media Contact: For Immediate Release: Darwin J. Morgan December 13, 2011 Kelly J. Snyder 702-295-3521 New Support Services Contract Awarded for Nevada Site Office A new support services contract has been awarded at the National Nuclear Security Administration's Nevada Site Office. J.G. Management Systems, Inc., of Grand Junction, Colorado, will provide office

  7. Education Office Housing

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Education Office Housing Housing A housing forum and listings for housing in and around Los Alamos. Contact Postdoc Housing Email LANL Students' Association Email LANL postdoc...

  8. Director, Geothermal Technologies Office

    Broader source: [DOE]

    The mission of the Geothermal Technologies Office (GTO) is to accelerate the development and deployment of clean, domestic geothermal resources that will promote a stronger, more productive economy...

  9. Solar Energy Technologies Office

    Broader source: [DOE]

    In 2011, the Energy Department's Solar Energy Technologies Office (SETO) became the SunShot Initiative, a collaborative national effort that aggressively drives innovation to make solar energy...

  10. Vehicle Technologies Office: News

    Broader source: [DOE]

    EERE intends to issue, on behalf of its Fuel Cell Technologies Office, a Funding Opportunity Announcement (FOA) entitled "Fuel Cell Technologies Incubator: Innovations in Fuel Cell and Hydrogen...

  11. Office of Physical Protection

    Broader source: [DOE]

    The Office of Physical Protection is comprised of a team of security specialists engaged in providing Headquarters-wide physical protection.

  12. Vehicle Technologies Office: Technologies

    Broader source: [DOE]

    To support DOE's goal to provide clean and secure energy, the Vehicle Technologies Office (VTO) invests in research and development that:

  13. Office of Legacy Management

    Office of Legacy Management (LM)

    Energy Office of Legacy Management JUL 1 0 2008 Alonso Ramirez, Scientific Director EI Verde Research Station Institute for Tropical Ecosystem Studies University of Puerto Rico...

  14. Office Buildings - Energy Consumption

    U.S. Energy Information Administration (EIA) Indexed Site

    Energy Consumption Office buildings consumed more than 17 percent of the total energy used by the commercial buildings sector (Table 4). At least half of total energy, electricity,...

  15. Sustainability Performance Office News

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    management-spo1461771 Sustainability Performance Office News en Executive Order 13693 Training Now Available On Demand http:energy.govmanagementspoarticles...

  16. David Henderson U.S. Department of Energy Office of Nuclear Energy

    Energy Savers [EERE]

    David Henderson U.S. Department of Energy Office of Nuclear Energy Mail Stop NE-52 19901 Germantown Rd. Germantown, MD 20874-1290 Re: UPA Response to DOE RFI; Excess Uranium Management: Effects of DOE Transfers of Excess Uranium on Domestic Uranium Mining, Conversion, and Enrichment Industries Dear Mr. Henderson: Uranerz Energy Corporation (Uranerz) appreciates the opportunity to provide input regarding the Department's management of the federal excess uranium inventory. Uranerz is a publicly

  17. David Henderson U.S. Department of Energy Office of Nuclear Energy

    Energy Savers [EERE]

    January 21, 2015 David Henderson U.S. Department of Energy Office of Nuclear Energy Mail Stop NE-52 19901 Germantown Rd. Germantown, MD 20874-1290 Re: UPA Response to DOE RFI; Excess Uranium Management: Effects of DOE Transfers of Excess Uranium on Domestic Uranium Mining, Conversion, and Enrichment Industries Dear Mr. Henderson: On behalf of the Uranium Producers of America (UPA) and our member companies, we appreciate the opportunity to provide input regarding the Department's management of

  18. David Henderson U.S. Department of Energy Office of Nuclear Energy

    Energy Savers [EERE]

    6, 2015 David Henderson U.S. Department of Energy Office of Nuclear Energy Mail Stop NE-52 19901 Germantown Rd. Germantown, MD 20874-1290 Re: Excess Uranium Management: Effects of DOE Transfers of Excess Uranium on Domestic Uranium Mining, Conversion, and Enrichment Industries; Notice of Issues for Public Comment, Federal Register 80 14107 Dear Mr. Henderson: Uranerz Energy Corporation (Uranerz) appreciates the opportunity to provide comments on Federal Register notice FR 80 14107. Uranerz is a

  19. David Henderson U.S. Department of Energy Office of Nuclear Energy

    Energy Savers [EERE]

    April 6, 2015 David Henderson U.S. Department of Energy Office of Nuclear Energy Mail Stop NE-52 19901 Germantown Rd. Germantown, MD 20874-1290 Re: Excess Uranium Management: Effects of DOE Transfers of Excess Uranium on Domestic Uranium Mining, Conversion, and Enrichment Industries; Notice of Issues for Public Comment, Federal Register 80 14107 Dear Mr. Henderson: Uranerz Energy Corporation (Uranerz) appreciates the opportunity to provide comments on Federal Register notice FR 80 14107.

  20. Mr. Christopher Lawrence and Ms. Julie Smith Office of Electricity Delivery and Energy Reliability

    Energy Savers [EERE]

    Mr. Christopher Lawrence and Ms. Julie Smith Office of Electricity Delivery and Energy Reliability Mail Code: OE-20 U.S. Department of Energy 1000 Independence Avenue, SW Washington, D.C. 20585 Dear Mr. Lawrence and Ms. Smith, The Western Governors' Association (WGA) is submitting these comments in response to the Department of Energy's (DOE) Request for Information (RFI), dated August 29, 2013 1 . The RFI outlines a proposed process to establish a coordinated series of meetings and other

  1. Ms. Julie A. Smith Mr. Christopher Lawrence Office of Electricity Delivery and Energy Reliability

    Energy Savers [EERE]

    October 30, 2013 Ms. Julie A. Smith Mr. Christopher Lawrence Office of Electricity Delivery and Energy Reliability Mail Code: OE-20 U.S. Department of Energy 1000 Independence Avenue, SW Washington, DC 20585 Dear Ms. Smith and Mr. Lawrence: The Association of Fish and Wildlife Agencies (AFWA) would like to provide comments on the Federal Register Notice Request for Information (RFI) on Improving Performance of Federal Permitting and Review of Infrastructure Projects, Federal Register Document

  2. Office of Acquisition and Financial Assessment PIA, Golden Field Office |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Acquisition and Financial Assessment PIA, Golden Field Office Office of Acquisition and Financial Assessment PIA, Golden Field Office Office of Acquisition and Financial Assessment PIA, Golden Field Office PDF icon Office of Acquisition and Financial Assessment PIA, Golden Field Office More Documents & Publications Integrated Safety Management Workshop Registration, PIA, Idaho National Laboratory Occupational Medicine - Assistant PIA, Idaho National Laboratory E-IDR

  3. Office of Sustainability Support

    Office of Energy Efficiency and Renewable Energy (EERE)

    The Office of Sustainability Support serves as AUs organizational lead in partnering with the Departments Sustainability Performance Office to support the understanding and implementation of sustainability programs and requirements within the Department, including through supporting development and implementation of DOEs annual Strategic Sustainability Program Plan.

  4. Office of Science

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Safeguards, Security & Emergency Preparedness Office of Safeguards, Security & Emergency Preparedness Office of Safeguards, Security & Emergency Preparedness Mission Develop and oversee the implementation of policy and guidance with respect to security and emergency management. Foster continuous improvement across the Environmental Management (EM) complex through application of Integrated Safeguards and Security Management principles. Serve as a liaison with sites and

  5. Office of Business Operations

    Broader source: [DOE]

    The Office of Business Operations manages financial and acquisition management programs throughout the Associate Under Secretary for the Office of Environment, Health, Safety and Security (AU), including the formulation and execution of the AU budget; funding control and accounting activities; preparation of management studies; and provision of acquisition management support.

  6. Address conversion unit for multiprocessor system

    SciTech Connect (OSTI)

    Fava, T.F.; Lary, R.F.; Blackledge, R.


    An address conversion unit is described for use in one processor in a multi-processor data processing system including a common memory, the processors and common memory being interconnected by a common bus including means for transferring address signals defining a common address space. The processor includes private bus means including means for transferring signals including address signals defining a private address space. A processor unit means is connected to the private bus means and includes means for transmitting and receiving signals including address signals over the private bus means for engaging in data transfers thereover. The address conversion unit is connected to the private bus means and common bus means for receiving address signals over the private bus means from the processor unit means in the private address space. The unit comprises: A. pointer storage means for storing a pointer identifying a portion of the common bus memory space; B. pointer generation means connected to receive a common bus address and for generating a pointer in response thereto for storage in the pointer storage means; and C. common bus address generation means connected to the private bus and the pointer storage means for receiving an address from the processor unit means and for generating a common bus address in response thereto. The common bus address is used to initiate transfers between the processor unit means and the common memory over the common bus.

  7. About INCITE | U.S. DOE Office of Science (SC)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    About EIA Senior Executive Biographies Adam Sieminski, Administrator Adam Sieminski Print friendly PDF Administrator E-mail: Phone: (202) 586-4361 Fax: (202) 586-0329 Room: 2H-027 Address: U.S. Energy Information Administration 1000 Independence Avenue, S.W. Washington, DC 20585 Biography Adam Sieminski was sworn in on June 4, 2012, as the eighth administrator of the U.S. Energy Information Administration (EIA). From March 2012 to May 2012, while awaiting confirmation as


    Energy Savers [EERE]

    OFFICE: NEPA REVIEWS: No NEPA reviews are ongoing or planned. SITE-WIDE: Preparation of a site-wide EIS was not considered at this time. The ongoing and planned NEPA reviews are listed in Part 2 below. A site-wide EIS WOULD facilitate future NEPA compliance efforts. A site-wide EIS WOULD NOT facilitate future NEPA compliance efforts. Part 3 DATE: PAGE: of 2016 Annual NEPA Planning Summary NEPA COMPLIANCE OFFICER: Secretarial Officers and Heads of Field Organizations submit annual NEPA planning

  9. Office of the Chief Financial Officer Annual Report 2009

    SciTech Connect (OSTI)

    Fernandez, Jeffrey


    Presented is the 2009 Chief Financial Officer's Annual Report. The data included in this report has been compiled from the Budget Office, the Controller, Procurement and Property Management and the Sponsored Projects Office.

  10. DOE NEPA Compliance Officers

    Energy Savers [EERE]

    Environmental Management (EM) Environmental Management 202-586-7668 FORS EM-11 20585 EM Julie Smith Carlsbad Field Office 575-234-7349 575-234-7061 DOE...

  11. Office of Information Security

    Broader source: [DOE]

    The Office of Information Security is responsible for implementation of the Classified Matter Protection and Control Program (CMPC), the Operations Security Program (OPSEC) and the Facility Clearance Program and the Survey Program for Headquarters

  12. Office of Analysis

    Broader source: [DOE]

    The Office of Analysis provides analysis of Department of Energy (DOE)-wide performance in protecting the public, the workers and the environment while performing the missions of DOE.

  13. Supervisory Program Analysis Officer

    Broader source: [DOE]

    A successful candidate in this position will be responsible for the program analysis and evaluation of all activities which fall within the purview of the Office. The incumbent directs a moderate...

  14. Director, Vehicle Technologies Office

    Broader source: [DOE]

    The Office of Energy Efficiency and Renewable Energy within the U.S. Department of Energy is looking for a dynamic, innovative, and experienced executive to lead the efforts of the Vehicle...

  15. Richland Operations Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Director, Office of Hearings and Appeals (HG-i), U.S. Department of Energy, L'Enfant Plaza Building, 1000 Independence Avenue SW, Washington, D.C. 20585-1615, and shall be filed...

  16. DOE NEPA Compliance Officers

    Broader source: (indexed) [DOE]

    DOESavannah River Operations Office EQMD P.O. Box A Aiken, SC 29802 SR Steve Danker West Valley Demonstration Project 716-942-4007 716-942-4703 DOE...

  17. Portsmouth Paducah Project Office

    Broader source: [DOE]

    The U.S. Department of Energy (DOE) established the Portsmouth/Paducah Project Office (PPPO) on October 1, 2003, to provide focused leadership to the Environmental Management missions at the...

  18. Office of Fossil Energy

    Office of Environmental Management (EM)

    & Natural Gas Office of Regulation and International Engagement Division of Natural Gas Regulation Phone: 202-586-7970 Email: 2015 Jan Feb March April May June...

  19. Deputy Chief Operating Officer

    Broader source: [DOE]

    This position will be filled at either Morgantown, WV or Pittsburgh, PA. A successful candidate in this position will serve as the Deputy Chief Operating Officer assigned to the Laboratory...

  20. Richland Operations Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    unique in that it was issued by RL in 1996, and has been maintained and interpreted by a Focus Group with invited membership by technical experts from the Office of River...

  1. Office of Management

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    Designates the Director, Office of Management as the DOE official responsible to perform the duties set forth in 22 CFR , sections 62.11 and 41.63 pertaining to the DOE Exchange Visitor Program,

  2. User Liaison Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Office Space User space is available in the ARC, reserve space here. arc-thumb.jpg Click to see Virtual Tour 12000 Jefferson Avenue, Newport News, VA 23606 Phone: (757) 269-7255...

  3. Office of Nuclear Safety

    Broader source: [DOE]

    The Office of Nuclear Safety establishes nuclear safety requirements and expectations for the Department to ensure protection of workers and the public from the hazards associated with nuclear operations with all Department operations.

  4. Office of Security Policy

    Broader source: [DOE]

    The Office of Security Policy is the central source within the Department of Energy for the development and analysis of safeguards and security policies and standards affecting facilities, nuclear materials, personnel, and classified information.

  5. Extremely High-Frequency Holographic Radar Imaging of Personnel and Mail

    SciTech Connect (OSTI)

    McMakin, Douglas L.; Sheen, David M.; Griffin, Jeffrey W.; Lechelt, Wayne M.


    The awareness of terrorists covertly transporting chemical warfare (CW) and biological warfare (BW) agents into government, military, and civilian facilities to harm the occupants has increased dramatically since the attacks of 9/11. Government and civilian security personnel have a need for innovative surveillance technology that can rapidly detect these lethal agents, even when they are hidden away in sealed containers and concealed either under clothing or in hand-carried items such as mailed packages or handbags. Sensor technology that detects BW and CW agents in mail or sealed containers carried under the clothing are under development. One promising sensor technology presently under development to defeat these threats is active millimeter-wave holographic radar imaging, which can readily image concealed items behind paper, cardboard, and clothing. Feasibility imaging studies at frequencies greater than 40 GHz have been conducted to determine whether simulated biological or chemical agents concealed in mail packages or under clothing could be detected using this extremely high-frequency imaging technique. The results of this imaging study will be presented in this paper.

  6. Vision Office Products

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1.1 The History of the University of Wisconsin Atmospheric Emitted Radiance Interferometer (AERI) Prototype During the Period April 1994 Through July 1995 June 1999 (Manuscript received November 1995, in final form December 1995) R. Knuteson B. Whitney H. Revercomb F. Best Prepared by the Space Science and Engineering Center, University of Wisconsin - Madison Work supported by the U.S. Department of Energy, Office of Energy Research, Office of Health and Environmental Research Knuteson et al.,

  7. Vision Office Products

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2 Shortwave (SW) Radiometer Inconsistencies at the Atmospheric Radiation Measurement (ARM) Southern Great Plains (SGP) Central Facility (CF) November 2000 C. N. Long Work supported by the U.S. Department of Energy, Office of Energy Research, Office of Health and Environmental Research Long, November 2000, ARM TR-002 iii Abstract There appears to be a problem with the Southern Great Plains (SGP) Central Facility (CF) Baseline Surface Radiation Network (BSRN) shortwave (SW) measurements. An

  8. Office of Science

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Office of Science /science-innovation/_assets/images/icon-science.jpg Office of Science Enabling remarkable discoveries and tools that transform our understanding of energy and matter and advance national, economic, and energy security. Advanced Scientific Computing Research» Basic Energy Sciences» Biological and Environmental Research» Fusion Energy Sciences» High Energy Physics» Nuclear Physics» Fusion Energy Science Research LANL fusion materials researchers use Titan supercomputer to

  9. Richland Operations Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    /: -. !~t. Department of Energy Richland Operations Office P.O. Box 550 Richland, Washington 99352 Nav 0 4 ?nn~ 05-AMCP-OO46 Mr. Todd Martin, Chair Hanford Advisory Board 1933 Jadwin, Suite 135 Richland, Washington 99352 Dear Mr. Martin: HANFORD ADVISORY BOARD (HAB) ADVICE #166 -FUND U PLANT AREA REMEDIATION ACTIVITIES In response to your letter dated September 10, 2004, the U.S. Department of Energy, Richland Operations Office (RL), appreciates your recommendations contained in HAB Consensus


    Energy Savers [EERE]

    6 Annual NEPA Planning Summary NEPA COMPLIANCE OFFICER: Secretarial Officers and Heads of Field Organizations submit annual NEPA planning summaries that briefly describe the status of ongoing NEPA compliance activities including Environmental Assessments expected to be prepared in the next 12 months, Environmental Impact Statements expected to be prepared in the next 24 months, the planned cost and schedule for each NEPA review, and every 3 years each Field Organization must include an

  11. Appointment of Contracting Officers and Contracting Officer Representatives

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    The Order established procedures governing the selection, appointment and termination of Department of Energy contracting officers and contracting officer representatives. Supersedes DOE O 541.1A.

  12. Richland Operations Office - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Richland Operations Office Richland Operations Office Richland Operations Office River Corridor Central Plateau Groundwater Mission Support Newsroom Richland Operations Office Email Email Page | Print Print Page |Text Increase Font Size Decrease Font Size Registration for 2016 Hanford Cleanup Tours Hanford Public Comment Period Hanford Public Comment Period UNITED STATES DEPARTMENT OF ENERGY Richland Operations Office RL2016LogoVert StacyCharboneau Welcome to the Richland Operations Office (RL),

  13. New Mexico Consortium (NMC) Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Signatures Applied Geophysical Experiences Materials Design Calendar NSEC New Mexico Consortium (NMC) Office New Mexico Consortium (NMC) Office Explore the multiple...

  14. Field Offices | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Field Offices Field Offices Albuquerque U.S. Department of Energy Office of Inspector General P.O. Box 5400 Albuquerque, NM 87185-5400 Audit Services: (505) 845-5558 Inspections: (505) 845-5153 Office of Investigations U.S. Department of Energy Office of Inspector General P.O. Box 5657 Albuquerque, NM 87185 (505) 845-4009 Chicago Office of Audit Services U.S. Department of Energy Office of Inspector General 9800 South Cass Avenue Building 308 Argonne, IL 60439 (630) 252-2345 DOE: Office of

  15. DOE Fuel Cell Technology Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Fuel Cell Technology Office - Sandia Energy Energy Search Icon Sandia Home Locations ... SunShot Grand Challenge: Regional Test Centers DOE Fuel Cell Technology Office Home...

  16. Deputy Manager, Carlsbad Field Office

    Broader source: [DOE]

    The Carlsbad Field Office (CBFO) is the lead Department of Energy office responsible for managing, planning, integrating, and implementing the National Transuranic (TRU) Program (NTP) activities...

  17. Office Protocols | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    December 2015 Office of Environment, Safety and Health Assessments Protocol for Oversight Activities, December 2015 April 24, 2015 Office of Environment, Safety and Health...

  18. DOE Fuel Cell Technologies Office

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DOE Fuel Cell Technologies Office Fuel Cell Seminar & Energy Exposition Columbus, Ohio Dr. Sunita Satyapal Director Fuel Cell Technologies Office Energy Efficiency and Renewable ...

  19. Research Projects Addressing Technical Challenges to Environmentally

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Acceptable Shale Gas Development Selected by DOE | Department of Energy Addressing Technical Challenges to Environmentally Acceptable Shale Gas Development Selected by DOE Research Projects Addressing Technical Challenges to Environmentally Acceptable Shale Gas Development Selected by DOE November 28, 2012 - 12:00pm Addthis Washington, DC - Fifteen research projects aimed at addressing the technical challenges of producing natural gas from shales and tight sands, while simultaneously

  20. Recommendations to Address Power Reliability Concerns Raised...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Reliability Concerns Raised as a Result of Pending Environmental Regulations for Electric Generation Stations Recommendations to Address Power Reliability Concerns Raised as a ...

  1. Energy Department Assistant Secretary Patricia Hoffman Addresses...

    Broader source: (indexed) [DOE]

    for Electricity Delivery and Energy Reliability Patricia Hoffman today addressed the ... In addition, whatever local reliability challenges that could arise should be manageable ...

  2. Addressing Challenges of Identifying Geometrically Diverse Sets...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Addressing Challenges of Identifying Geometrically Diverse Sets of Crystalline Porous Materials Previous Next List R. L. Martin, B. Smit, and M. Haranczyk, J. Chem Inf. Model. 52...

  3. Categorical Exclusion Determinations: Carlsbad Field Office ...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Carlsbad Field Office Categorical Exclusion Determinations: Carlsbad Field Office Categorical Exclusion Determinations issued by Carlsbad Field Office. DOCUMENTS AVAILABLE FOR ...

  4. Kansas City Field Office | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Kansas City Field Office

  5. Office of Emergency Operations | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Office of Emergency Operations

  6. Savannah River Field Office | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Savannah River Field Office

  7. Categorical Exclusion Determinations: Sandia Site Office | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    09122011 Location(s): Albuquerque, New Mexico Office(s): NNSA-Headquarters, Golden ... 09122011 Location(s): Albuquerque, New Mexico Office(s): NNSA-Headquarters, Golden ...

  8. Office of River Protection - Hanford Site

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Office of River Protection Office of River Protection Office of River Protection Office of River Protection Email Email Page | Print Print Page |Text Increase Font Size Decrease...

  9. U.S. Office of Personnel Management, ...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    - President Obama, Executive Order 13583 U.S. Office of Personnel Management Office of .........8 U.S. Office of Personnel Management Office of ...

  10. Field Offices | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Field Offices Field Offices Learn More Sandia National Laboratory Welcome to the Kansas City Field Office Welcome to the Livermore Field Office Welcome to the Los Alamos...

  11. Economic Development Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Economic Development Office Is your technology business looking for a door to the Laboratory? The Economic Development Office at PNNL is here to help you start, grow, or relocate your business. We help you tap into technology experts, facilities, and other resources available at the Laboratory...some at no cost to you. We've helped more than 400 companies in our region and 100 more nationwide. Our goals: to expand the economy's technology sector and create high-value jobs. Economic Development

  12. Nevada Operations Office

    Office of Legacy Management (LM)

    Nevada Operations Office t' . 0. Box 14100, Las Vegas, NV 89114-4100 Lt. Col. Kent J. Rohlof; USAF Commander 554th Civil Engineering Support Squadron (TAC) Nellis Air Force Base, NV 89191 DISPOSAL OF LIQUID RADIOACTIVE WASTE--NELLIS AIR FORCE BASE Layton O'Neill and Thomas Graham of my office recently visited two sites at Nellis AFB, Area II, identified as locations for burial of radioactive waste. The purpose of this visit was to visually inspect the physical status of the sites, one identified

  13. Richland Operations Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ITEM 1 Department of Energy Richland Operations Office P.O. Box 550 Richland, Washington 99352 15-PRO-0175 APR 3 0 205 Mr. J. A. Ciucci, President and Chief Executive Officer CH2M HILL Plateau Remediation Company Richland, Washington 99352 Dear Mr. Ciucci: CONTRACT NO. DE-ACO6-08RL 14788 - FISCAL YEAR (FY) 2014 FINAL FEE DETERMINATION FOR PLATEAU REMEDIATION CONTRACT The purpose of this letter is to provide the final fee determination for the FY 2014 evaluation period. Pursuant to the

  14. Richland Operations Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Department of Energy Richland Operations Office P.O. Box 550 &?ATES0~Richland, Washington 99352 10O-AMSE-0054 A PR I~ ~~ Mr. J. G. Lehew III, President and Chief Executive Officer CH2M HILL Plateau Remediation Company Richland, Washington 99352 Dear Mr. Lehew: CONTRACT NO. DE-AC06-08RL14788 - DE MINIMIS CHANGES TO THE HANFORD ANALYTICAL SERVICES QUALITY ASSURANCE REQUIREMENTS DOCUMENT (HASQARD) Compliance with the HASQARD, DOE/RL-96-68, is required by your Contract (Attachment J.2, List B:

  15. The Office of Independent Enterprise Assessments' Office of Enforcement

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    convened the 2014 DOE Safety and Security Enforcement Workshop May 13 and 14, 2014 | Department of Energy The Office of Independent Enterprise Assessments' Office of Enforcement convened the 2014 DOE Safety and Security Enforcement Workshop May 13 and 14, 2014 The Office of Independent Enterprise Assessments' Office of Enforcement convened the 2014 DOE Safety and Security Enforcement Workshop May 13 and 14, 2014 June 4, 2014 - 1:53pm Addthis Steve Simonson, Director of the Office of

  16. Office of the Chief Human Capital Officer | Department of Energy

    Broader source: All U.S. Department of Energy (DOE) Office Webpages

    Human Capital Officer Search Search form Search Office of the Chief Human Capital Officer Office of the Chief Human Capital Officer Services Services Home Benefits Benefits Home DOE Workers' Compensation Program Insurance Military/Reservist Retirement Telework Thrift Savings Plan (TSP) Wellness Programs Executive Resources Learning and Workforce Development New Employee Orientation Policy and Guidance Policy and Guidance Home Compensation Employment/Staffing Employment/Staffing Home Recruitment

  17. Corel Office Document

    Office of Environmental Management (EM)

    ADDRESSES: The final DOE report and guidelines in this notice are available on the web ... public docket at a DOE web site giving the current status of all requests for correction. ...

  18. Corel Office Document

    Gasoline and Diesel Fuel Update (EIA)

    (toll free) at 1-888-433-8348. For general information about the survey, visit our Web site at http:www.eia.doe.govemeucbecs. 6. Please use the enclosed self-addressed, ...

  19. Office of Nuclear Energy

    Broader source: [DOE]

    The Department of Energy Office of Nuclear Energy advances nuclear power as a resource capable of meeting the Nation's energy, environmental, and national security needs by resolving technical, cost, safety, proliferation resistance, and security barriers through research, development, and demonstration as appropriate.

  20. Office of Strategic Programs

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Strategic Programs STEAB Meeting JoAnn Milliken Washington, DC Acting Director June 27, 2012 Strategic Programs * Advanced Manufacturing * Sustainability Performance * Strategic Programs OFFICE OF ENERGY EFFICIENCY AND RENEWABLE ENERGY ENERGY EFFICIENCY * Advanced Manufacturing * Building Technologies * Federal Energy Management * Weatherization & Intergovernmental RENEWABLE ENERGY * Geothermal Technologies * Solar Energy Technologies * Wind & Water Technologies TRANSPORTATION *


    Office of Legacy Management (LM)

    OFFICE FOR EMERGENCY MANAGEMENT 155OP STREETNW. WiSHINGTON. D.C. ' , iQns 25,19&L At-t :. I' .' at l530 P Btmat, IO&, XtwMn&m, 0. 6., at 9130 A.Jb Sa 1 llmbemupoftbaaomlttaal8f...

  2. Office of Security Assistance

    Broader source: [DOE]

    The Office of Security Assistance manages the Technology Deployment Program to improve the security posture of the Department of Energy and the protection of its assets and facilities through the deployment of new safeguards and security technologies and development of advanced technologies that reduce operating costs, save protective force lives, and improve security effectiveness.

  3. Office of Document Reviews

    Broader source: [DOE]

    The Office of Document Reviews ensures that all documents prepared at DOE Headquarters are properly marked to identify the level and category of protected information they contain (if any) and to ensure that all documents the Department prepares or is required to review under applicable statutes for public release contain no information requiring protection under law, regulations and Executive orders.

  4. Chief Financial Officer Responsibilities

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    The Order sets forth requirements for operating the Department of Energy in full compliance with the Chief Financial Officers Act of 1990 and sets standards for sound financial management policies and practices, effective internal controls, accurate and timely financial information, and well-qualified financial managers. Supersedes DOE O 520.1.

  5. Office of Technical Guidance

    Broader source: [DOE]

    The Office of Technical Guidance develops, promulgates, and interprets national level policies, procedures, and guidance to identify (1) information that must be classified or controlled under statute or Executive order to protect the national security, to ensure the effective operation of the Government, or to protect the privacy interests of individuals and (2) classified or controlled information that may be declassified or decontrolled.

  6. Office of Quality Management

    Broader source: [DOE]

    The Office of Quality Management develops and interprets Government-wide policies and procedures and conducts training to ensure the accurate identification of information and documents that must be classified or controlled under statute or Executive order to protect the national security and controlled unclassified Official Use Only information for the effective operation of the Government.

  7. Vehicle Technologies Office

    Broader source: [DOE]

    The Vehicle Technologies Office is developing more energy efficient and environmentally friendly highway transportation technologies that will enable America to use less petroleum. The long-term aim is to develop "leap frog" technologies that will provide Americans with greater freedom of mobility and energy security, while lowering costs and reducing impacts on the environment.

  8. Office of Economic Impact and Diversity | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Office of Economic Impact and Diversity Minorities in Energy Initiative: Our Ambassadors Minorities in Energy Initiative: Our Ambassadors The Minorities in Energy Initiative, guided by the U.S. Department of Energy's Office of Economic Impact and Diversity, seeks to create a substantive, sustainable model that connects diverse stakeholders together to address challenges and opportunities for minority engagement in energy economic participation, STEM education, and climate change. Read more

  9. Vehicle Technologies Office: 2014 Advanced Combustion Engine Annual

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Progress Report | Department of Energy Advanced Combustion Engine Annual Progress Report Vehicle Technologies Office: 2014 Advanced Combustion Engine Annual Progress Report The Advanced Combustion Engine research and development (R&D) subprogram within the DOE Vehicle Technologies Office (VTO) provides support and guidance for many cutting-edge automotive technologies under development. Research focuses on addressing critical barriers to commercializing higher efficiency, very low

  10. Vehicle Technologies Office: 2014 Vehicle and Systems Simulation and

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Testing Annual Progress Report | Department of Energy Vehicle and Systems Simulation and Testing Annual Progress Report Vehicle Technologies Office: 2014 Vehicle and Systems Simulation and Testing Annual Progress Report The Vehicle and Systems Simulation and Testing research and development (R&D) subprogram within the DOE Vehicle Technologies Office (VTO) provides support and guidance for many cutting-edge automotive technologies under development. Research focuses on addressing critical

  11. Vehicle Technologies Office: 2015 Vehicle Systems Annual Progress Report |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Vehicle Systems Annual Progress Report Vehicle Technologies Office: 2015 Vehicle Systems Annual Progress Report The Vehicle Systems research and development (R&D) subprogram within the DOE Vehicle Technologies Office (VTO) provides support and guidance for many cutting-edge automotive technologies under development. Research focuses on addressing critical barriers to advancing light-, medium-, and heavy-duty vehicle systems to help maximize the number of electric

  12. Bioenergy Technologies Office FY 2016 Budget At-A-Glance

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    BIOENERGY TECHNOLOGIES OFFICE FY 2016 BUDGET AT-A-GLANCE The Bioenergy Technologies Office (BETO) supports targeted research, development, demonstration, and deployment (RDD&D) activities to advance the sustainable, nationwide production of advanced biofuels that will displace a share of petroleum-derived fuels, mitigate climate change, create jobs, and increase United States energy security. What We Do  Research and Development focused on addressing technical barriers, providing

  13. Monthly Energy Review - March 2001

    Annual Energy Outlook [U.S. Energy Information Administration (EIA)]

    and additional mailing offices. POSTMASTER: Send address changes to Monthly Energy Review, Energy Information Administration, EI-30, 1000 Independence Avenue, SW,...

  14. Microsoft Word - 1897.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Identification Device User print name Government AgencySponsored Company Visitor's Z Number or ID Number Email Address Phone Number Fax Number Mail Stop and Office Location...

  15. Office of Executive Resources Office of the Chief Human Capital Officer

    Energy Savers [EERE]

    Office of Executive Resources Office of the Chief Human Capital Officer U.S. Department of Energy Senior Executive Service (SES) Performance Management System Policy and Operating Procedures Executive Summary The U.S. Office of Personnel Management (OPM), in coordination with the Office of Management and Budget (OMB) issued a government-wide Senior Executive Service (SES) performance management system in 2012. The Department of Energy (DOE) adopted this government-wide SES performance management

  16. 2015 State of Indian Nations Address

    Broader source: [DOE]

    The President of the National Congress of American Indians will deliver his annual State of the Indian Nations address to Member of Congress, government officials, tribal leaders and citizens, and...

  17. Federal Actions to Address Impacts of Uranium

    Office of Legacy Management (LM)

    Federal Actions to Address Impacts of Uranium Contamination in the Navajo Nation 2014 Page | i TABLE OF CONTENTS Executive Summary ....................................................................................................................... 1 Introduction .................................................................................................................................... 2 Summary of Work Completed 2008-2012

  18. In-Office Services:

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Office Services: Meet with an experienced attorney who can advise and represent you. Attorney Services include: * Reviewing and preparing documents * Making follow-up calls and writing letters * Providing legal advice and consultation * Representation in court Comprehensive Coverage protects you from costly legal fees. Most covered legal matters are 100% paid-in-full when you work with a Network Attorney. (See reverse side of flyer for details.) Reduced Fee Benefits are available for matters not

  19. SSRL Safety Office Memo

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Safety Office SSO 01/24/06 Memo to SSRL staff concerning operation of Circuit Breakers and Disconnect Switches Recently SLAC has adopted new regulations (NFPA70E) which outline the "Standard for Electrical Safety in the Workplace". Specifically it requires that the Arc Flash Hazard be categorized and PPE stated for all circuit breakers and disconnect switches. This memo identifies requirement for operating circuit breakers or disconnect switches at SSRL. SSRL staff members shall be

  20. The Geothermal Technologies Office

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Geothermal Technologies Office (GTO) funded and launched the NGDS and the DOE Geothermal Data Repository node to facilitate a seamless delivery of geotherm- al data for a variety of applications. NGDS is an interoperable networked system of distributed data repositories, accessed through federated catalog nodes and built upon an open architecture using open source software practices. The system provides access to geo- thermal data from providers across the U.S., including all 50 state geological


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Office of Information Resources - FOIAXpress Department of Energy Privacy Impact Assessment (PIA) Guidance is provided in the template. See DOE Order 206.1, Department of Energy Privacy Program, Appendix A, Privacy Impact Assessments, for requirements and additional guidance for conducting a PIA: Please complete electronically: no hand-written submissions will be accepted. This template may not be modified. MODULE 1- PRIVACY


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Office of Workforce Development for Teachers and Scientists Department of Energy Privacy Impact Assessment (PIA) Guidance is provided in the template. See DOE Order 206.1, Department of Energy Privacy Program, Appendix A, Privacy Impact Assessments, for requirements and additional guidance for conducting a PIA: Please complete electronically: no hand-written submissions will be accepted. This template may not be modified. MODULE

  3. Office of Personnel Management

    Energy Savers [EERE]

    Personnel Management October 2014 Questions & Answers 1 Pathways Programs 5 CFR Parts 213, 302, 315, and 362 Questions and Answers Background Executive Order 13562 Recruiting and Hiring Students and Recent Graduates dated December 27, 2010, authorized two new excepted service hiring authorities and consolidated them with a revised Presidential Management Fellows Program to establish the Pathways Programs for students and recent graduates. The U.S. Office of Personnel Management (OPM)

  4. Sandia Corporate Ombuds Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    COMMUNITY MEMBERS Sandia's Corporate Ombuds Office can serve as a point of contact for those in the community, the state or the nation who have some connection to Sandia or Sandians and are seeking guidance on how to deal with an issue or concern. The Ombuds can supply formal contact information or provide a way for important information to get to those who need to know. They are also an informal, neutral and confidential resource available for constructive resolution of issues and conflicts.

  5. Office of Environmental Management

    Office of Environmental Management (EM)

    Control and Biological Safety at the Los Alamos National Laboratory - December 2015 | Department of Energy Enterprise Assessments Targeted Review of Work Planning and Control and Biological Safety at the Los Alamos National Laboratory - December 2015 Office of Enterprise Assessments Targeted Review of Work Planning and Control and Biological Safety at the Los Alamos National Laboratory - December 2015 December 2015 Review of Work Planning and Control and Biological Safety at the Los Alamos

  6. Education Office Housing

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Education Office Housing Housing A housing forum and listings for housing in and around Los Alamos. Contact Postdoc Housing Email LANL Students' Association Email LANL postdoc program housing The LANL Postdoc Program has a Postdoc Housing listing. If you are interested in posting a housing opportunity, send an email with the pertinent information to Housing listings will be posted for 1 month. If you wish for the listing to remain on the web site longer, please contact

  7. Vehicle Technologies Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Technologies Office - Sandia Energy Energy Search Icon Sandia Home Locations Contact Us Employee Locator Energy & Climate Secure & Sustainable Energy Future Stationary Power Energy Conversion Efficiency Solar Energy Wind Energy Water Power Supercritical CO2 Geothermal Natural Gas Safety, Security & Resilience of the Energy Infrastructure Energy Storage Nuclear Power & Engineering Grid Modernization Battery Testing Nuclear Fuel Cycle Defense Waste Management Programs Advanced

  8. Vision Office Products

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    1 North Slope of Alaska and Adjacent Arctic Ocean Cloud and Radiation Testbed: Science, Siting and Implementation Strategies B. D. Zak Sandia National Laboratories H. W. Church Sandia National Laboratories Consultant K. Stamnes University of Alaska Fairbanks K. Widener Pacific Northwest National Laboratories February 2002 Work supported by the U.S. Department of Energy, Office of xxxxxxxxxxxxxxxxxxxxxxxxxxx Forward This is the most recent version of a document that has gone through many

  9. Field Office, Osk Ridge

    Office of Legacy Management (LM)

    ,_ . -... .,- .._ -,,. ..- _~ ,.- .- ,~._ _- "- .- Depanment of Energy Field Office, Osk Ridge P.O. Box 2001 Oak Ridge, Tennessee 37831- 8723 April 20, 1993 Ms. Rita Aldrich Principle Radiophysicist Oivisfon of Safety and Health New York State Department of Labor 1 Rain Street Brooklyn, New York 11201 Dear Iis. Aldrich: BAKER AND WILLIAM WAREHOUSES SITE - COMPLETION OF CLEANUP ACTIVITIES The purpose of this notice is to inform you about further scheduled cleanup activities to be conducted

  10. Oak Ridge Office

    Office of Environmental Management (EM)

    Martin , Chair Oak Ridge Site Specific Advisory Board Post Office Box 200 I Oak Ridge, Tennessee 37831 Dear Mr. Martin : May 22, 2013 RESPONSE TO YOUR LETTER DATED MAY 9, 2013, RECOMMENDATION 216: RECOMMENDATIONS ON FISCAL YEAR 2015 DOE OAK RIDGE ENVIRONMENT AL MANAGEMENT BUDGET REQUEST Reference: Letter from David Martin to Mark Whitney, Recommendation 216: Recommendation on Fiscal Year 2015 DOE Oak Ridge Environmental Management Budget Request, dated May 9, 2013. I would like to express my

  11. Oak Ridge Office

    Office of Environmental Management (EM)

    - Mr. Steve Dixon, Chairman Oak Ridge Site Specific Advisory Board Post Office Box 200 1 Oak Ridge, Tennessee 3 783 0 Dear Mr. Dixon: RESPONSE TO RECOMMENDATION ON PROVIDING INFORMATION IN TBE DEPARTMENT OF ENERGY QUARTERLY PROJECT REVIEWS I In response to the June 11,2009 above recommendation, the Environmental Management (EM) program will begin providing quarterly reports to the Site Specific Advisory Board (SSAB) that provide project specific information on programmatic issues and

  12. Oak Ridge Office

    Office of Environmental Management (EM)

    PO. Box 2001 Oak Ridge, Tennessee 37831 July 21, 2010 Mr. Ron Murphree, Chair Oak Ridge Site Specific Advisory Board Post Office Box 200 1 Oak Ridge, Tennessee 3783 1 Dear Mr. Murphree: RESPONSE TO BOARD RECOMMENDATION 188 ON THE LONG-TERM STEWARDSHIP IMPLEMENTATION PLAN Reference: Letter from Ron Murphree to John Eschenberg, Recommendation 188: Recommendations and Comments on the Long-Term Stewardship Implementation Plan for the Department of Energy-Oak Ridge, dated April 15,201 0 We appreciate

  13. Oak Ridge Office

    Office of Environmental Management (EM)

    Ms. Maggie Owen, Chair Oak Ridge Site Specific Advisory Board Post Office Box 2001 Oak Ridge, Tennessee 37831 Dear Ms. Owen: May 18, 2012 RESPONSE TO YOUR LETTER DATED APRIL 12,2012, RECOMMENDATION 209: RECOMMENDATION ON FISCAL YEAR 2014 DOE OAK RIDGE ENVIRONMENTAL MANAGEMENT BUDGET REQUEST Reference: Letter from Maggie Owen to Susan Cange, Recommendation 209: Recommendation on Fiscal Year 2014 DOE Oak Ridge Environmental Management Budget Request, dated Aprill2, 2012. I would like to express my

  14. DOE - Office of Legacy Management -- Naval Office at the University...

    Office of Legacy Management (LM)

    Office at the University of New Mexico - NM 0-03 FUSRAP Considered Sites Site: NAVAL OFFICE AT THE UNIVERSITY OF NEW MEXICO (NM.0-03) Eliminated from further consideration under...

  15. Office of Heath, Safety and Security Now Two New Offices

    Broader source: [DOE]

    To serve you better, DOE has structured the former HSS into to new organizations: the Office Independent Enterprise Assessment (IEA); and Office of Environment, Health, Safety and Security (EHSS).

  16. Appointment of Contracting Officers and Contracting Officer Representatives

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    To establish procedures governing the selection, appointment, and termination of contracting officers and for the appointment of contracting officer representatives. Cancels DOE Order 4200.4A. Canceled by DOE O 541.1A.


    Energy Savers [EERE]

    URANIUM PRODUCERS OF AMERICA 141 EAST PALACE AVENUE, POST OFFICE Box 669, SANTA FE, NEW MEXICO 87504-0669 TELEPHONE(505) 982-4611; FAX (505) 988-2987; WWW.URANJUMPRODUCERSAMERJCA.COM David Henderson U.S. Department of Energy Office of Nuclear Energy Mail Stop NE-52 19901 Germantown Rd. Germantown, MD 20874-1290 April 6, 2015 Re: UP A Response to DOE Notice of Issues for Public Comment on "Excess Uranium Management: Effects of DOE Transfers of Excess Uranium on Domestic Uranium Mining,

  18. Office of the Chief Human Capital Officer | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Office of the Chief Human Capital Officer Office of the Chief Human Capital Officer Most Requested Benefits CHRIS (DOE Only) DOE & Headquarters Awards DOE Info (DOE Only) DOE Jobs Employee Viewpoint Survey Entry-Level/Student Jobs ESS Grade & Pay Retention HC Strategic Plan Military and Reservist Online Learning Center Policy Guidance Memorandum Retirement Recruitment Policies and Sources SEET Telework Voluntary Leave Transfer Worklife Center Working With Us The Energy Department's

  19. Appointment of Contracting Officers and Contracting Officer's Representatives

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]


    To establish procedures governing the selection, appointment, and termination of contracting officers and for the appointment of contracting officer's representatives. To ensure that only trained and qualified procurement and financial assistance professionals, within the scope of this Order, serve as contracting officers. Cancels DOE O 541.1. Canceled by DOE O 541.1B.

  20. Annual Report 2008 -- Office of the Chief Financial Officer (OCFO)

    SciTech Connect (OSTI)

    Fernandez, Jeffrey


    It is with great pleasure that I present to you the 2008 Chief Financial Officer's Annual Report. The data included in this report has been compiled from the Budget Office, the Controller, Procurement and Property Management and the Sponsored Projects Office. Also included are some financial comparisons with other DOE Laboratories and a glossary of commonly used acronyms.

  1. Facility Security Officer Contractor Toolcart

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Function Contact Email Telephone Badge Office 505-284-3626 - Escorting 505-845-1321 Classification 505-844-5574 - Classification Officer Ron McIntosh ...

  2. Jefferson Lab Chief Operating Officer

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    COO Privacy and Security Notice Skip over navigation Search the JLab Site Chief Operating Officer Please upgrade your browser. This site's design is only visible in a graphical browser that supports web standards, but its content is accessible to any browser. Concerns? Group Navigation COO Home Lab Contracts print version Mike Dallas Chief Operating Officer, x7538 Chief Operating Officer (COO) The Chief Operating Officer is responsible for the business functions of Jefferson

  3. Carlsbad Field Office - Fact Sheet

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the nation's nuclear waste disposal problem Carlsbad Field Office The U.S. Department of Energy (DOE) created the Carlsbad Area Office in late 1993 to lead the nation's transuranic waste disposal efforts. In September 2000 the office was elevated in status to become the Carlsbad Field Office (CBFO), taking on significant new responsibilities. These include protecting the environment along the U.S. - Mexico border and serving as an international center for the study of waste management. The CBFO

  4. Recent NRC research activities addressing valve and pump issues

    SciTech Connect (OSTI)

    Morrison, D.L.


    The mission of the U.S. Nuclear Regulatory Commission (NRC) is to ensure the safe design, construction, and operation of commercial nuclear power plants and other facilities in the U.S.A. One of the main roles that the Office of Nuclear Regulatory Research (RES) plays in achieving the NRC mission is to plan, recommend, and implement research programs that address safety and technical issues deemed important by the NRC. The results of the research activities provide the bases for developing NRC positions or decisions on these issues. Also, RES performs confirmatory research for developing the basis to evaluate industry responses and positions on various regulatory requirements. This presentation summarizes some recent RES supported research activities that have addressed safety and technical issues related to valves and pumps. These activities include the efforts on determining valve and motor-operator responses under dynamic loads and pressure locking events, evaluation of monitoring equipment, and methods for detecting and trending aging of check valves and pumps. The role that RES is expected to play in future years to fulfill the NRC mission is also discussed.

  5. Office of Environmental Management Perspective

    Office of Environmental Management (EM)

    Targeted Review of Work Planning and Control and Biological Safety at the Los Alamos National Laboratory December 2015 Office of Worker Safety and Health Assessments Office of Environment, Safety and Health Assessments Office of Enterprise Assessments U.S. Department of Energy i Table of Contents Acronyms ...................................................................................................................................................... ii Executive Summary

  6. Shared address collectives using counter mechanisms

    DOE Patents [OSTI]

    Blocksome, Michael; Dozsa, Gabor; Gooding, Thomas M; Heidelberger, Philip; Kumar, Sameer; Mamidala, Amith R; Miller, Douglas


    A shared address space on a compute node stores data received from a network and data to transmit to the network. The shared address space includes an application buffer that can be directly operated upon by a plurality of processes, for instance, running on different cores on the compute node. A shared counter is used for one or more of signaling arrival of the data across the plurality of processes running on the compute node, signaling completion of an operation performed by one or more of the plurality of processes, obtaining reservation slots by one or more of the plurality of processes, or combinations thereof.

  7. Cheaper Adjoints by Reversing Address Computations

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Hascoët, L.; Utke, J.; Naumann, U.


    The reverse mode of automatic differentiation is widely used in science and engineering. A severe bottleneck for the performance of the reverse mode, however, is the necessity to recover certain intermediate values of the program in reverse order. Among these values are computed addresses, which traditionally are recovered through forward recomputation and storage in memory. We propose an alternative approach for recovery that uses inverse computation based on dependency information. Address storage constitutes a significant portion of the overall storage requirements. An example illustrates substantial gains that the proposed approach yields, and we show use cases in practical applications.

  8. Loan Programs Office

    Energy Savers [EERE]

    1,400 Jobs | Department of Energy Loan Guarantees for Three California PV Solar Plants Expected to Create 1,400 Jobs Loan Guarantees for Three California PV Solar Plants Expected to Create 1,400 Jobs June 30, 2011 - 2:29pm Addthis Ginny Simmons Ginny Simmons Former Managing Editor for, Office of Public Affairs What will these projects produce? These projects are expected to create 1,400 jobs in California and hundreds along the PV module supply chain across the country. Combined,

  9. Idaho Operations Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    September 2. 2010 Josh Berman 2 N. Riverside Plaza, Suite 2250 Chicago, IL 60606 SUBJECT: FOIA Response (10-034) (lD-201O-01859-F)(OHA Case No. TFA-0404) (OM-PA-I0- 062) Dear Mr. Berman: This is a revised final response from the Idaho Operations Office (DOE-ID), regarding your July 22, 2010, Freedom ofInformation Act (FOIA) request. In that letter you requested: * Richard Boardman Emails * WoodiGrubick Emails FY 2006 * Wood/Grubick Emails FY 2007 * WoodiGrubick Emails FY 2008 * WoodiGrubick

  10. Office of Information Resources

    Energy Savers [EERE]

    ,2008 Melanie Pustay Director Office of Information and Privacy U.S. Department of Justice 1425 New York Ave., Suite 11050 Washington, DC 20530 Dear Ms. Pustay: Pursuant to the requirements set forth by Title 5, United States Code, Section 552(e), enclosed is a copy of the Annual Report on the administration of the Freedom of Information Act (FOIA) by the Department of Energy. The report will be made available on the World Wide Web through the FOIA Home Page of the Department. If you have any

  11. Richland Operations Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ZATESO~'P.O. Box 550 E Richland, Washington 99352 11 -SED-0 124 JUL 0 7 2Mt Mr. J. G. Lehew 111, President and Chief Executive Officer CH2M HILL Plateau Remnediation Company Richland, Washington 99352 Dear Mr. Lehew: CONTRACT NO. DE-ACO6-08RL 14788 - TRANSN4ITTAL OF SURVEILLANCE REPORT PLANNING AND EXECUTION OF RADIOLOGICAL WORK (S-1I l-SFD-CHPRC-PFP-002) Pursuant to Clause E. 1, "DOE Inspection and Acceptance," this letter transmits Surveillance Report S-1 I -SED-CHPRC-PFP-002. The

  12. Richland Operations Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ATESORichland, Washington 99352 16-PRO-0061 DEC 17 2015 Ms. H. P. Mooers, President HPM Corporation 4304 West 2 4 th Aye, Suite 100 Kennewick, Washington 99338 Dear Ms. Mooers: CONTRACT NO. DE-EM0002043 - HPM CORPORATION (HPMC) FISCAL YEAR 2015 PERFORMANCE EVALUATION AND MEASUREMENT PLAN (PEMP) FEE DETERMINATION The U.S. Department of Energy Richland Operation Office (RL) has completed its evaluation of I-PMC's performance for the period of October 1, 2014, through September 30, 2015. As the Fee

  13. Ca rlsbad Field Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    En ergy Ca rlsbad Field Office P. O . Box 3090 Carlsbad , New Mexico 88221 AUG 2 9 2013 Mr. John E. Kieling , Chief Hazardous Waste Bureau New Mexico Environment Department 2905 Rodeo Park Drive East, Building 1 Santa Fe, New Mexico 87505-6303 Subject: Notification of Class 1 Permit Modification to the Waste Isolation Pilot Plant Hazardous Waste Facility Permit Number: NM4890139088-TSDF Dear Mr. Kieling: Enclosed is a Class 1 Permit Modification Notification for the fo ll owing items: * Revise a

  14. OSTI, US Dept of Energy, Office of Scientific and Technical Information |

    Office of Scientific and Technical Information (OSTI)

    Speeding access to science information from DOE and Beyond Office of Scientific & Technical Information NEWS MEDIA CONTACT: Cathey Daniels, (865) 576-9539 FOR IMMEDIATE RELEASE April 4, 2006 Alert Service Sends International Research to Public Desktops Oak Ridge, TN - Citizens can set up a free e-mail alert account and receive information on a wide variety of energy-related research through a new U.S. Department of Energy (DOE) developed service. Users can target information of interest,

  15. Pensacola Smart Grid RFI Addressing Policy and Logistical Challenges...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Pensacola Smart Grid RFI Addressing Policy and Logistical Challenges Pensacola Smart Grid RFI Addressing Policy and Logistical Challenges Pensacola Smart Grid RFI Addressing Policy ...

  16. Office of Executive Resources Office of the Chief Human Capital Officer

    Energy Savers [EERE]

    Executive Resources Office of the Chief Human Capital Officer U.S. Department of Energy Senior Executive Service (SES) Performance Management System Policy and Operating Procedures Executive Summary The U.S. Office of Personnel Management (OPM), in coordination with the Office of Management and Budget (OMB) issued a government-wide Senior Executive Service (SES) performance management system in 2012. The Department of Energy (DOE) adopted this government-wide SES performance management system

  17. DOE NEPA Compliance Officers | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NEPA Compliance Officers DOE NEPA Compliance Officers NEPA Compliance Officers are listed by program office. Field offices are listed under their primary program office. PDF icon NCO_Directory_2016-03-24.pdf More Documents & Publications DOE Employee Concerns Program Contact List Privacy Act Officers Contact List Points of Contact for FEOSH Program at Field Sites

  18. Alternate Watch Office | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Alternate Watch Office Germantown Watch Office When activated at senior leadership direction, the Forrestal Watch Office functions are transferred to a relocated Watch Office. This alternate Watch Office replicates the 24/7/365 mission and communications links resident in the Forrestal Watch Office. Related Topics emergency operations watch office

  19. Idaho Operations Office

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    9, 2010 SUBJECT: Release of the Finding of No Significant Impact and the Final Enviromnental Assessment for the MUltipurpose Haul Road Within the Idaho National Laboratory Site Dear Citizen: Thank you for your interest in the Finding of No Significant Impact (FONSI) and the Final Enviromnental Assessment (EA) for the Multipurpose Haul Road Within the Idaho National Laboratory Site (enclosed). All comments on this project and the potential enviromnental impacts have been addressed and the

  20. Mapping virtual addresses to different physical addresses for value disambiguation for thread memory access requests

    DOE Patents [OSTI]

    Gala, Alan; Ohmacht, Martin


    A multiprocessor system includes nodes. Each node includes a data path that includes a core, a TLB, and a first level cache implementing disambiguation. The system also includes at least one second level cache and a main memory. For thread memory access requests, the core uses an address associated with an instruction format of the core. The first level cache uses an address format related to the size of the main memory plus an offset corresponding to hardware thread meta data. The second level cache uses a physical main memory address plus software thread meta data to store the memory access request. The second level cache accesses the main memory using the physical address with neither the offset nor the thread meta data after resolving speculation. In short, this system includes mapping of a virtual address to a different physical addresses for value disambiguation for different threads.

  1. Office of Executive Resources Office of the Chief Human Capital Officer

    Energy Savers [EERE]

    Office of Executive Resources Office of the Chief Human Capital Officer U.S. Department of Energy FY 2015 Senior Executive Service (SES) and Senior Professional (SP) Performance Appraisal Closeout Guidance 2 Table of Contents I. FY 2015 PERFORMANCE APPRAISAL CYCLE BUSINESS RULES ............................................................................. 3 ASSESSING PERFORMANCE

  2. Office of Executive Resources Office of the Chief Human Capital Officer

    Energy Savers [EERE]

    Office of Executive Resources Office of the Chief Human Capital Officer U.S. Department of Energy Excepted Service Exceptionally Well Qualified (EWQ) (EQ Pay Plan) Policy and Operating Procedures Table of Contents I. AUTHORITY AND PURPOSE ........................................................................................................... 4 II. BACKGROUND ............................................................................................................................... 4 III.

  3. Myth-Busting2Ž: Addressing Misconceptions and Further Improving Communication During the Acquisition Process

    Energy Savers [EERE]

    MA N A G E ME N T A N D B U D G E T W A S H I N G T O N , D . C . 2 0 5 0 3 O F F I C E O F F E D E R A L May 7, 2012 P R O C U R E M E N T P O L I C Y MEMORANDUM FOR CHIEF ACQUISITION OFFICERS SENIOR PROCUREMENT EXECUTIVES CHIEF INFORMATION OFFICERS FROM: Lesley A. Field Acting Administrator for Federal Procurement Policy SUBJECT: "Myth-Busting 2": Addressing Misconceptions and Further Improving Communication During the Acquisition Process Early, frequent, and constructive engagement


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site


  5. BLM Boise District Office | Open Energy Information

    Open Energy Info (EERE)

    Boise District Office Jump to: navigation, search Name: BLM Boise District Office Abbreviation: Boise Place: Boise, Idaho ParentHolding Organization: BLM Idaho State Office...

  6. BLM Prineville District Office | Open Energy Information

    Open Energy Info (EERE)

    Prineville District Office Jump to: navigation, search Name: BLM Prineville District Office Place: Prineville, Oregon References: BLM Prineville District Office Directory1 This...

  7. BLM Vale District Office | Open Energy Information

    Open Energy Info (EERE)

    Vale District Office Jump to: navigation, search Name: BLM Vale District Office Place: Vale, Oregon ParentHolding Organization: BLM References: BLM Vale District Office...

  8. Contact the Sustainability Performance Office | Department of...

    Office of Environmental Management (EM)

    Performance Office Contact the Sustainability Performance Office The U.S. Department of Energy (DOE) Sustainability Performance Office (SPO) oversees departmental sustainability...

  9. Livermore Field Office | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Us Our Operations Management and Budget Office of Civil Rights Workforce Statistics Livermore Field Office Livermore Field Office FY15 Year End Report Semi Annual...

  10. Nevada Field Office | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Us Our Operations Management and Budget Office of Civil Rights Workforce Statistics Nevada Field Office Nevada Field Office FY15 Year End Report Semi Annual Report...

  11. Sandia Field Office | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Us Our Operations Management and Budget Office of Civil Rights Workforce Statistics Sandia Field Office Sandia Field Office FY15 Year End Report Semi Annual Report...

  12. Independent Oversight Inspection, Savannah River Site Office...

    Energy Savers [EERE]

    Office - December 2009 Independent Oversight Inspection, Savannah River Site Office - December 2009 December 2009 Inspection of Nuclear Safety at the Savannah River Site Office and ...

  13. Nevada Field Office | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    Nevada Field Office Nevada Field Office NNSA's safety office accredited and recognized for ... High schools compete for Nevada Science Bowl title The winner of the 2016 Nevada Science ...

  14. Independent Oversight Review, Richland Operations Office - November...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Richland Operations Office - November 2012 Independent Oversight Review, Richland Operations Office - November 2012 November 2012 Review of the Richland Operations Office Oversight...

  15. Professional","Government ","All Other Office"

    U.S. Energy Information Administration (EIA) Indexed Site

    ,"All Buildings*","Office Buildings" ,,"All Office","Administrative Professional","Government ","All Other Office" "All Buildings",64783,12208,6628,1549,4031 "Building...

  16. Professional","Government ","All Other Office"

    U.S. Energy Information Administration (EIA) Indexed Site

    ,"All Buildings*","Office Buildings" ,,"All Office","Administrative Professional","Government ","All Other Office" "All Buildings",4645,824,442,84,298 "Building Floorspace"...

  17. livermore field office | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    field office livermore field office Livermore Field Office sets core values as part of continuous improvement process At their recent off-site continuous improvement session,...


    Broader source: (indexed) [DOE]


  19. Categorical Exclusion Determinations: Golden Field Office | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Program Date: 03252015 Location(s): Nationwide Office(s): Golden Field Office March 24, 2015 CX-100203 Categorical Exclusion Determination Solar Hot Water Project in Greenburgh,...

  20. Addressing Deferred Maintenance, Infrastructure Costs, and Excess

    Office of Environmental Management (EM)

    About Us About Us Photo of a street with two-story homes with solar panels on the roof. Energy Saver is the U.S. Department of Energy's (DOE) consumer resource on saving energy and using renewable energy technologies at home. Learn more about the Energy Saver Mission. Energy Saver offers the following resources: Website Blog Facebook Twitter The Energy Saver Guide (booklet, download, e-book) Energy Saver is managed by DOE's Office of Energy Efficiency and Renewable Energy. Energy Saver Services

  1. Health

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Energy Headquarters Program & Staff Office Mailing Addresses Headquarters Program & Staff Office Mailing Addresses The following addresses are for delivery of regular mail and small packages: Delivery to the Headquarters buildings in Washington, DC: Name of Individual Title Routing Symbol/Forrestal Building U.S. Department of Energy 1000 Independence Ave., S.W. Washington, DC 20585 Name of Individual Title Routing Symbol/L'Enfant Plaza Building U.S. Department of Energy 1000


    Office of Legacy Management (LM)

    OFFICE FOR EMERGENCY MANAGEMENT 155OP STREETNW. WiSHINGTON. D.C. ' , iQns 25,19&L At-t :. I' .' ~ at l530 P Btmat, IO&, XtwMn&m, 0. 6., at 9130 A.Jb Sa 1 llmbemupoftbaaomlttaal8~f~r :::i.: :;::j:/ :::.,:.,::: . . . -2, . -3- .,... .:.:. . . ,::;:: 2. lktlv4rsityof-ta ?oral8rtbnsfoaofth4~cnlLmd farumd4rContraotO~~9 t4a : lwlnde the d4v4logmullt. construotion j andop4ratloaofadditl~auls, s~tNm4t4ln. /; ./ 3. alllY4rsltyofcb.l4s&o on4fth4w*callyd sar tmdor OoBtroct OEUS~ 7 :;::.

  3. Enhancing Energy Infrastructure Resiliency and Addressing Vulnerabilities

    Broader source: [DOE]

    Quadrennial Energy Review Task Force Secretariat and Energy Policy and Systems Analysis Staff, U. S. Department of Energy (DOE) Public Meeting on “Enhancing Resilience in Energy Infrastructure and Addressing Vulnerabilities” On Friday, April 11, 2014, at 10 a.m. in room HVC-215 of the U.S. Capitol, the Department of Energy (DOE), acting as the Secretariat for the Quadrennial Energy Review Task Force, will hold a public meeting to discuss and receive comments on issues related to the Quadrennial Energy Review (QER). The meeting will focus on infrastructure vulnerabilities related to the electricity, natural gas and petroleum transmission, storage and distribution systems (TS&D). The meeting will consist of two facilitated panels of experts on identifying and addressing vulnerabilities within the nation’s energy TS&D infrastructure. Following the panels, an opportunity will be provided for public comment via an open microphone session. The meeting will be livestreamed at

  4. Multithreaded Global Address Space Communication Techniques

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Multithreaded Global Address Space Communication Techniques for Gyrokinetic Fusion Applications on Ultra-Scale Platforms Robert Preissl Lawrence Berkeley National Laboratory Berkeley, CA, USA 94720 Nathan Wichmann CRAY Inc. St. Paul, MN, USA, 55101 Bill Long CRAY Inc. St. Paul, MN, USA, 55101 John Shalf Lawrence Berkeley National Laboratory Berkeley, CA, USA 94720 Stephane Ethier Princeton Plasma Physics Laboratory Princeton, NJ,

  5. Field Offices | U.S. DOE Office of Science (SC)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Jobs Brochures, Logos, & Information Resources Contact Contact Information Office of Science U.S. Department of Energy 1000 Independence Ave., SW Washington, DC 20585 P: ...

  6. Global-Address Space Networking (GASNet) Library

    Energy Science and Technology Software Center (OSTI)


    GASNet (Global-Address Space Networking) is a language-independent, low-level networking layer that provides network-independent, high-performance communication primitives tailored for implementing parallel global address space SPMD languages such as UPC and Titanium. The interface is primarily intended as a compilation target and for use by runtime library writers (as opposed to end users), and the primary goals are high performance, interface portability, and expressiveness. GASNet is designed specifically to support high-performance, portable implementations of global address spacemore » languages on modern high-end communication networks. The interface provides the flexibility and extensibility required to express a wide variety of communication patterns without sacrificing performance by imposing large computational overheads in the interface. The design of the GASNet interface is partitioned into two layers to maximize porting ease without sacrificing performance: the lower level is a narrow but very general interface called the GASNet core API - the design is basedheavily on Active Messages, and is implemented directly on top of each individual network architecture. The upper level is a wider and more expressive interface called GASNet extended API, which provides high-level operations such as remote memory access and various collective operations. This release implements GASNet over MPI, the Quadrics "elan" API, the Myrinet "GM" API and the "LAPI" interface to the IBM SP switch. A template is provided for adding support for additional network interfaces.« less

  7. Comments of Cisco Systems to Office of Electricity Delivery and Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Reliability | Department of Energy of Cisco Systems to Office of Electricity Delivery and Energy Reliability Comments of Cisco Systems to Office of Electricity Delivery and Energy Reliability Cisco Systems provides comments in response to the RFI issued by DOE on addressing policy andlogistical challenges to smart grid implementation. PDF icon Comments of Cisco Systems to Office of Electricity Delivery and Energy Reliability More Documents & Publications NIST Activities in Support of the

  8. Categorical Exclusion Determinations: Los Alamos Site Office...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    B6.1 Date: 02182015 Location(s): New Mexico Offices(s): Los Alamos Site Office ... B1.19 Date: 02092015 Location(s): New Mexico Offices(s): Los Alamos Site Office ...

  9. Accountable Officers' Accounts Records | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site


  10. Category:MediumOffice | Open Energy Information

    Open Energy Info (EERE)

    IN Duke Energy Indiana Inc.png SVMediumOffice Indiana... 62 KB SVMediumOffice Jackson MS Entergy Mississippi Inc.png SVMediumOffice Jackson... 72 KB SVMediumOffice Kansas...

  11. Home Office and Electronics | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Home Office and Electronics Home Office and Electronics Addthis Keep Your Home Office Efficient with ENERGY STAR. 1 of 2 Keep Your Home Office Efficient with ENERGY STAR. Laptops ...

  12. Categorical Exclusion Determinations: Golden Field Office | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Award Number: DE- EE-0007182 CX(s) Applied: A9, A11 Solar Energy Technologies Office Date: 10222015 Location(s): CA Office(s): Golden Field Office October 20, 2015 CX-100391...

  13. Categorical Exclusion Determinations: Golden Field Office | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Number: DE-EE0007137 CX(s) Applied: A9, B3.6, B3.11 Solar Energy Technologies Office Date: 09102015 Location(s): AL Office(s): Golden Field Office September 8, 2015 CX-100362...

  14. Join @Energy for the 2016 State of the Union Address | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    @Energy for the 2016 State of the Union Address Join @Energy for the 2016 State of the Union Address January 11, 2016 - 11:10am Addthis Join us for live coverage of the State of the Union, starting at 9PM ET on Tuesday. | Image courtesy of Carly Wilkins. Join us for live coverage of the State of the Union, starting at 9PM ET on Tuesday. | Image courtesy of Carly Wilkins. Allison Lantero Allison Lantero Digital Content Specialist, Office of Public Affairs How can I participate? Follow along with

  15. moveLINQ PIA, Office of the Chief Financial Officer | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    moveLINQ PIA, Office of the Chief Financial Officer moveLINQ PIA, Office of the Chief Financial Officer moveLINQ PIA, Office of the Chief Financial Officer PDF icon moveLINQ PIA, Office of the Chief Financial Officer More Documents & Publications Integrated Safety Management Workshop Registration, PIA, Idaho National Laboratory PIA - Bonneville Power Adminstration Ethics Helpline Occupational Medicine - Assistant

  16. Report on Audit of the Department of Energy Program Offices' Use of Management and Operating Contractor Employees, IG-0392

    Energy Savers [EERE]

    U.S. DEPARTMENT OF ENERGY OFFICE OF INSPECTOR GENERAL OFFICE OF AUDIT SERVICES AUDIT OF THE DEPARTMENT OF ENERGY PROGRAM OFFICES' USE OF MANAGEMENT AND OPERATING CONTRACTOR EMPLOYEES The Office of Inspector General wants to make the distrution of its reports as customer friendly and cost effective as possible. Therefore, this report will be available electronically through the Internet five to seven days after publication at the following addresses: Department of energy Headquarters Gopher

  17. Carlsbad Field Office Manager Selected

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Carlsbad Field Office Manager Selected CARLSBAD, N.M., November 10, 2011 - The U.S. Department of Energy's (DOE) Richland Operations Office (RL) Assistant Manager for the River Corridor Joe Franco was selected as Manager for the Carlsbad Field Office (CBFO), which oversees the Waste Isolation Pilot Plant (WIPP). CBFO Deputy Manager Ed Ziemianski has been acting in the CBFO Manager's position for the past year and will continue to serve as Deputy Manager. In operation since 1999, WIPP is a DOE

  18. Perfecting marksmanship: Sandia California Security Police Officers...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Perfecting marksmanship: Sandia California Security Police Officers train to improve ... Home NNSA Blog Perfecting marksmanship: Sandia California Security Police Officers ... ...

  19. All Office Administrative/ Professional Government All Other

    U.S. Energy Information Administration (EIA) Indexed Site

    Buildings Energy Consumption Survey All Office Administrative Professional Government All Other Office All Buildings... 4,645 824 442 84...

  20. All Office Administrative/ Professional Government All Other

    U.S. Energy Information Administration (EIA) Indexed Site

    Buildings Energy Consumption Survey All Office Administrative Professional Government All Other Office All Buildings... 64,783 12,208...

  1. Stanford Geothermal Workshop - Geothermal Technologies Office...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    - Geothermal Technologies Office Stanford Geothermal Workshop - Geothermal Technologies Office Presentation by Geothermal Technologies Director Doug Hollett at the Stanford ...

  2. Advanced Manufacturing Office (Formerly Industrial Technologies...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Manufacturing Office (Formerly Industrial Technologies Program) Advanced Manufacturing Office (Formerly Industrial Technologies Program) Presented at the NREL Hydrogen and Fuel ...

  3. Business Opportunities Session Office of Environmental Management...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Opportunities Session Office of Environmental Management Business Opportunities Session Office of Environmental Management Environmental Clean up PDF icon Business Opportunities ...

  4. Welcome to The Office of Science

    ScienceCinema (OSTI)

    Brinkman, William


    The Director of the Department of Energy's Office of Science, Dr. William Brinkman, introduces the new Office of Science website.

  5. Welcome to The Office of Science

    SciTech Connect (OSTI)

    Brinkman, William


    The Director of the Department of Energy's Office of Science, Dr. William Brinkman, introduces the new Office of Science website.

  6. Bioenergy Technologies Office Solicitations | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Financial Opportunities Bioenergy Technologies Office Solicitations Bioenergy Technologies Office Solicitations To explore current financial opportunity solicitations, click on ...

  7. Bioenergy Technologies Office (BETO) Announces Renewable Carbon...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Funding Opportunity Announcement (FOA) Bioenergy Technologies Office (BETO) Announces ... Related Articles Renewable Carbon Fibers Bioenergy Technologies Office Announces Notice of ...


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    request must document explicitly how the Contracting Officer plans to perform cost realism analysis without audit support. A waiver from the Procurement Director is not...

  9. Director, Information Technologies Services Office

    Broader source: [DOE]

    The mission of the Information Technologies Services Office (ITSO) is to provide effective corporate leadership to proactively identify and manage business system efficiency improvements and to...

  10. Golden Laboratories and Offices | NREL

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    NREL's administrative offices and most research laboratories are located at our campus in Golden, Colorado, north of highway I-70 and west of Denver West Boulevard. View...

  11. Profiles in garbage: Office paper

    SciTech Connect (OSTI)

    Miller, C.


    The primary markets for recycled office paper are tissue mills, printing and writing paper, and paperboard packaging. Other uses include exports and newsprint. As recently as 1990, more than half of recovered office paper was exported, primarily to paper mills in Pacific Rim countries. This decade has seen an increase in the number of mills using deinked market pulp made from office paper. North American capacity to produce deinked market pulp skyrocketed in the first half of this decade. However, oversupply in the end markets for office paper led to financial problems and shutdown for several of these new mills.

  12. LANSCE | Training Office | User Training

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Users User Office User Program LANSCE User Group Rosen Scholar Rosen Prize News & Multimedia News Multimedia Events Profiles Highlights Seminars Activity Reports The Pulse User ...

  13. Office of Science User Facilities

    Broader source: [DOE]

    This presentation summarizes the information on the Office of Science User Facilities, which was given during the webinar on the DOE BRIDGE funding opportunity.

  14. Director, Solar Energy Technologies Office

    Broader source: [DOE]

    The mission of the Solar Energy Technologies Office (SETO) is to provide the overall programmatic and technical oversight, policy, management, and strategic direction necessary for a balanced...

  15. Vehicle Technologies Office: Propulsion Systems

    Office of Energy Efficiency and Renewable Energy (EERE)

    Vehicle Technologies Office research focuses much of its effort on improving vehicle fuel economy while meeting increasingly stringent emissions standards. Achieving these goals requires a...

  16. Director, Office of Resource Management

    Broader source: [DOE]

    The Office of the Associate Under Secretary for Environment, Health, Safety, and Security (AU) provides corporate leadership and strategic approaches for protecting DOEs workers, the public, the...

  17. Office of Intelligence and Counterintelligence

    Broader source: [DOE]

    The U.S. Department of Energy’s Office of Intelligence and Counterintelligence is responsible for all intelligence and counterintelligence activities throughout the DOE complex, including nearly...

  18. Via E-Mail Michael Li Electricity Policy Specialist U.S. Department of Energy

    Energy Savers [EERE]

    Veterans Solving Energy Challenges Veterans Solving Energy Challenges August 6, 2014 - 10:31am Addthis Ronald J. (R.J.) McIntosh receives a Certificate of Special Congressional Recognition from Rep. Suzan DelBene of Washington. | Photo courtesy of Rep. Suzan DelBene’s office Ronald J. (R.J.) McIntosh receives a Certificate of Special Congressional Recognition from Rep. Suzan DelBene of Washington. | Photo courtesy of Rep. Suzan DelBene's office Six of the eight FEMP veteran internship

  19. Office of Chief Financial Officer DOE/CF-0125

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DOE/CF-0125 Budget in Brief Department of Energy FY 2017 Congressional Budget Request February 2016 Office of Chief Financial Officer DOE/CF-0125 Budget in Brief Printed with soy ink on recycled paper Department of Energy FY 2017 Congressional Budget Request FY 2017 BUDGET IN BRIEF TABLE OF CONTENTS Overview

  20. Opportunities for Building America Research to Address Energy Upgrade Technical Challenges: HVAC, Envelope & IAQ (301)

    Energy Savers [EERE]

    Peer Exchange Call Series: Opportunities for Building America Research to Address Energy Upgrade Technical Challenges: HVAC, Envelope & IAQ (301) July 21, 2015 Call Slides and Discussion Summary Agenda  Call Logistics and Introductions  Opening Polls  Residential Network and Peer Exchange Call Overview  Introduction to Building America Technology to Market Roadmaps  Eric Werling, Building America Program Director, DOE Building Technologies Office  Questions, Discussion, and

  1. Addressing the Voltage Fade Issue with Lithium-Manganese-Rich Oxide Cathode

    Broader source: (indexed) [DOE]

    Materials | Department of Energy 2012 DOE Hydrogen and Fuel Cells Program and Vehicle Technologies Program Annual Merit Review and Peer Evaluation Meeting PDF icon es161_burrell_2012_o.pdf More Documents & Publications Studies on Lithium Manganese Rich MNC Composite Cathodes Vehicle Technologies Office Merit Review 2014: Electrochemical Modeling of LMR-NMC Materials and Electrodes Addressing the Voltage Fade Issue with Lithium-Manganese-Rich Oxide Cathode Materials

  2. Support of US CLIVAR Project Office 2012

    SciTech Connect (OSTI)

    Cummings, Donna


    SUBJECT: CLOSEOUT OF AWARD NO DE-SC0008494 FINAL REPORT: SUPPORT OF US CLIVAR PROJECT OFFICE 2012 UNIVERSITY CORPORATION FOR ATMOSPHERIC RESEARCH Director of JOSS, supervised the U.S. CLIVAR Project Office Director and helped direct the officer to enhance the goals and objectives of the U.S. CLIVAR Project and budget. Financial Manager of JOSS, worked to complete proposals and monitor compliance with award requirements and funding limitations and ensure the U.S. CLIVAR Project Office complied with UCAR policies and procedures. Project Coordinator administered the funding for the U.S. CLIVAR Project Office and was responsible for coordinating special projects that required additional support from JOSS technical staff. These projects included activities such as website updates, technology upgrades, production of printed reports, and development of graphic elements like logos. Web Developer worked both on web development and graphic work and the work consisted of the following: Maintaining the site ? installing updates to Drupal CMS (Content Management System). Creating new templates for webpages and styling them with CSS and JavaScript/jQuery code. Fixing the styling on webpages that the content contributor/manager (Jenn Mays) created and has had trouble with. Creating new web forms for abstract uploading, subscriptions, and meeting registrations. Created 4 webpages for the ?ASP: Key Uncertainties in the Global Carbon-Cycle? meeting. Developed a document review form, instruction webpages, login redirect, dynamic table with form submissions for the US CLIVAR SSC Science Plan Document Review. This was open to the public from June 12, 2013 until July 10, 2013. During this time the user accounts had to be checked (daily) that were created by the public, to delete any spam ones. Graphics work: preparing images for general use on webpages, webpage banners, and for meeting name badges, creating a US CLIVAR letterhead, redesigning the US AMOC logo. System Administrator spent time working on the migration of the US CLIVAR site from the USGCRP office to UCAR here Boulder. This was done to increase the general speed of the site & to allow the web developer to work in it more efficiently. Main tasks were to Archive the old Site, create new development site for web developer, and move web address to new website when web developer was finished with development. There are no patients or equipment related to this proposals

  3. NOTICE TO SUPPLIERS Fraudulent Quote Requests/Purchase Order E-Mail Activity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    * The email message may be poorly written, with misspellings and awkward sentence structure. * The sender's email address is not the same as CNS standard email address domain. The email address domain for Y-12:, for Pantex: Email from either site may also be in this form: * The message and purchase order requests shipment/delivery of products to non-CNS facilities. * The message will include an attachment that is designed to look like a purchase

  4. NOTICE TO SUPPLIERS Fraudulent Quote Requests/Purchase Order E-Mail Activity

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

     The email message may be poorly written, with misspellings and awkward sentence structure.  The senders email address is not the same as CNS standard email address domain. The email address domain for Y-12:, for Pantex:  The message and purchase order requests shipment/delivery of products to non-CNS facilities.  The message will include an attachment that is designed to look like a purchase order, and includes a logo or other graphic, and a signature

  5. Office of Executive Resources Office of the Chief Human Capital Officer

    Energy Savers [EERE]

    Office of Executive Resources Office of the Chief Human Capital Officer U.S. Department of Energy Senior Executive Service (SES) Competitive Staffing Policy and Operating Procedures 2 The Senior Executive Service (SES) Competitive Staffing Policy and Operating Procedures implements the provisions of 5 CFR 317, Employment in the SES. This document applies after the Senior Management Review Board (SMRB) approves the establishment and/or recruitment of an SES position. SES positions may be filled

  6. Framework for Address Cooperative Extended Transactions

    Energy Science and Technology Software Center (OSTI)


    The Framework for Addressing Cooperative Extended Transactions (FACET) is an object-oriented software framework for building models of complex, cooperative behaviors of agents. it can be used to implement simulation models of societal processes such as the complex interplay of participating individuals and organizations engaged in multiple concurrent transactions in pursuit of their various goals. These transactions can be patterned on, for example, clinical guidelines and procedures, business practices, government and corporate policies, etc. FACET canmore » also address other complex behaviors such as biological life cycles or manufacturing processes. FACET includes generic software objects representing the fundamental classes of agent -- Person and Organization - with mechanisms for resource management, including resolution of conflicting requests for participation and/or use of the agent's resources. The FACET infrastructure supports stochastic behavioral elements and coping mechanisms by which specified special conditions and events can cause an active cooperative process to be preempted, diverting the participants onto appropriate alternative behavioral pathways.« less

  7. Information and Technology Services Office | Department of Energy

    Energy Savers [EERE]

    Information and Technology Services Office Information and Technology Services Office The Information and Technology Services Office (ITSO) is an office within the Office of...


    Energy Savers [EERE]

    Daniel I. Gordon Administrator for Federal Procurement Policy SUBJECT: "Myth-Busting": Addressing Misconceptions to Improve Communication


    Energy Savers [EERE]

    Daniel I. Gordon Administrator for Federal Procurement Policy SUBJECT: "Myth-Busting": Addressing Misconceptions to Improve Communication

  10. Office Buildings: Assessing and Reducing Plug and Process Loads in Office Buildings (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available


    Plug and process loads (PPLs) in commercial buildings account for almost 5% of U.S. primary energy consumption. Minimizing these loads is a primary challenge in the design and operation of an energy-efficient building. PPLs are not related to general lighting, heating, ventilation, cooling, and water heating, and typically do not provide comfort to the occupants. They use an increasingly large fraction of the building energy use pie because the number and variety of electrical devices have increased along with building system efficiency. Reducing PPLs is difficult because energy efficiency opportunities and the equipment needed to address PPL energy use in office spaces are poorly understood.

  11. DOE Contracting Offices Directory | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    DOE Contracting Offices Directory DOE Contracting Offices Directory The Department of Energy has a decentralized procurement process for buying goods and services which is carried out by the contracting offices primarily at field locations. The Headquarters Procurement Services office buys for many of the program elements and offices at headquarters. One major responsibility of many of these contracting offices, along with their site offices, is to administer the contracts of their Facility

  12. Vehicle Technologies Office Merit Review 2015: Vehicle Technologies Office Overview

    Broader source: [DOE]

    Presentation given by U.S. Department of Energy  at 2015 DOE Hydrogen and Fuel Cells Program and Vehicle Technologies Office Annual Merit Review and Peer Evaluation meeting about Vehicle...

  13. Office of the Chief Information Officer | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Office of the Chief Information Officer DOE Cyber Distinguished Speaker Series DOE Cyber Distinguished Speaker Series Learn from the experts. Read more DOE Cyber Strategy DOE Cyber Strategy Check out the DOE's strategy for meeting today's cyber challenges. Read more Women in STEM Women in STEM Read about women working in STEM at Energy. Read more Records Management Records Management Your guide to Records Management. Read more FY 2014-2018 DOE IRM STRATEGIC PLAN Read the FY 2014-2018 DOE IRM


    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    THE CHIEF INFORMATION OFFICER WEEKLY REPORT March 27, 2009 Schedule Nothing to report Departmental News Nothing to report Upcoming Events or Matters of Secretarial Interest (7-day advance) Nothing to report Progress on EPACT Deliverables Nothing to report V. Press Inquiries Nothing to report FOIA Requests Nothing to report Grants, Economic Announcements, and Publications Nothing to report FOIA-2009-000360 OFFICE OF LEGACY MANAGEMENT WEEKLY REPORT March 27, 2009 Schedule Dave Geiser, Acting

  15. February 2016 Office of Chief Financial Officer Laboratory Tables

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Laboratory Tables Preliminary Department of Energy FY 2017 Congressional Budget Request DOE/CF-0126 February 2016 Office of Chief Financial Officer Laboratory Tables Preliminary Printed with soy ink on recycled paper The numbers depicted in this document represent the gross level of DOE budget authority for the years displayed. The figures include both the discretionary and mandatory funding in the budget. They do not consider revenues/receipts, use of prior year balances, deferrals,

  16. February 2016 Office of Chief Financial Officer State Tables

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    State Tables Preliminary Department of Energy FY 2017 Congressional Budget Request DOE/CF-0127 February 2016 Office of Chief Financial Officer State Tables Preliminary Printed with soy ink on recycled paper The numbers depicted in this document represent the gross level of DOE budget authority for the years displayed. The figures include both the discretionary and mandatory funding in the budget. They do not consider revenues/receipts, use of prior year balances, deferrals, rescissions, or other

  17. NNSA reorganizes Office of Emergency Operations (NA-40), Office of

    National Nuclear Security Administration (NNSA)

    Counterterrorism and Counterproliferation (NA-80) | National Nuclear Security Administration reorganizes Office of Emergency Operations (NA-40), Office of Counterterrorism and Counterproliferation (NA-80) Wednesday, December 9, 2015 - 11:00am Colleagues: The Department of Energy has adopted an enterprise-wide approach to strengthening its preparedness for and its capability to respond to a broad spectrum of potential emergencies, including those resulting from natural phenomena (e.g.,

  18. Contact Us | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Contact Us Contact Us Postdoctoral Program Lead Kristene (Tina) Henne Phone: 630.252.2907 E-mail: Administrative Support Kathy Eggers Phone: 630.252.6034 E-mail: Mailing Address Argonne National Laboratory Postdoctoral Program Office Building 201, Room 151 9700 South Cass Avenue Argonne, Illinois 60439 U.S.A.

  19. Protocol for Addressing Induced Seismicity Associated with Enhanced...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Protocol for Addressing Induced Seismicity Associated with Enhanced Geothermal Systems (EGS) Protocol for Addressing Induced Seismicity Associated with Enhanced Geothermal Systems...

  20. Smart Grid RFI: Addressing Policy and Logistical Challenges....

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Smart Grid RFI: Addressing Policy and Logistical Challenges. Comments of the Alliance to Save Energy. Smart Grid RFI: Addressing Policy and Logistical Challenges. Comments of the...

  1. Method for the electro-addressable functionalization of electrode...

    Office of Scientific and Technical Information (OSTI)

    Method for the electro-addressable functionalization of electrode arrays Citation Details In-Document Search Title: Method for the electro-addressable functionalization of ...

  2. Addressing Uncertainties in Design Inputs: A Case Study of Probabilist...

    Office of Environmental Management (EM)

    Addressing Uncertainties in Design Inputs: A Case Study of Probabilistic Settlement Evaluations for Soft Zone Collapse at SWPF Addressing Uncertainties in Design Inputs: A Case...

  3. Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology Addressing Biomass Supply Chain Challenges With AFEX(tm) Technology Plenary IV: Advances in Bioenergy ...

  4. Opportunities for Building America Research to Address Energy...

    Energy Savers [EERE]

    Opportunities for Building America Research to Address Energy Upgrade Technical Challenges: HVAC, Envelope and IAQ (301) Opportunities for Building America Research to Address...

  5. Bush Administration Plays Leading Role in Studying and Addressing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Bush Administration Plays Leading Role in Studying and Addressing Global Climate Change Bush Administration Plays Leading Role in Studying and Addressing Global Climate Change...

  6. Energy Department Addresses Largest Gathering of Geothermal Energy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Addresses Largest Gathering of Geothermal Energy Stakeholders Energy Department Addresses Largest Gathering of Geothermal Energy Stakeholders October 4, 2012 - 1:00pm Addthis Photo ...

  7. DOE Convenes Multi-stakeholder Process to Address Privacy for...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Convenes Multi-stakeholder Process to Address Privacy for Data Enabled by Smart Grid Technologies DOE Convenes Multi-stakeholder Process to Address Privacy for Data Enabled by ...

  8. Strategies to Address Split Incentives in Multifamily Buildings...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Strategies to Address Split Incentives in Multifamily Buildings Better Buildings Neighborhood Program Multifamily Low-Income Peer Exchange Call: Strategies to Address Split ...

  9. Policy Agenda for Addressing Climate Change in Bangladesh: Copenhagen...

    Open Energy Info (EERE)

    Agenda for Addressing Climate Change in Bangladesh: Copenhagen and Beyond Jump to: navigation, search Name Policy Agenda for Addressing Climate Change in Bangladesh: Copenhagen and...

  10. Indonesia National Action Plan Addressing Climate Change | Open...

    Open Energy Info (EERE)

    National Action Plan Addressing Climate Change Jump to: navigation, search Tool Summary LAUNCH TOOL Name: Indonesia National Action Plan Addressing Climate Change AgencyCompany...

  11. New partnership uses advanced computer science modeling to address...

    National Nuclear Security Administration (NNSA)

    computer science modeling to address climate change | National Nuclear Security ... New partnership uses advanced computer science modeling to address climate change Several ...

  12. NBP RFI-Addressing Policy and Logistical Challenges to Smart...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NBP RFI-Addressing Policy and Logistical Challenges to Smart Grid Implementation. September 10, 2009 NBP RFI-Addressing Policy and Logistical Challenges to Smart Grid ...

  13. Southern Company: DOE Smart Grid RFI Addressing Policy and Logistical...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Southern Company: DOE Smart Grid RFI Addressing Policy and Logistical Challenges Southern Company: DOE Smart Grid RFI Addressing Policy and Logistical Challenges Southern Company: ...

  14. New York Independent System Operator, Smart Grid RFI: Addressing...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    York Independent System Operator, Smart Grid RFI: Addressing Policy and Logistical Challenges. New York Independent System Operator, Smart Grid RFI: Addressing Policy and ...

  15. Response to Request for Information titled "Addressing Policy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to Request for Information titled "Addressing Policy and Logistical Challenges to Smart Grid Implementation" Response to Request for Information titled "Addressing Policy and ...

  16. ASHRAE draft regarding Smart Grid RFI: Addressing Policy and...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    ASHRAE draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges ASHRAE draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges The American ...

  17. NAP Coalition Response to DOE RFI: Addressing Policy and Logistical...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    NAP Coalition Response to DOE RFI: Addressing Policy and Logistical Challenges to Smart Grid Implementation NAP Coalition Response to DOE RFI: Addressing Policy and Logistical ...

  18. Steffes Corporation Smart Grid RFI: Addressing Policy and Logistical...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Steffes Corporation Smart Grid RFI: Addressing Policy and Logistical Challenges Steffes Corporation Smart Grid RFI: Addressing Policy and Logistical Challenges Steffes Corporation ...

  19. Progress Energy draft regarding Smart Grid RFI: Addressing Policy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Progress Energy draft regarding Smart Grid RFI: Addressing Policy and Logistical Challenges Progress Energy draft regarding Smart Grid RFI: Addressing Policy and Logistical ...

  20. Pepco Holdings, Inc. Smart Grid RFI: Addressing Policy and Logistical...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Holdings, Inc. Smart Grid RFI: Addressing Policy and Logistical Challenges Pepco Holdings, Inc. Smart Grid RFI: Addressing Policy and Logistical Challenges Pepco Holdings, Inc. ...