Powered by Deep Web Technologies
Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


PIA - Savannah River Nuclear Solutions (SRNS) Human Resource...  

Office of Environmental Management (EM)

Solutions (SRNS) Human Resource Management System (HRMS) PIA - Savannah River Nuclear Solutions (SRNS) Human Resource Management System (HRMS) PIA - Savannah River Nuclear...


PIA - Savannah River Nuclear Solution (SRNS) MedGate Occupational...  

Office of Environmental Management (EM)

Occupational Health and Safety Medical System (OHS) (Includes the Drug and Alcohol Testing System (Assistant)) PIA - Savannah River Nuclear Solution (SRNS) MedGate...


PIA - Savannah River Nuclear Solution (SRNS) Procurement Cycle...  

Energy Savers [EERE]

Occupational Health and Safety Medical System (OHS) (Includes the Drug and Alcohol Testing System (Assistant)) PIA - Savannah River Nuclear Solution (SRNS) Energy Employees...


PIA - Savannah River Nuclear Solution (SRNS) Energy Employees...  

Energy Savers [EERE]

Occupational Health and Safety Medical System (OHS) (Includes the Drug and Alcohol Testing System (Assistant)) PIA - Savannah River Nuclear Solution (SRNS) Procurement Cycle...


from Savannah River Nuclear Solutions, LLC NEWS SRNS's Maciaszek Elected  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

SRNS's Maciaszek Elected SRNS's Maciaszek Elected Fellow of Society of Fire Protection Engineers AIKEN, S.C. (July 11, 2012) - Stan Maciaszek, fire protection engineer for Savannah River Nuclear Solutions' (SRNS) Tritium Programs, was recently inducted as a Fellow of the Society of Fire Protection Engineers (SFPE). A Registered Professional Engineer, Maciaszek has served as a system engineer and design authority for the Savannah River Site tritium facilities for over 11 years, in which he has been responsible for the nu- clear safety related fire suppression systems. He actively supports and promotes fire pro- tection and fire protection engineering through mentoring, National Engineer Week activities and other education outreach programs, which introduce middle and high school students


PIA - Savannah River Nuclear Solution (SRNS) MedGate Occupational Health  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

MedGate Occupational MedGate Occupational Health and Safety Medical System (OHS) (Includes the Drug and Alcohol Testing System (Assistant)) PIA - Savannah River Nuclear Solution (SRNS) MedGate Occupational Health and Safety Medical System (OHS) (Includes the Drug and Alcohol Testing System (Assistant)) PIA - Savannah River Nuclear Solution (SRNS) MedGate Occupational Health and Safety Medical System (OHS) (Includes the Drug and Alcohol Testing System (Assistant)) PIA - Savannah River Nuclear Solution (SRNS) MedGate Occupational Health and Safety Medical System (OHS) (Includes the Drug and Alcohol Testing System (Assistant)) More Documents & Publications PIA - Savannah River Nuclear Solution (SRNS) Procurement Cycle System (PCS) PIA - Savannah River Nuclear Solutions (SRNS) Human Resource Management


from Savannah River Nuclear Solutions, LLC NEWS SRNS Partners with Georgialina Physical Therapy Associates to  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Partners with Georgialina Physical Therapy Associates to Partners with Georgialina Physical Therapy Associates to Bring Services to SRS Employees AIKEN, S.C. - April 25, 2013 - The days of long drives, even longer wait times, and work challenges associated with ongoing physical therapy appointments are drawing to an end for Savannah River Site (SRS) employees thanks to a partnership between Savannah River Nuclear Solutions, LLC (SRNS) and Georgialina Physical Therapy (GPT) Associates. Together, the companies have launched a new program to provide a range of physical therapy services to all SRS employees. "Any SRS employee can schedule an appointment with us at our on-site location," said Brett Brannon, co-owner, Georgialina Physical Therapy Associates. "We provide the same services at our SRS clinic that we do in any of our


SRNS revives student robotics team | National Nuclear Security  

National Nuclear Security Administration (NNSA)

SRNS revives student robotics team | National Nuclear Security SRNS revives student robotics team | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Home > NNSA Blog > SRNS revives student robotics team SRNS revives student robotics team Posted By Office of Public Affairs The Aiken County Robotics Team "M'Aiken Magic" was recently revived


SRNS signs on as industry partner for Nuclear Engineering Technology...  

National Nuclear Security Administration (NNSA)

Dr. Rick Hall, Vice President of Academic Affairs, Augusta Technical College and Carol Johnson, Savannah River Nuclear Solutions President & CEO, to sign an Agreement of...


SRNS-RP-2013-00005 Savannah River Site Ten Year Site Plan FY  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

SRNS-RP-2013-00005 SRNS-RP-2013-00005 Savannah River Site Ten Year Site Plan FY 2014 - 2023 May 2013 United States Department of Energy Savannah River Site Ten Year Site Plan FY 2014 - 2023 May 2013 Prepared by: Savannah River Nuclear Solutions, LLC A Fluor Daniel Partnership Savannah River Site Aiken, SC 29808 SRNS-RP-2013-00005 Savannah River Site Ten Year Site Plan SRNS-RP-2013-00005 May 2013 DISCLAIMER This report was prepared by Savannah River Nuclear Solutions LLC (SRNS) for the United States Department of Energy under Contract No. DE-AC09-08SR22470 and is an account of work performed under that contract. Reference herein to any specific commercial product, process or services by trademark, name, manufacturer, or otherwise does not necessarily constitute or imply endorsement,


Preliminary Notice of Violation, Savannah River Nuclear Solutions, LLC- WEA-2012-04  

Broader source: Energy.gov [DOE]

Issued to Savannah River Nuclear Solutions (SRNS), LLC, related to a Worker Fall from a Scaffold in the K-Area Complex at the Savannah River Site.


SRNS Preliminary Notice of Violation  

Broader source: Energy.gov (indexed) [DOE]

November 9, 2012 November 9, 2012 RETURN RECEIPT REQUESTED Mr. Dwayne Wilson President and Chief Executive Officer Savannah River Nuclear Solutions, LLC 6160 Executive Woodside Court Aiken, South Carolina 29803 WEA-2012-04 Dear Mr. Wilson: This letter refers to the U.S. Department of Energy (DOE) Office of Health, Safety and Security's Office of Enforcement and Oversight investigation into the facts and circumstances associated with a worker fall from a Tele-Tower® Adjustable Work Platform in the K-Area Complex at the Savannah River Site on July 1, 2011. The results of DOE's investigation were provided to Savannah River Nuclear Solutions, LLC (SRNS) in an investigation report dated May 8, 2012. An enforcement conference was held on June 27,2012, with you and members of your staff to discuss the report's


Project Management Institute Highlights Savannah River Nuclear Solutions in Publication  

Broader source: Energy.gov [DOE]

AIKEN, S.C. – Project Management Institute (PMI) — the world’s largest not-for-profit membership association for the project management profession — features a story on Savannah River Nuclear Solutions (SRNS).


Principal Media Contact: DT Townsend Savannah River Nuclear Solutions, LLC  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Project Management Institute Selects SRNS as Finalist for Project Management Institute Selects SRNS as Finalist for International Award Project Management Institute cites SRS American Recovery and Reinvestment Act cleanup success in naming SRNS finalist for prestigious recognition AIKEN, S.C. (Sept. 4, 2013) - Department of Energy -SR contractor Savannah River Nuclear Solutions, LLC (SRNS) has been named one of three finalists for the "Project Management of the Year" award by the internationally-renowned Project Management Institute (PMI), the world's largest association for project managers. SRNS is being considered for this coveted award due to exceptional project management of the extensive work accomplished through Savannah River Site's $1.4 billion American Recovery and Reinvestment Act (ARRA) clean-


DOE to Extend Savannah River Nuclear Solutions Contract at Savannah River  

Broader source: Energy.gov (indexed) [DOE]

to Extend Savannah River Nuclear Solutions Contract at Savannah to Extend Savannah River Nuclear Solutions Contract at Savannah River Site to September 2016 DOE to Extend Savannah River Nuclear Solutions Contract at Savannah River Site to September 2016 September 6, 2012 - 12:00pm Addthis Media Contact Bill Taylor 803-952-8564 bill.taylor@srs.gov Aiken, SC -- The Department of Energy's (DOE) Savannah River Operations Office today exercised its option to extend the current Savannah River Site Management and Operating contract with Savannah River Nuclear Solutions, LLC (SRNS) for an additional 38 months, from August 1, 2013 to September 2016. The SRNS contract was competatviely awareded January 10, 2008. The total value of the SRNS contract with the extension is approximately $8 billion. The current contract provides for management and operations of Savannah


Preliminary Notice of Violation, Savannah River Nuclear Solutions, LLC -  

Broader source: Energy.gov (indexed) [DOE]

2-04 2-04 Preliminary Notice of Violation, Savannah River Nuclear Solutions, LLC - WEA-2012-04 November 9, 2012 Issued to Savannah River Nuclear Solutions (SRNS), LLC, related to a Worker Fall from a Scaffold in the K-Area Complex at the Savannah River Site This letter refers to the U.S. Department of Energy (DOE) Office of Health, Safety and Security's Office of Enforcement and Oversight investigation into the facts and circumstances associated with a worker fall from a Tele-Tower® Adjustable Work Platform in the K-Area Complex at the Savannah River Site on July 1, 2011. The results of DOE's investigation were provided to Savannah River Nuclear Solutions, LLC (SRNS) in an investigation report dated May 8, 2012. An enforcement conference was held on June 27, 2012, with you and members of your staff to discuss the


DOE Selects Savannah River Nuclear Solutions, LLC to Manage and Operate its  

Broader source: Energy.gov (indexed) [DOE]

DOE Selects Savannah River Nuclear Solutions, LLC to Manage and DOE Selects Savannah River Nuclear Solutions, LLC to Manage and Operate its Savannah River Site DOE Selects Savannah River Nuclear Solutions, LLC to Manage and Operate its Savannah River Site January 10, 2007 - 10:24am Addthis WASHINGTON, DC - The U.S. Department of Energy (DOE) today announced that Savannah River Nuclear Solutions (SRNS), LLC has been selected as the management and operating contractor for DOE's Savannah River Site (SRS) in Aiken, South Carolina. The contract is a cost-plus award-fee contract valued at approximately $800 million per year and is for a five-year base period with the option to extend it for up to five additional years. SRNS is a limited liability corporation consisting of Fluor Federal Services, Inc., Honeywell International, Inc., and Newport News


DOE Selects Savannah River Nuclear Solutions, LLC to Manage and Operate its  

Broader source: Energy.gov (indexed) [DOE]

Savannah River Nuclear Solutions, LLC to Manage and Savannah River Nuclear Solutions, LLC to Manage and Operate its Savannah River Site DOE Selects Savannah River Nuclear Solutions, LLC to Manage and Operate its Savannah River Site January 10, 2007 - 10:24am Addthis WASHINGTON, DC - The U.S. Department of Energy (DOE) today announced that Savannah River Nuclear Solutions (SRNS), LLC has been selected as the management and operating contractor for DOE's Savannah River Site (SRS) in Aiken, South Carolina. The contract is a cost-plus award-fee contract valued at approximately $800 million per year and is for a five-year base period with the option to extend it for up to five additional years. SRNS is a limited liability corporation consisting of Fluor Federal Services, Inc., Honeywell International, Inc., and Newport News


Department of Energy Cites Savannah River Nuclear Solutions, LLC for Worker  

Broader source: Energy.gov (indexed) [DOE]

Solutions, LLC Solutions, LLC for Worker Safety and Health Violations Department of Energy Cites Savannah River Nuclear Solutions, LLC for Worker Safety and Health Violations November 9, 2012 - 5:50pm Addthis News Media Contact (202) 586-4940 WASHINGTON - The U.S. Department of Energy has issued a Preliminary Notice of Violation (PNOV) to Savannah River Nuclear Solutions, LLC (SRNS) for violations of the Department's worker safety and health regulations. The violations are associated with a July 1, 2011, incident that occurred while a worker was using a Tele-Tower® scaffold to perform facility modifications in the Purification Area Vault of Building 105-K in the K-Area Complex at the Savannah River Site (SRS). The SRNS worker fell from the scaffold and was hospitalized with injuries to his head and


Preliminary Notice of Violation,Savannah River Nuclear Solutions, LLC -  

Broader source: Energy.gov (indexed) [DOE]

Savannah River Nuclear Solutions, Savannah River Nuclear Solutions, LLC - NEA-2011-02 Preliminary Notice of Violation,Savannah River Nuclear Solutions, LLC - NEA-2011-02 July 22, 2011 Preliminary Notice of Violation issued to Savannah River Nuclear Solutions, LLC related to a Puncture Wound Injury resulting in a Radiological Uptake at the Savannah River Site This letter refers to the Office of Health, Safety and Security's Office of Enforcement and Oversight investigation into the facts and circumstances associated with the June 14, 2010, employee puncture wound injury, which occurred in the F-TRU Remediation Enclosure within the F-Canyon Facility, at the U.S. Department of Energy' s (DOE) Savannah River Site. This occurrence was reported in Noncompliance Tracking System (NTS) report NTS-SRSO--SRNS-CPWM-20IO-0002, Contaminated Puncture Wound During TRU Drum

Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Dr. Terry Michalske SRNS Executive Vice President and SRNL Director  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Dr. Terry Michalske Dr. Terry Michalske SRNS Executive Vice President and SRNL Director Dwayne Wilson SRNS President and CEO Dr. David Moody Manager, DOE-Savannah River 2013 Research and Technology Recognition P A T E N T S * L I C E N S E S * C R A D A S * A W A R D S * L A B O R A T O R Y D I R E C T O R A W A R D S * F E L L O W S "What we are celebrating is really the heart and core of SRS. It is that spirit of finding new solutions, new ways to address problems, integrated with a wide set of capabilities at the Savannah River Site, that allows us to solve really big challenges for the nation." "Recognizing these people is important as is congratulating them on the strengths and longevity they are placing in the Savannah River National Laboratory." "This is a night for the inventors, a night to recognize their


from Savannah River Nuclear Solutions, LLC NEWS Mobility Impaired Hunters Seek Trophy Buck at SRS  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Mobility Impaired Hunters Seek Trophy Buck at SRS Mobility Impaired Hunters Seek Trophy Buck at SRS SRNS manages hunt, providing an opportunity of a lifetime AIKEN, S.C. (Sept. 17, 2012) - Twenty-five physically disabled hunters participated today in the twelfth annual "Deer Hunt for Mobility-Impaired Hunters" at the Savannah River Site, Aiken, S.C. Mobility-impaired hunters from throughout the southeast, and as far as Ohio, met Friday, Nov. 16, at the Savannah River Ecology Lab (SREL) Conference Center to begin the two day hunt. "The Site is a prime location to conduct this type of hunt and we are fortunate to be a part of such a special event," said Ed Spears, Savannah River Nuclear Solutions, LLC (SRNS) Deer Hunt Manager. "This hunt specifically is special because it is a unique opportunity for


Principal Media Contact: DT Townsend Savannah River Nuclear Solutions, LLC  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Over 7,000 Area Students Attend College Night 2013 Over 7,000 Area Students Attend College Night 2013 Greatly exceeds last year's attendance as $15,000 in scholarships were awarded to area students AAiken, S.C., (Sept. 13, 2013) - Over 7,000 high school students and educators from the greater Aiken-Augusta area recently met with recruiters from more than 150 colleges and universi- ties during this year's CSRA College Night. "We were thrilled with this year's attendance," said Gladys Moore, Program Coordinator, Savannah River Nuclear Solutions, LLC (SRNS). "We broke last year's attendance by more than one thousand students. At times, the arena was packed, wall to wall, with enthusiastic students eager to obtain much needed information." A large number of College Night volun- teers are employees working at the U.S.


Is Nuclear Energy the Solution?  

E-Print Network [OSTI]

009-0270-y Is Nuclear Energy the Solution? Milton H. Saier &in the last 50 years, nuclear energy subsidies have totaledadministration, the Global Nuclear Energy Partnership (GNEP)

Saier, Milton H.; Trevors, Jack T.



Dwayne Wilson SRNS President and CEO  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

commonly employed through the government for detection of nuclear forensically- relevant isotope ratios of uranium and plutonium among other elements. The goal of this work is to...


from Savannah River Nuclear Solutions, LLC NEWS Savannah River Tritium Enterprise Achieves High Marks for  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Tritium Enterprise Achieves High Marks for Tritium Enterprise Achieves High Marks for Support to Nation's Security Fiscal Year 2012 Performance Prepares Enterprise for Continued Service AIKEN, S.C. (February 7, 2013) - The National Nuclear Security Administration (NNSA) has rated the Savannah River Tritium Enterprise's overall Fiscal Year 2012 performance as "excel- lent," meaning that the Savannah River Site's tritium-related work has once again success- fully met and exceeded NNSA's Defense Programs goals. The Savannah River Tritium Enterprise (SRTE), which is managed for NNSA by Savannah River Nuclear Solutions (SRNS), earned the rating for its successful performance of the four missions it carries out in support of the nation's security: tritium supply, nuclear stockpile maintenance,


Is Nuclear Energy the Solution?  

E-Print Network [OSTI]

10.1007/s11270-009-0270-y Is Nuclear Energy the Solution?MHS) attended a lecture on “Nuclear Responsibility” on theof the Alliance for Nuclear Responsibility. The information

Saier, Milton H.; Trevors, Jack T.



from Savannah River Nuclear Solutions, LLC NEWS Area High School Teams Compete during DOE's National Science  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

High School Teams Compete during DOE's National Science High School Teams Compete during DOE's National Science Bowl® Regional Championship: Lakeside and Evans High School Finish Second and Third - Dorman Wins AIKEN, S.C. - Feb. 25, 2013 - Using a format similar to the television show "Jeopardy," America's next generation of scientists and engineers put their knowledge to the test at the University of South Carolina Aiken during the DOE National Science Bowl regional compe- tition this past weekend. High School teams from across South Carolina and the greater Augusta, Ga. area relied on their collective knowledge as they participated in one of the coun- try's largest science tournaments. This regional competition, managed by Savannah River Nuclear Solutions, LLC (SRNS), hosted 120 high school students from 12 high schools. It is the only educational event


from Savannah River Nuclear Solutions, LLC NEWS D Area Powerhouse Retired after Nearly 60 Years of Service  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

D Area Powerhouse Retired after Nearly 60 Years of Service D Area Powerhouse Retired after Nearly 60 Years of Service Huge, 1950s era, power and steam generating plant nearing end of mission AIKEN, S.C. - (May 22, 2012) - As Savannah River Nuclear Solutions, LLC (SRNS) em- braces new, clean and highly efficient power generation technology, the massive 1950s era powerhouse in D Area has been shut down after decades of service at the Savannah River Site (SRS). At one time, this coal-powered facility was capable of generating 75 million watts of power, enough electricity to support the entire city of Aiken, S.C. However, those days have passed and the 280,000 square-foot, five story building is being prepared for deactivation. "Recent startup of three new wood-chip burning (biomass) steam plants at SRS means we


Nuclear waste solutions  

DOE Patents [OSTI]

High efficiency removal of technetium values from a nuclear waste stream is achieved by addition to the waste stream of a precipitant contributing tetraphenylphosphonium cation, such that a substantial portion of the technetium values are precipitated as an insoluble pertechnetate salt.

Walker, Darrel D. (1684 Partridge Dr., Aiken, SC 29801); Ebra, Martha A. (129 Hasty Rd., Aiken, SC 29801)



Microsoft Word - 2008 SRNS Funding Notice 2.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

008 ANNUAL FUNDING NOTICE 008 ANNUAL FUNDING NOTICE Savannah River Nuclear Solutions, LLC Multiple Employer Pension Plan Introduction This notice includes important funding information about your pension plan ("the Plan"). This notice also provides a summary of federal rules governing the termination of single-employer defined benefit pension plans and of benefit payments guaranteed by the Pension Benefit Guaranty Corporation (PBGC), a federal agency. This notice is for the plan year beginning 1/1/2008 and ending 12/31/2008 ("Plan Year"). Funding Target Attainment Percentage The funding target attainment percentage of a plan is a measure of how well the plan is funded on a particular date. This percentage for a plan year is obtained by dividing the Plan's Net Plan Assets by Plan Liabilities on the


Principal Media Contact: DT Townsend Savannah River Nuclear Solutions...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

an extensive job shadowing experience for Kazen, Ledbetter also conducts tours for job candidates considering a career at SRNS in the area of engineering. "I love working...


Savannah River Nuclear Solutions, LLC Preliminary Notice of Violation  

Office of Environmental Management (EM)

noncompliances, and demonstrated a commitment to improving its work planning and control process. Additionally, SRNS implemented a safety improvement program intended to...


Is Nuclear Energy the Solution?  

Science Journals Connector (OSTI)

In the event of a major radioactive release from a nuclear power plant, public opinion would likely react strongly against nuclear power...

Milton H. Saier; Jack T. Trevors



Department of Energy Cites Savannah River Nuclear Solutions for...  

Broader source: Energy.gov (indexed) [DOE]

Savannah River Nuclear Solutions for Worker Safety and Health Violations Department of Energy Cites Savannah River Nuclear Solutions for Worker Safety and Health Violations October...


Savannah River Site Land Use Plan - May, 2013 i SRNS-RP-2013-00162  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Savannah River Site Land Use Plan - May, 2013 i Savannah River Site Land Use Plan - May, 2013 i SRNS-RP-2013-00162 Savannah River Site Land Use Plan - May, 2013 i Table of Contents 1.0 - Purpose p1 2.0 - Executive Summary p1 3.0 - SRS Land Use Overview p5 Assumptions Current Land Use Leases, Transfers and Other Land Use Actions Future Land Use Land Use Issues 4.0 - Land Use Planning and Control for Existing Missions p13 Cleanup, Production and Support Missions Natural and Cultural Resource Management 5.0 - Process for Future Land Use Changes p15 Introduction Process Overview Process Description 6.0 - Summary p19 7.0 - References p20 8.0 - Acronyms p21 Savannah River Site Land Use Plan - May, 2013 i


FY 2009 Savannah River Nuclear Solutions, LLC, PER Summary |...  

National Nuclear Security Administration (NNSA)

Savannah River Nuclear Solutions, LLC, PER Summary | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing...


Department of Energy Cites Savannah River Nuclear Solutions,...  

Energy Savers [EERE]

Solutions, LLC for Worker Safety and Health Violations Department of Energy Cites Savannah River Nuclear Solutions, LLC for Worker Safety and Health Violations November 9, 2012 -...


Savannah River Nuclear Solutions awards family scholarships | National  

National Nuclear Security Administration (NNSA)

Savannah River Nuclear Solutions awards family scholarships | National Savannah River Nuclear Solutions awards family scholarships | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Home > NNSA Blog > Savannah River Nuclear Solutions awards family scholarships Savannah River Nuclear Solutions awards family scholarships Posted By Office of Public Affairs Savannah River Nuclear Solutions awards family scholarships


Nuclear Power No Solution to the Climate Crisis  

E-Print Network [OSTI]

Nuclear Power No Solution to the Climate Crisis Michael Mariotte Nuclear Information and Resource-12, 2009 #12;Environmental Statement on Nuclear Power and the Climate Crisis "We do not support emissions than nuclear power." Signed by 483 US organizations, 164 int'l organizations and 10

Laughlin, Robert B.

Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


FY 2010 Savannah River Nuclear Solutions, LLC, PER Summary | National  

National Nuclear Security Administration (NNSA)

Savannah River Nuclear Solutions, LLC, PER Summary | National Savannah River Nuclear Solutions, LLC, PER Summary | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog FY 2010 Savannah River Nuclear Solutions, LLC, PER Summary Home > About Us > Our Operations > Acquisition and Project Management > Performance Evaluations > FY 2010 Savannah River Nuclear Solutions, LLC,


FY 2012 Savannah River Nuclear Solutions, LLC, PER Summary | National  

National Nuclear Security Administration (NNSA)

Savannah River Nuclear Solutions, LLC, PER Summary | National Savannah River Nuclear Solutions, LLC, PER Summary | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog FY 2012 Savannah River Nuclear Solutions, LLC, PER Summary Home > About Us > Our Operations > Acquisition and Project Management > Performance Evaluations > FY 2012 Savannah River Nuclear Solutions, LLC,


Savannah River Nuclear Solutions Celebrates Nuclear Science Week...  

National Nuclear Security Administration (NNSA)

Celebrates Nuclear Science Week With Students | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing...


Preliminary Notice of Violation, Savannah River Nuclear Solutions, LLC -  

Broader source: Energy.gov (indexed) [DOE]

Preliminary Notice of Violation, Savannah River Nuclear Solutions, Preliminary Notice of Violation, Savannah River Nuclear Solutions, LLC - WEA-2010-05 Preliminary Notice of Violation, Savannah River Nuclear Solutions, LLC - WEA-2010-05 October 7, 2010 Preliminary Notice of Violation issued to Savannah River Nuclear Solutions, LLC related to a Nitric Acid Spill Event and an Electrical Arc Flash Injury Event at the Savannah River Site This letter refers to the Office of Health, Safety and Security's Office of Enforcement investigation into the facts and circumstances surrounding the nitric acid spill event that occurred in F Area on August 18, 2009, and the electrical arc flash injury that occurred in the D Area powerhouse on September 23, 2009, at the Savannah River Site. Based on an evaluation of the evidence in this matter, the U.S. Department of Energy (DOE) has


DOE Cites Washington TRU Solutions for Nuclear Safety Violations |  

Broader source: Energy.gov (indexed) [DOE]

Washington TRU Solutions for Nuclear Safety Violations Washington TRU Solutions for Nuclear Safety Violations DOE Cites Washington TRU Solutions for Nuclear Safety Violations December 22, 2005 - 4:53pm Addthis WASHINGTON, D.C. -- The Department of Energy (DOE) today notified Washington TRU Solutions (WTS) that it will fine the company $192,500 for violations of the department's nuclear safety requirements. The Preliminary Notice of Violation (PNOV) issued today cites a number of deficiencies that led to a series of low-level plutonium uptakes by workers at a WTS mobile facility (MOVER) stationed at the Lawrence Livermore National Laboratory (LLNL) in Livermore, Calif. The violations reflected WTS' limited understanding of the design and operational limitations of the MOVER facility, a portable waste processing facility designed to be


Method for cleaning solution used in nuclear fuel reprocessing  

DOE Patents [OSTI]

Nuclear fuel processing solution consisting of tri-n-butyl phosphate and dodecane, with a complex of uranium, plutonium, or zirconium and with a solvent degradation product such as di-n-butyl phosphate therein, is contacted with an aqueous solution of a salt formed from hydrazine and either a dicarboxylic acid or a hydroxycarboxylic acid, thereby removing the aforesaid complex from the processing solution.

Tallent, O.K.; Crouse, D.J.; Mailen, J.C.



Savannah River Nuclear Solutions, LLC Preliminary Notice of Violation  

Broader source: Energy.gov (indexed) [DOE]

CERTIFIED MAIL CERTIFIED MAIL RETURN RECEIPT REQUESTED Garry W. Flowers President and Chief Executive Officer Savannah River Nuclear Solutions, LLC 6160 Executive Woodside Court Aiken, South Carolina 29803 WEA-2010-05 Dear Mr. Flowers: This letter refers to the Office of Health, Safety and Security's Office of Enforcement investigation into the facts and circumstances surrounding the nitric acid spill event that occurred in F Area on August 18,2009, and the electrical arc flash injury that occurred in the D Area powerhouse on September 23,2009, at the Savannah River Site. Based on an evaluation of the evidence in this matter, the U.S. Department of Energy (DOE) has concluded that violations of 10 C.F.R Part 851, Worker Safety and Health Program, by Savannah River Nuclear Solutions,


Principal Media Contact: DT Townsend Savannah River Nuclear Solutions, LLC  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

NNSA Honors 41 Savannah River Site Employees with Defense NNSA Honors 41 Savannah River Site Employees with Defense Programs Awards of Excellence AIKEN, S.C. (September 20, 2013) - Forty-one Savannah River Nuclear Solutions employ- ees were honored for excellence in support of the National Nuclear Security Administration's Defense Programs. Doug Dearolph, manager of the NNSA Savannah River Field Office presented NNSA Defense Programs Awards of Excellence to one individual and two teams for their "signif- icant achievement in quality, productivity, cost savings, safety, or creativity in support of NNSA's nuclear weapons program." Honorees included Rick Poland of Savannah River National Laboratory, the Tritium Control Room Operator Training Team, and the B83 Alt 353 Implementation Team. Poland was honored for his multi-year work as Director of the Federal Working Group on


Preliminary Notice of Violation, Savannah River Nuclear Solutions, LLC- WEA-2010-05  

Broader source: Energy.gov [DOE]

Issued to Savannah River Nuclear Solutions, LLC related to a Nitric Acid Spill Event and an Electrical Arc Flash Injury Event at the Savannah River Site


Principal Media Contact: DT Townsend Savannah River Nuclear Solutions...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Fluor-led company whose members are Fluor Federal Services, Newport News Nuclear and Honeywell, responsible for the management and operations of the Department of Energy's...


Nuclear magnetic resonance studies of drug-nucleic acid interactions at the synthetic DNA level in solution  

Science Journals Connector (OSTI)

Nuclear magnetic resonance studies of drug-nucleic acid interactions at the synthetic DNA level in solution ...

Dinshaw J. Patel



Treatment of Nuclear Waste Solutions Using a New Class of Extractants: Pentaalkyl Propane Diamides  

Science Journals Connector (OSTI)

A new class of bifunctional extractants pentaalkyl propane diamides is studied in order to extract trivalent cations (Am3+, Cm3+…) and other actinides contained in waste solutions of nuclear industry. These solve...

C. Cuillerdier; C. Musikas; P. Hoel



Surfactant based imbibition and induced solution gas drive process: investigation by nuclear magnetic resonance  

E-Print Network [OSTI]


Cox, James Calvin



Standard test methods for chemical, mass spectrometric, spectrochemical, nuclear, and radiochemical analysis of nuclear-grade plutonium nitrate solutions  

E-Print Network [OSTI]

1.1 These test methods cover procedures for the chemical, mass spectrometric, spectrochemical, nuclear, and radiochemical analysis of nuclear-grade plutonium nitrate solutions to determine compliance with specifications. 1.2 The analytical procedures appear in the following order: Sections Plutonium by Controlled-Potential Coulometry Plutonium by Amperometric Titration with Iron(II) Plutonium by Diode Array Spectrophotometry Free Acid by Titration in an Oxalate Solution 8 to 15 Free Acid by Iodate Precipitation-Potentiometric Titration Test Method 16 to 22 Uranium by Arsenazo I Spectrophotometric Test Method 23 to 33 Thorium by Thorin Spectrophotometric Test Method 34 to 42 Iron by 1,10-Phenanthroline Spectrophotometric Test Method 43 to 50 Impurities by ICP-AES Chloride by Thiocyanate Spectrophotometric Test Method 51 to 58 Fluoride by Distillation-Spectrophotometric Test Method 59 to 66 Sulfate by Barium Sulfate Turbidimetric Test Method 67 to 74 Isotopic Composition by Mass Spectrom...

American Society for Testing and Materials. Philadelphia



Analysis of zero-frequency solutions of the pion dispersion equation in nuclear matter  

E-Print Network [OSTI]

In this paper we consider instability of nuclear matter which takes place when the frequencies of the collective excitations turn to zero. We investigate collective excitations with pion quantum numbers J^\\pi=0^-. We study the dependence of zero-frequency solutions of the pion dispersion equation on the value of the spin-isospin quasiparticle interaction G'. The solutions of the pion dispersion equation describe the different types of the excitations in the matter, \\omega_i(k). At the critical density \\rho=\\rho_c one of solutions of the definite type turns to zero: \\omega_{i0}(k_c)=0. When \\rho>\\rho_c, the excitations \\omega_{i0}(k) become amplified. It is shown that there is such a "transitional" value of G'=G'_{tr} that for G'G'_{tr} they pertain to the type \\omega_c. The solutions of the type \\omega_{sd} correspond to instability to small density fluctuations of the nuclear matter at G'\\le -1. On the other hand, \\omega_c is responsible for the "pion condensation" at G'\\approx 2. For the stable nuclear matter the branches of solutions \\omega_{sd}(k) and \\omega_c(k) are located on the unphysical sheets of the complex plane of frequency.

V. A. Sadovnikova



Standard test methods for chemical, mass spectrometric, spectrochemical, nuclear, and radiochemical analysis of nuclear-grade uranyl nitrate solutions  

E-Print Network [OSTI]

1.1 These test methods cover procedures for the chemical, mass spectrometric, spectrochemical, nuclear, and radiochemical analysis of nuclear-grade uranyl nitrate solution to determine compliance with specifications. 1.2 The analytical procedures appear in the following order: Sections Determination of Uranium 7 Specific Gravity by Pycnometry 15-20 Free Acid by Oxalate Complexation 21-27 Determination of Thorium 28 Determination of Chromium 29 Determination of Molybdenum 30 Halogens Separation by Steam Distillation 31-35 Fluoride by Specific Ion Electrode 36-42 Halogen Distillate Analysis: Chloride, Bromide, and Iodide by Amperometric Microtitrimetry 43 Determination of Chloride and Bromide 44 Determination of Sulfur by X-Ray Fluorescence 45 Sulfate Sulfur by (Photometric) Turbidimetry 46 Phosphorus by the Molybdenum Blue (Photometric) Method 54-61 Silicon by the Molybdenum Blue (Photometric) Method 62-69 Carbon by Persulfate Oxidation-Acid Titrimetry 70 Conversion to U3O8 71-74 Boron by ...

American Society for Testing and Materials. Philadelphia



from Savannah River Nuclear Solutions, LLC NEWS SRS Employees Donate Food to Golden Harvest Food Bank  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Employees Donate Food to Golden Harvest Food Bank Employees Donate Food to Golden Harvest Food Bank AIKEN, S.C. - (June 7, 2012) Today, the Savannah River Site (SRS) donated $22,000 and 18,000 pounds of food during its annual food drive for the Golden Harvest Food Bank. Several SRS organizations participated in this food drive-Savannah River Nuclear Solutions, Savannah River Remediation, U.S. Forest Service-Savannah River, URS and WSI- Savannah River. The SRS food drive is one of Golden Harvest Food Bank's largest, local fund-raisers. According to Savannah River Nuclear Solutions, LLC President and CEO Dwayne Wilson, the Site's past food drives have collec- tively yielded over 262,475 pounds of food for Golden Harvest. "We're pleased to support Golden Harvest in their highly effective efforts as they strive


Safety of interim storage solutions of used nuclear fuel during extended term  

SciTech Connect (OSTI)

In 2013, the total amount of stored used nuclear fuel (UNF) in the world will reach 225,000 T HM. The UNF inventory in wet storage will take up over 80% of the available total spent fuel pool (SFP) capacity. Interim storage solutions are needed. They give flexibility to the nuclear operators and ensure that nuclear reactors continue to operate. However, we need to keep in mind that they are also an easy way to differ final decision and implementation of a UNF management approach (recycling or final disposal). In term of public perception, they can have a negative impact overtime as it may appear that nuclear industry may have significant issues to resolve. In countries lacking an integrated UNF management approach, the UNF are being discharged from the SFPs to interim storage (mostly to dry storage) at the same rate as UNF is being discharged from reactors, as the SFPs at the reactor sites are becoming full. This is now the case in USA, Taiwan, Switzerland, Spain, South Africa and Germany. For interim storage, AREVA has developed different solutions in order to allow the continued operation of reactors while meeting the current requirements of Safety Authorities: -) Dry storage canisters on pads, -) Dual-purpose casks (dry storage and transportation), -) Vault dry storage, and -) Centralized pool storage.

Shelton, C.; Bader, S.; Issard, H.; Arslan, M. [AREVA, 7135 Minstrel Way, Suite 300 Columbia, MD 21045 (United States)




SciTech Connect (OSTI)

High-level nuclear waste produced from fuel reprocessing operations at the Savannah River Site (SRS) requires pretreatment to remove {sup 137}Cs, {sup 90}Sr and alpha-emitting radionuclides (i.e., actinides) prior to disposal. Separation processes planned at SRS include caustic side solvent extraction, for {sup 137}Cs removal, and ion exchange/sorption of {sup 90}Sr and alpha-emitting radionuclides with an inorganic material, monosodium titanate (MST). The predominant alpha-emitting radionuclides in the highly alkaline waste solutions include plutonium isotopes {sup 238}Pu, {sup 239}Pu and {sup 240}Pu. This paper provides a summary of data acquired to measure the performance of MST to remove strontium and actinides from simulated waste solutions. These tests evaluated the influence of ionic strength, temperature, solution composition and the oxidation state of plutonium.




Fusion solution to dispose of spent nuclear fuel, transuranic elements, and highly enriched uranium  

Science Journals Connector (OSTI)

The disposal of the nuclear spent fuel, the transuranic elements, and the highly enriched uranium represents a major problem under investigation by the international scientific community to identify the most promising solutions. The investigation of this paper focused on achieving the top rated solution for the problem, the elimination goal, which requires complete elimination for the transuranic elements or the highly enriched uranium, and the long-lived fission products. To achieve this goal, fusion blankets with liquid carrier, molten salts or liquid metal eutectics, for the transuranic elements and the uranium isotopes are utilized. The generated energy from the fusion blankets is used to provide revenue for the system. The long-lived fission products are fabricated into fission product targets for transmutation utilizing the neutron leakage from the fusion blankets. This paper investigated the fusion blanket designs for small fusion devices and the system requirements for such application. The results show that 334 MW of fusion power from D–T plasma for 30 years with an availability factor of 0.75 can dispose of the 70,000 tons of the U.S. inventory of spent nuclear fuel generated up to the year 2015. In addition, this fusion solution eliminates the need for a geological repository site, which is a major advantage. Meanwhile, such utilization of the fusion power will provide an excellent opportunity to develop fusion energy for the future.

Yousry Gohar


Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


A general numerical solution of dispersion relations for the nuclear optical model  

E-Print Network [OSTI]

A general numerical solution of the dispersion integral relation between the real and the imaginary parts of the nuclear optical potential is presented. Fast convergence is achieved by means of the Gauss-Legendre integration method, which offers accuracy, easiness of implementation and generality for dispersive optical model calculations. The use of this numerical integration method in the optical-model parameter search codes allows for a fast and accurate dispersive analysis. PACS number(s): 11.55.Fv, 24.10.Ht, 02.60.Jh

Roberto Capote; Alberto Molina; Jose Manuel Quesada



Americium/Lanthanide Separations in Alkaline Solutions for Advanced Nuclear Fuel Cycles  

SciTech Connect (OSTI)

Project goals: Can used nuclear fuel be partitioned by dissolution in alkaline aqueous solution to give a solution of uranium, neptunium, plutonium, americium and curium and a filterable solid containing nearly all of the lanthanide fission products and certain other fission products? What is the chemistry of Am/Cm/Ln in oxidative carbonate solutions? Can higher oxidation states of Am be stabilized and exploited? Conclusions: Am(VI) is kinetically stable in 0.5-2.0 M carbonate solutions for hours. Aliquat 336 in toluene has been successfully shown to extract U(VI) and Pu(VI) from carbonate solutions. (Stepanov et al 2011). Higher carbonate concentration gives lower D, SF{sub U/Eu} for = 4 in 1 M K{sub 2}CO{sub 3}. Experiments with Am(VI) were unsuccessful due to reduction by the organics. Multiple sources of reducing organics...more optimization. Reduction experiments of Am(VI) in dodecane/octanol/Aliquat 336 show that after 5 minutes of contact, only 30-40% of the Am(VI) has been reduced. Long enough to perform an extraction. Shorter contact times, lower T, and lower Aliquat 336 concentration still did not result in any significant extraction of Am. Anion exchange experiments using a strong base anion exchanger show uptake of U(VI) with minimal uptake of Nd(III). Experiments with Am(VI) indicate Am sorption with a Kd of 9 (10 minute contact) but sorption mechanism is not yet understood. SF{sub U/Nd} for = 7 and SF{sub U/Eu} for = 19 after 24 hours in 1 M K{sub 2}CO{sub 3}.

Goff, George S. [Los Alamos National Laboratory; Long, Kristy Marie [Los Alamos National Laboratory; Reilly, Sean D. [Los Alamos National Laboratory; Jarvinen, Gordon D. [Los Alamos National Laboratory; Runde, Wolfgang H. [Los Alamos National Laboratory



Corrosion property of 9Cr-ODS steel in nitric acid solution for spent nuclear fuel reprocessing  

SciTech Connect (OSTI)

Corrosion tests of oxide dispersion strengthened with 9% Cr (9Cr-ODS) steel, which is one of the desirable materials for cladding tube of sodium-cooled fast reactors, in pure nitric acid solution, spent FBR fuel solution, and its simulated solution were performed to understand the corrosion behavior in a spent nuclear fuel reprocessing. In this study, the 9Cr-ODS steel with lower effective chromium content was evaluated to understand the corrosion behavior conservatively. As results, the tube-type specimens of the 9Cr-ODS steels suffered severe weight loss owing to active dissolution at the beginning of the immersion test in pure nitric acid solution in the range from 1 to 3.5 M. In contrast, the weight loss was decreased and they showed a stable corrosion in the higher nitric acid concentration, the dissolved FBR fuel solution, and its simulated solution by passivation. The corrosion rates of the 9Cr-ODS steel in the dissolved FBR fuel solution and its simulated solution were 1-2 mm/y and showed good agreement with each other. The passivation was caused by the shift of corrosion potential to noble side owing to increase in nitric acid concentration or oxidative ions in the dissolved FBR fuel solution and the simulated spent fuel solution. (authors)

Takeuchi, M.; Koizumi, T. [Japan Atomic Energy Agency, Tokai-mura, Naka-gun, Ibaraki 319-1195 (Japan); Inoue, M.; Koyama, S.I. [Japan Atomic Energy Agency, Oarai-machi, Higashi-ibaraki-gun, Ibaraki 311-1393 (Japan)




Broader source: Energy.gov (indexed) [DOE]



Nuclear spin relaxation of sodium cations in bacteriophage Pf1 solutions D. N. Sobieski, N. R. Krueger, S. Vyas,a  

E-Print Network [OSTI]

Nuclear spin relaxation of sodium cations in bacteriophage Pf1 solutions D. N. Sobieski, N. R The nuclear magnetic resonance NMR spectra for the I=3/2 23 Na cation dissolved into filamentous bacteriophage the 23 Na nuclear quadrupole moment and the electric field gradient produced by the negatively charged Pf

Augustine, Mathew P.


Numerical solution for stochastic point-kinetics equations with sinusoidal reactivity in dynamical system of nuclear reactor  

Science Journals Connector (OSTI)

In this present analysis, the numerical simulation methods are applied to calculate the solution for stochastic point-kinetic equations with sinusoidal reactivity in dynamical system of nuclear reactor. The resulting system of differential equations is solved for each time step-size. Using experimental data, the methods are investigated over initial conditions and with sinusoidal reactivity. The computational results designate that these numerical approximation methods are straightforward, effective and easy for solving stochastic point-kinetic equations.

S. Saha Ray; A. Patra



EM Develops Database for Efficient Solutions to Nuclear Cleanup Challenges Across Complex  

Broader source: Energy.gov [DOE]

WASHINGTON, D.C. – Many deactivation and decommissioning (D&D) projects across the EM complex require robotic and remote handling systems to protect workers during nuclear cleanup operations.



SciTech Connect (OSTI)

The evaporator recycle streams of nuclear waste tanks may contain waste in a chemistry and temperature regime that exceeds the current corrosion control program, which imposes temperature limits to mitigate caustic stress corrosion cracking (CSCC). A review of the recent service history found that two of these A537 carbon steel tanks were operated in highly concentrated hydroxide solution at high temperature. Visual inspections, experimental testing, and a review of the tank service history have shown that CSCC has occurred in uncooled/un-stress relieved tanks of similar construction. Therefore, it appears that the efficacy of stress relief of welding residual stress is the primary corrosion-limiting mechanism. The objective of this experimental program is to test A537 carbon steel small scale welded U-bend specimens and large welded plates (30.48 x 30.38 x 2.54 cm) in a caustic solution with upper bound chemistry (12 M hydroxide and 1 M each of nitrate, nitrite, and aluminate) and temperature (125 C). These conditions simulate worst-case situations in these nuclear waste tanks. Both as-welded and stress-relieved specimens have been tested. No evidence of stress corrosion cracking was found in the U-bend specimens after 21 days of testing. The large plate test was completed after 12 weeks of immersion in a similar solution at 125 C except that the aluminate concentration was reduced to 0.3 M. Visual inspection of the plate revealed that stress corrosion cracking had not initiated from the machined crack tips in the weld or in the heat affected zone. NDE ultrasonic testing also confirmed subsurface cracking did not occur. Based on these results, it can be concluded that the environmental condition of these tests was unable to develop stress corrosion cracking within the test periods for the small welded U-bends and for the large plates, which were welded with an identical procedure as used in the construction of the actual nuclear waste tanks in the 1960s. The absence of evidence of stress corrosion cracking and general corrosion in the laboratory-scaled specimens indicate that this type of nuclear waste tank is not susceptible to highly caustic solutions up to 12 M hydroxide at 125 C when sufficient nitrite inhibitor is present.

Lam, P.; Stripling, C.; Fisher, D.; Elder, J.



8/25/07 11:53 PMNUCLEAR POWER:A Nuclear Solution to Climate Change? --Sailor et al. 288 (5469): 1177 --Science Page 1 of 6http://www.sciencemag.org/cgi/content/full/288/5469/1177  

E-Print Network [OSTI]

: Vol. 288. no. 5469, pp. 1177 - 1178 DOI: 10.1126/science.288.5469.1177 POLICY FORUM NUCLEAR POWER8/25/07 11:53 PMNUCLEAR POWER:A Nuclear Solution to Climate Change? -- Sailor et al. 288 (5469: A Nuclear Solution to Climate Change? William C. Sailor,* David Bodansky, Chaim Braun, Steve Fetter, Bob van

Kammen, Daniel M.


A Parallel Multi-Domain Solution Methodology Applied to Nonlinear Thermal Transport Problems in Nuclear Fuel Pins  

E-Print Network [OSTI]

This paper describes an efficient and nonlinearly consistent parallel solution methodology for solving coupled nonlinear thermal transport problems that occur in nuclear reactor applications over hundreds of individual 3D physical subdomains. Efficiency is obtained by leveraging knowledge of the physical domains, the physics on individual domains, and the couplings between them for preconditioning within a Jacobian Free Newton Krylov method. Details of the computational infrastructure that enabled this work, namely the open source Advanced Multi-Physics (AMP) package developed by the authors is described. Details of verification and validation experiments, and parallel performance analysis in weak and strong scaling studies demonstrating the achieved efficiency of the algorithm are presented. Furthermore, numerical experiments demonstrate that the preconditioner developed is independent of the number of fuel subdomains in a fuel rod, which is particularly important when simulating different types of fuel rods...

Philip, Bobby; Allu, Srikanth; Hamilton, Steven P; Sampath, Rahul S; Clarno, Kevin T; Dilts, Gary A



System and method for the analysis of one or more compounds and/or species produced by a solution-based nuclear reactor  

SciTech Connect (OSTI)

The present invention relates generally to both a system and method for determining the composition of an off-gas from a solution nuclear reactor (e.g., an Aqueous Homogeneous Reactor (AHR)) and the composition of the fissioning solution from those measurements. In one embodiment, the present invention utilizes at least one quadrupole mass spectrometer (QMS) in a system and/or method designed to determine at least one or more of: (i) the rate of production of at least one gas and/or gas species from a nuclear reactor; (ii) the effect on pH by one or more nitrogen species; (iii) the rate of production of one or more fission gases; and/or (iv) the effect on pH of at least one gas and/or gas species other than one or more nitrogen species from a nuclear reactor.

Policke, Timothy A; Nygaard, Eric T



Savannah River Nuclear Solutions S A V A N N A H R I V E R S  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Fluor-led company whose members are Fluor Federal Services, Newport News Nuclear and Honeywell, responsible for the management and operations of the Department of Energy's...


Nuclear and Particle Futures  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Nuclear and Particle Futures Nuclear and Particle Futures The Lab's four Science Pillars harness capabilities for solutions to threats- on national and global scales. Contacts...


Development of a novel solvent for the simultaneous separation of strontium and cesium from dissolved Spent Nuclear Fuel solutions  

SciTech Connect (OSTI)

The recovery of Cs and Sr from acidic solutions by solvent extraction has been investigated. The goal of this project was to develop an extraction process to remove Cs and Sr from high-level waste in an effort to reduce the heat loading in storage. Solvents for the extraction of Cs and Sr separately have been used on both caustic and acidic spent nuclear fuel waste in the past. The objective of this research was to find a suitable solvent for the extraction of both Cs and Sr simultaneously from acidic nitrate media. The solvents selected for this research possess good stability and extraction behavior when mixed together. The extraction experiments were performed with 4 ,4,(5 )-Di-(tbutyldicyclohexano)- 18-crown-6 {DtBuCH18C6}, Calix[4]arene-bis-(tert-octylbenzocrown-6) {BOBCalixC6} and 1-(2,2,3,3-tetrafluoropropoxy)-3-(4-sec-butylphenoxy)-2-propanol {Cs-7SB modifier} in a branched aliphatic kerosene {Isopar® L}. The BOBCalixC6 and Cs-7SB modifier were developed at Oak Ridge National Laboratory (ORNL) by Bonnesen et al. [1]. The values obtained from the SREX solvent for DSr in 1 M nitric acid ranged from 0.7 to 2.2 at 25oC and 10oC respectively. The values for DCs in 1 M nitric acid with the CSSX solvent ranged from 8.0 to 46.0 at 25oC and 10oC respectively. A new mixed solvent, developed at the Idaho National Engineering and Environmental Laboratory (INEEL) by Riddle et al. [2], showed distributions for Sr ranging from 8.8 to 17.4 in 1 M nitric acid at 25oC and 10oC respectively. The DCs for the mixed solvent ranged from 7.7 to 20.2 in 1 M nitric acid at 25oC to 10oC respectively. The unexpectedly high distributions for Sr at both 25oC and 10oC show a synergy in the mixed solvent. The DCs, although lower than with CSSX solvent, still showed good extraction behavior.

Catherine L. Riddle; John D. Baker; Jack D. Law; Christopher A. McGrath; David H. Meikrantz; Bruce J. Mincher; Dean R. Peterman; Terry A. Todd



Use of Noncompetitive Procurements to Obtain Services at the Savannah River Site, IG-0862  

Broader source: Energy.gov (indexed) [DOE]

Use of Noncompetitive Use of Noncompetitive Procurements to Obtain Services at the Savannah River Site DOE/IG-0862 April 2012 U.S. Department of Energy Office of Inspector General Office of Audits and Inspections Department of Energy Washington, DC 20585 April 10, 2012 MEMORANDUM FOR THE SECRETARY FROM: Gregory H. Friedman Inspector General SUBJECT: INFORMATION: Audit Report on "Use of Noncompetitive Procurements to Obtain Services at the Savannah River Site" INTRODUCTION AND OBJECTIVE Savannah River Nuclear Solutions, LLC (SRNS), assumed management and operating responsibility for the Department of Energy's Savannah River Site located near Aiken, South Carolina, in August 2008. Under its contract, SRNS is responsible for environmental cleanup,


Nuclear magnetic resonance solution structure of hirudin(1–51) and comparison with corresponding three-dimensional structures determined using the complete 65-residue hirudin polypeptide chain  

Science Journals Connector (OSTI)

The three-dimensional structure of the N-terminal 51-residue domain of recombinant hirudin in aqueous solution was determined by 1H nuclear magnetic resonance (NMR) spectroscopy, and the resulting high-quality solution structure was compared with corresponding structures obtained from studies with the intact, 65-residue polypeptide chain of hirudin. On the basis of 580 distance constraints derived from nuclear Overhauser effects and 109 dihedral angle constraints, a group of 20 conformers representing the solution structure of hirudin(1–51) was computed with the program DIANA and energyminimized with a modified version of the program AMBER. Residues 3 to 30 and 37 to 48 form a well-defined molecular core with two antiparallel ?-sheets composed of residues 14 to 16 and 20 to 22, and 27 to 31 and 36 to 40, and three reverse turns at residues 8 to 11 (type II), 17 to 20 (type II?) and 23 to 26 (type II). The average root-mean-square deviation of the individual NMR conformers relative to their mean co-ordinates is 0.38 Å for the backbone atoms and 0.77 Å for all heavy atoms of these residues. Increased structural disorder was found for the N-terminal dipeptide segment, the loop at residues 31 to 36, and the C-terminal tripeptide segment. The solution structure of hirudin(1–51) has the same molecular architecture as the corresponding polypeptide segment in natural hirudin and recombinant desulfatohirudin. It is also closely similar to the crystal structure of the N-terminal 51-residue segment of hirudin in a hirudin-thrombin complex, with root-mean-square deviations of the crystal structure relative to the mean solution structure of 0.61 Å for the backbone atoms and 0.91 Å for all heavy atoms of residues 3 to 30 and 37 to 48. Further coincidence is found for the loop formed by residues 31 to 36, which shows increased structural disorder in all available solution structures of hirudin, and of which residues 32 to 35 are not observable in the electron density map of the thrombin complex. Significant local structural differences between hirudin(1–51) in solution and hirudin in the crystalline thrombin complex were identified mainly for the N-terminal tripeptide segment and residues 17 to 21. These are further analyzed in an accompanying paper.

T. Szyperski; P. Güntert; S.R. Stone; K. Wüthrich



Solution structure of a fragment of the dimerization domain of E2F-1 determined by circular dichroism, 1H nuclear magnetic resonance and distance geometry  

Science Journals Connector (OSTI)

The structure of a synthesized peptide with the sequence GVVDLNWAAEVLKVQKRRIYDITNVLEGIQ which corresponds to residues 149–178 of transcription factor E2F-1 was determined by 1H nuclear magnetic resonance in 40% d3-TFE/water. NOE cross peaks and ?H chemical shifts indicate that the peptide consists of a helix from Ala-8 to Leu-26 in this solution. Circular dichroism measurements confirm the presence of nearly 45% helix in TFE/water solution but show no evidence of helicity in water solution of this peptide. Fifty structures were constructed with 329 upper distance limits by DIANA. The 20 best conformers show a RMSD of 0.78 Å for backbone atoms and 1.78 Å for heavy atoms from residue Ala-8 to Leu-26. This result, together with our previous work on the solution structure of a fragment of DP-1, supports the proposal that E2F-1 and DP-1 may dimerize with a coiled-coil type interaction.

Shouhong Guang; Jihui Wu; Limei Tao; Youlin Xia; Yunyu Shi



Solution of resource allocation problem for identification of cost-effective measures to reduce nuclear proliferation risks  

SciTech Connect (OSTI)

This report presents a methodology of selection of cost-effective measures to reduce nuclear proliferation risks. The methodology relies on a graded security model used in practice in different applications. The method is based on the controlled finite Markov chain approach set in combination with discrete dynamic programming and MCDM (Multi Criteria Decision Making) techniques that enables the expert to select the cost-effective measures to reduce nuclear proliferation risks depending on availability of resources. The analysis performed with different number of possible measures confirms the conclusions that the implementation of extra-large costs may not produce the required effect, and the increase in resources above a certain level does not appear sensitive. Diversification in improving the effectiveness of other measures seems more rational and efficient for the whole system than the unlimited improvement of the effectiveness of only one measure.

Andrianov, A.; Kuptsov, I. [Obninsk Institute for Nuclear Power Engineering, Studgorodok 1, Obninsk, Kaluga region 249030 (Russian Federation)



Risk-Based Remediation Approach for Cs-137 Contaminated Sediment/Soils at the Savannah River Site (SRS) Lower Three Runs Tail (U) - 13348 - SRNS-RP-2012-00546  

SciTech Connect (OSTI)

Lower Three Runs is a large blackwater stream that runs through the eastern and southern portion of the Savannah River Site. The Lower Three Runs watershed includes two SRS facility areas: P Area (P Reactor) and R Area (R Reactor) that provided effluent discharges to Lower Three Runs. During reactor operations, effluent discharges were well above natural (pre-industrial) or present day stream discharges. The watershed contains a 2,500-acre mainstream impoundment (PAR Pond), several smaller pre-cooler ponds, and a canal system that connects the pre-cooler ponds and discharges surface water to PAR Pond. From the PAR Pond dam, Lower Three Runs flows approximately 36 kilometers braiding through bottom-land/flood-plain forests before it enters the Savannah River. About eight kilometers downstream from the PAR Pond dam, the SRS boundary narrows (termed the Lower Three Runs tail) providing a limited buffer of DOE property for the Lower Three Runs stream and associated flood-plain. Previous screening characterization efforts revealed Cs-137 contamination in the sediment/soils of the flood-plain. As a part of the American Recovery and Reinvestment Act stimulus package, a comprehensive characterization effort was executed on the sediment/soils of the Lower Three Runs tail flood-plain providing a comprehensive look at the contaminant signature of the area. As a follow-up to that characterization, a regulatory decision Core Team, comprised of members of the South Carolina Department of Health and Environmental Control, Environmental Protection Agency - Region IV, and DOE, conducted negotiations on a risk-based approach to address the level of contamination found in the tail flood-plain as an early action that provided a long-term solution to exposure scenarios. For evaluation purposes, the adolescent trespasser was selected as the most likely human receptor for the Lower Three Runs tail portion because of the natural attractiveness of the area for recreational activities (i.e., hunting, fishing, hiking etc.) and access from public property. Exposure of the adolescent trespasser to Cs-137 contaminated sediment/soil at concentrations greater than 23.7 pico curies per gram have been calculated to result in an unacceptable cancer risk (> 1 x 10{sup -4}). Comparing the characterization sampling results conducted in 2009 with the benchmark concentration of 23.7 pCi/g, identified elevated risk levels along three sampling areas in the Lower Three Runs tail portion. On January 5, 2012, it was agreed by the core team that a Removal Action in the Lower Three Runs tail was to be conducted for the identified soil/sediment locations in the three identified areas that exceed the 1 x 10{sup -4} risk (23.7 pCi/g) for the adolescent trespasser receptor. The addition of Land Use Controls following the Removal Action was appropriate to protect human health and the environment. A systematic screening matrix was initiated at the identified hot spots (i.e., sampling points with Cs-137 activities greater than 23.7 pCi/g) to identify the limits of the excavation area. Sediment/soil within the defined removal areas would be excavated to the depth necessary to achieve the cleanup goal and disposed of in a CERCLA Off-Site Rule approved disposal facility. It was agreed that this removal action would adequately reduce the volume of available Cs-137 in the Lower Three Runs tail and consequently residual activities of the Cs-137 would decay over time reducing the amount of Cs-137 available in the tail which would curtail risk. The Land Use Controls consist of installation of an additional seven miles of fencing at major road crossings, utility easements, and at areas that showed a higher probability of access. In addition, signs were placed along the entire SRS perimeter of the Lower Three Runs tail approximately every 200 feet. Sign posts included both a No Trespassing sign and a Contaminant Warning sign. The project initiated a subcontract for both the removal action and the installation of fencing and signs on May 1, 2012. All field activities were completed

Freeman, Candice [Department of Energy- Savannah River Site, Aiken, SC (United States)] [Department of Energy- Savannah River Site, Aiken, SC (United States); Bergren, Christopher; Blas, Susan; Kupar, James [Area Completion Projects, Savannah River Nuclear Solutions, LLC (United States)] [Area Completion Projects, Savannah River Nuclear Solutions, LLC (United States)



Alkali metal Rankine cycle boiler technology challenges and some potential solutions for space nuclear power and propulsion applications  

SciTech Connect (OSTI)

Alkali metal boilers are of interest for application to future space Rankine cycle power conversion systems. Significant progress on such boilers was accomplished in the 1960's and early 1970's, but development was not continued to operational systems since NASA's plans for future space missions were drastically curtailed in the early 1970's. In particular, piloted Mars missions were indefinitely deferred. With the announcement of the Space Exploration Initiative (SEI) in July 1989 by President Bush, interest was rekindled in challenging space missions and, consequently in space nuclear power and propulsion. Nuclear electric propulsion (NEP) and nuclear thermal propulsion (NTP) were proposed for interplanetary space vehicles, particularly for Mars missions. The potassium Rankine power conversion cycle became of interest to provide electric power for NEP vehicles and for 'dual-mode' NTP vehicles, where the same reactor could be used directly for propulsion and (with an additional coolant loop) for power. Although the boiler is not a major contributor to system mass, it is of critical importance because of its interaction with the rest of the power conversion system; it can cause problems for other components such as excess liquid droplets entering the turbine, thereby reducing its life, or more critically, it can drive instabilities-some severe enough to cause system failure. Funding for the SEI and its associated technology program from 1990 to 1993 was not sufficient to support significant new work on Rankine cycle boilers for space applications. In Fiscal Year 1994, funding for these challenging missions and technologies has again been curtailed, and planning for the future is very uncertain. The purpose of this paper is to review the technologies developed in the 1960's and 1970's in the light of the recent SEI applications. In this way, future Rankine cycle boiler programs may be conducted most efficiently.

Stone, J.R.


Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Solution structure of a fragment of the dimerization domain of DP-1 determined by 1H-nuclear magnetic resonance and distance geometry  

Science Journals Connector (OSTI)

The structure of a synthesized peptide with the sequence of NHILPNESAYDQKNIRRRVYDALNVLMAMNIISK that corresponds to residues 151–184 of transcription factor DP-1 (Girling et al., Nature 362 (1993) 83–87) was determined by 1H-nuclear magnetic resonance in water and 40% d3-trifluoroethanol/water, respectively. Nuclear Overhauser effect cross peaks, ?H chemical shifts and J-coupling constants of ?H–NH show that the peptide consists a helix from Ser-8 to Ser-33 in solution. Fifty structures were constructed with 288 upper distance limits and 21 angle constraints by DIANA (Guntert et al., J. Mol. Biol. 217 (1991) 517–530). Although the N-terminal of the peptide exhibits a random conformation, the 20 best structures show a root mean square deviation of 0.89±0.36 Å for backbone atoms and 1.80±0.34 Å for heavy atoms from residue Ser-8 to Ser-33. This result supports the proposal that DP-1 and E2F-1 may dimerize with a coiled-coil type interaction.

Shouhong Guang; Jihui Wu; Tianning Yu; Youlin Xia; Yunyu Shi



EnergySolutions Inc | Open Energy Information  

Open Energy Info (EERE)

Salt Lake City, Utah Zip: 84101 Sector: Services Product: Utah-based international nuclear services company that provides services and solutions to the nuclear industry....


Slurry Nebulization-Inductively Coupled Plasma Mass Spectrometry with Solution Calibration for Determination of Ultratrace Boron in High Pure Nuclear Graphite Powder  

Science Journals Connector (OSTI)

Slurry nebulization-inductively coupled plasma mass spectrometry (ICP-MS) was developed for the direct determination of trace boron (B) in high-purity graphite powders. After the graphite powders were ground and sifted, the particle size of graphite was collected less than 5 ?m. Polyvinylpyrrolidone (PVP) was used as the dispersant in slurry preparation. The optimal mass ratio of PVP to the graphite was found to be 0.5. Well-proportioned and stable slurry solution was obtained by magnetic stirrer. 0.1 M NH4OH as the aqueous medium could provide the optimal pH of 10 for the stable slurry and eliminate the memory effect of B. ICP-MS was operated in a higher resolution mode (0.6 amu) to eliminate the interference with the matrix 12C by peak tailing. Oxygen was added into the plasma at a flow rate of 60 mL min?1 to resolve carbon deposition on the sampler and skimmer cones and accelerate particle dissociation in the plasma. External calibration with aqueous solution standards was established for quantification. Beryllium was chosen as the internal standard to evaluate the efficiency of matrix effect correction. A correlation coefficient of 0.9995 was obtained for B concentration ranging 2–200 ?g L?1. The detection limit (3S) of B was 0.095 ?g g?1. As a practical application, the proposed method was used for the determination of trace B in four nuclear graphite samples (claimed 99.999% purity), with the satisfactory recoveries for the spike tests in the range of 97.2%–103.1%.

Xin-Li LIU; Tai-Cheng DUAN; Yi HAN; Xiao-Yu JIA; Wei-Na ZHANG; Hang-Ting CHEN



Audit Report: OAS-L-13-08 | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

8 8 Audit Report: OAS-L-13-08 April 19, 2013 Home Office Expenses Submitted by Fluor Federal Services, Inc., on Savannah River Nuclear Solutions, LLC's U.S. Department of Energy Management & Operating (M&O) Contract No. DE-AC09-08SR22470 The Department of Energy awarded Management and Operating (M&O) Contract No. DE-AC09-08SR22470 to Savannah River Nuclear Solutions, LLC (SRNS), a for-profit joint venture, established between Fluor Federal Services, Inc. (Fluor), Newport News Nuclear, Inc., and Honeywell International. SRNS commenced performance on the M&O contract on August 1, 2008. Fluor has a majority share in the joint venture. The Office of Inspector General contracted with an independent certified public accounting firm to assess the accuracy and completeness of the


S A V A N N A H R I V E R S I T E  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Orientation The Savannah River Site (SRS) Tritium Orientation The Savannah River Site (SRS) Tritium area occupies approximately 29 acres in the northwest portion of H Area. Operations began in 1955. The Tri- tium Facilities are currently operated by Savannah River Nuclear Solutions, LLC (SRNS), for the National Nuclear Security Administration (NNSA). SRS works together with seven NNSA partner sites in the U.S. Nuclear Security Enterprise (NSE) to maintain a safe and reliable nuclear stockpile. The SRNS personnel have a long history of outstanding performance in safe, secure, disciplined, and compliant operations, consistently delivering high-quality products to our customers on schedule. Missions SRS is committed to continued excellence in the execution of four assigned missions that are vital to the United


Is Nuclear Energy the Solution?  

E-Print Network [OSTI]

Savannah River Site (SC), as well as the reprocessing of naval irradiated fuel at the Idaho National Laboratory (

Saier, Milton H.; Trevors, Jack T.



Is Nuclear Energy the Solution?  

E-Print Network [OSTI]

fired power plant per unit of electrical energy. Wind powerpower plants will not be cost competitive with other electricity-generating alternatives. For example, wind

Saier, Milton H.; Trevors, Jack T.



Home Office Expenses Submitted by Fluor Federal Services, Inc., on Savannah River Nuclear Solutions, LLC's U.S. Department of Energy Management & Operating (M&O) Contract No. DE-AC09-08SR22470  

Broader source: Energy.gov (indexed) [DOE]

Home Office Expenses Submitted by Fluor Home Office Expenses Submitted by Fluor Federal Services, Inc., on Savannah River Nuclear Solutions, LLC's U.S. Department of Energy Management & Operating (M&O) Contract No. DE-AC09-08SR22470 OAS-L-13-08 April 2013 Department of Energy Washington, DC 20585 April 19, 2013 MEMORANDUM FOR THE MANAGER, SAVANNAH RIVER OPERATIONS OFFICE FROM: Rickey R. Hass Deputy Inspector General for Audits and Inspections Office of Inspector General SUBJECT: INFORMATION: Audit Report on "Home Office Expenses Submitted by Fluor Federal Services, Inc., on Savannah River Nuclear Solutions, LLC's U.S. Department of Energy Management & Operating (M&O) Contract No. DE-AC09-08SR22470" BACKGROUND The attached report presents the results of an audit of home office expenses submitted by Fluor


Structural Basis of the 1H-Nuclear Magnetic Resonance Spectra of Ethanol–Water Solutions Based on Multivariate Curve Resolution Analysis of Mid-Infrared Spectra  

Science Journals Connector (OSTI)

The 1H-nuclear magnetic resonance (NMR) chemical shifts of ethanol and water hydroxyl groups show a pattern change at a critical ethanol concentration. Below the critical...

Hu, Naiping; Wu, Dan; Cross, Kelly J; Schaefer, Dale W



Page not found | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

31 - 2040 of 29,416 results. 31 - 2040 of 29,416 results. Download Electronic Document Online Correspondence and Concurrence System (eDOCS),Office of the Executive Secretariat http://energy.gov/management/downloads/electronic-document-online-correspondence-and-concurrence-system-edocsoffice Download PIA- Savannah River Nuclear Solution SRNS Electronic Document Workflow RECORDS System (EDWS) http://energy.gov/management/downloads/pia-savannah-river-nuclear-solution-srns-electronic-document-workflow-records Download Oak Ridge Office Document Management Ststem(HummingbirdDM) PIA, Oak Ridge Operations Office http://energy.gov/management/downloads/oak-ridge-office-document-management-ststemhummingbirddm-pia-oak-ridge Listing Light Water Reactor Sustainability Technical Documents http://energy.gov/ne/listings/light-water-reactor-sustainability-technical-documents


Nuclear Energy  

Science Journals Connector (OSTI)

Nuclear Energy ... A brief summary of the history and key concepts of nuclear energy. ... Nuclear / Radiochemistry ...

Charles D. Mickey



Nuclear batteries  

Science Journals Connector (OSTI)

Nuclear batteries ... Describes the structure, operation, and application of nuclear batteries. ... Nuclear / Radiochemistry ...

Alfred B. Garrett



Nuclear Forensics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

nuclear forensics Nuclear Forensics AMS is a Powerful Tool for Nuclear Forensics Nuclear forensics, which can be applied to both interdicted materials and debris from a nuclear...


SRNL - News Room  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Hyperion Power Sign Strategic Agreement Hyperion Power Sign Strategic Agreement ( PDF button Download printer-friendly, PDF version) AIKEN, SC (Sept. 9, 2010) - Savannah River National Laboratory (SRNL) and Hyperion Power Generation Inc., today announced an agreement that could lead to deployment of a small modular nuclear reactor at the United States Department of Energy's (DOE) Savannah River Site (SRS). The agreement was signed by John R. (Grizz) Deal, Chief Executive Officer and co-founder of Hyperion Power, and Garry Flowers, President and Chief Executive Officer of Savannah River Nuclear Solutions, LLC (SRNS). SRNS operates SRNL under contract to DOE. "This is one of the first in a series of steps that can put this region in an active role toward transforming America's energy future," said Flowers. "Small and modular reactors can become the primary base of new, clean power for the world. SRS is an ideal place to develop and demonstrate this exciting technology."


Audit Letter Report: OAS-L-09-09  

Broader source: Energy.gov (indexed) [DOE]

09 09 REPLY TO ATTN TO: IG-32 (A08ET058) SUBJECT: Report on "Audit of Closure of Subcontracts at the Savannah River Site" TO: Manager, Savannah River Operations Office INTRODUCTION AND OBJECTIVE A significant amount of Federal funds expended at the Savannah River Site are attributable to subcontracts for goods and services. In Fiscal Year (FY) 2008, $312 million of $1.3 billion in total obligations were made for subcontracts. The Savannah River Site is managed and operated by Savannah River Nuclear Solutions, LLC (SRNS) through a prime contract with the Department of Energy's (Department) Savannah River Operations Office. Prior to August 2008, the site was managed and operated by Washington Savannah River Co., LLC (WSRC). SRNS is expected to ensure that subcontracts are closed within a reasonable period of


Microsoft Word - SpecialEditionSep08Update.doc  

National Nuclear Security Administration (NNSA)

UPDATE TO PHONE NUMBERS FOR SAVANNAH RIVER OPERATIONS UPDATE TO PHONE NUMBERS FOR SAVANNAH RIVER OPERATIONS As announced in the previous edition of the NMMSS News, NMMSS operations are transitioning from NAC International in Norcross, Georgia to the Office of Health, Safety and Security (HSS), DOE, Germantown, Maryland. During the transition, NMMSS will be operated from DOE Savannah River Site by Savannah River Nuclear Solutions (SRNS), the NMMSS upgrade developer and the continuity of operations backup site for NMMSS. Methods of submitting data to Savannah River Site NMMSS Operations were provided in the previous Special Edition of the NMMSS New and are provided again below. Note, however, that the SRNS phone numbers for data submission and questions regarding data submission will not be available until October 6, 2008 or later.


Microsoft Word - WBH-12-0002.doc  

Broader source: Energy.gov (indexed) [DOE]

May 30, 2012 ) Case No.: WBH-12-0002 May 30, 2012 ) Case No.: WBH-12-0002 ) ___________________________________ ) Issued: January 8, 2013 ____________________ Initial Agency Decision ____________________ Steven J. Goering, Hearing Officer: This Decision and Order involves a Complaint of Retaliation filed by John Robertson ("complainant") against KQ Services ("KQ" or "respondent") under the DOE's Contractor Employee Protection Program and its governing regulations set forth at 10 C.F.R. Part 708. The complainant was an employee of KQ, a subcontractor of Savannah River Nuclear Solutions, LLC (SRNS), which, since 2007, has been the management and operating contractor for the DOE's Savannah River Site (SRS) in Aiken, South Carolina. KQ is a furniture relocation company that provides moving services to SRNS at the SRS. Mr.


Facility Utilization and Risk Analysis for Remediation of Legacy Transuranic Waste at the Savannah River Site - 13572  

SciTech Connect (OSTI)

Savannah River Nuclear Solutions (SRNS) completed the Accelerated TRU Project for remediating legacy waste at the Savannah River Site with significant cost and schedule efficiencies due to early identification of resources and utilization of risk matrices. Initial project planning included identification of existing facilities that could be modified to meet the technical requirements needed for repackaging and remediating the waste. The project schedule was then optimized by utilization of risk matrices that identified alternate strategies and parallel processing paths which drove the overall success of the project. Early completion of the Accelerated TRU Project allowed SRNS to pursue stretch goals associated with remediating very difficult TRU waste such as concrete casks from the hot cells in the Savannah River National Laboratory. Project planning for stretch goals also utilized existing facilities and the risk matrices. The Accelerated TRU project and stretch goals were funded under the American Recovery and Reinvestment Act (ARRA). (authors)

Gilles, Michael L.; Gilmour, John C. [Savannah River Nuclear Solutions, LLC (United States)] [Savannah River Nuclear Solutions, LLC (United States)



Microsoft Word - 2011sr09.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

June 28, 2011 June 28, 2011 james-r.giusti@srs.gov Paivi Nettamo, SRNS, (803) 646-6075 paivi.nettamo@srs.gov SRS Seals Access to P and R Reactors, Marking End to Nearly 60-Years of History American Recovery and Reinvestment Act Project Progress AIKEN, S.C. - With investments from the American Recovery and Reinvestment Act, the U.S. Department of Energy and Savannah River Nuclear Solutions, LLC, (SRNS) today sealed the access to the historic P and R Reactors as part of footprint reduction and legacy cleanup at the Savannah River Site. At P Reactor today, Dr. David Moody, DOE's Savannah River Operations Office Manager and Marc Sharpe, a reactor operator at P Reactor in the 1980s, were the last people to exit the P Reactor before its final opening was welded shut.


Mesoscopic structuring and dynamics of alcohol/water solutions probed by Terahertz Time-Domain Spectroscopy and Pulsed Field Gradient Nuclear Magnetic Resonance  

E-Print Network [OSTI]

in the structure of alcohol/water mixtures. Taking aqueous ethanol as a representative example, excess enthalpy, heat capacity, diffusivity, and viscosity all exhibit maxima or minima at ?15?20 mol %;12,16,20?23 this is attributable to Received: March 20, 2014... dielectric spectroscopy and the results were compared to femtosecond infrared pump? probe studies. By investigating a range of concentrations of aqueous tetramethylurea solutions it was found that the dynamics of the water molecules in close vicinity...

Li, Ruoyu; D'Agostino, Carmine; McGregor, James; Mantle, Michael D.; Zeitler, J. Axel; Gladden, Lynn F.


Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Solvent wash solution  

DOE Patents [OSTI]

A process is claimed for removing diluent degradation products from a solvent extraction solution, which has been used to recover uranium and plutonium from spent nuclear fuel. A wash solution and the solvent extraction solution are combined. The wash solution contains (a) water and (b) up to about, and including, 50 vol % of at least one-polar water-miscible organic solvent based on the total volume of the water and the highly-polar organic solvent. The wash solution also preferably contains at least one inorganic salt. The diluent degradation products dissolve in the highly-polar organic solvent and the organic solvent extraction solvent do not dissolve in the highly-polar organic solvent. The highly-polar organic solvent and the extraction solvent are separated.

Neace, J.C.



SRS upgrades helium recovery system | National Nuclear Security...  

National Nuclear Security Administration (NNSA)

detectors employed by the United States Department of Homeland Security to detect neutron activity from nuclear material. Savannah River Nuclear Solutions, LLC, the management...


Nuclear Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Research Programs >> Nuclear Energy Error Error Nuclear Energy Home - RCC cannot be displayed due to a timeout error. We recommend: * Refresh Nuclear Energy Home - RCC * Increasing...


Alan Roback Policy Implications of Nuclear Winter  

E-Print Network [OSTI]

Alan Roback Policy Implications of Nuclear Winter and Ideas for Solutions The 5 May 1988 United of war or policy. Even a "first strike" or a "limited nuclear war" would be likely to result in nuclear Nations report clearly states that the nuclear winter theory is supported by current scientific evidence

Robock, Alan


Dynamic simulation of nuclear hydrogen production systems  

E-Print Network [OSTI]

Nuclear hydrogen production processes have been proposed as a solution to rising CO 2 emissions and low fuel yields in the production of liquid transportation fuels. In these processes, the heat of a nuclear reactor is ...

Ramírez Muñoz, Patricio D. (Patricio Dario)



Nuclear Debate  

Science Journals Connector (OSTI)

Nuclear Debate ... This month, the Senate will consider the nominations of two women to serve on the Nuclear Regulatory Commission. ... Svinicki is a nuclear engineer with experience in the Department of Energy’s nuclear energy programs. ...




Nuclear Resonance Fluorescence for Nuclear Materials Assay  

E-Print Network [OSTI]

Potential of Nuclear Resonance Fluorescence . . . . . . . .2.9.1 Nuclear ThomsonSections . . . . . . . . . . . . . . . Nuclear Resonance

Quiter, Brian Joseph



Nuclear Returns  

Science Journals Connector (OSTI)

Nuclear Returns ... For the first time since 1978, the Nuclear Regulatory Commission has given the green light for a new U.S. nuclear power plant. ... NRC granted a license to Southern Co. to build and operate twin 1,100-MW reactors adjacent to two operating nuclear power plants at its Vogtle nuclear facility, near Waynesboro, Ga. ...




Optimization Online - Guaranteed Minimum-Rank Solutions of ...  

E-Print Network [OSTI]

Jun 28, 2007 ... Guaranteed Minimum-Rank Solutions of Linear Matrix Equations via Nuclear Norm Minimization. Benjamin Recht(brecht ***at*** caltech.edu)

Benjamin Recht



MagLab - Solution Nuclear Magnetic Resonance  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

organisms. This probe, which now operates at UFs AMRIS NMR facility, is based on high temperature superconductor (HTS) technology. It is the first HTS probe to use a 1-mm...


Nuclear Fusion  

Science Journals Connector (OSTI)

Although not yet developed at the commercial stage, nuclear fusion technology is still being considered as a ... used in nuclear warfare. Since research in nuclear fusion for the production of energy started abou...

Ricardo Guerrero-Lemus; José Manuel Martínez-Duart



Nuclear Nonproliferation  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Nuclear Nonproliferation As more countries embrace nuclear power as a cost-effective and clean alternative to fossil fuels, the need exists to ensure that the nuclear fuel cycle is...


Nuclear Engineering Nuclear Criticality Safety  

E-Print Network [OSTI]

Nuclear Engineering Nuclear Criticality Safety The Nuclear Engineering Division (NE) of Argonne National Laboratory is experienced in performing criticality safety and shielding evaluations for nuclear, and neutron spectra. The NE nuclear criticality safety (NCS) capabilities are based on a staff with decades

Kemner, Ken


Compositions and methods for treating nuclear fuel  

DOE Patents [OSTI]

Compositions are provided that include nuclear fuel. Methods for treating nuclear fuel are provided which can include exposing the fuel to a carbonate-peroxide solution. Methods can also include exposing the fuel to an ammonium solution. Methods for acquiring molybdenum from a uranium comprising material are provided.

Soderquist, Chuck Z; Johnsen, Amanda M; McNamara, Bruce K; Hanson, Brady D; Smith, Steven C; Peper, Shane M



Compositions and methods for treating nuclear fuel  

DOE Patents [OSTI]

Compositions are provided that include nuclear fuel. Methods for treating nuclear fuel are provided which can include exposing the fuel to a carbonate-peroxide solution. Methods can also include exposing the fuel to an ammonium solution. Methods for acquiring molybdenum from a uranium comprising material are provided.

Soderquist, Chuck Z; Johnsen, Amanda M; McNamara, Bruce K; Hanson, Brady D; Smith, Steven C; Peper, Shane M




E-Print Network [OSTI]

??Nuclear reactors are devices containing fissionable material in sufficient quantity and so arranged as to be capable of maintaining a controlled, self-sustaining NUCLEAR FISSION chain… (more)

Belachew, Dessalegn



nuclear reactor  

Science Journals Connector (OSTI)

...a complex atomic apparatus used to obtain energy from nuclear fission chain reaction. Used to produce nuclear energy, radioactive isotopes, and artificial elements.... atomic pile ...



Nuclear Energy  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Nuclear Energy Idaho National Laboratory is the Department of Energy's lead nuclear energy research and development facility. Building upon its legacy responsibilities,...


Nuclear Hydrogen  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Error Error Nuclear Hydrogen - RCC cannot be displayed due to a timeout error. We recommend: * Refresh Nuclear Hydrogen - RCC * Increasing your portlet timeout setting. *...


Nuclear Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Underground Research Facility in South Dakota, which will search for neutrinoless double-beta decay. Strong Los Alamos programs in nuclear data and nuclear theory supports...

Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


State and Local Solution Center: Financing Solutions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Technical Assistance Technical Assistance Resources Printable Version Share this resource Send a link to State and Local Solution Center: Financing Solutions to someone by E-mail Share State and Local Solution Center: Financing Solutions on Facebook Tweet about State and Local Solution Center: Financing Solutions on Twitter Bookmark State and Local Solution Center: Financing Solutions on Google Bookmark State and Local Solution Center: Financing Solutions on Delicious Rank State and Local Solution Center: Financing Solutions on Digg Find More places to share State and Local Solution Center: Financing Solutions on AddThis.com... Strategic Energy Planning Energy Policies & Programs Financing Financing Overview Financing Program Market Segments Energy Data Management Energy Technologies


Nuclear Matter and Nuclear Dynamics  

E-Print Network [OSTI]

Highlights on the recent research activity, carried out by the Italian Community involved in the "Nuclear Matter and Nuclear Dynamics" field, will be presented.

M Colonna



Chapter 7 - Nuclear Energy  

Science Journals Connector (OSTI)

Abstract Nuclear energy grew rapidly during the 1960–1975 period in countries such as France, the United States, and Norway. But nuclear energy ran into problems in the 1970s because of public concern over the radioactive waste it generates, and this concern suppressed the further expansion of nuclear power. The public perception had begun to change in recent years, as concern about atmospheric carbon dioxide levels led to a renewed interest in energy sources not reliant on hydrocarbons. But, in 2010, a tsunami in Japan led to an accident at the Fukushima nuclear power plant, and the ensuing release of radioactive materials once again raised concerns about safety. At the same time, limited supplies of uranium have caused the price of that fuel material to go up. The solution to the shortage and resulting price increase is fast breeder reactors that use both uranium and thorium fuels. Unfortunately, this technology has not yet been perfected and commercialized.

Brian F. Towler



Nuclear choices  

SciTech Connect (OSTI)

This book contains part of the series New Liberal Arts, which is intended to make science and technology more accessible to students of the liberal arts. Volume in hand provides a comprehensive, multifaceted examination of nuclear energy, in nontechnical terms. Wolfson explains the basics of nuclear energy and radiation, nuclear power..., and nuclear weapons..., and he invites readers to make their own judgments on controversial nuclear issues. Illustrated with photos and diagrams. Each chapter contains suggestions for additional reading and a glossary. For policy, science, and general collections in all libraries. (ES) Topics contained include Atoms and nuclei. Effects and uses of radiation. Energy and People. Reactor safety. Nuclear strategy. Defense in the nuclear age. Nuclear power, nuclear weapons, and nuclear futures.

Wolfson, R.




Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

HRD-BEN-2013-0029 HRD-BEN-2013-0029 Date: April 30, 2013 To: All Plan Participants From: SRNS Benefits Administration Re: Savannah River Nuclear Solutions, LLC Multiple Employer Pension Plan Funding Notices Attached is the pension plan notice of which the wording is very closely regulated by the federal government. Therefore, we are providing a quick overview of the notice here. 2012 Annual Funding Notice: The government previously required the distribution of an abbreviated form of this information and called it the Summary Annual Report (SAR). You may have seen SARs from previous years posted on the SRS Intranet "InSite". The enhanced version of that


Enenrgy Employees Occupational Illness Compensation Program Act (EEOICPA)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Enenrgy Employees Occupational Illness Compensation Program Act Enenrgy Employees Occupational Illness Compensation Program Act (EEOICPA) Tracking System, PIA, Savannah River Operations Office Enenrgy Employees Occupational Illness Compensation Program Act (EEOICPA) Tracking System, PIA, Savannah River Operations Office Enenrgy Employees Occupational Illness Compensation Program Act (EEOICPA) Tracking System, PIA, Savannah River Operations Office Enenrgy Employees Occupational Illness Compensation Program Act (EEOICPA) Tracking System, PIA, Savannah River Operations Office More Documents & Publications Energy Employees Occupational Illness Compensation Program Act (EEOICPA) Tracking System PIA, Office of Business Operations PIA - Savannah River Nuclear Solution (SRNS) Energy Employees Occupational Illness Compensation Program Act (EEOICPA)


Final Review of Safety Assessment Issues at Savannah River Site, August 2011  

SciTech Connect (OSTI)

At the request of Savannah River Nuclear Solutions (SRNS) management, a review team composed of experts in atmospheric transport modeling for environmental radiation dose assessment convened at the Savannah River Site (SRS) on August 29-30, 2011. Though the meeting was prompted initially by suspected issues related to the treatment of surface roughness inherent in the SRS meteorological dataset and its treatment in the MELCOR Accident Consequence Code System Version 2 (MACCS2), various topical areas were discussed that are relevant to performing safety assessments at SRS; this final report addresses these topical areas.

Napier, Bruce A.; Rishel, Jeremy P.; Bixler, Nathan E.



An Adaptive, Consent-Based Path to Nuclear Waste Storage and...  

Broader source: Energy.gov (indexed) [DOE]

An Adaptive, Consent-Based Path to Nuclear Waste Storage and Disposal Solutions An Adaptive, Consent-Based Path to Nuclear Waste Storage and Disposal Solutions February 12, 2014 -...


defense nuclear security | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

nuclear security | National Nuclear Security Administration People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response...


Chernobyl Nuclear Accident | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

Chernobyl Nuclear Accident | National Nuclear Security Administration People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response...


Countering Nuclear Terrorism and Trafficking | National Nuclear...  

National Nuclear Security Administration (NNSA)

Countering Nuclear Terrorism and Trafficking | National Nuclear Security Administration People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...


Nuclear Science  

Broader source: Energy.gov (indexed) [DOE]

Science Science and Engineering Education Sourcebook 2013 American Nuclear Society US Department of Energy Nuclear Science & Engineering Education Sourcebook 2013 North American Edition American Nuclear Society Education, Training, and Workforce Division US Department of Energy Office of Nuclear Energy Editor and Founder John Gilligan Professor of Nuclear Engineering North Carolina State University Version 5.13 Welcome to the 2013 Edition of the Nuclear Science and Engineering Education (NS&EE) Sourcebook. We have evolved and improved! The core mission of the Sourcebook has not changed, however. Our purpose is to facilitate interaction among faculty, students, industry, and government agencies to accomplish nuclear research, teaching and service activities. Since 1986 we have compiled critical information on nuclear


Nuclear reactions  

Science Journals Connector (OSTI)

Much reference has been made in the last chapter to nuclear energy levels and their various properties (e.g ... ways of doing this — the use of nuclear reactions, and studies of how excited nuclei...

R. J. Blin-Stoyle FRS



nuclear security  

National Nuclear Security Administration (NNSA)

3%2A en Shaping the future of nuclear detection http:nnsa.energy.govblogshaping-future-nuclear-detection


Nuclear Ukraine  

Science Journals Connector (OSTI)

... SIR - Your article (Nature 365, 599; 1993) on the US-Ukraine stalemate over nuclear weapons prompts the following remarks. The United States made a mistake ... nuclear weapons prompts the following remarks. The United States made a mistake in not recognizing Ukraine as a legitimate successor state to the Soviet nuclear arsenal and is still insisting that ...

Arno Arrak



Nuclear Engineer (Nuclear Safety Specialist)  

Broader source: Energy.gov [DOE]

A successful candidate of this position will serve as a Nuclear Engineer (Nuclear Safety Specialist) responsible for day-to-day technical monitoring, and evaluation of aspects of authorization...


Enhancing nuclear power safety  

Science Journals Connector (OSTI)

Through its ClydeUnion Pumps brand, SPX has a long history of providing pumps to the nuclear power industry and is working to help provide solutions that enhance vital safety systems on these plants. Compared with traditional alternatives, its TWL steam turbine driven pump is designed to increase the reliability of systems that provide heat removal from pressurised water reactors and boiling water reactors during extended emergency periods.



Nuclear Deterrence  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Nuclear Deterrence Nuclear Deterrence Nuclear Deterrence LANL's mission is to develop and apply science and technology to ensure the safety, security, and effectiveness of the U.S. nuclear deterrent; reduce global threats; and solve other emerging national security and energy challenges. April 12, 2012 A B-2 Spirit bomber refuels from a KC-135 Stratotanker A B-2 Spirit bomber refuels from a KC-135 Stratotanker. Contact Operator Los Alamos National Laboratory (505) 667-5061 Charlie McMillan, Director: "For the last 70 years there has not been a world war, and I have to think that our strong deterrent has something to do with that fact." Mission nuclear weapons Charlie McMillan, Director of Los Alamos National Laboratory 1:06 Director McMillan on nuclear deterrence While the role and prominence of nuclear weapons in U.S. security policy


Accelerating Solutions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Solutions From vehicles on the road to the energy that powers them, Oak Ridge National Laboratory innovations are advancing American transportation. Oak Ridge National Laboratory is making an impact on everyday America by enhancing transportation choices and quality of life. Through strong collaborative partnerships with industry, ORNL research and development efforts are helping accelerate the deployment of a new generation of energy efficient vehicles powered by domestic, renewable, clean energy. EPA ultra-low sulfur diesel fuel rule ORNL and the National Renewable Energy Laboratory co-led a comprehensive research and test program to determine the effects of diesel fuel sulfur on emissions and emission control (catalyst) technology. In the course of this program, involving


A Safer Nuclear Enterprise  

Science Journals Connector (OSTI)

...2012 at the Nuclear Security...leadership in nuclear enterprise...multinational assessment of emerging risks and consequences...to assess nuclear risks in...or nuclear terrorism. States...and nuclear power. Since 1945...nuclear power plant can mean...

Sidney D. Drell; George P. Shultz; Steven P. Andreasen


Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Nuclear astrophysics  

SciTech Connect (OSTI)

The problem of core-collapse supernovae is used to illustrate the many connections between nuclear astrophysics and the problems nuclear physicists study in terrestrial laboratories. Efforts to better understand the collapse and mantle ejection are also motivated by a variety of interdisciplinary issues in nuclear, particle, and astrophysics, including galactic chemical evolution, neutrino masses and mixing, and stellar cooling by the emission of new particles. The current status of theory and observations is summarized.

Haxton, W.C.



Nuclear astrophysics  

SciTech Connect (OSTI)

The problem of core-collapse supernovae is used to illustrate the many connections between nuclear astrophysics and the problems nuclear physicists study in terrestrial laboratories. Efforts to better understand the collapse and mantle ejection are also motivated by a variety of interdisciplinary issues in nuclear, particle, and astrophysics, including galactic chemical evolution, neutrino masses and mixing, and stellar cooling by the emission of new particles. The current status of theory and observations is summarized.

Haxton, W.C.



Nuclear Counterterrorism  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

The Order defines requirements for the protection of sensitive improvised nuclear device information and provides a framework to support DOE activities related to nuclear counterterrorism. (A supplemental DOE Manual, Control of and Access to Improvised Nuclear Device Information, provides requirements and procedures for protecting Sigma 20 information.) Appendices A and B are Official Use Only. Point of contact is Adam Boyd (NA-82), 202-586-0010. Cancels DOE O 457.1 and DOE M 457.1-1.



Nuclear Power  

Science Journals Connector (OSTI)

Nuclear Power ... THIS WEEK’S issue contains six letters on nuclear power, a representative sample of the letters C&EN received in response to the editorial, “Resist Hysteria,” I wrote shortly after the earthquake and tsunami in Japan devastated the Fukushima Daiichi Nuclear Power Station (C&EN, March 21, page 5). ... Four of the six letters take sharp issue with the primary point I made in the editorial, which was that, despite the severity of the situation in Japan, nuclear power remains an essential component of our overall energy mix for the near to mid-term because it will help us avert the worst impacts of global climate disruption. ...





Science Journals Connector (OSTI)

Japanese nuclear power plant crisis sparks examination of U.S. REACTORS ... Calls are particularly zeroing in on reactors similar in location and design to those in Japan. ...




Nuclear radiation electronic gear  

Science Journals Connector (OSTI)

Nuclear radiation electronic gear ... Examines the line of nuclear radiation instrumentation offered by Nuclear-Chicago Corporation and Victoreen Instrument Company. ... Nuclear / Radiochemistry ...

S. Z. Lewin



Nuclear Weapons Journal  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Nuclear Weapons Journal Nuclear Weapons Journal x The Nuclear Weapons Journal ceased publication after Issue 2, 2009. Below are Nuclear Weapons Journal archived issues. Issue 2,...


Nuclear Forces and Nuclear Systems  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Forces and Nuclear Systems Forces and Nuclear Systems Our goal is to achieve a description of nuclear systems ranging in size from the deuteron to nuclear matter and neutron stars using a single parameterization of the nuclear forces. Our work includes both the construction of two- and three-nucleon potentials and the development of many-body techniques for computing nuclear properties with these interactions. Detailed quantitative, computationally intense studies are essential parts of this work. In the last decade we have constructed several realistic two- and three-nucleon potential models. The NN potential, Argonne v18, has a dominant charge-independent piece plus additional charge-dependent and charge-symmetry-breaking terms, including a complete electromagnetic interaction. It fits 4301 pp and np elastic scattering data with a chi**2


Nuclear Systems Modeling, Simulation & Validation | Nuclear Science...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Research Areas Fuel Cycle Science & Technology Fusion Nuclear Science Isotope Development and Production Nuclear Security Science & Technology Nuclear Systems Modeling, Simulation...


Nuclear Materials Management & Safeguards System | National Nuclear...  

National Nuclear Security Administration (NNSA)

System Nuclear Materials Management & Safeguards System NMMSS U.S. Department of Energy U.S. Nuclear Regulatory Commission Nuclear Materials Management & Safeguards...


Nuclear options  

Science Journals Connector (OSTI)

... sad if transient commercial expediency led the country to take risks now by adopting nuclear reactor designs from abroad which are in some respects technically less sound than those produced at ... much lower priority. It can be anticipated, however; that although the types of nuclear reactor selected as the best that Britain could build next may be suitable for unit designs ...

G. R. Bainbridge



Nuclear Reactor Materials and Fuels  

Science Journals Connector (OSTI)

Nuclear reactor materials and fuels can be classified into six categories: Nuclear fuel materials Nuclear clad materials Nuclear coolant materials Nuclear poison materials Nuclear moderator materials

Dr. James S. Tulenko



(Nuclear theory). [Research in nuclear physics  

SciTech Connect (OSTI)

This report discusses research in nuclear physics. Topics covered in this paper are: symmetry principles; nuclear astrophysics; nuclear structure; quark-gluon plasma; quantum chromodynamics; symmetry breaking; nuclear deformation; and cold fusion. (LSP)

Haxton, W.



Nuclear Astrophysics  

E-Print Network [OSTI]

Nuclear physics has a long and productive history of application to astrophysics which continues today. Advances in the accuracy and breadth of astrophysical data and theory drive the need for better experimental and theoretical understanding of the underlying nuclear physics. This paper will review some of the scenarios where nuclear physics plays an important role, including Big Bang Nucleosynthesis, neutrino production by our sun, nucleosynthesis in novae, the creation of elements heavier than iron, and neutron stars. Big-bang nucleosynthesis is concerned with the formation of elements with A nuclear physics inputs required are few-nucleon reaction cross sections. The nucleosynthesis of heavier elements involves a variety of proton-, alpha-, neutron-, and photon-induced reactions, coupled with radioactive decay. The advent of radioactive ion beam facilities has opened an important new avenue for studying these processes, as many involve radioactive species. Nuclear physics also plays an important role in neutron stars: both the nuclear equation of state and cooling processes involving neutrino emission play a very important role. Recent developments and also the interplay between nuclear physics and astrophysics will be highlighted.

Carl R. Brune



nuclear security | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

security | National Nuclear Security Administration People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our...


Nuclear Incident Team | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

Incident Team | National Nuclear Security Administration People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing...


nuclear navy | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

navy | National Nuclear Security Administration People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our...


nuclear threat science | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

threat science | National Nuclear Security Administration People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing...


Nuclear Operations | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

Nuclear Security Administration People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure...


Nuclear Radius and Nuclear Forces  

Science Journals Connector (OSTI)

The difference between the radius of the nuclear matter distribution and the nuclear force radius, RN?1.4A13×10-13 cm, for heavy nuclei (A>100) is interpreted as a consequence of the finite range of nuclear forces. Assuming that the nuclear matter distribution coincides with the charge distribution as determined at Stanford (RC=1.12A13×10-13 cm is the distance at which the charge density falls to one half value) we sum up the nuclear interactions of an incident nucleon for various proposed internucleon potentials, V(r). We also evaluate contributions from the spin, charge, and matter polarizations induced in the nuclear distributions by the incident nucleon as a test of the convergence of these calculations. The aim here is to infer some features of nuclear forces which satisfy saturation requirements and at the same time give rise to an appreciable nuclear attraction for an incident nucleon at RN. Analyses of the scattering of neutrons and protons by heavy nuclei suggest a nuclear attraction ?14 Mev at a distance RN.These considerations are primarily sensitive to the long range behavior of the direct, central part of V(r). The key point which emerges from them is that the nuclear forces must contain long range (~ meson Compton wavelength) direct, central attractions which will be felt by an incident nucleon at RN before the shorter range repulsions (hard cores, many-body forces, or exchange interactions), which are responsible for saturation, become effective. Such interactions can be constructed phenomenologically, but are not found in recent meson-theoretically deduced potentials.

S. D. Drell


Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Nuclear condensation  

Science Journals Connector (OSTI)

This work draws an analogy between a heated nucleus breaking up into clusters and a liquid undergoing a phase transition to a gas in which droplets appear. The critical temperature and density in the nucleus are investigated using a Skyrme effective interaction and finite temperature Hartree-Fock theory. The energy and pressure as a function of density are calculated. The effects of compressibility, effective mass, and binding energy per particle on the critical temperature and critical density of nuclear systems is developed. In some cases, analytic expressions for these quantities can be obtained.NUCLEAR REACTIONS Phase transitions in hot nuclear matter.

H. Jaqaman; A. Z. Mekjian; L. Zamick



Nuclear War  

SciTech Connect (OSTI)

Several chapters in Last Aid warrant the attention of the medical profession. What is known and not known about acute biologic effects following a nuclear explosion is described. The social, physical, and environmental impact of nuclear war on urban population centers is described. How nuclear weapons could affect the composition of the ozone layer and the effects this could have on human survival, including possible interruption of the aquatic ecosystem to produce single-cell organisms for the food cycle, especially seafood is noted.

MacLeod, G.K.



Nuclear energy: current situation and prospects to 2020  

Science Journals Connector (OSTI)

...as a matter of policy that a country will have nuclear in its forward...and accept. For nuclear energy in the UK, clarity in waste policy is essential as...immediately to encourage nuclear build. There...deliver such a policy and the solution...



Nuclear magnetic resonance analysis of protein–DNA interactions  

Science Journals Connector (OSTI)

...review-article Review articles 1004 30 15 Nuclear magnetic resonance analysis of protein-DNA...instrumental advances in solution-state nuclear magnetic resonance have opened up the...structural biology|protein-DNA complex|nuclear magnetic resonance| 1. Introduction...



Climate Change, Nuclear Power and Nuclear  

E-Print Network [OSTI]

Climate Change, Nuclear Power and Nuclear Proliferation: Magnitude Matters Rob Goldston MIT IAP biomass wind hydro coal CCS coal nat gas CCS nat gas nuclear Gen IV nuclear Gen III nuclear Gen II 5-1 Electricity Generation: CCS and Nuclear Power Technology Options Available Global Electricity Generation WRE


Nuclear Medicine  

Science Journals Connector (OSTI)

Nuclear medicine is the branch of medicine that is concerned with the use of in the diagnosis, management, and treatment of disease. It usually uses small amounts of radioactive materials or , substances th...



Nuclear viscosity  

Science Journals Connector (OSTI)

The decay rate of momentum in a nuclear reaction is given by an exact formula expressed in terms of the T matrix. A special case, where a viscosity coefficient can be estimated, is considered.

B. Giraud; J. Le Tourneux; E. Osnes



Nuclear Waste  

Science Journals Connector (OSTI)

Nuclear waste is radioactive material no longer considered valuable...238U, 235U, and 226Ra (where the latter decays to 222Rn gas by emitting an alpha particle) or formed through fission of fissile radioisotopes ...

Rob P. Rechard



Nuclear Golf  

E-Print Network [OSTI]

Broadcast Transcript: Pay no attention to that nuclear warhead behind the 18th hole; just shout "Fore!" and drive your Titleist down the fairway. In a development that is bizarre even by North Korean standards, the country ...

Hacker, Randi; Tsutsui, William



Nuclear Fuels  

Science Journals Connector (OSTI)

The core of a nuclear reactor is composed of a controlled critical configuration of a fissile material, which in strict a sense is the fuel. This fissile material is contained in a matrix, normally a ceramic c...

Rudy J. M. Konings; Thierry Wiss…



Nuclear Energy!  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

driver, see the Nuclear Clean Air Energy race car and receive a special clean energy patch on October 21 from 6:30 - 7:30 p.m. Space is limited RSVP by October 4 Hands-on...


Nuclear forces  

SciTech Connect (OSTI)

These lectures present an introduction into the theory of nuclear forces. We focus mainly on the modern approach, in which the forces between nucleons emerge from low-energy QCD via chiral effective field theory.

Machleidt, R. [Department of Physics, University of Idaho, Moscow, Idaho 83844 (United States)



Nuclear Physics for Nuclear Fusion  

SciTech Connect (OSTI)

The nuclear fusion data for deuteron-triton resonance near 100 keV are found to be consistent with the selective resonant tunneling model. The feature of this selective resonant tunneling is the selectivity. It selects not only the energy level, but also the damping rate (nuclear reaction rate). When the Coulomb barrier is thin and low, the resonance selects the fast reaction channel; however, when the Coulomb barrier is thick and high, the resonance selects the slow reaction channel. This mechanism might open an approach toward fusion energy with no strong nuclear radiation.

Li Xingzhong [Tsinghua University (China)



Countering Nuclear Terrorism | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

Countering Nuclear Terrorism | National Nuclear Security Administration Countering Nuclear Terrorism | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog The National Nuclear Security Administration Countering Nuclear Terrorism Home > Our Mission > Countering Nuclear Terrorism Countering Nuclear Terrorism NNSA provides expertise, practical tools, and technically informed policy


Fissile solution dynamics: Student research  

SciTech Connect (OSTI)

There are two research projects in criticality safety at the University of Arizona: one in dynamic simulation of hypothetical criticality accidents in fissile solutions, and one in criticality benchmarks using transport theory. We have used the data from nuclear excursions in KEWB, CRAC, and SILENE to help in building models for solution excursions. An equation of state for liquids containing gas bubbles has been developed and coupled to point-reactor dynamics in an attempt to predict fission rate, yield, pressure, and kinetic energy. It appears that radiolytic gas is unimportant until after the first peak, but that it does strongly affect the shape of the subsequent power decrease and also the dynamic pressure.

Hetrick, D.L.



Nuclear shadowing in the light-cone dipole approach  

E-Print Network [OSTI]

We study nuclear shadowing at small Bjorken x nuclear shadowing for the barq-q Fock component of the photon is calculated using exact numerical solution of the evolution equation for the Green function. At x nuclear shadowing becomes effective. Numerical results for nuclear shadowing are compared with available data from the E665 and NMC collaborations. Model calculations are finally tested with the results obtained from other models.

Jan Nemchik



Viscosity of polymer solutions  

Science Journals Connector (OSTI)

Viscosity of polymer solutions ... Abstracts for Volume 5A, Number 2. This program contains three components: "Density of Liquids", "Viscosity of Liquids", and "Viscosity of Polymer Solutions". ...

Gary L. Bertrand




E-Print Network [OSTI]

1980, pp.l4-20 THE DAYLIGHTING SOLUTION Stephen SelkowitzEEB-W·-80-19 W-74 THE DAYLIGHTING SOLUTION Stephen Selkowitz

Selkowitz, Stephen



Nuclear Induction  

Science Journals Connector (OSTI)

The magnetic moments of nuclei in normal matter will result in a nuclear paramagnetic polarization upon establishment of equilibrium in a constant magnetic field. It is shown that a radiofrequency field at right angles to the constant field causes a forced precession of the total polarization around the constant field with decreasing latitude as the Larmor frequency approaches adiabatically the frequency of the r-f field. Thus there results a component of the nuclear polarization at right angles to both the constant and the r-f field and it is shown that under normal laboratory conditions this component can induce observable voltages. In Section 3 we discuss this nuclear induction, considering the effect of external fields only, while in Section 4 those modifications are described which originate from internal fields and finite relaxation times.

F. Bloch



Collaborating Organizations - Nuclear Data Program, Nuclear Engineering  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Collaborating Organizations Collaborating Organizations Nuclear Data Program Overview Current Projects & Recent Activities Collaborating Organizations Publications Nuclear Data Measurements (NDM) Reports Experimental Nuclear Data Resources Contact ND Program Related Resources Other Major Programs Work with Argonne Contact us For Employees Site Map Help Join us on Facebook Follow us on Twitter NE Division on Flickr Nuclear Data Program Collaborating Organizations Bookmark and Share National Nuclear Data Center, Brookhaven National Laboratory, Upton, New York. International Nuclear Structure and Decay Data Network, coordinated by IAEA, Vienna, Austria Heavy-Ion Nuclear Physics Group, Physics Division, Argonne National Laboratory, Argonne, Illinois. Nuclear Spectroscopy Group, Department of Nuclear Physics,

Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Nuclear Data Program - Nuclear Engineering Division (Argonne)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Data Program Data Program Nuclear Data Program Overview Current Projects & Recent Activities Collaborating Organizations Publications Nuclear Data Measurements (NDM) Reports Experimental Nuclear Data Resources Contact ND Program Related Resources Other Major Programs Work with Argonne Contact us For Employees Site Map Help Join us on Facebook Follow us on Twitter NE Division on Flickr Nuclear Data Program We contribute to the development of comprehensive nuclear reactions and nuclear structure databases, including nuclear data measurement, analysis, modeling and evaluation methodologies, that are implemented in basic science research and advanced nuclear technologies. Bookmark and Share Recent Events Nuclear Structure 2012 Conference Argonne National Laboratory hosted the


Nuclear Science & Technology  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Nuclear Science & Technology Nuclear Science & Technology Nuclear Science & Technology1354608000000Nuclear Science & TechnologySome of these resources are LANL-only and will require Remote Access. /No/ Nuclear Science & Technology Some of these resources are LANL-only and will require Remote Access. Key Resources Databases Organizations Journals Key Resources International Atomic Energy Agency IAEA scientific and technical publications cover areas of nuclear power, radiation therapy, nuclear security, nuclear law, and emergency repose. Search under Publications/Books and Reports for scientific books, standards, technical guides and reports National Nuclear Data Center Nuclear physics data for basic nuclear research and for applied nuclear technologies, operated by Brookhaven.



E-Print Network [OSTI]

One might summarize of nuclear potential energy has beendegree of freedom) for the nuclear interaction between anyUniversity of California. Nuclear Proximity Forces 'I< at

Randrup, J.



Nuclear Nonproliferation Programs | ORNL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Nuclear Nonproliferation Programs SHARE Nuclear Nonproliferation Programs image Oak Ridge National Laboratory covers the entire spectrum of nuclear nonproliferation work, from...


Slide 1  

Broader source: Energy.gov (indexed) [DOE]

GIS Groups GIS Groups at DOE Manager GIS and Environmental Systems Savannah River Nuclear Solutions, LLC August 16, 2011 Paula H. Brown Washington, DC OCIO -DOE GIS User Group SRNS-S0000-2011-00031 GIS Groups at DOE Geospatial Science Steering Committee (GSSC) Chair: Mark Tuttle, Oak Ridge National Lab Co-Chair: Denise Bleakly, Sandia National Lab DOE GIS User Group Chair: Paula Brown Savannah River Nuclear Solutions 2 Geospatial Sciences Steering Committee Purpose Functions in an advisory role to: - DOE - HQ - DOE National Laboratories - Major facilities - Field office elements To actively promote effective utilization of GIS science and technology in the DOE Complex. 3 Geospatial Sciences Steering Committee Goals The principal goals of the GSSC are to: - Foster technical excellence and


New Letterhead  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

â–¡ the above-identified Work is properly marked with the appropriate restrictive notices relative â–¡ the above-identified Work is properly marked with the appropriate restrictive notices relative PRESENTATION/PUBLICATION AGREEMENT SAVANNAH RIVER NATIONAL LABORATORY EM Waste Processing Technical Exchange Title of Work: Author(s): Name of Licensee: Savannah River Nuclear Solutions, LLC Licensee's Address: Savannah River Site, Aiken, SC 29808 This Agreement is between or among the author(s) and Savannah River Nuclear Solutions, LLC (SRNS), incorporated under the laws of the State of South Carolina, under its Contract No. DE-AC09-08SR22470 with the U.S. DEPARTMENT OF ENERGY (DOE), as Managing and Operating Contractor of Savannah River Site (SRS) and the Savannah River National Laboratory (SRNL) and having its principal place of business located at


Nuclear Data | More Science | ORNL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Nuclear Data SHARE Nuclear Data Nuclear Data ORNL is a recognized, international leader in nuclear data research and development (R&D) to support nuclear applications analyses. For...


Nuclear Facilities | Department of Energy  

Energy Savers [EERE]

Nuclear Facilities Nuclear Facilities Nuclear Facilities Locator Map Numerical map data points indicate two or more nuclear facilities in the same geographic location. Nuclear...


ORISE: White paper analyzes Deepwater Horizon event for improving nuclear  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Deepwater Horizon and Nuclear and Radiological Incidents: Common Challenges Deepwater Horizon and Nuclear and Radiological Incidents: Common Challenges and Solutions White paper analyzes Deepwater Horizon response, identifies approaches for radiological or nuclear emergency planning The 2010 Deepwater Horizon oil spill shares many of the same challenges associated with a radiological incident like the one considered in the Empire 09 exercise or even a much larger nuclear incident. By analyzing experiences during Deepwater Horizon, these challenges can be identified by the interagency in advance of a radiological or nuclear emergency and solutions made available. In the white paper Deepwater Horizon and Nuclear and Radiological Incidents: Common Challenges and Solutions (PDF, 462KB), ORISE examines the following three aspects of the Deepwater Horizon response:


Slide 1  

Broader source: Energy.gov (indexed) [DOE]

Congressional Nuclear Cleanup Caucus Congressional Nuclear Cleanup Caucus Savannah River Site T. Zack Smith Deputy Manager Savannah River Operations Office June 12, 2013 www.energy.gov/EM 2 President Truman announced that Russia tested its first atomic weapon. Sept. 23, 1949 Atomic Energy Commission asked E.I. Du Pont de Nemours & Company to undertake a new atomic project. Du Pont built the Savannah River Plant and operated it for nearly 40 years. June 12, 1950 Westinghouse Savannah River Company took over as SRS's prime contractor. April 1, 1989 Savannah River Nuclear Solutions (SRNS) assumed responsibility for SRS management and operations. Aug. 1, 2008 Savannah River Remediation (SRR) assumed responsibility for SRS Liquid Waste operations.


Nuclear “waffles”  

Science Journals Connector (OSTI)

Background: The dense neutron-rich matter found in supernovae and inside neutron stars is expected to form complex nonuniform phases, often referred to as nuclear pasta. The pasta shapes depend on density, temperature and proton fraction and determine many transport properties in supernovae and neutron star crusts.

A. S. Schneider; D. K. Berry; C. M. Briggs; M. E. Caplan; C. J. Horowitz



Nuclear cheap?  

Science Journals Connector (OSTI)

... account of the fact that if there had been no nuclear contribution the additional fossil fuel supplies would have had to come from expanded output at the marginal and most expensive ... a perfectly proper accountancy basis, including allowance for costs yet to be incurred, the price we would be paying for electricity would be higher now had fossil stations been preferred ...




Nuclear electricity  

Science Journals Connector (OSTI)

... p.344-6) and referred to in my letter of 23 October. The retail price index (RPI) has been used to correct for inflation and a uniform interest rate ... as given by historic costs, and if a previously unconsidered effect of inflation on nuclear fuel costs is included, the margin becomes 34 per cent above that for coal.




Neutrino nuclear response and photo nuclear reaction  

E-Print Network [OSTI]

Photo nuclear reactions are shown to be used for studying neutrino/weak nuclear responses involved in astro-neutrino nuclear interactions and double beta decays. Charged current weak responses for ground and excited states are studied by using photo nuclear reactions through isobaric analog states of those states, while neutral current weak responses for excited states are studied by using photo nuclear reactions through the excited states. The weak interaction strengths are studied by measuring the cross sections of the photo nuclear reactions, and the spin and parity of the state are studied by measuring angular correlations of particles emitted from the photo nuclear reactions. Medium-energy polarized photons obtained from laser photons scattered off GeV electrons are very useful. Nuclear responses studied by photo nuclear reactions are used to evaluate neutrino/weak nuclear responses, i.e. nuclear beta and double beta matrix elements and neutrino nuclear interactions, and to verify theoretical calculations for them.

H. Ejiri; A. I. Titov; M. Boswell; A. Young



Financing Solutions | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Solution Center Financing Solutions Financing Solutions Transitioning to a clean energy economy requires innovative financing solutions that enable state, local, and tribal...


Nuclear Medicine CT Angiography  

E-Print Network [OSTI]

Nuclear Medicine CT Angiography Stress Testing Rotation The Nuclear Medicine/CT angiography. Understand the indications for exercise treadmill testing and specific nuclear cardiology tests, safe use Level 2 proficiency in performing and interpreting cardiac nuclear imaging tests. Progression

Ford, James


Nuclear Forensics | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

Forensics | National Nuclear Security Administration Forensics | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Nuclear Forensics Home > About Us > Our Programs > Emergency Response > Responding to Emergencies > Nuclear Forensics Nuclear Forensics Forensics Operations The National Technical Nuclear Forensics (NTNF) program is a Homeland Security Council and National Security


Nuclear structure and nuclear reactions | Argonne Leadership...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

the production Automatic Dynamic Load Balancing (ADLB) library on the BGP. Steve Pieper, Argonne National Laboratory Nuclear structure and nuclear reactions PI Name: James Vary PI...


Audit Report National Nuclear Security Administration Nuclear...  

Broader source: Energy.gov (indexed) [DOE]

National Nuclear Security Administration Nuclear Weapons Systems Configuration Management DOEIG-0902 March 2014 U.S. Department of Energy Office of Inspector General Office of...


Nuclear Resonance Fluorescence for Nuclear Materials Assay  

E-Print Network [OSTI]

to learn MCNPX and nuclear safeguards, Bill B. , Steve K. ,Introduction 1.1 Nuclear Safeguards . . . . . . . . . . . .Programme to IAEA Safeguards. STUK-YTO-TR 170. Helsinki

Quiter, Brian Joseph


Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Civilian Nuclear Programs  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Civilian Nuclear Programs Civilian Nuclear Programs Civilian Nuclear Programs Los Alamos is committed to using its advanced nuclear expertise and unique facilities to meet the civilian nuclear national security demands of the future. CONTACT US Program Director Bruce Robinson (505) 667-1910 Email Los Alamos partners extensively with other laboratories, universities, industry, and the international nuclear community to address real-world technical challenges The Civilian Nuclear Programs Office is the focal point for nuclear energy research and development and next-generation repository science at Los Alamos National Laboratory. The Civilian Nuclear Programs Office manages projects funded by the Department of Energy's offices of Nuclear Energy Environmental Management Nuclear Regulatory Commission


Theory of nuclear reactions  

SciTech Connect (OSTI)

The book presents a theory of nuclear reaction. An account is given of the nonrelativistic nuclear reaction theory. The R - matrix description of nuclear reactions is considered and the dispersion method is formulated. Mechanisms of nuclear reactions and their relationship are studied in detail. Attention is paid to nuclear reactions involving the compound nuclear formation and to direct nuclear processes. The optical model the diffraction approach and high - energy diffraction nuclear processes involving composite particles are discussed.

Sitenko, A.G.



Technical solutions to nonproliferation challenges  

SciTech Connect (OSTI)

The threat of nuclear terrorism is real and poses a significant challenge to both U.S. and global security. For terrorists, the challenge is not so much the actual design of an improvised nuclear device (IND) but more the acquisition of the special nuclear material (SNM), either highly enriched uranium (HEU) or plutonium, to make the fission weapon. This paper provides two examples of technical solutions that were developed in support of the nonproliferation objective of reducing the opportunity for acquisition of HEU. The first example reviews technologies used to monitor centrifuge enrichment plants to determine if there is any diversion of uranium materials or misuse of facilities to produce undeclared product. The discussion begins with a brief overview of the basics of uranium processing and enrichment. The role of the International Atomic Energy Agency (IAEA), its safeguard objectives and how the technology evolved to meet those objectives will be described. The second example focuses on technologies developed and deployed to monitor the blend down of 500 metric tons of HEU from Russia's dismantled nuclear weapons to reactor fuel or low enriched uranium (LEU) under the U.S.-Russia HEU Purchase Agreement. This reactor fuel was then purchased by U.S. fuel fabricators and provided about half the fuel for the domestic power reactors. The Department of Energy established the HEU Transparency Program to provide confidence that weapons usable HEU was being blended down and thus removed from any potential theft scenario. Two measurement technologies, an enrichment meter and a flow monitor, were combined into an automated blend down monitoring system (BDMS) and were deployed to four sites in Russia to provide 24/7 monitoring of the blend down. Data was downloaded and analyzed periodically by inspectors to provide the assurances required.

Satkowiak, Lawrence [Director, Nonproliferation, Safeguards and Security Programs, Oak Ridge National Laboratory, Oak Ridge, Tennessee (United States)



Learning Nuclear Science with Marbles  

Science Journals Connector (OSTI)

Nuclei are small: if an atom was the size of a football field the nucleus would be an apple sitting on the 50?yd line. At the same time nuclei are dense: the Earth compressed to nuclear density could fit inside four Sears Towers. The subatomic level is strange and exotic. For that reason it's not hard to get young minds excited about nuclear science. But how does one move beyond analogies like those above and offer a better understanding of the extraordinary world of the nucleus? This is the challenge faced by the outreach program at Michigan State University's National Superconducting Cyclotron Laboratory (NSCL) a National Science Foundation?supported facility specializing in the creation and study of rare isotopes. It was necessary to devise a model of the nucleus that students could interact with and even use to approximate the nuclear reactions that create exotic nuclei. The solution was to use magnetic marbles.

Zach Constan



Energy Gap in Nuclear Matter  

Science Journals Connector (OSTI)

The magnitude of the energy gap in nuclear matter associated with a highly correlated ground state of of the type believed to be important in the theory of superconductivity has been evaluated theoretically. The integral equation of Cooper, Mills, and Sessler is linearized and transformed into a form suitable for numerical solution. The energy gap, calculated by using an appropriate single-particle potential and the Gammel-Thaler two-body potential, is found to be a very strong function of the density of nuclear matter, and of the effective mass at the Fermi surface. It is concluded that the magnitude of the energy gap for nuclear matter should not be compared directly with experimental values for finite nuclei, although the results suggest that if the theory is extended to apply to finite nuclei it probably would be in agreement with experiment.

V. J. Emery and A. M. Sessler



Nuclear photonics  

SciTech Connect (OSTI)

With the planned new {gamma}-beam facilities like MEGa-ray at LLNL (USA) or ELI-NP at Bucharest (Romania) with 10{sup 13}{gamma}/s and a band width of {Delta}E{gamma}/E{gamma} Almost-Equal-To 10{sup -3}, a new era of {gamma} beams with energies up to 20MeV comes into operation, compared to the present world-leading HI{gamma}S facility at Duke University (USA) with 10{sup 8}{gamma}/s and {Delta}E{gamma}/E{gamma} Almost-Equal-To 3 Dot-Operator 10{sup -2}. In the long run even a seeded quantum FEL for {gamma} beams may become possible, with much higher brilliance and spectral flux. At the same time new exciting possibilities open up for focused {gamma} beams. Here we describe a new experiment at the {gamma} beam of the ILL reactor (Grenoble, France), where we observed for the first time that the index of refraction for {gamma} beams is determined by virtual pair creation. Using a combination of refractive and reflective optics, efficient monochromators for {gamma} beams are being developed. Thus, we have to optimize the total system: the {gamma}-beam facility, the {gamma}-beam optics and {gamma} detectors. We can trade {gamma} intensity for band width, going down to {Delta}E{gamma}/E{gamma} Almost-Equal-To 10{sup -6} and address individual nuclear levels. The term 'nuclear photonics' stresses the importance of nuclear applications. We can address with {gamma}-beams individual nuclear isotopes and not just elements like with X-ray beams. Compared to X rays, {gamma} beams can penetrate much deeper into big samples like radioactive waste barrels, motors or batteries. We can perform tomography and microscopy studies by focusing down to {mu}m resolution using Nuclear Resonance Fluorescence (NRF) for detection with eV resolution and high spatial resolution at the same time. We discuss the dominating M1 and E1 excitations like the scissors mode, two-phonon quadrupole octupole excitations, pygmy dipole excitations or giant dipole excitations under the new facet of applications. We find many new applications in biomedicine, green energy, radioactive waste management or homeland security. Also more brilliant secondary beams of neutrons and positrons can be produced.

Habs, D.; Guenther, M. M.; Jentschel, M.; Thirolf, P. G. [Ludwig-Maximilians-Universitaet Muenchen, D-85748 Garching (Germany); Max Planck Institut fuer Quantenoptik, D-85748 Garching (Germany); Institut Laue-Langevin, F-38042 Grenoble (Germany); Ludwig-Maximilians-Universitaet Muenchen, D-85748 Garching (Germany)



Nuclear Hydrogen Initiative  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Advanced Nuclear Research Advanced Nuclear Research Office of Nuclear Energy, Science and Technology FY 2003 Programmatic Overview Nuclear Hydrogen Initiative Nuclear Hydrogen Initiative Office of Nuclear Energy, Science and Technology Henderson/2003 Hydrogen Initiative.ppt 2 Nuclear Hydrogen Initiative Nuclear Hydrogen Initiative Program Goal * Demonstrate the economic commercial-scale production of hydrogen using nuclear energy by 2015 Need for Nuclear Hydrogen * Hydrogen offers significant promise for reduced environmental impact of energy use, specifically in the transportation sector * The use of domestic energy sources to produce hydrogen reduces U.S. dependence on foreign oil and enhances national security * Existing hydrogen production methods are either inefficient or produce


Nuclear / Radiological Advisory Team | National Nuclear Security  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

/ Radiological Advisory Team | National Nuclear Security / Radiological Advisory Team | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Nuclear / Radiological Advisory Team Home > About Us > Our Programs > Emergency Response > Responding to Emergencies > Operations > Nuclear / Radiological Advisory Team Nuclear / Radiological Advisory Team


Nuclear Nonproliferation Program Offices | National Nuclear Security  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Nonproliferation Program Offices | National Nuclear Security Nonproliferation Program Offices | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Nuclear Nonproliferation Program Offices Home > About Us > Our Programs > Nonproliferation > Nuclear Nonproliferation Program Offices Nuclear Nonproliferation Program Offices One of the gravest threats the United States and the international


Nuclear Nonproliferation Program Offices | National Nuclear Security  

National Nuclear Security Administration (NNSA)

Nonproliferation Program Offices | National Nuclear Security Nonproliferation Program Offices | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Nuclear Nonproliferation Program Offices Home > About Us > Our Programs > Nonproliferation > Nuclear Nonproliferation Program Offices Nuclear Nonproliferation Program Offices One of the gravest threats the United States and the international


Nuclear Systems Technology | Nuclear Science | ORNL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Advanced Fuel Cycle Systems Criticality Safety Irradiation Experiment Development and Execution Robotics & Remote Systems Engineering and Applications Thermal & Hydraulic Experiments & Analysis Used Nuclear Fuel Storage, Transportation, and Disposal Reactor Technology Nuclear Science Home | Science & Discovery | Nuclear Science | Research Areas | Nuclear Systems Technology SHARE Nuclear Systems Technology Nuclear Systems Technology Image 2 ORNL has had historic involvement in a broad set of nuclear research areas: irradiated materials and isotopes R&D, fission and fusion reactors development, neutron scattering, fuel enrichment, used fuel recycling and disposal, etc. The skills and knowledge required to succeed in these research areas often cultivated core areas of expertise in which ORNL is


Thermodynamics of dilute solutions  

Science Journals Connector (OSTI)

Thermodynamics of dilute solutions ... The development of the necessary thermodynamic equations directly in terms of molality is not common ... ...

Gabor Jancso; David V. Fenby



Nuclear power, nuclear eapons link argued  

Science Journals Connector (OSTI)

Nuclear power, nuclear eapons link argued ... The problem of the spread of nuclear weapons to nations not currently possessing them—so-called horizontal proliferation—often is linked to development of commercial nuclear power. ... However, John P. Holdren, professor of energy and resources at the University of California, Berkeley, maintains that commercial nuclear power is linked intimately to horizontal proliferation and that the development of alternative energy technologies is crucial to prevent the spread. ...



The Nuclear Revolution, Relative Gains, and International Nuclear Assistance  

E-Print Network [OSTI]

international nuclear assistance dataset, this article findsinternational nuclear assistance dataset. Table 2 presentsinternational nuclear assistance dataset. Table 3 presents

Kroenig, Matthew



Nuclear Forces  

Science Journals Connector (OSTI)

One-meson-exchange Feynman diagrams are nonrelativistically reduced and unitarized via Schrödinger's equation. Properties of nucleon-nucleon scattering are calculated at incident laboratory energies of 25-310 MeV. Bound-state properties of the deuteron and of nuclear matter are also calculated. Mesons included are the ?, ?, ?, ?, ?, and ?. Very good over-all agreement with the experimental data is obtained. Important features of this "potential" include its momentum dependence, properly treated, and the contribution of the ? "meson," which qualitatively changes the central/tensor force ratio from that of previous phenomenological potentials.

Lester Ingber



Nuclear Waffles  

E-Print Network [OSTI]

The dense neutron-rich matter found in supernovae and neutron stars is expected to form complex nonuniform phases referred to as nuclear pasta. The pasta shapes depend on density, temperature and proton fraction and determine many transport properties in supernovae and neutron star crusts. We use two recently developed hybrid CPU/GPU codes to perform large scale molecular dynamics (MD) simulations with $51200$ and $409600$ nucleons of nuclear pasta. From the output of the MD simulations we characterize the topology and compute two observables, the radial distribution function $g(r)$ and the structure factor $S(q)$, for systems with proton fractions $Y_p=0.10, 0.20, 0.30$ and $0.40$ at about one third of nuclear saturation density and temperatures near $1.0$ MeV. We observe that the two lowest proton fraction systems simulated, $Y_p=0.10$ and $0.20$, equilibrate quickly and form liquid-like structures. Meanwhile, the two higher proton fraction systems, $Y_p=0.30$ and $0.40$, take a longer time to equilibrate and organize themselves in solid-like periodic structures. Furthermore, the $Y_p=0.40$ system is made up of slabs, lasagna phase, interconnected by defects while the $Y_p=0.30$ systems consist of a stack of perforated plates, the nuclear waffle phase. The periodic configurations observed in our MD simulations for proton fractions $Y_p\\ge0.30$ have important consequences for the structure factors $S(q)$ of protons and neutrons, which relate to many transport properties of supernovae and neutron star crust. A detailed study of the waffle phase and how its structure depends on temperature, size of the simulation and the screening length showed that finite-size effects appear to be under control and, also, that the plates in the waffle phase merge at temperatures slightly above $1.0$ MeV and the holes in the plates form an hexagonal lattice at temperatures slightly lower than $1.0$ MeV.

A. S. Schneider; D. K. Berry; C. M. Briggs; M. E. Caplan; C. J. Horowitz



Enertech partners with CCI Thermal Technologies on nuclear filtration  

Science Journals Connector (OSTI)

Curtiss-Wright Flow Control Co's Enertech business unit and CCI Thermal Technologies Inc have signed an agreement to work together to provide heating and filtration solutions and products to the nuclear industry worldwide.



Investigation of Peptide Folding by Nuclear Magnetic Resonance Spectroscopy  

E-Print Network [OSTI]

. Solution-state nuclear magnetic resonance (NMR) is a powerful technique to investigate protein structure, dynamics, and folding mechanisms, since it provides residue-specific information. One of the major contributions that govern protein structure appears...

Hwang, SoYoun



Global Nuclear Energy Partnership Fact Sheet - Minimize Nuclear...  

Broader source: Energy.gov (indexed) [DOE]

Minimize Nuclear Waste Global Nuclear Energy Partnership Fact Sheet - Minimize Nuclear Waste GNEP will increase the efficiency in the management of used nuclear fuel, also known as...


Process for recovery of palladium from nuclear fuel reprocessing wastes  

DOE Patents [OSTI]

Palladium is selectively removed from spent nuclear fuel reprocessing waste by adding sugar to a strong nitric acid solution of the waste to partially denitrate the solution and cause formation of an insoluble palladium compound. The process includes the steps of: (a) adjusting the nitric acid content of the starting solution to about 10 M; (b) adding 50% sucrose solution in an amount sufficient to effect the precipitation of the palladium compound; (c) heating the solution at reflux temperature until precipitation is complete; and (d) centrifuging the solution to separate the precipitated palladium compound from the supernatant liquid.

Campbell, D.O.; Buxton, S.R.


Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Secretary Chu Announces Blue Ribbon Commission on America's Nuclear Future  

Broader source: Energy.gov (indexed) [DOE]

Blue Ribbon Commission on America's Nuclear Blue Ribbon Commission on America's Nuclear Future Secretary Chu Announces Blue Ribbon Commission on America's Nuclear Future January 29, 2010 - 12:00am Addthis Washington, D.C. - As part of the Obama Administration's commitment to restarting America's nuclear industry, U.S. Secretary of Energy Steven Chu today announced the formation of a Blue Ribbon Commission on America's Nuclear Future to provide recommendations for developing a safe, long-term solution to managing the Nation's used nuclear fuel and nuclear waste. The Commission is being co-chaired by former Congressman Lee Hamilton and former National Security Advisor Brent Scowcroft. In light of the Administration's decision not to proceed with the Yucca Mountain nuclear waste repository, President Obama has directed Secretary


SRS - Website Map  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

1/2011 1/2011 SEARCH GO menu spacer SRS Home Savannah River Site Website Map About SRS Mission & Vision Where We Are SRS History Fact Sheets Tour SRS Contact SRS SRS Organizations Savannah River Nuclear Solutions, LLC (SRNS) Savannah River Remediation LLC (SRR) Savannah River Ecology Laboratory (SREL) USDA Forest Service - Savannah River Wackenhut Services, Inc. Mixed Oxide Fuel Fabrication Facility (MOX) Parsons Related Links & Resources Department of Energy (DOE) Department of Energy - Environmental Management (DOE-EM) National Nuclear Security Administration (NNSA) American Recovery & Reinvestment Act (ARRA) News News Releases Video Releases Fact Sheets Photo Gallery Speakers Media Contacts Business Opportunities Community Reuse Organization Technology Transfer Savannah River National Laboratory (SRNL)


Independent Oversight Review, Savannah River Site - August 2011 |  

Broader source: Energy.gov (indexed) [DOE]

August 2011 August 2011 Independent Oversight Review, Savannah River Site - August 2011 August 2011 Review of Commercial Grade Dedication Plans for the Safety Instrumented System at the Savannah River Site Waste Solidification Building Project The Office of Enforcement and Oversight (Independent Oversight) within the Office of Health, Safety and Security (HSS), conducted an independent review of selected aspects of Savannah River Nuclear Solutions' (SRNS) plans for commercial grade dedication (CGD) of the Waste Solidification Building (WSB) Safety Instrumented System (SIS) safety significant components at the Savannah River Site (SRS). The independent review was conducted during June 14-24 and July 12-13, 2011, by Independent Oversight in coordination with the U.S. Department of Energy and the National Nuclear


Nuclear radiation electronic gear (continued)  

Science Journals Connector (OSTI)

Nuclear radiation electronic gear (continued) ... Examines nuclear instrumentation available from several major U.S. manufacturers. ... Nuclear / Radiochemistry ...

S. Z. Lewin



Innovations in Nuclear Infrastructure  

Broader source: Energy.gov (indexed) [DOE]

Innovations in Nuclear Infrastructure Innovations in Nuclear Infrastructure and Education (INIE) Innovations in Nuclear Infrastructure and Education (INIE) Presented to the Nuclear Energy Research Advisory Committee Crystal City, Virginia John Gutteridge Director, University Programs Office of Nuclear Energy, Science and Technology September 30 - October 1, 2002 Office of Nuclear Energy, Science and Technology Gutteridge/Sep-Oct_02 INIE-NERAC.ppt (2) INIE The Stimuli .... INIE The Stimuli .... 6 Declining number of operating university research/training reactors 6 Dwindling student population in nuclear engineering 6 Closing or loss of identity of university nuclear engineering programs 6 Looming shortage of nuclear engineering graduates 6 Threat of additional reactor closures -- Cornell, Michigan, MIT


Reconversion of nuclear weapons  

E-Print Network [OSTI]

The nuclear predicament or nuclear option. Synopsis of three lectures : 1- The physical basis of nuclear technology. Physics of fission. Chain reaction in reactors and weapons. Fission fragments. Separration of isotopes. Radiochemistry.2- Nuclear reactors with slow and fast neutrons. Power, size, fuel and waste. Plutonium production. Dose rate, shielding and health hazard. The lessons of Chernobyl3- Nuclear weapons. Types, energy, blast and fallout. Fusion and hydrogen bombs. What to do with nuclear weapons when you cannot use them? Testing. Nonmilittary use. Can we get rid of the nuclear weapon? Nuclear proliferation. Is there a nuclear future?

Kapitza, Sergei P



Nuclear Security Enterprise | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

Enterprise | National Nuclear Security Administration Enterprise | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Nuclear Security Enterprise Home > About Us > Our Programs > Defense Programs > Nuclear Security Enterprise Nuclear Security Enterprise The Nuclear Security Enterprise (NSE) mission is to ensure the Nation sustains a safe, secure, and effective nuclear deterrent through the


Extraction of cesium and strontium from nuclear waste  

DOE Patents [OSTI]

Cesium is extracted from acidified nuclear waste by contacting the waste with a bis 4,4'(5) [1-hydroxy-2-ethylhexyl]benzo 18-crown-6 compound and a cation exchanger in a matrix solution. Strontium is extracted from acidified nuclear waste by contacting the waste with a bis 4,4'(5') [1-hydroxyheptyl]cyclohexo 18-crown-6 compound, and a cation exchanger in a matrix solution.

Davis, Jr., Milton W. (Lexington, SC); Bowers, Jr., Charles B. (Columbia, SC)



National Nuclear Data Center  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Internal Radiation Dose Evaluated Nuclear (reaction) Data File Experimental nuclear reaction data Sigma Retrieval & Plotting Nuclear structure & decay Data Nuclear Science References Experimental Unevaluated Nuclear Data List Evaluated Nuclear Structure Data File NNDC databases Ground and isomeric states properties Nuclear structure & decay data journal Nuclear reaction model code Tools and Publications US Nuclear Data Program Cross Section Evaluation Working Group Nuclear data networks Basic properties of atomic nuclei Parameters & thermal values Basic properties of atomic nuclei Internal Radiation Dose Evaluated Nuclear (reaction) Data File Experimental nuclear reaction data Sigma Retrieval & Plotting Nuclear structure & decay Data Nuclear Science References Experimental Unevaluated Nuclear Data List Evaluated Nuclear Structure Data File NNDC databases Ground and isomeric states properties Nuclear structure & decay data journal Nuclear reaction model code Tools and Publications US Nuclear Data Program Cross Section Evaluation Working Group Nuclear data networks Basic properties of atomic nuclei Parameters & thermal values Basic properties of atomic nuclei Homepage BNL Home Site Index - Go USDNP and CSEWG November 18-22! USNDP CSEWG Agenda Thanks for attending! EXFOR 20,000 Milestone EXFOR Milestone 20,000 experimental works are now in the EXFOR database!



E-Print Network [OSTI]

waste management proceedings. Keywords Nuclear, nuclear power plant, spent fuel, nuclear waste, dataCALIFORNIA ENERGY COMMISSION INSTRUCTIONS FOR SUBMITTING NUCLEAR POWER PLANT-RELATED DATA of Submitted Data 3 NUCLEAR POWER PLANT DATA REQUESTS 6 A. Environmental Impacts 6 B. Spent Fuel Generation 8 C


If Terrorists Go Nuclear  

Science Journals Connector (OSTI)

...officials, two nuclear indus-try...urging the nuclear nations to...a terrorist attack is increasing...in the same risk category as...Prevention ofNuclear Terrorism," by the...to protect nuclear weapons against...security at civil plants. * As civil...The nuclear power industry should...




If Terrorists Go Nuclear  

Science Journals Connector (OSTI)

...officials, two nuclear indus-try...urging the nuclear nations to...terrorist attack is increasing...the same risk category...ofNuclear Terrorism," by the...to protect nuclear weapons against...aid U.S. security, O'Keefe...at civil plants. * As civil...The nuclear power industry...




Reactor & Nuclear Systems Publications | ORNL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Nuclear Science Home | Science & Discovery | Nuclear Science | Publications and Reports | Reactor and Nuclear Systems Publications SHARE Reactor and Nuclear Systems Publications...


Nuclear Forces and Nuclear Energetics  

Science Journals Connector (OSTI)

Both a static and a momentum-dependent potential are derived from one-meson-exchange Born amplitudes, and are adjusted to fit (i) the deuteron binding energy and quadrupole moment, (ii) S, P, and D partial waves from 25 to 310 MeV, and (iii) the binding energy and saturation property of nuclear matter. This is possible through a different form of the central and tensor potentials which has not been used previously to calculate problems (i), (ii), and (iii) above. We find the ? meson unsuitable to describe the two-pion-exchange region in that a potential with meson parameters common to all partial waves is not achieved.

Lester Ingber



Microsoft PowerPoint - NanoAnode for Li-ion Batteries SRNL-L9100-2009-00153p1.ppt  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Nanostructured Anodes for Lithium-Ion Nanostructured Anodes for Lithium-Ion Batteries at a glance  patent pending  increase energy density  longer cyclic life  replaces graphite anodes  simple and lower cost manufacturing Current carbon-based anodes are fabricated through a series of processes of mixing carbon, binder and conductive additives in organic solution, pasting the slurry on current collector and baking to remove solvent. It involves intensive labor, fire safety and environment emission control resulting in high cost. Background Savannah River Nuclear Solutions (SRNS), managing contractor of the Savannah River Site (SRS) for the Department of Energy, has developed new anodes for lithium-ion batteries that are reported to increase the energy density four-fold. It is


Nuclear Power  

E-Print Network [OSTI]

of electrical grid system on the other hand. Clean coal is a secure source for long term. However the deployment of clean technologies and industrial implementation of CO2 capture have to be waited for quite a long time. One of possible option for clean... of renewable sources is one, but not the only solution due to the low energy density, large land demand on the one hand, and immaturity of some technologies and operating limitations of electrical grid system on the other hand. Clean coal is a secure source...


Nuclear power: an outlook  

Science Journals Connector (OSTI)

Nuclear power: an outlook ... For nuclear power to regain public acceptance and investor confidence, the nation's nuclear plants must sustain an unblemished safety record, reflecting an industrywide commitment to the highest professional standards. ...



Press Release: Nuclear Power  

Science Journals Connector (OSTI)

Two nuclear physicists, a nuclear engineer, and an economistmmembers of the Union of Concerned Scientists--released a report today that examined a new problem with nuclear reactor safety. According to the repo...

Henry W. Kendall



Nuclear Data Links  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Links to Other Useful Sites Online Journals Institutions and Programs Related to Nuclear Physics U.S. Nuclear Data Program: All evaluated nuclear data supported by the U.S....


Nuclear functions of prefoldin  

Science Journals Connector (OSTI)

...original author and source are credited. Nuclear functions of prefoldin Gonzalo Millan-Zambrano...and are functionally connected with nuclear processes in yeast and metazoa. Plant...available on the involvement of prefoldin in nuclear phenomena, place special emphasis on...


Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Nuclear Workforce Initiative - SRSCRO  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

nuclear Nuclear Workforce Initiative The United States stands on the brink of a nuclear renaissance - a resurging confidence in the power of the clean, safe atom to finally conquer...


Nuclear chemistry at Harvard  

Science Journals Connector (OSTI)

Nuclear chemistry at Harvard ... This article points out the potential of the chemistry department at Harvard University for research in nuclear chemistry for students who wish to do work in the field for the Ph.D. degree. ... Nuclear / Radiochemistry ...

Geoffrey Wilkinson; Richard M. Diamond; Eugene G. Rochow



Nuclear Explosive Safety  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

The Order establishes requirements to implement the nuclear explosive safety (NES) elements of DOE O 452.1E, Nuclear Explosive and Weapon Surety Program, for routine and planned nuclear explosive operations (NEOs).



Nuclear Explosive Safety  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

This Department of Energy (DOE) Order establishes requirements to implement the nuclear explosive safety (NES) elements of DOE O 452.1E, Nuclear Explosive and Weapon Surety Program, or successor directive, for routine and planned nuclear explosive operations (NEOs).



High Energy Nuclear Events  

Science Journals Connector (OSTI)

......research-article Articles High Energy Nuclear Events Enrico Fermi Institute...Distribution of Pions produced in High Energy Nuclear Collisions Yoshihiro Yamamoto...Possible Interpretation of High Energy Nuclear Events Nobuo Yajima, Shuji Takagi......

Enrico Fermi



Solution deposition assembly  

DOE Patents [OSTI]

Methods and devices are provided for improved deposition systems. In one embodiment of the present invention, a deposition system is provided for use with a solution and a substrate. The system comprises of a solution deposition apparatus; at least one heating chamber, at least one assembly for holding a solution over the substrate; and a substrate curling apparatus for curling at least one edge of the substrate to define a zone capable of containing a volume of the solution over the substrate. In another embodiment of the present invention, a deposition system for use with a substrate, the system comprising a solution deposition apparatus; at heating chamber; and at least assembly for holding solution over the substrate to allow for a depth of at least about 0.5 microns to 10 mm.

Roussillon, Yann; Scholz, Jeremy H; Shelton, Addison; Green, Geoff T; Utthachoo, Piyaphant



Nuclear Fuel Cycle & Vulnerabilities  

SciTech Connect (OSTI)

The objective of safeguards is the timely detection of diversion of significant quantities of nuclear material from peaceful nuclear activities to the manufacture of nuclear weapons or of other nuclear explosive devices or for purposes unknown, and deterrence of such diversion by the risk of early detection. The safeguards system should be designed to provide credible assurances that there has been no diversion of declared nuclear material and no undeclared nuclear material and activities.

Boyer, Brian D. [Los Alamos National Laboratory



Nuclear Security 101 | National Nuclear Security Administration  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

101 | National Nuclear Security Administration 101 | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Home > Media Room > Fact Sheets > Nuclear Security 101 Fact Sheet Nuclear Security 101 Mar 23, 2012 The goal of United States Government's nuclear security programs is to prevent the illegal possession, use or transfer of nuclear material,


Nuclear Security | National Nuclear Security Administration  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

| National Nuclear Security Administration | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Nuclear Security Home > About Us > Our Programs > Nuclear Security Nuclear Security The Office of Defense Nuclear Security (DNS) is responsible for the development and implementation of security programs for NNSA. In this capacity, DNS is the NNSA line management organization responsible for


Nuclear Security 101 | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

101 | National Nuclear Security Administration 101 | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Home > Media Room > Fact Sheets > Nuclear Security 101 Fact Sheet Nuclear Security 101 Mar 23, 2012 The goal of United States Government's nuclear security programs is to prevent the illegal possession, use or transfer of nuclear material,


Nuclear Security | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

| National Nuclear Security Administration | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Nuclear Security Home > About Us > Our Programs > Nuclear Security Nuclear Security The Office of Defense Nuclear Security (DNS) is responsible for the development and implementation of security programs for NNSA. In this capacity, DNS is the NNSA line management organization responsible for


Nuclear Structure and Nuclear Reactions | Argonne Leadership...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

the ab initio no-core full configuration approach," Phys. Rev. C 86, 034325 (2012) Nuclear Structure and Nuclear Reactions PI Name: James Vary PI Email: jvary@iastate.edu...


Nuclear Structure and Nuclear Reactions | Argonne Leadership...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

value of 92.16 MeV and the point rms radius is 2.35 fm vs 2.33 from experiment. Nuclear Structure and Nuclear Reactions PI Name: James Vary PI Email: jvary@iastate.edu...


Nuclear Quadrupole Moments and Nuclear Shell Structure  

DOE R&D Accomplishments [OSTI]

Describes a simple model, based on nuclear shell considerations, which leads to the proper behavior of known nuclear quadrupole moments, although predictions of the magnitudes of some quadrupole moments are seriously in error.

Townes, C. H.; Foley, H. M.; Low, W.



Solution 3 - Spring 2011  

E-Print Network [OSTI]

Neglecting air resistance, find the maximum height above the roadway which the particle can reach. Solution: (by Shuhao Cao, Graduate student, Mathematics).


International Nuclear Security | National Nuclear Security Administrat...  

National Nuclear Security Administration (NNSA)

Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure...


Nuclear Forensics | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure...


6 Nuclear Fuel Designs  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Message from the Director Message from the Director 2 Nuclear Power & Researrh Reactors 3 Discovery of Promethium 4 Nuclear Isotopes 4 Nuclear Medicine 5 Nuclear Fuel Processes & Software 6 Nuclear Fuel Designs 6 Nuclear Safety 7 Nuclear Desalination 7 Nuclear Nonproliferation 8 Neutron Scattering 9 Semiconductors & Superconductors 10 lon-Implanted Joints 10 Environmental Impact Analyses 11 Environmental Quality 12 Space Exploration 12 Graphite & Carbon Products 13 Advanced Materials: Alloys 14 Advanced Materials: Ceramics 15 Biological Systems 16 Biological Systems 17 Computational Biology 18 Biomedical Technologies 19 Intelligent Machines 20 Health Physics & Radiation Dosimetry 21 Radiation Shielding 21 Information Centers 22 Energy Efficiency: Cooling & Heating


LANL | Physics | Nuclear Physics  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Leaders in nuclear physics Physics Division scientists and engineers play an important role in the Laboratory's Nuclear Physics program, funded by the Department of Energy's Office...


Nuclear Energy Advisory Committee  

Broader source: Energy.gov [DOE]

The Nuclear Energy Advisory Committee (NEAC), formerly the Nuclear Energy Research Advisory Committee (NERAC), was established on October 1, 1998, to provide independent advice to the Office of...

Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Nuclear Safety Regulatory Framework  

Energy Savers [EERE]

Department of Energy Nuclear Safety Regulatory Framework DOE's Nuclear Safety Enabling Legislation Regulatory Enforcement & Oversight Regulatory Governance Atomic Energy Act 1946...


Assessment of Nuclear Resonance Fluorescence for Spent Nuclear Fuel Assay  

E-Print Network [OSTI]

Security of the National Nuclear Security Administration, USof Energys National Nuclear Security Administration (NNSA)

Quiter, Brian



Accelerator Driven Nuclear Energy - The Thorium Option  

ScienceCinema (OSTI)

Conventional nuclear reactors use enriched Uranium as fuel and produce nuclear waste which needs to be stored away for over 10,000 years.   At the current rate of use, existing sources of Uranium will last for 50-100 years.  We describe a solution to the problem that uses particle accelerators to produce fast neutrons that can be used to burn existing nuclear waste and produce energy.  Such systems, initially proposed by Carlo Rubbia and collaborators in the 1990's, are being seriously considered by many countries as a possible solution to the green energy problem.  Accelerator driven reactors operate in a sub-critical regime and, thus, are safer and can obtain energy from plentiful elements such as Thorium-232 and Uranium-238. What is missing is the high intensity (10MW) accelerator that produces 1 GeV protons. We will describe scenarios which if implemented will make such systems a reality.  

Rajendran Raja



Principal Media Contact: DT Townsend Savannah River Nuclear Solutions, LLC  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Registration for the 2014 SRS Registration for the 2014 SRS Public Tour Program Begins December 30 AIKEN, S.C. (Dec. 16, 2013) - Registration for the Savannah River Site's 2014 public tour program will begin Monday, Dec. 30. More than 1,000 seats will be available during 22 tours to be held throughout the upcoming year at the Department of Energy site near Aiken, S.C. Driving tours are offered each year at SRS to provide members of the public an opportunity to see many of the site's facilities and learn more about the site's history, current activities and future missions. The first of the tours will be held in January. Each tour starts at the Aiken County Applied Research Center located off Highway 278, near New Ellenton, and begins with an overview pre- sentation about SRS and a safety briefing.


Principal Media Contact: DT Townsend Savannah River Nuclear Solutions, LLC  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Children to Benefit Children to Benefit from SRS "Toys for Tots" Campaign Over two decades of toy collection merit special celebration AIKEN, S.C. (Dec. 12, 2013) - Employees at the Department of Energy's Savannah River Site (SRS) are celebrating more than 20 years of supporting the U.S. Marine Reserves Toys for Tots campaign with the collection of more than 15,000 toys this year alone and over 220,000 toys since the start of SRS Toys for Tots campaigns in 1991. "Many families throughout the Central Savannah River Area have been hit hard by the continu- ing recession," said Julie Kirby, Chair, SRS Toys for Tots Campaign. "Our hearts and now our gifts go out to those in need, many of whom consist of the working poor and single mothers. We hope to brighten Christmas day for their children and lighten the burden they carry day to day."


Preliminary Notice of Violation, Savannah River Nuclear Solutions...  

Office of Environmental Management (EM)

August 18, 2009, and an electrical arc flash event with that occurred in the D Area powerhouse on September 23, 2009, at the Savannah River Site. Preliminary Notice of Violation,...


Office of Nuclear Safety  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Office of Nuclear Safety (HS-30) Office of Nuclear Safety (HS-30) Office of Nuclear Safety Home » Directives » Nuclear and Facility Safety Policy Rules » Nuclear Safety Workshops Technical Standards Program » Search » Approved Standards » Recently Approved » RevCom for TSP » Monthly Status Reports » Archive » Feedback DOE Nuclear Safety Research & Development Program Office of Nuclear Safety Basis & Facility Design (HS-31) Office of Nuclear Safety Basis & Facility Design - About Us » Nuclear Policy Technical Positions/Interpretations » Risk Assessment Working Group » Criticality Safety » DOE O 420.1C Facility Safety » Beyond Design Basis Events Office of Nuclear Facility Safety Programs (HS-32) Office of Nuclear Facility Safety Programs - About Us


Dispersant solutions for dispersing hydrocarbons  

DOE Patents [OSTI]

A dispersant solution includes a hydrocarbon dispersing solution derived from a bacterium from ATCC 75527, ATCC 75529, or ATCC 55638.

Tyndall, R.L.



Alerting Humanitarians to Emergencies PARIS, Jan 12 (Reuters) -Europe could build a disputed experimental nuclear  

E-Print Network [OSTI]

, as opposed to today's nuclear reactors and weapons, which produce energy by splitting atoms apart. Fifty experimental nuclear fusion reactor on its own if the multinational joint venture promoting it decided to give. Nuclear fusion has been touted as a solution to the world's energy problems, as it would be low


Discretisation and solution of quasi-diffusion equations  

E-Print Network [OSTI]

DISCRETISATION AND SOLUTION OF QUASI-DIFFUSION EQUATIONS A Thesis by NICOLAS DOMINIQUE VALETTE Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements for the degree of MASTER OF SCIENCE... August 2002 Major Subject: Nuclear Engineering DISCRETISATION AND SOLUTION OF QUASI-DIFFUSION EQUATIONS A Thesis by NICOLAS DOMINIQUE VALETTE Submitted to Texas A&M University in partial fu]fillment of the requirements for the degree of MASTER...

Valette, Nicolas Dominique



The Joys of Nuclear Engineering  

ScienceCinema (OSTI)

Nuclear fuels researcher Jon Carmack talks about the satisfactions of a career in nuclear engineering.

Jon Carmack



Secretary Chu Announces Blue Ribbon Commission on America's Nuclear  

Broader source: Energy.gov (indexed) [DOE]

Blue Ribbon Commission on America's Blue Ribbon Commission on America's Nuclear Future Secretary Chu Announces Blue Ribbon Commission on America's Nuclear Future January 29, 2010 - 12:57pm Addthis As part of the Obama Administration's commitment to restarting America's nuclear industry, U.S. Secretary of Energy Steven Chu today announced the formation of a Blue Ribbon Commission on America's Nuclear Future to provide recommendations for developing a safe, long-term solution to managing the Nation's used nuclear fuel and nuclear waste. The Commission is being co-chaired by former Congressman Lee Hamilton and former National Security Advisor Brent Scowcroft. In light of the Administration's decision not to proceed with the Yucca Mountain nuclear waste repository, President Obama has directed Secretary


Nuclear reactor  

DOE Patents [OSTI]

A nuclear reactor comprising a cylindrical pressure vessel, an elongated annular core centrally disposed within and spaced from the pressure vessel, and a plurality of ducts disposed longitudinally of the pressure vessel about the periphery thereof, said core comprising an annular active portion, an annular reflector just inside the active portion, and an annular reflector just outside the active a portion, said annular active portion comprising rectangular slab, porous fuel elements radially disposed around the inner reflector and extending the length of the active portion, wedge-shaped, porous moderator elements disposed adjacent one face of each fuel element and extending the length of the fuel element, the fuel and moderator elements being oriented so that the fuel elements face each other and the moderator elements do likewise, adjacent moderator elements being spaced to provide air inlet channels, and adjacent fuel elements being spaced to provide air outlet channels which communicate with the interior of the peripheral ducts, and means for introducing air into the air inlet channels which passes through the porous moderator elements and porous fuel elements to the outlet channel.

Thomson, Wallace B. (Severna Park, MD)



Advanced nuclear fuel  

SciTech Connect (OSTI)

Kurt Terrani uses his expertise in materials science to develop safer fuel for nuclear power plants.

Terrani, Kurt



TVA chooses nuclear power  

Science Journals Connector (OSTI)

TVA chooses nuclear power ... In giving the nod to a nuclear (over a coal) power generating station 10 days ago, TVA probably gave nuclear power its biggest boost to date. ... The $247 million nuclear power plant—a dual boiling-water reactor unit with a total capacity of 2.2 million kw(e).—will ...




Science Journals Connector (OSTI)

TERRORISM AND NUCLEAR POWER ... The attacks of Sept. 11 raise fear that U.S. nuclear power plants may be vulnerable ... THE TERRORIST ATTACKS ON THE World Trade Center and Pentagon are forcing a reexamination of the security of the nation's 103 nuclear power plants by nuclear's advocates and foes alike. ...




Nuclear Science & Engineering  

E-Print Network [OSTI]

. 1 Nuclear Science & Engineering Nuclear Energy Present and Future Ian H. Hutchinson Head, Department of Nuclear Science and Engineering CoPrincipal, Alcator Tokamak Project, Plasma Science and Fusion Center Massachusetts Institute of Technology Outline: Nuclear Power in the US and the World Limitations



Science Journals Connector (OSTI)

SPOTLIGHT ON NUCLEAR POWER ... TOUGHER RULES are needed to improve the safety of U.S. nuclear power facilities and to better protect the public from the type of disaster that occurred this spring at Japan’s Fukushima Daiichi nuclear energy plant, says a preliminary report released by the Nuclear Regulatory Commission (NRC) on July 12. ...




Advanced nuclear fuel  

ScienceCinema (OSTI)

Kurt Terrani uses his expertise in materials science to develop safer fuel for nuclear power plants.

Terrani, Kurt



Nuclear Waste: Knowledge Waste?  

Science Journals Connector (OSTI)

...06520, USA. Nuclear power is re-emerging...proclaiming a “nuclear renaissance...example, plant safety...liabilities, terrorism at plants and in transport...high-level nuclear wastes (HLW...factor in risk perceptions...supporting nuclear power in the abstract...

Eugene A. Rosa; Seth P. Tuler; Baruch Fischhoff; Thomas Webler; Sharon M. Friedman; Richard E. Sclove; Kristin Shrader-Frechette; Mary R. English; Roger E. Kasperson; Robert L. Goble; Thomas M. Leschine; William Freudenburg; Caron Chess; Charles Perrow; Kai Erikson; James F. Short


Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Global Nuclear Energy Partnership Fact Sheet - Develop Enhanced Nuclear  

Broader source: Energy.gov (indexed) [DOE]

Global Nuclear Energy Partnership Fact Sheet - Develop Enhanced Global Nuclear Energy Partnership Fact Sheet - Develop Enhanced Nuclear Safeguards Global Nuclear Energy Partnership Fact Sheet - Develop Enhanced Nuclear Safeguards GNEP will help prevent misuse of civilian nuclear facilities for nonpeaceful purposes by developing enhanced safeguards programs and technologies. International nuclear safeguards are integral to implementing the GNEP vision of a peaceful expansion of nuclear energy and demonstration of more proliferation-resistant fuel cycle technologies. Global Nuclear Energy Partnership Fact Sheet - Develop Enhanced Nuclear Safeguards More Documents & Publications GNEP Element:Develop Enhanced Nuclear Safeguards Global Nuclear Energy Partnership Fact Sheet Global Nuclear Energy Partnership Fact Sheet - Demonstrate Small-Scale


China's Scientific Investigation for Liquid Waste Treatment Solutions  

SciTech Connect (OSTI)

Post World War II created the nuclear age with several countries developing nuclear technology for power, defense, space and medical applications. China began its nuclear research and development programs in 1950 with the establishment of the China Institute of Atomic Energy (CIAE) located near Beijing. CIAE has been China's leader in nuclear science and technical development with its efforts to create advanced reactor technology and upgrade reprocessing technology. In addition, with China's new emphasis on environmental safety, CIAE is focusing on waste treatment options and new technologies that may provide solutions to legacy waste and newly generated waste from the full nuclear cycle. Radioactive liquid waste can pose significant challenges for clean up with various treatment options including encapsulation (cement), vitrification, solidification and incineration. Most, if not all, nuclear nations have found the treatment of liquids to be difficult, due in large part to the high economic costs associated with treatment and disposal and the failure of some methods to safely contain or eliminate the liquid. With new environmental regulations in place, Chinese nuclear institutes and waste generators are beginning to seek new technologies that can be used to treat the more complex liquid waste streams in a form that is safe for transport and for long-term storage or final disposal. [1] In 2004, CIAE and Pacific Nuclear Solutions, a division of Pacific World Trade, USA, began discussions about absorbent technology and applications for its use. Preliminary tests were conducted at CIAE's Department of Radiochemistry using generic solutions, such as lubricating oil, with absorbent polymers for solidification. Based on further discussions between both parties, it was decided to proceed with a more formal test program in April, 2005, and additional tests in October, 2005. The overall objective of the test program was to apply absorbent polymers to various waste streams to determine leach rates, stability (immobilization), effective bonding ratios, compression capability, waste minimization and effects of irradiation on the solidified samples. (authors)

Liangjin, B.; Meiqiong, L. [China Institute of Atomic Energy, P.O. Box 275(87), Beijing, 102413 (China); Kelley, D. [Pacific Nuclear Solutions, 450 East 96th Street, Suite 335, Indianapolis, Indiana 46240 (United States)



Modeling fabrication of nuclear components: An integrative approach  

SciTech Connect (OSTI)

Reduction of the nuclear weapons stockpile and the general downsizing of the nuclear weapons complex has presented challenges for Los Alamos. One is to design an optimized fabrication facility to manufacture nuclear weapon primary components in an environment of intense regulation and shrinking budgets. This dissertation presents an integrative two-stage approach to modeling the casting operation for fabrication of nuclear weapon primary components. The first stage optimizes personnel radiation exposure for the casting operation layout by modeling the operation as a facility layout problem formulated as a quadratic assignment problem. The solution procedure uses an evolutionary heuristic technique. The best solutions to the layout problem are used as input to the second stage - a simulation model that assesses the impact of competing layouts on operational performance. The focus of the simulation model is to determine the layout that minimizes personnel radiation exposures and nuclear material movement, and maximizes the utilization of capacity for finished units.

Hench, K.W.




Energy Savers [EERE]



Nuclear Science and Engineering | ornl.gov  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Supporting Organizations Nuclear Science Engineering Nuclear Science Home | Science & Discovery | Nuclear Science | Supporting Organizations | Nuclear Science Engineering SHARE...


Thermodynamics of a desalination system at nuclear power stations  

Science Journals Connector (OSTI)

Nuclear power engineering is developing steadily in industrial countries. This is caused by features of using nuclear fuel and high environmental safety of nuclear power stations. At the same time, the thermodynamic efficiency of nuclear power stations is lower than indices of thermal power stations operating on gas, coal or oil fuel. This efficiency does not usually exceed 30â??35%. Hence more than 60% of the energy of nuclear fuel being used escapes into the environment through turbine condensers at nuclear power stations. Cogeneration turbines that reduce heat loss by 20â??30% are used at thermal power stations for efficiency upgrading. However, cogeneration schemes have not found wide utility at nuclear power stations due to safety conditions. Thus, it is possible to use, in addition, a major part of nuclear fuel energy for desalination at nuclear power stations located on the coast. In this case, some main problems are solved: production of fresh water consumed by nuclear power station for technological purposes and sold to external consumers; upgrading of effectiveness of using nuclear fuel including the cost of steady operation of nuclear power stations at high loads; reduction of non-productive thermal pollutants from nuclear power stations into the environment. It is required to provide maximum upgrading of power station heat efficiency and high capacity of distillers when connecting desalination installations to the thermal scheme of nuclear power stations. The use of energy of the heat carrier's low-temperature flows being emitted by turbine condensers into the environment is of particular value. In this case, different thermodynamic analysis methods are used for the justification of optimal engineering solutions In the article under consideration some results of research of thermodynamics of cycles of nuclear power stations where thermal schemes includes different types of thermal desalination installations are given. From the analysis of thermodynamic processes carried out at nuclear power stations, recommendations related to improvement of desalination installations' thermal schemes providing power system efficiency upgrading have been obtained.

V.V. Slesarenko



Future Climate Engineering Solutions  

E-Print Network [OSTI]

Engineering Associations from around the world are part of the project `Future Climate - Engineering Solu- tions'. Within the project the participating associations have been developing national climate plansFuture Climate Engineering Solutions Joint report 13 engineering participating engeneering


Selected Solution 7  

E-Print Network [OSTI]

Selected Solutions. Math 341 Homework 7*. November 4, 2014. 1. (Alternating Series Test.) Take zn = 1/n2. Show that s2n = (z1 ? z2)+(z3 ? z4) + ··· + z2n?1 ...



Osmosis with active solutes  

E-Print Network [OSTI]

Despite much current interest in active matter, little is known about osmosis in active systems. Using molecular dynamics simulations, we investigate how active solutes perturb osmotic steady states. We find that solute activity increases the osmotic pressure, and can also expel solvent from the solution - i.e. cause reverse osmosis. The latter effect cannot be described by an effective temperature, but can be reproduced by mapping the active solution onto a passive one with the same degree of local structuring as the passive solvent component. Our results provide a basic framework for understanding active osmosis, and suggest that activity-induced structuring of the passive component may play a key role in the physics of active-passive mixtures.

Thomas W. Lion; Rosalind J. Allen



Osmosis with active solutes  

E-Print Network [OSTI]

Despite much current interest in active matter, little is known about osmosis in active systems. Using molecular dynamics simulations, we investigate how active solutes perturb osmotic steady states. We find that solute activity increases the osmotic pressure, and can also expel solvent from the solution - i.e. cause reverse osmosis. The latter effect cannot be described by an effective temperature, but can be reproduced by mapping the active solution onto a passive one with the same degree of local structuring as the passive solvent component. Our results provide a basic framework for understanding active osmosis, and suggest that activity-induced structuring of the passive component may play a key role in the physics of active-passive mixtures.

Lion, Thomas W



A Robust Solution Searching Scheme in Genetic Shigeyoshi Tsutsui1  

E-Print Network [OSTI]

of aerospace control system, nuclear power control system, where a kind of robustness against the perturbation of the environmental features are important. In nature, the phenotypic feature of an organism is determined from develop a genetic search scheme which can produce robust solutions. The proposed approach uses the effect

Tsutsui, Shigeyoshi


Nuclear Structure Aspects in Nuclear Astrophysics  

SciTech Connect (OSTI)

Nuclear Astrophysics as a broad and diverse field of study can be viewed as a magnifier of the impact of microscopic processes on the evolution of macroscopic events. One of the primary goals in Nuclear Astrophysics is the understanding of the nucleosynthesis processes that take place in the cosmos and the simulation of the correlated stellar and explosive burning scenarios. These simulations are strongly dependent on the input from Nuclear Physics which sets the time scale for all stellar dynamic processes--from giga-years of stellar evolution to milliseconds of stellar explosions--and provides the basis for most of the signatures that we have for the interpretation of these events--from stellar luminosities, elemental and isotopic abundances to neutrino flux from distant supernovae. The Nuclear Physics input comes through nuclear structure, low energy reaction rates, nuclear masses, and decay rates. There is a common perception that low energy reaction rates are the most important component of the required nuclear physics input; however, in this article we take a broader approach and present an overview of the close correlation between various nuclear structure aspects and their impact on nuclear astrophysics. We discuss the interplay between the weak and the strong forces on stellar time scales due to the limitations they provide for the evolution of slow and rapid burning processes. The effects of shell structure in nuclei on stellar burning processes as well as the impact of clustering in nuclei is outlined. Furthermore we illustrate the effects of the various nuclear structure aspects on the major nucleosynthesis processes that have been identified in the last few decades. We summarize and provide a coherent overview of the impact of all aspects of nuclear structure on nuclear astrophysics.

Smith, Michael Scott [ORNL



The Nuclear Revolution, Relative Gains, and International Nuclear Assistance  

E-Print Network [OSTI]

Organizations, accidents, and nuclear weapons. Princeton,the likelihood of a nuclear accident (Sagan 1993, 1995). “potential for a nuclear accident. Yet it seems implausible

Kroenig, Matthew



Belgium Nuclear Security Summit: Fact Sheet | National Nuclear...  

National Nuclear Security Administration (NNSA)

Nuclear Security Summit: Fact Sheet | National Nuclear Security Administration People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency...


Italy Nuclear Security Summit: Fact Sheet | National Nuclear...  

National Nuclear Security Administration (NNSA)

Nuclear Security Summit: Fact Sheet | National Nuclear Security Administration People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency...


COLLOQUIUM: Nuclear Famine: The Threat to Humanity from Nuclear...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

MBG Auditorium COLLOQUIUM: Nuclear Famine: The Threat to Humanity from Nuclear Weapons Dr. Alan Robock Rutgers University A nuclear war between India and Pakistan, with...


The Nuclear Revolution, Relative Gains, and International Nuclear Assistance  

E-Print Network [OSTI]

nature of the nuclear recipient’s security environment. ThisKeywords: Nuclear weapons proliferation; security; securitynature of the nuclear recipient’s security environment. This

Kroenig, Matthew



Savannah River Site Waste Solidification Building Corrective Actions from the January 2013 Report on Construction Quality of Mechanical Systems Installation and Fire Protection Design, May 2013  

Broader source: Energy.gov (indexed) [DOE]

HIAR SRS-2013-5-07 HIAR SRS-2013-5-07 Site: Savannah River Site Subject: Office of Enforcement and Oversight's Office of Safety and Emergency Management Evaluations Activity Report for the Savannah River Site (SRS) Waste Solidification Building (WSB) Corrective Actions from the January 2013 Report on Construction Quality of Mechanical Systems Installation and Fire Protection Design Dates of Activity : 05/07/2013 - 05/09/2013 Report Preparer: Joseph Lenahan Activity Description/Purpose: 1. Review the corrective actions being implemented by the construction contractor to address Findings 1-4, 6, and 9 from a construction quality review performed by the Office of Health, Safety and Security (HSS) (Reference 1). 2. Meet with the SRS WSB project staff and Savannah River Nuclear Solutions (SRNS) engineers to discuss the


Independent Oversight Activity Report, Savannah River Site Waste  

Broader source: Energy.gov (indexed) [DOE]

Savannah River Site Waste Savannah River Site Waste Solidification Building Independent Oversight Activity Report, Savannah River Site Waste Solidification Building May 2013 Savannah River Site Waste Solidification Building Corrective Actions from the January 2013 Report on Construction Quality of Mechanical Systems Installation and Fire Protection Design [HIAR SRS-2013-5-07] Activity Description/Purpose: Review the corrective actions being implemented by the construction contractor to address Findings 1-4, 6, and 9 from a construction quality review performed by the Office of Health, Safety and Security (HSS) (Reference 1). Meet with the SRS WSB project staff and Savannah River Nuclear Solutions (SRNS) engineers to discuss the proposed corrective actions discussed in Reference 2, and clarify additional reviews to be performed by


Preliminary Notice of Violation, NEA-2011-02  

Broader source: Energy.gov (indexed) [DOE]

July 22, 2011 July 22, 2011 RETURN RECEIPT REQUESTED Mr. Garry W. Flowers President and Chief Executive Officer Savannah River Nuclear Solutions, LLC 6160 Executive Woodside Court Aiken, South Carolina 29803 NEA-2011-02 Dear Mr. Flowers: This letter refers to the Office of Health, Safety and Security's Office of Enforcement and Oversight investigation into the facts and circumstances associated with the June 14, 2010, employee puncture wound injury, which occurred in the F-TRU Remediation Enclosure within the F-Canyon Facility, at the U.S. Department of Energy's (DOE) Savannah River Site. This occurrence was reported in Noncompliance Tracking System {NTS) report NTS-SRSO--SRNS-CPWM-2010-0002, Contaminated Puncture Wound During TR U Drum Remediation. The results of the investigation were provided to

Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Savannah River Site Waste Solidification Building Corrective Actions from the January 2013 Report on Construction Quality of Mechanical Systems Installation and Fire Protection Design, May 2013  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

HIAR SRS-2013-5-07 HIAR SRS-2013-5-07 Site: Savannah River Site Subject: Office of Enforcement and Oversight's Office of Safety and Emergency Management Evaluations Activity Report for the Savannah River Site (SRS) Waste Solidification Building (WSB) Corrective Actions from the January 2013 Report on Construction Quality of Mechanical Systems Installation and Fire Protection Design Dates of Activity : 05/07/2013 - 05/09/2013 Report Preparer: Joseph Lenahan Activity Description/Purpose: 1. Review the corrective actions being implemented by the construction contractor to address Findings 1-4, 6, and 9 from a construction quality review performed by the Office of Health, Safety and Security (HSS) (Reference 1). 2. Meet with the SRS WSB project staff and Savannah River Nuclear Solutions (SRNS) engineers to discuss the


Page not found | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

41 - 24550 of 29,416 results. 41 - 24550 of 29,416 results. Article SRS Seals Access to P and R Reactors, Marking End to Nearly 60-Years of History: American Recovery and Reinvestment Act Project Progress AIKEN, S.C. - With investments from the American Recovery and Reinvestment Act, the U.S. Department of Energy and Savannah River Nuclear Solutions, LLC, (SRNS) today sealed the access to the historic P and R Reactors as part of footprint reduction and legacy cleanup at the Savannah River Site. http://energy.gov/em/articles/srs-seals-access-p-and-r-reactors-marking-end-nearly-60-years-history Article DOE Awards Grant to New Mexico Environment Department for Waste Isolation Pilot Plant Oversight, Monitoring Carlsbad, NM - The Department of Energy (DOE) today awarded a grant for an estimated $1.6 million to the New Mexico Environment Department (NMED). The


Page not found | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

61 - 21670 of 28,560 results. 61 - 21670 of 28,560 results. Download CX-007873: Categorical Exclusion Determination Northeast Photovoltaic Regional Training Provider CX(s) Applied: A9, A11, B3.14 Date: 01/27/2012 Location(s): New York Offices(s): Golden Field Office http://energy.gov/nepa/downloads/cx-007873-categorical-exclusion-determination Article SRS Seals Access to P and R Reactors, Marking End to Nearly 60-Years of History: American Recovery and Reinvestment Act Project Progress AIKEN, S.C. - With investments from the American Recovery and Reinvestment Act, the U.S. Department of Energy and Savannah River Nuclear Solutions, LLC, (SRNS) today sealed the access to the historic P and R Reactors as part of footprint reduction and legacy cleanup at the Savannah River Site. http://energy.gov/em/articles/srs-seals-access-p-and-r-reactors-marking-end-nearly-60-years-history


Microsoft Word - Letter - Overview Pension Plan Notices.doc  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

HRD-BEN-2011-0057 HRD-BEN-2011-0057 Date: April 29, 2011 To: All Plan Participants From: SRNS Benefits Administration Re: Savannah River Nuclear Solutions, LLC Multiple Employer Pension Plan Funding Notices Attached are three pension plan notices of which the wording is very closely regulated by the federal government. Therefore, we are providing a quick overview of the notices here. 2010 Annual Funding Notice: The government previously required the distribution of an abbreviated form of this information and called it the Summary Annual Report (SAR). You may have seen SARs from previous years posted on the SRS Intranet "InSite" (formerly known as ShRINE). The enhanced version of that SAR is called the Annual Funding Notice. This particular



Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

HRD-BEN-2012-0038 HRD-BEN-2012-0038 Date: April 30, 2012 To: All Plan Participants From: SRNS Benefits Administration Re: Savannah River Nuclear Solutions, LLC Multiple Employer Pension Plan Funding Notices Attached are three pension plan notices of which the wording is very closely regulated by the federal government. Therefore, we are providing a quick overview of the notices here. 2011 Annual Funding Notice: The government previously required the distribution of an abbreviated form of this information and called it the Summary Annual Report (SAR). You may have seen SARs from previous years posted on the SRS Intranet "InSite". The enhanced version of that SAR is called the Annual Funding Notice. This particular notice covers the plan year 2011 and is issued after the


Independent Oversight Activity Report, Savannah River Site Waste  

Broader source: Energy.gov (indexed) [DOE]

Independent Oversight Activity Report, Savannah River Site Waste Independent Oversight Activity Report, Savannah River Site Waste Solidification Building Independent Oversight Activity Report, Savannah River Site Waste Solidification Building May 2013 Savannah River Site Waste Solidification Building Corrective Actions from the January 2013 Report on Construction Quality of Mechanical Systems Installation and Fire Protection Design [HIAR SRS-2013-5-07] Activity Description/Purpose: Review the corrective actions being implemented by the construction contractor to address Findings 1-4, 6, and 9 from a construction quality review performed by the Office of Health, Safety and Security (HSS) (Reference 1). Meet with the SRS WSB project staff and Savannah River Nuclear Solutions (SRNS) engineers to discuss the proposed corrective actions


Preliminary Review of Safety Assessment Issues at Savannah River Site, August 2011  

SciTech Connect (OSTI)

At the request of Savannah River Nuclear Solutions (SRNS) management, a review team composed of experts in atmospheric transport modeling for environmental radiation dose assessment convened at the Savannah River Site (SRS) on August 29-30, 2011. Several issues were presented at the meeting for discussion. This is a short summary that is organized in accordance with the primary issues discussed, which is not necessarily a chronological record. Issues include: SRS Meteorological Data and its Use in MACCS2; Deposition Velocities for Particles; Deposition Velocities for Tritium; MACCS2 Dispersion Coefficients; Use of Low Surface Roughness in Open Areas; Adequacy of Meteorological Tower and Instrumentation; Displacement Height; and Validity of MACCS2 Calculations at Close-in Distances. A longer report will be issued at a later date that expands upon these topics and recommendations.

Napier, Bruce A.; Rishel, Jeremy P.; Bixler, Nathan E.



Tennessee Nuclear Profile - Watts Bar Nuclear Plant  

U.S. Energy Information Administration (EIA) Indexed Site

Watts Bar Nuclear Plant" "Unit","Summer capacity (mw)","Net generation (thousand mwh)","Summer capacity factor (percent)","Type","Commercial operation date","License expiration...


Wisconsin Nuclear Profile - Point Beach Nuclear Plant  

U.S. Energy Information Administration (EIA) Indexed Site

Point Beach Nuclear Plant" "Unit","Summer capacity (mw)","Net generation (thousand mwh)","Summer capacity factor (percent)","Type","Commercial operation date","License expiration...


Massachusetts Nuclear Profile - Pilgrim Nuclear Power Station  

U.S. Energy Information Administration (EIA) Indexed Site

Pilgrim Nuclear Power Station" "Unit","Summer capacity (mw)","Net generation (thousand mwh)","Summer cpacity factor (percent)","Type","Commercial operation date","License...


Arkansas Nuclear Profile - Arkansas Nuclear One  

U.S. Energy Information Administration (EIA) Indexed Site

Nuclear One" "Unit","Summer capacity (mw)","Net generation (thousand mwh)","Summer capacity factor (percent)","Type","Commercial operation date","License expiration date"...


Nuclear Science at NERSC  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Accelerator Science Accelerator Science Astrophysics Biological Sciences Chemistry & Materials Science Climate & Earth Science Energy Science Engineering Science Environmental Science Fusion Science Math & Computer Science Nuclear Science Science Highlights NERSC Citations HPC Requirements Reviews Home » Science at NERSC » Nuclear Science Nuclear Science Experimental and theoretical nuclear research carried out at NERSC is driven by the quest for improving our understanding of the building blocks of matter. This includes discovering the origins of nuclei and identifying the forces that transform matter. Specific topics include: Nuclear astrophysics and the synthesis of nuclei in stars and elsewhere in the cosmos; Nuclear forces and quantum chromodynamics (QCD), the quantum field


Neutron and Nuclear Science News  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

News Recent news and events related to neutron and nuclear science at LANSCE. Neutron and Nuclear Science News Nuclear science observations and opportunities at the Los Alamos...


Nuclear & Radiological Activity Center (NRAC)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Nuclear & Radiological Activity Center (NRAC) Where nuclear research and deployment capabilities come together to solve nuclear nonproliferation challenges. Skip Navigation Links...



E-Print Network [OSTI]

Gove and A. H. Wapstra, Nuclear Data Tables 11, 127 (1972).P. Jackson, Chalk River Nuclear Laboratories Report (1975)national Conference on Nuclear Structure and Spec­ troscopy,

Authors, Various



Nuclear Energy University Programs (NEUP)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

DOE-NE Fosters Novel International Investments in U.S. Nuclear Energy Research October 14, 2014 Nuclear energy is an international industry, but nuclear research and development...


Counterterrorism | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

a unique Counterterrorism Counterterrorism Policy and CooperationNuclear Threat Science Office of Nuclear Threat Science The Office of Nuclear Threat Science is responsible...


Supporting Organizations | Nuclear Science | ORNL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Educational Outreach Publications and Reports News and Awards Supporting Organizations Nuclear Science Engineering Fusion & Materials for Nuclear Systems Nuclear Science Home |...



E-Print Network [OSTI]

135 Te INCLUSIONS IN CdTe GROWN FROM A SLOWLY COOLED Te SOLUTION AND BY THE TRAVELLING SOLVENT. Abstract. 2014 CdTe crystals have been grown from a slowly cooled Te solution and with the travelling. Introduction. - CdTe crystals for nuclear radia- tion detectors are usually grown from a slowly cooled solution

Paris-Sud XI, Université de


Nuclear Energy Program  

Broader source: Energy.gov (indexed) [DOE]

April 15, 2002 April 15, 2002 NERAC Spring 2002 Meeting Office of Nuclear Energy, Science and Technology Magwood/April15_02 NERAC.ppt (2) 2002 Will Be A Transition Year 2002 Will Be A Transition Year 6 Nuclear Power 2010 6 Major Program Developments 6 FY 2003 Budget Request Office of Nuclear Energy, Science and Technology Magwood/April15_02 NERAC.ppt (3) Nuclear Power 2010 Nuclear Power 2010 Nuclear Power 2010 is a new R&D initiative announced by Secretary Abraham on February 14, 2002. This initiative is designed to clear the way for the construction of new nuclear power plants by 2010. Office of Nuclear Energy, Science and Technology Magwood/April15_02 NERAC.ppt (4) Can We Build New U.S. Reactors By 2010? Yes! Can We Build New U.S. Reactors By 2010? Yes! Can Be Deployed by 2010

Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Promulgating Nuclear Safety Requirements  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

Applies to all Nuclear Safety Requirements Adopted by the Department to Govern the Conduct of its Nuclear Activities. Cancels DOE P 410.1. Canceled by DOE N 251.85.



Nuclear energy in Argentina  

Science Journals Connector (OSTI)

After early interest in the possible uses of uranium in 1937, Argentina's scientists and politicians showed an inclination to support nuclear development that has kept quite steady compared with other areas. The Argentinean government prohibited the export of uranium in 1945, because of the emerging possibility of producing nuclear energy. The creation of the Atomic Energy Commission soon followed, and the first experimental reactor was set critical in 1958. Since then, nuclear development has allowed the successful operation of two nuclear power reactors, a quite integrated nuclear fuel cycle, and sustained activity in the development, production and use of radioisotopes. Nowadays an Argentinean company competes with success in the experimental nuclear reactor market. After a period in which the nuclear sector has been largely ignored in the official interest, Argentina's authorities have launched a comprehensive plan intended to rehabilitate all aspects of nuclear activity.

Gabriel N. Barcelo



Nuclear Energy Production  

Science Journals Connector (OSTI)

We shall limit ourselves here to a very rough summary of the most important features of nuclear reactions in stars. This will suffice completely ... , while the study of particular aspects of nuclear astrophysics...

Professor Dr. Rudolf Kippenhahn…



Marine Nuclear Propulsion  

Science Journals Connector (OSTI)

... June 30 about 95 qualified scientists and engineers were engaged on research and development on marine nuclear ... nuclear propulsion within his Department, including the Atomic Energy Authority and the Ship Research Association. This ...



Nuclear Power Plants  

Science Journals Connector (OSTI)

A third issue related to the production, use and transportation of nuclear materials is the safety issue associated with ... an act of war or an act of terrorism. While the containment buildings of typical nuclear

Efstathios E. (Stathis) Michaelides



Nuclear Engineer (Criticality Safety)  

Broader source: Energy.gov [DOE]

This position is located in the Nuclear Safety Division (NSD) which has specific responsibility for managing the development, analysis, review, and approval of non-reactor nuclear facility safety...


Nuclear Energy & Energy Security  

Science Journals Connector (OSTI)

Safety issues related to use of nuclear energy and secure operation of nuclear installations are mail stones of great importance. Although none of technologies producing energy are absolutely safe it is obvious t...

Jumber Mamasakhlisi



On Nuclear Energy Levels  

Science Journals Connector (OSTI)

...research-article On Nuclear Energy Levels K. M. Guggenheimer The formula for the energy levels of the rigid rotator...nuclei. Two kinds of nuclear rotation are discussed...an A relation for the energy levels of different nuclei...



Nuclear radiation actuated valve  

DOE Patents [OSTI]

A nuclear radiation actuated valve for a nuclear reactor. The valve has a valve first part (such as a valve rod with piston) and a valve second part (such as a valve tube surrounding the valve rod, with the valve tube having side slots surrounding the piston). Both valve parts have known nuclear radiation swelling characteristics. The valve's first part is positioned to receive nuclear radiation from the nuclear reactor's fuel region. The valve's second part is positioned so that its nuclear radiation induced swelling is different from that of the valve's first part. The valve's second part also is positioned so that the valve's first and second parts create a valve orifice which changes in size due to the different nuclear radiation caused swelling of the valve's first part compared to the valve's second part. The valve may be used in a nuclear reactor's core coolant system.

Christiansen, David W. (Kennewick, WA); Schively, Dixon P. (Richland, WA)



General Engineer (Nuclear Safety)  

Broader source: Energy.gov [DOE]

The Chief of Nuclear Safety (CNS) reports the US/M&P; in serving as the Central Technical Authority (CTA) for M&P; activities, ensuring the Departments nuclear safety policies and...


NNSA: Working to Prevent Nuclear Proliferation | National Nuclear...  

National Nuclear Security Administration (NNSA)

to Prevent Nuclear Proliferation | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation...


Nuclear Weapons Testing Resumes | National Nuclear Security Administra...  

National Nuclear Security Administration (NNSA)

Testing Resumes | National Nuclear Security Administration People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response...


Nuclear power browning out  

SciTech Connect (OSTI)

When the sad history of nuclear power is written, April 26, 1986, will be recorded as the day the dream died. The explosion at the Chernobyl plant was a terrible human tragedy- and it delivered a stark verdict on the hope that nuclear power will one day replace fossil fuel-based energy systems. Nuclear advocates may soldier on, but a decade after Chernobyl it is clear that nuclear power is no longer a viable energy option for the twenty-first century.

Flavin, C.; Lenssen, N.



Nuclear Explosive Safety Manual  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

This Manual provides supplemental details to support the requirements of DOE O 452.2D, Nuclear Explosive Safety.




Energy Science and Technology Software Center (OSTI)

003029WKSTN00 Delineation of nuclear structures in 3D multicellular systems  https://vision.lbl.gov/Software/3DMorphometry/ 


Preparing Non-nuclear Engineers for the Nuclear Field  

E-Print Network [OSTI]

Preparing Non-nuclear Engineers for the Nuclear Field Elizabeth K. Ervin The University. An understanding of power generation is important for all modern-day engineers, and nuclear energy serves as a good-four universities have nuclear- related programs, including Nuclear or Radiological Engineering, Nuclear Science

Ervin, Elizabeth K.


Nuclear Eclectic Power  

Science Journals Connector (OSTI)

...much higher future costs for oil and natural gas. However, the...ELECTRICITY GENERATION FROM COAL, OIL, AND NUCLEAR FUEL, NUCLEAR...electricity generation from coal, oil, and nuclear fuel, cite about...possibility that stimu-lated a marathon debate between the Union of...

David J. Rose



Nuclear Power for Italy  

Science Journals Connector (OSTI)

ITALY HAS DECIDED to use British know-how to build its first big nuclear power plant. A.G.I.P. Nucleare, a subsidiary of the Italian government-owned petroleum organization, E.N.I., and Britain's Nuclear Power Plant Co. will sign final agreement next ...



Catechism for nuclear power  

Science Journals Connector (OSTI)

... doses of radiation exposure are potentially harmful to people, and should be avoided. -"Nuclear power stations, and the nuclear industry in general, are sources of artificial radiation to which ... general, are sources of artificial radiation to which people may be exposed." Therefore nuclear power stations should not be built."Hither explain in no more than 250 words which ...



Nuclear Physics with trapped  

E-Print Network [OSTI]

Nuclear Physics with trapped atoms and ions #12;2/2/2013Dan Melconian #12;2/2/2013Dan Melconian Outline · Scope and applications of nuclear physics precision frontier compliments LHC properties and aquifers in the Sahara #12;2/2/2013Dan Melconian What is Nuclear Physics? · Began with the study

Boas, Harold P.

Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.



E-Print Network [OSTI]

NUCLEAR POWER in CALIFORNIA: 2007 STATUS REPORT CALIFORNIA ENERGY COMMISSION October 2007 CEC-100, California Contract No. 700-05-002 Prepared For: California Energy Commission Barbara Byron, Senior Nuclear public workshops on nuclear power. The Integrated Energy Policy Report Committee, led by Commissioners


Nuclear Lamins and Neurobiology  

Science Journals Connector (OSTI)

...August 2014 review-article Minireview Nuclear Lamins and Neurobiology Stephen G. Young...California, USA Much of the work on nuclear lamins during the past 15 years has focused...papers have identified important roles for nuclear lamins in the central nervous system...

Stephen G. Young; Hea-Jin Jung; John M. Lee; Loren G. Fong



Nuclear Explosive Safety  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

This Department of Energy (DOE) Order establishes requirements to implement the nuclear explosive safety (NES) elements of DOE O 452.1D, Nuclear Explosive and Weapon Surety Program, for routine and planned nuclear explosive operations (NEOs). Cancels DOE O 452.2C. Admin Chg 1, dated 7-10-13, cancels DOE O 452.2D.




E-Print Network [OSTI]

for the digital protection systems of a nuclear power plant. When spec- ifying requirements for software and CRSA processes are described using shutdown system 2 of the Wolsong nuclear power plants as the digital, the missiles, and the digital protection systems embed- ded in nuclear power plants. Obviously, safety


Nuclear Explosive Safety  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

This Order establishes requirements to implement the nuclear explosive safety elements of DOE O 452.1D, Nuclear Explosive and Weapon Surety Program, for routine and planned nuclear explosive operations. Cancels DOE O 452.2C. Admin Chg 1, 7-10-13



Nuclear Research Reactors  

Science Journals Connector (OSTI)

... their countries for the advent of nuclear power. A few countries had built large research reactors for the production of isotopes and to study the behaviour of nuclear fuel, but ... production of isotopes and to study the behaviour of nuclear fuel, but the small training reactor had not been developed. Since then, research ...




Nuclear Energy Institutes  

Science Journals Connector (OSTI)

Nuclear Energy Institutes ... The Atomic Energy Commission and the American Society for Engineering Education offer their nuclear energy courses for engineering and science teachers again in the summer of 1960. ... At least 160 college and university teachers will study nuclear science in the seven institutes scheduled. ...




E-Print Network [OSTI]

ANNOUNCEMENT NUCLEAR ENGINEERING FACULTY POSITION The Department of Nuclear Engineering undergraduate and graduate courses in general nuclear engineering. The Knoxville campus of the University, Associate Professor of Nuclear Engineering; The University of Tennessee; 312 Pasqua Engineering Bldg

Tennessee, University of



E-Print Network [OSTI]

but also in the context of conventional power plants and renewables such as wind power plants. ConsequentlySTRUCTURAL HEALTH MONITORING SOLUTIONS FOR POWER PLANTS Benoit Jouan, J¨urgen Rudolph, Steffen solutions gain in importance not only as part of the ageing management of nuclear power plant components

Paris-Sud XI, Université de


Materials Challenges in Nuclear Energy  

SciTech Connect (OSTI)

Nuclear power currently provides about 13% of the worldwide electrical power, and has emerged as a reliable baseload source of electricity. A number of materials challenges must be successfully resolved for nuclear energy to continue to make further improvements in reliability, safety and economics. The operating environment for materials in current and proposed future nuclear energy systems is summarized, along with a description of materials used for the main operating components. Materials challenges associated with power uprates and extensions of the operating lifetimes of reactors are described. The three major materials challenges for the current and next generation of water-cooled fission reactors are centered on two structural materials aging degradation issues (corrosion and stress corrosion cracking of structural materials and neutron-induced embrittlement of reactor pressure vessels), along with improved fuel system reliability and accident tolerance issues. The major corrosion and stress corrosion cracking degradation mechanisms for light water reactors are reviewed. The materials degradation issues for the Zr alloy clad UO2 fuel system currently utilized in the majority of commercial nuclear power plants is discussed for normal and off-normal operating conditions. Looking to proposed future (Generation IV) fission and fusion energy systems, there are 5 key bulk radiation degradation effects (low temperature radiation hardening and embrittlement, radiation-induced and modified solute segregation and phase stability, irradiation creep, void swelling, and high temperature helium embrittlement) and a multitude of corrosion and stress corrosion cracking effects (including irradiation-assisted phenomena) that can have a major impact on the performance of structural materials.

Zinkle, Steven J [ORNL] [ORNL; Was, Gary [University of Michigan] [University of Michigan



Functionalized Polymers For Binding To Solutes In Aqueous Solutions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Functionalized Polymers For Binding To Solutes In Aqueous Solutions Functionalized Polymers For Binding To Solutes In Aqueous Solutions Functionalized Polymers For Binding To Solutes In Aqueous Solutions A functionalized polymer for binding a dissolved molecule in an aqueous solution is presented. Available for thumbnail of Feynman Center (505) 665-9090 Email Functionalized Polymers For Binding To Solutes In Aqueous Solutions A functionalized polymer for binding a dissolved molecule in an aqueous solution is presented. The polymer has a backbone polymer to which one or more functional groups are covalently linked. The backbone polymer can be such polymers as polyethylenimine, polyvinylamine, polyallylamine, and polypropylamine. These polymers are generally water-soluble, but can be insoluble when cross-linked. The functional group can be for example diol


Counterterrorism and Counterproliferation | National Nuclear...  

National Nuclear Security Administration (NNSA)

and Counterproliferation | National Nuclear Security Administration People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response...


Relativistic nuclear structure. I. Nuclear matter  

Science Journals Connector (OSTI)

The formalism for the Dirac-Brueckner approach to the nuclear many-body problem is described including its basis in relativistic two-nucleon scattering. A family of relativistic meson-exchange potentials is constructed which (apart from the usual coupling terms for heavy mesons) apply the pseudovector (gradient) coupling for the interaction of pseudoscalar mesons (?,?) with nucleons. These potentials describe low-energy two-nucleon scattering and the deuteron data accurately. Using these potentials, the properties of nuclear matter are calculated in the Dirac-Brueckner-Hartree-Fock approximation, in which the empirical nuclear matter saturation is explained quantitatively. The effective two-body interaction in the nuclear matter medium (G matrix) is calculated directly in the nuclear matter rest frame. Thus, cumbersome transformations between the two-nucleon center-of-mass frame and the nuclear matter rest frame are avoided. Size and nature of relativistic effects included in the present approach are examined in detail. The formalism, the potentials, and the results of this paper may also serve as a basis and a realistic starting point for systematic relativistic nuclear structure studies as well as for the investigation of further relativistic many-body corrections and of contributions of higher order.

R. Brockmann and R. Machleidt



Nuclear reactor cooling system decontamination reagent regeneration  

DOE Patents [OSTI]

An improved method for decontaminating the coolant system of water-cooled nuclear power reactors and for regenerating the decontamination solution. A small amount of one or more weak-acid organic complexing agents is added to the reactor coolant, and the pH is adjusted to form a decontamination solution which is circulated throughout the coolant system to dissolve metal oxides from the interior surfaces and complex the resulting metal ions and radionuclide ions. The coolant containing the complexed metal ions and radionuclide ions is passed through a strong-base anion exchange resin bed which has been presaturated with a solution containing the complexing agents in the same ratio and having the same pH as the decontamination solution. As the decontamination solution passes through the resin bed, metal-complexed anions are exchanged for the metal-ion-free anions on the bed, while metal-ion-free anions in the solution pass through the bed, thus removing the metal ions and regenerating the decontamination solution.

Anstine, Larry D. (San Jose, CA); James, Dean B. (Saratoga, CA); Melaika, Edward A. (Berkeley, CA); Peterson, Jr., John P. (Livermore, CA)



Nuclear Safety Regulatory Framework  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Department of Energy Department of Energy Nuclear Safety Regulatory Framework DOE's Nuclear Safety Enabling Legislation Regulatory Enforcement & Oversight Regulatory Governance Atomic Energy Act 1946 Atomic Energy Act 1954 Energy Reorganization Act 1974 DOE Act 1977 Authority and responsibility to regulate nuclear safety at DOE facilities 10 CFR 830 10 CFR 835 10 CFR 820 Regulatory Implementation Nuclear Safety Radiological Safety Procedural Rules ISMS-QA; Operating Experience; Metrics and Analysis Cross Cutting DOE Directives & Manuals DOE Standards Central Technical Authorities (CTA) Office of Health, Safety, and Security (HSS) Line Management SSO/ FAC Reps 48 CFR 970 48 CFR 952 Federal Acquisition Regulations External Oversight *Defense Nuclear Facility


Nuclear spirals in galaxies  

E-Print Network [OSTI]

Recent high-resolution observations indicate that nuclear spirals are often present in the innermost few hundred parsecs of disc galaxies. My models show that nuclear spirals form naturally as a gas response to non-axisymmetry in the gravitational potential. Some nuclear spirals take the form of spiral shocks, resulting in streaming motions in the gas, and in inflow comparable to the accretion rates needed to power local Active Galactic Nuclei. Recently streaming motions of amplitude expected from the models have been observed in nuclear spirals, confirming the role of nuclear spirals in feeding of the central massive black holes.

Witold Maciejewski



Neutrinos, Dark Matter and Nuclear Detection  

SciTech Connect (OSTI)

Solutions to problems in nuclear non-proliferation and counter-terrorism may be found at the forefront of modern physics. Neutrino oscillation experiments, dark matter searches, and high energy astrophysics, are based on technology advances that have may also have application to nuclear detection. The detection problems share many characteristics, including energy scales, time structures, particle-type, and, of course, the combination of high backgrounds and low signal levels. This convergence of basic and applied physics is realized in non-proliferation and homeland security projects at Lawrence Livermore National Laboratory. Examples described here include reactor anti-neutrino monitoring, dual-phase noble liquid TPC development, gamma-ray telescopes, and nuclear resonance fluorescence.

Goldstein, W H; Bernstein, A; Craig, W W; Johnson, M



Office of Nuclear Threat Science | National Nuclear Security Administration  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Nuclear Threat Science | National Nuclear Security Administration Nuclear Threat Science | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog The National Nuclear Security Administration Office of Nuclear Threat Science Home > About Us > Our Programs > Counterterrorism and Counterproliferation > Office of Nuclear Threat Science Office of Nuclear Threat Science


Nuclear | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Nuclear Nuclear Nuclear Radioisotope Power Systems, a strong partnership between the Energy Department's Office of Nuclear Energy and NASA, has been providing the energy for deep space exploration. Nuclear power is the use of sustained nuclear fission to generate heat and electricity. Nuclear power plants provide about 6 percent of the world's energy and 13-14 percent of the world's electricity. Featured Five Years of Building the Next Generation of Reactors Simulated three-dimensional fission power distribution of a single 17x17 rod PWR fuel assembly. | Photo courtesy of the Consortium for Advanced Simulation of Light Water Reactors (CASL). A two-year update on the Consortium for Advanced Simulation of Light Water Reactors and the progress being made in overcoming barriers to national


Calculation methods of the nuclear characteristics  

E-Print Network [OSTI]

In the book the mathematical methods of nuclear cross sections and phases of elastic scattering, energy and characteristics of bound states in two- and three-particle nuclear systems, when the potentials of interaction contain not only central, but also tensor component, are presented. Are given the descriptions of the mathematical numerical calculation methods and computer programs in the algorithmic language "BASIC" for "Turbo Basic" of firm "Borland" for the computers of the type IBM PC AT. For the numerical solutions of the initial Schroedinger equations are used finite- difference and variational methods, and also method of Runge-Kutta with the automatic calling sequence on the assigned accuracy of results for the scattering phase shifts and binding energy. Is given the description not of the standard methods of solving the system of equations of Schroedinger to the bound states and the alternative to Schmidt's method, method of solution of the generalized matrix problem at the eigenvalues. The developed programs make it possible to determine the wave functions of relative motion of nuclear fragments, calibrated to the correct asymptotic behavior taking into account Coulomb interaction. The programs of the extraction of nuclear phases (phase shift analysis) from the differential elastic cross sections are given. The book can be used as the textbook according to the numerical mathematical methods for the students and the graduate students of the physical and mathematical specialties of higher educational institutions. This Book is written in Russian, but will perhaps present certain interest.

S. B. Dubovichenko


Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


International R&D Collaboration Develops Innovative Solutions to Global  

National Nuclear Security Administration (NNSA)

R&D Collaboration Develops Innovative Solutions to Global R&D Collaboration Develops Innovative Solutions to Global Challenges | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Home > NNSA Blog > International R&D Collaboration Develops Innovative Solutions to ... International R&D Collaboration Develops Innovative Solutions to Global


Building Science and Technology Solutions for National Problems  

SciTech Connect (OSTI)

The nation's investment in Los Alamos has fostered scientific capabilities for national security missions. As the premier national security science laboratory, Los Alamos tackles: (1) Multidisciplinary science, technology, and engineering challenges; (2) Problems demanding unique experimental and computational facilities; and (3) Highly complex national security issues requiring fundamental breakthroughs. Our mission as a DOE national security science laboratory is to develop and apply science, technology, and engineering solutions that: (1) ensure the safety, security, and reliability of the US nuclear deterrent; (2) protect against the nuclear threat; and (3) solve national security challenges.

Bishop, Alan R. [Los Alamos National Laboratory



Volkov solution for two laser beams and ITER  

E-Print Network [OSTI]

We find the solution of the Dirac equation for two plane waves (laser beams) and we determine the modified Compton formula for the scattering of two photons on an alectron. The practical meaning of the two laser beams is, that two laser beams impinging on a targed which is constituted from material in the form of a foam, can replace 100-200 laser beams impinging on a normal targed. It means that the nuclear fusion with two laser beams is realistic in combination with the nuclear reactor such as ITER.

Miroslav Pardy



The Office of Nuclear Verification | National Nuclear Security  

National Nuclear Security Administration (NNSA)

Nuclear Verification | National Nuclear Security Nuclear Verification | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog The Office of Nuclear Verification Home > About Us > Our Programs > Nonproliferation > Nonproliferation & International Security > The Office of Nuclear Verification The Office of Nuclear Verification


Eisenhower Halts Nuclear Weapons Testing | National Nuclear Security  

National Nuclear Security Administration (NNSA)

Eisenhower Halts Nuclear Weapons Testing | National Nuclear Security Eisenhower Halts Nuclear Weapons Testing | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog Home > About Us > Our History > NNSA Timeline > Eisenhower Halts Nuclear Weapons Testing Eisenhower Halts Nuclear Weapons Testing August 22, 1958 Washington, DC Eisenhower Halts Nuclear Weapons Testing


Nuclear energy is an important source of power, supplying 20  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

energy is an important source of power, supplying 20 energy is an important source of power, supplying 20 percent of the nation's electricity. More than 100 nuclear power plants are operating in the U.S., and countries around the world are implementing nuclear power as a carbon-free alternative to fossil fuels. We can maximize the climate and energy security benefits provided by responsible global nuclear energy expansion by developing options to increase the energy extracted from nuclear fuel, improve waste management, and strengthen nuclear nonproliferation controls. To develop viable technical solutions, these interdependent challenges must be addressed through tightly integrated multidisciplinary research and development efforts. Los Alamos National Laboratory is playing a key role in


Nuclear Science | ORNL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Educational Outreach Educational Outreach Publications and Reports News and Awards Home | Science & Discovery | Nuclear Science Nuclear Science | Nuclear Science SHARE In World War II's Manhattan Project, ORNL helped usher in the nuclear age. Today, laboratory scientists are leaders in using nuclear technologies and systems to improve human health; explore safer, more environmentally friendly power; and better understand the structure of matter. Thanks to its nuclear heritage, ORNL is a world leader in the production of isotopes for medical purposes and research. The lab's High Flux Isotope Reactor (HFIR) and Radiochemical Engineering Development Center (REDC) together provide the western world's sole supply of californium-252, an isotope instrumental in a wide variety of uses including cancer therapy,


nuclear | OpenEI  

Open Energy Info (EERE)

nuclear nuclear Dataset Summary Description This dataset presents summary information related to world nuclear energy. It is part of a supporting dataset for the book World On the Edge: How to Prevent Environmental and Economic Collapse by Lester R. Source Earth Policy Institute Date Released January 12th, 2011 (3 years ago) Date Updated Unknown Keywords EU nuclear nuclear electricity world Data application/vnd.ms-excel icon Summary nuclear energy consumption data (xls, 68.6 KiB) Quality Metrics Level of Review Some Review Comment Temporal and Spatial Coverage Frequency Time Period License License Open Data Commons Attribution License Comment "Reuse of our data is permitted. We merely ask that wherever it is listed, it be appropriately cited" Rate this dataset


Nuclear Science References Database  

E-Print Network [OSTI]

The Nuclear Science References (NSR) database together with its associated Web interface, is the world's only comprehensive source of easily accessible low- and intermediate-energy nuclear physics bibliographic information for more than 210,000 articles since the beginning of nuclear science. The weekly-updated NSR database provides essential support for nuclear data evaluation, compilation and research activities. The principles of the database and Web application development and maintenance are described. Examples of nuclear structure, reaction and decay applications are specifically included. The complete NSR database is freely available at the websites of the National Nuclear Data Center http://www.nndc.bnl.gov/nsr and the International Atomic Energy Agency http://www-nds.iaea.org/nsr.

B. Pritychenko; E. B?ták; B. Singh; J. Totans



E-Print Network 3.0 - advanced nuclear energy Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

is far less than any of the alternative energy technologies now... contemplated, such as solar, biomass and wind. Nuclear power must be part of any future solution to the...


E-Print Network 3.0 - advance nuclear energy Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

is far less than any of the alternative energy technologies now... contemplated, such as solar, biomass and wind. Nuclear power must be part of any future solution to the...


National Nuclear Security Administration  

Broader source: Energy.gov (indexed) [DOE]

National Nuclear Security Administration National Nuclear Security Administration Ofice of Secure Transportation mKlK= Box RQMM= ^luquerqueI= kj= UTNUR= ;JAN 03 213 MEMORANDUM FOR GREGORY eK= WOODS GENERAL COUNSEL DEPARTMENT OF ENERGY FROM: SUBJECT: JEFFREY P. HARREL ASSIST ANT DEPU FOR SECURE 2013 ANNUAL PLANNING SUMMARY In response to your memorandum of December TI= 2012, the following information is provided for the National Nuclear Security Administration Ofice of Secure


Absolute nuclear material assay  

DOE Patents [OSTI]

A method of absolute nuclear material assay of an unknown source comprising counting neutrons from the unknown source and providing an absolute nuclear material assay utilizing a model to optimally compare to the measured count distributions. In one embodiment, the step of providing an absolute nuclear material assay comprises utilizing a random sampling of analytically computed fission chain distributions to generate a continuous time-evolving sequence of event-counts by spreading the fission chain distribution in time.

Prasad, Manoj K. (Pleasanton, CA); Snyderman, Neal J. (Berkeley, CA); Rowland, Mark S. (Alamo, CA)



Energy from nuclear power  

SciTech Connect (OSTI)

Nuclear power should play a pivotal and expanded role in supplying world energy, the authors says. Risks must be minimized by designing a new generation of safe reactors. Atomic energy's vast potential can be harnessed only if issues of safety, waste and nuclear-weapon proliferation are addressed by a globally administered institution. The current situation in nuclear power is described before addressing its future.

Haefele, W.



Nuclear rearrangement energy  

Science Journals Connector (OSTI)

The concept of rearrangement energy in nuclear particle removal is carefully defined by specifying several energies associated with the process and its analysis. Connection is made between the present definition and closely related concepts apt to be confused with "rearrangement energy" so defined. Remarks are made concerning the implications of rearrangement to analysis and interpretation of experimental data.NUCLEAR STRUCTURE Nuclear rearrangement energy theoretically defined and differentiated from related energies. Reaction theories examined regarding rearrangement.

William A. Friedman



Nuclear Fabrication Consortium  

SciTech Connect (OSTI)

This report summarizes the activities undertaken by EWI while under contract from the Department of Energy (DOE) � Office of Nuclear Energy (NE) for the management and operation of the Nuclear Fabrication Consortium (NFC). The NFC was established by EWI to independently develop, evaluate, and deploy fabrication approaches and data that support the re-establishment of the U.S. nuclear industry: ensuring that the supply chain will be competitive on a global stage, enabling more cost-effective and reliable nuclear power in a carbon constrained environment. The NFC provided a forum for member original equipment manufactures (OEM), fabricators, manufacturers, and materials suppliers to effectively engage with each other and rebuild the capacity of this supply chain by : � Identifying and removing impediments to the implementation of new construction and fabrication techniques and approaches for nuclear equipment, including system components and nuclear plants. � Providing and facilitating detailed scientific-based studies on new approaches and technologies that will have positive impacts on the cost of building of nuclear plants. � Analyzing and disseminating information about future nuclear fabrication technologies and how they could impact the North American and the International Nuclear Marketplace. � Facilitating dialog and initiate alignment among fabricators, owners, trade associations, and government agencies. � Supporting industry in helping to create a larger qualified nuclear supplier network. � Acting as an unbiased technology resource to evaluate, develop, and demonstrate new manufacturing technologies. � Creating welder and inspector training programs to help enable the necessary workforce for the upcoming construction work. � Serving as a focal point for technology, policy, and politically interested parties to share ideas and concepts associated with fabrication across the nuclear industry. The report the objectives and summaries of the Nuclear Fabrication Consortium projects. Full technical reports for each of the projects have been submitted as well.

Levesque, Stephen



Microfluidic-Based Robotic Sampling System for Radioactive Solutions  

SciTech Connect (OSTI)

A novel microfluidic based robotic sampling system has been developed for sampling and analysis of liquid solutions in nuclear processes. This system couples the use of a microfluidic sample chip with a robotic system designed to allow remote, automated sampling of process solutions in-cell and facilitates direct coupling of the microfluidic sample chip with analytical instrumentation. This system provides the capability for near real time analysis, reduces analytical waste, and minimizes the potential for personnel exposure associated with traditional sampling methods. A prototype sampling system was designed, built and tested. System testing demonstrated operability of the microfluidic based sample system and identified system modifications to optimize performance.

Jack D. Law; Julia L. Tripp; Tara E. Smith; Veronica J. Rutledge; Troy G. Garn; John Svoboda; Larry Macaluso



Interactions of Cl? and OH Radical in Aqueous Solution  

Science Journals Connector (OSTI)

There is a considerable controversy surrounding the nature of the Cl?/OH complex in aqueous solution, which appears as a byproduct of the irradiation of salt solutions in nuclear reactor operation, radioactive waste storage, medicine, and environmental problems. ... A similar process in the interfacial environment has been implicated in the production of molecular chlorine from sea salt aerosol, which ultimately could lead to enhanced ozone levels in the marine boundary layer. ... (2, 3) A detailed understanding of this reaction is hindered by uncertainty regarding the nature of the complex between OH and Cl? in aqueous environments. ...

Marat Valiev; Raffaella D’Auria; Douglas J. Tobias; Bruce C. Garrett




Broader source: Energy.gov (indexed) [DOE]

December 21, 1999 (Volume 64, Number 244)] December 21, 1999 (Volume 64, Number 244)] [Proposed Rules] [Page 71331-71333] From the Federal Register Online via GPO Access [wais.access.gpo.gov] [DOCID:fr21de99-21] ======================================================================= ----------------------------------------------------------------------- NUCLEAR REGULATORY COMMISSION 10 CFR Parts 71 and 73 RIN 3150-AG41 Advance Notification to Native American Tribes of Transportation of Certain Types of Nuclear Waste AGENCY: Nuclear Regulatory Commission. ACTION: Advance notice of proposed rulemaking. ----------------------------------------------------------------------- SUMMARY: The Nuclear Regulatory Commission (NRC) is considering an amendment to its regulations that would require NRC licensees to notify


Controlled Nuclear Fusion Reactions  

Science Journals Connector (OSTI)

... THE presentation of full and authoritative accounts of research on controlled nuclear fusion reactions was a major feature of the second Geneva Conference on the Peaceful Uses of ...



Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Unclassified Controlled Nuclear Information  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

To prevent unauthorized dissemination of Unclassified Controlled Nuclear Information (UCNI). Cancels DOE 5635.4 and DOE 5650.3A



Nuclear Energy Systems  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Role of Synchrotron Radiation in Solving Scientific Challenges in Advanced Nuclear Energy Systems 27 to 28 January 2010 at Argonne's Advanced Photon Source Scope Third-generation...


Comprehensive Nuclear Materials  

SciTech Connect (OSTI)

This book encompasses a rich seam of current information on the vast and multidisciplinary field of nuclear materials employed in fission and prototype fusion systems. Discussion includes both historical and contemporary international research in nuclear materials, from Actinides to Zirconium alloys, from the worlds leading scientists and engineers. Synthesizes pertinent current science to support the selection, assessment, validation and engineering of materials in extreme nuclear environments. The work discusses the major classes of materials suitable for usage in nuclear fission, fusion reactors and high power accelerators, and for diverse functions in fuels, cladding, moderator and control materials, structural, functional, and waste materials.

Konings, Dr. Rudy J. M. [European Commission Joint Research Centre; Allen, Todd R. [University of Wisconsin, Madison; Stoller, Roger E [ORNL; Yamanaka, Prof. Shinsuke [Osaka University



Nuclear criticality safety guide  

SciTech Connect (OSTI)

This technical reference document cites information related to nuclear criticality safety principles, experience, and practice. The document also provides general guidance for criticality safety personnel and regulators.

Pruvost, N.L.; Paxton, H.C. [eds.] [eds.



Nuclear Physics: Experiment Research  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

search Nuclear Physics Program Please upgrade your browser. This site's design is only visible in a graphical browser that supports web standards, but its content is accessible to...


Nuclear Power in Idaho  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Look at Issues Dr. Ralph Bennett Idaho National Laboratory 2 What's been Changing? 1. Nuclear Regulatory Commission (NRC) * Combined constructionoperating license (COL) * Early...


Nuclear Data Links  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Links to Useful Online Nuclear Physics Journals Important Online Resources Science Direct American Institute of Physics Journals APS Journals Online: Physical Review A, B, C, D, E,...


Nuclear Science Series: Radiochemistry  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

eBooks Radiochemistry Nuclear Science Series: Radiochemistry These volumes are publicly accessible via the Library Catalog or the links below. Question? 667-5809 Email Scope...


EIA - State Nuclear Profiles  

U.S. Energy Information Administration (EIA) Indexed Site

Massachusetts Nuclear Profile 2010 Massachusetts profile Massachusetts total electric power industry, summer capacity and net generation, by energy source, 2010 Primary energy...


EIA - State Nuclear Profiles  

U.S. Energy Information Administration (EIA) Indexed Site

Iowa Nuclear Profile 2010 Iowa profile Iowa total electric power industry, summer capacity and net generation, by energy source, 2010 Primary energy source Summer capacity (mw)...


EIA - State Nuclear Profiles  

U.S. Energy Information Administration (EIA) Indexed Site

Illinois Nuclear Profile 2010 Illinois profile Illinois total electric power industry, summer capacity and net generation, by energy source, 2010 Primary energy source Summer...


Nuclear magnetic resonance imaging  

Science Journals Connector (OSTI)

Nuclear magnetic resonance imaging (NMRI) is a powerful imaging modality having a range of important applications to medicine and industry. The basic principles of NMRI are reviewed in...

Rothwell, William P



EIA - State Nuclear Profiles  

U.S. Energy Information Administration (EIA) Indexed Site

Louisiana Nuclear Profile 2010 Louisiana profile Louisiana total electric power industry, summer capacity and net generation, by energy source, 2010 Primary energy source Summer...


Nuclear Physics from QCD  

E-Print Network [OSTI]

Effective field theories provide a bridge between QCD and nuclear physics. I discuss light nuclei from this perspective, emphasizing the role of fine-tuning.

U. van Kolck



The Chernobyl Nuclear Accident  

Science Journals Connector (OSTI)

...often repeated belief of the opponents of nuclear power that the risks, whatever they are, outweigh the need for and the known value of nuclear energy in developing electric power in the world. We are some 44 years away from the first development of nuclear energy, and yet the authors of this editorial... To the Editor: Cassel and Leaning began their editorial (July 27 issue)1 with a review of the report on the Chernobyl nuclear accident by Baranov et al.2 in the same issue, but they very quickly shifted to a barrage of warning shots across the bow of the ...



Nuclear Physics Program  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Office Data Acquisition Group Detector & Imaging Group Electronics Group User Liaison Nuclear Physics Program HALL A Hall A wide shot of detectors Scientists from across the...


National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

University of California Extend Management Contracts For Defense Labs The Department of Energy (DOE), the National Nuclear Security Administration (NNSA) and the University of...


Nuclear Magnetic Moments  

Science Journals Connector (OSTI)

This paper contains approximate formulas (Eqs. (5) and (6) for the calculation of nuclear magnetic moments from observed hyperfine structure separations.

S. Goudsmit



Management of Nuclear Materials  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

To establish requirements for the lifecycle management of DOE owned and/or managed accountable nuclear materials. Cancels DOE O 5660.1B.



Bearwall Energy Efficient Solutions  

E-Print Network [OSTI]

CATEE Conference November 20, 2014 ENERGY EFFICIENT SOLUTIONS ESL-KT-14-11-06 CATEE 2014: Clean Air Through Efficiency Conference, Dallas, Texas Nov. 18-20 Brief History of Bearwall… Who We Are: ? Manuel Sovero ? Luis Osorio Energy Conservation... Experience: ESL-KT-14-11-06 CATEE 2014: Clean Air Through Efficiency Conference, Dallas, Texas Nov. 18-20 Energy Programs… ESL-KT-14-11-06 CATEE 2014: Clean Air Through Efficiency Conference, Dallas, Texas Nov. 18-20 Bearwall Methodology… Introduction...



Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Nuclear Materials Management U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office (NNSA/NSO)  

SciTech Connect (OSTI)

In light of the changing Defense Complex mission, the high cost to storing and protecting nuclear materials, and in consideration of scarcity of resources, it is imperative that the U.S. Department of Energy (DOE) owned nuclear materials are managed effectively. The U.S. Department of Energy, National Nuclear Security Administration (NNSA) Strategic Action Plan outlines the strategy for continuing to meet America’s nuclear security goals, meeting the overall mission challenges of DOE and NNSA as well as giving focus to local missions. The mission of the NNSA/NSO Nuclear Materials Management (NMM) Program is to ensure that nuclear material inventories are accurately assessed and reported, future material needs are adequately planned, and that existing Nevada Test Site (NTS) inventories are efficiently utilized, staged, or dispositioned. The NNSA/NSO understands that the NTS has unique characteristics to serve and benefit the nation with innovative solutions to the complex problems involving Special Nuclear Materials, hazardous materials, and multi-agency, integrated operations. The NNSA/NSO is defining infrastructure requirements for known future missions, developing footprint consolidation strategic action plans, and continuing in the path of facility modernization improvements. The NNSA/NSO is striving for the NTS to be acknowledged as an ideal location towards mission expansion and growth. The NTS has the capability of providing isolated, large scale construction and development locations for nuclear power or alternate energy source facilities, expanded nuclear material storage sites, and for new development in “green” technology.

Jesse Schreiber



Nuclear Power Facilities (2008) | Department of Energy  

Broader source: Energy.gov (indexed) [DOE]

Nuclear Power Facilities (2008) Nuclear Power Facilities (2008) Nuclear Power Facilities (2008) More Documents & Publications Financial Institution Partnership Program - Commercial...


Unclassified Controlled Nuclear Information (UCNI) | Department...  

Energy Savers [EERE]

Unclassified Controlled Nuclear Information (UCNI) Unclassified Controlled Nuclear Information (UCNI) Welcome to the Unclassified Controlled Nuclear Information (UCNI) webpage....


National Nuclear Security Administration | Department of Energy  

Office of Environmental Management (EM)

National Nuclear Security Administration National Nuclear Security Administration National Nuclear Security Administration More Documents & Publications Global Threat Reduction...


Nuclear Transportation Management Services | Department of Energy  

Office of Environmental Management (EM)

Nuclear Transportation Management Services Nuclear Transportation Management Services Nuclear Transportation Management Services More Documents & Publications Transportation and...


Unclassified Controlled Nuclear Information Training | Department...  

Office of Environmental Management (EM)

Unclassified Controlled Nuclear Information Training Unclassified Controlled Nuclear Information Training Training Unclassified Controlled Nuclear Information for persons with...


Advanced Nuclear Energy Projects Solicitation | Department of...  

Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

Advanced Nuclear Energy Projects Solicitation Advanced Nuclear Energy Projects Solicitation INFORMATIONAL MATERIALS ADVANCED NUCLEAR ENERGY PROJECTS SOLICITATION Solicitation...


Draft Advanced Nuclear Energy Projects Solicitation | Department...  

Broader source: Energy.gov (indexed) [DOE]

Draft Advanced Nuclear Energy Projects Solicitation Draft Advanced Nuclear Energy Projects Solicitation INFORMATIONAL MATERIALS DRAFT ADVANCED NUCLEAR ENERGY PROJECTS SOLICITATION...


Interim Management of Nuclear Materials  

Broader source: Energy.gov (indexed) [DOE]

1995/01_eis0220_for.html[6/27/2011 12:53:53 PM] 1995/01_eis0220_for.html[6/27/2011 12:53:53 PM] FOREWORD The Savannah River Site (SRS) is a major Department of Energy (DOE) installation. The past mission of the SRS was to produce nuclear materials that supported the defense, research, and medical programs of the United States. In 1992 the Secretary of Energy directed the SRS to phase out defense-related chemical separations activities. As a result of shutdowns and reduced demand for nuclear materials, the SRS presently has a large inventory of in-process solutions, reactor fuel assemblies, and reactor targets. These materials, due to their form or to the condition in which they are maintained, could represent a concern for the public, worker health and safety, and the environment. DOE published a Notice of Intent (NOI) to prepare this environmental impact statement (EIS) on March 17, 1994 (59


Interim Management of Nuclear Materials  

Broader source: Energy.gov (indexed) [DOE]

1995/01_eis0220_for.html[6/27/2011 12:53:53 PM] 1995/01_eis0220_for.html[6/27/2011 12:53:53 PM] FOREWORD The Savannah River Site (SRS) is a major Department of Energy (DOE) installation. The past mission of the SRS was to produce nuclear materials that supported the defense, research, and medical programs of the United States. In 1992 the Secretary of Energy directed the SRS to phase out defense-related chemical separations activities. As a result of shutdowns and reduced demand for nuclear materials, the SRS presently has a large inventory of in-process solutions, reactor fuel assemblies, and reactor targets. These materials, due to their form or to the condition in which they are maintained, could represent a concern for the public, worker health and safety, and the environment. DOE published a Notice of Intent (NOI) to prepare this environmental impact statement (EIS) on March 17, 1994 (59


Radioactivities in Solution by Particle Radiation can Increase Sister  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Radioactivities in Solution by Particle Radiation can Increase Sister Radioactivities in Solution by Particle Radiation can Increase Sister Chromatid Exchanges Junko Maeda Colorado State University Abstract Introduction Non-radioactive atoms can become radioactive from a nuclear reaction when atoms are hit by other high energy particles. These radioactivations are observed in nuclear facilities and may result in health effects in humans. Protons, carbon-ions, and iron-ions are tested to verify this hypothesis. Materials and Methods Protons were accelerated to 70MeV in cyclotron (NIRS-930) at National Institute of Radiological Sciences (NIRS). Carbon-ions and iron-ions were accelerated to 290MeV/n and 500MeV/n respectively, in HIMAC (Heavy ion Medical Accelerator in Chiba) at NIRS. 60ml of sterilized Milli-Q ultra pure water or PBS were filled in Falcon T25 flasks and exposed to ionizing


Future World Energy Constraints and the Direction for Solutions  

SciTech Connect (OSTI)

This paper was originally written in response to the concern that rising levels of CO2 in the atmosphere caused by burning of fossil fuels will ultimately contribute to global warming. Now we are beginning to see evidence of coming problems in the supply of fuels for transportation. This paper describes the benefits of adequate energy supply and the problems of future energy supply. Partial solutions are suggested for immediate application as well as longer term solutions to address both of these concerns. To evaluate the situation and solutions we must understand: (1) how much primary energy is currently used world-wide and might be needed in 2100, (2) how important energy is to the welfare of people, (3) the forms of energy sources and end uses and (4) where new sources may come from. The major portion of world primary energy demand is provided by fossil fuels. This portion dropped from 93% in 1970 to 85% in 1995, mainly because of the increased use of nuclear energy. How ever, since the mid-1990s fossil fuels have maintained their 85% share of world energy supply. The importance of the relationship between per capita energy consumption and per capita income for the world is discussed. The limits of conservation, energy efficiency and renewable energies are examined. The contribution of renewable energies is compared to 41 different views of world energy demand in 2100. Without new technology for large scale storage of intermittent electricity from wind and solar the contribution of renewable energies is not likely to grow significantly beyond the current level of 7-8%. The paper offers conclusions and partial solutions that we can work on immediately. Examination of the forms of energy supplied by the sun, which is powered by nuclear fusion, and the way in which nuclear fission currently supplies energy to the world sets the research framework for longer term solutions. This framework points towards two possible longer term complementary res earch projects which take advantage of the concentrated energy and portability of nuclear fission: (1) to find ways of extending nuclear fission to smaller transportation and heating applications and (2) to develop nuclear fusion for manufacturing fissionable materials.

Lightfoot, H.D.



Soy Solutions | Open Energy Information  

Open Energy Info (EERE)

Soy Solutions Place: Milford, Iowa Zip: 51351 Product: Manufacturer and distributor of 100 percent Soy-Based Biodiesel References: Soy Solutions1 This article is a stub. You can...


DEVELOPMENT Solutions | Open Energy Information  

Open Energy Info (EERE)

DEVELOPMENT Solutions DEVELOPMENT Solutions Jump to: navigation, search Name DEVELOPMENT Solutions Place Reading, England, United Kingdom Zip RG4 8UJ Sector Efficiency Product DEVELOPMENT Solutions (DS) supports investors to realise projects with sustainable applications, including in the areas of environment, energy efficiency, water resource management and other applications for sustainable development. References DEVELOPMENT Solutions[1] LinkedIn Connections CrunchBase Profile No CrunchBase profile. Create one now! This article is a stub. You can help OpenEI by expanding it. DEVELOPMENT Solutions is a company located in Reading, England, United Kingdom . References ↑ "DEVELOPMENT Solutions" Retrieved from "http://en.openei.org/w/index.php?title=DEVELOPMENT_Solutions&oldid=344207


Nuclear fuel cycle information workshop  

SciTech Connect (OSTI)

This overview of the nuclear fuel cycle is divided into three parts. First, is a brief discussion of the basic principles of how nuclear reactors work; second, is a look at the major types of nuclear reactors being used and world-wide nuclear capacity; and third, is an overview of the nuclear fuel cycle and the present industrial capability in the US.

Not Available



Generation IV Nuclear Energy Systems ...  

E-Print Network [OSTI]

Generation IV Nuclear Energy Systems ... The U.S. Department of Energy's Office of Nuclear Energy enhance safety and security, and develop nuclear power as an energy source for industrial applications Information ... U.S. Department of Energy www.energy.gov DOE Office of Nuclear Energy www.nuclear

Kemner, Ken


National Nuclear Science Week 2012 - SRSCRO  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

to Know Nuclear National Nuclear Science Week January 23 - 27, 2012 Fostering a deeper public understanding Logos for: National Nuclear Science Week, Nuclear Workforce Initiative,...


Civilian Nuclear Programs, SPO-CNP: LANL  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Nuclear Office of Science Civilian Nuclear Programs Home Advanced Nuclear Energy Programs Yucca Mountain and Nevada Test Site Programs WIPP and Actinide Science Programs Nuclear...


Nuclear Resonance Fluorescence for Materials Assay  

E-Print Network [OSTI]

nuclear forensics, and safeguards for nuclear fuel cyclesIndex Terms—Nuclear Safeguards, non-destructive analysis,radiological source, nuclear safeguards including measuring

Quiter, Brian



The Office of Nuclear Energy Announces Central Europe Nuclear Safety  

Broader source: Energy.gov (indexed) [DOE]

The Office of Nuclear Energy Announces Central Europe Nuclear The Office of Nuclear Energy Announces Central Europe Nuclear Safety Workshop in Prague The Office of Nuclear Energy Announces Central Europe Nuclear Safety Workshop in Prague October 3, 2011 - 2:04pm Addthis The Office of Nuclear Energy, in partnership with Czech Republic Ministry of Industry and Trade, Ministry of Foreign Affairs, the State Agency for Nuclear Safety of the Czech Republic, and Argonne National Laboratory, is conducting a regional Nuclear Safety Workshop on Trends in Nuclear Power Plant Safety for Robust Civil Nuclear Programs on Oct. 10-13, 2011 in Prague. U.S. Ambassador Norman Eisen and Department of Energy Assistant Secretary for Nuclear Energy Dr. Pete Lyons will deliver speeches welcoming participants. Representatives from the Czech Republic, Bulgaria, Lithuania,

Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


The Nuclear Revolution, Relative Gains, and International Nuclear Assistance  

E-Print Network [OSTI]

204. Bhatia, Shyam. 1988. Nuclear rivals in the Middle East.of the merits of selective nuclear proliferation. Journal ofThe Case for a Ukranian nuclear deterrent. Foreign Affairs.

Kroenig, Matthew



Density content of nuclear symmetry energy from nuclear observables  

Science Journals Connector (OSTI)

The nuclear symmetry energy at a given density measures the energy transferred in converting symmetric nuclear matter into the pure neutron matter. The density content of nuclear symmetry energy remains poorly co...




NUCLEAR ENERGY PERGAMON Annals of Nuclear Energy 27 (2000) 138551398  

E-Print Network [OSTI]

annafs of NUCLEAR ENERGY PERGAMON Annals of Nuclear Energy 27 (2000) 138551398 www-4549(00)00033-5 #12;1386 I. Phi!, V. Arzhanov. /Annals qf Nuclear Energy 27 (2000) 1385-1398 subcritical systems (ADS

Pázsit, Imre


Generation III reactors safety requirements and the design solutions  

SciTech Connect (OSTI)

Nuclear energy's public acceptance, and hence its development, depends on its safety. As a reactor designer, we will first briefly remind the basic safety principles of nuclear reactors' design. We will then show how the industry, and in particular Areva with its EPR, made design evolution in the wake of the Three Miles Island accident in 1979. In particular, for this new generation of reactors, severe accidents are taken into account beyond the standard design basis accidents. Today, Areva's EPR meets all so-called 'generation III' safety requirements and was licensed by several nuclear safety authorities in the world. Many innovative solutions are integrated in the EPR, some of which will be introduced here.

Felten, P. [Areva NP (France)



Nuclear Waste Management using Electrometallurgical Technology - Nuclear  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Technology Technology Nuclear Fuel Cycle and Waste Management Technologies Overview Modeling and analysis Unit Process Modeling Mass Tracking System Software Waste Form Performance Modeling Safety Analysis, Hazard and Risk Evaluations Development, Design, Operation Overview Systems and Components Development Expertise System Engineering Design Other Major Programs Work with Argonne Contact us For Employees Site Map Help Join us on Facebook Follow us on Twitter NE Division on Flickr Nuclear Waste Management using Electrometallurgical Technology Bookmark and Share The NE system engineering activities involve the conceptual design, through the manufacturing and qualification testing of the Mk-IV and Mk-V electrorefiner and the cathode processor. These first-of-a-kind large scale


Bonner sphere neutron spectrometry at nuclear workplaces in the framework of the EVIDOS project  

Science Journals Connector (OSTI)

......consistent for each analysis of the 14 BSS datasets. As results, the solution neutron fluence...the Euratom 5th Framework Programme: Nuclear Energy, 1998-2002, Contract No FIKR-CT-2001-00175...spectrometry with Bonner spheres at workplaces in nuclear facilities at Krummel (Germany)-EVIDOS......

V. Lacoste; M. Reginatto; B. Asselineau; H. Muller




SciTech Connect (OSTI)

Solids such as granular activated carbon, hematite and sodium phosphates, if present as sludge components in nuclear waste storage tanks, have been found to be capable of precipitating/sorbing actinides like plutonium, neptunium and uranium from nuclear waste storage tank supernatant liqueur. Thus, the potential may exists for the accumulation of fissile materials in such nuclear waste storage tanks during lengthy nuclear waste storage and processing. To evaluate the nuclear criticality safety in a typical nuclear waste storage tank, a study was initiated to measure the affinity of granular activated carbon, hematite and anhydrous sodium phosphate to sorb plutonium, neptunium and uranium from alkaline salt solutions. Tests with simulated and actual nuclear waste solutions established the affinity of the solids for plutonium, neptunium and uranium upon contact of the solutions with each of the solids. The removal of plutonium and neptunium from the synthetic salt solution by nuclear waste storage tank solids may be due largely to the presence of the granular activated carbon and transition metal oxides in these storage tank solids or sludge. Granular activated carbon and hematite also showed measurable affinity for both plutonium and neptunium. Sodium phosphate, used here as a reference sorbent for uranium, as expected, exhibited high affinity for uranium and neptunium, but did not show any measurable affinity for plutonium.

Oji, L; Bill Wilmarth, B; David Hobbs, D



Controlled Nuclear Fusion  

Science Journals Connector (OSTI)

... papers have an English abstract. Translations of the Russian papers have already been published in Nuclear Fusion. It is a great pity, for Western readers at least, that the Russian ... two volumes are obviously going to be standard reference books for those interested in controlled nuclear fusion. They also contain a large amount of information, particularly on the theoretical side, ...




Lithium and nuclear fusion  

Science Journals Connector (OSTI)

... the EEC of a decision on the siting of the Joint European Torus (JET) nuclear fusion project, worrying setbacks though these are for European fusion research, should not be allowed ... gain is the highest (about 1,800 per fusion reaction). The first generation of nuclear fusion reactors will therefore need a continuous supply of both deuterium and tritium fuel.

Nick Walton, Ed Spooner



Polyploidy and Nuclear Fusion  

Science Journals Connector (OSTI)

... mitotic figures, reported during delayed wound healing in Rhodnius11, are likewise the result of nuclear fusion. Polyploid nuclei are far more plentiful in the fat body of Rhodnius after extreme ... starved for long periods. It is probable that this occasional polyploidy also is due to nuclear fusion. Endomitosis, however, occurs regularly in the fat body of Rhodnius as in other ...




Nuclear Regulatory Commission issuances  

SciTech Connect (OSTI)

This thirty-second volume of issuances (1--496) of the Nuclear Regulatory Commission and its Atomic Safety and Licensing Appeal Boards, Atomic Safety and Licensing Boards, and Administrative Law Judges it covers the period from July 1, 1990 to December 31, 1990. The hardbound edition of the Nuclear Regulatory commission Issuances is a final compilation of the monthly issuances. It includes all of the legal precedents for the agency within a six-month period. Any opinions, decisions, denials, memoranda and orders of the Commission inadvertently omitted from the monthly softbounds and any corrections submitted by the NRC legal staff to the printed softbound issuances are contained in the hardbound edition. Cross references in the text and indexes are to the NRCI page numbers which are the same as the page numbers in this publication. Issuances are referred to as follows: Commission--CLI, Atomic Safety and Licensing Appeal Boards--ALAB, Atomic Safety and Licensing Boards--LBP, Administrative Law Judges--ALJ, Directors'Decisions--DD, and Denial of Petitions for Rulemaking--DPRM. Specific facilities discussed are: Carroll County Nuclear Station; Palo Verde Nuclear Generating Station; Perry Nuclear Power Plant; Quad Cities Nuclear Power Stations; Seabrook Station; Shoreham Nuclear Generating Plant; Vermont Yankee Nuclear Power Station; and Vogtle Electric Generating Plant.

Not Available



New Nuclear Reaction  

Science Journals Connector (OSTI)

Thermonuclear-like reaction points to possibilities for better kind of nuclear energy ... FISSION can make a chain reaction take place, as can fusion. ... To these two, scientists at University of California Radiation Laboratory have added a third: a "catalyzed nuclear reaction," a reaction that yields energy and is akin to fusion (thermonuclear) reactions. ...



Nuclear power engineering  

Science Journals Connector (OSTI)

... been easy to write 950 pages of unrelenting tedium. But both volumes of Pedersen's Nuclear Power read like computer printouts, an avalanche of factual information recited in a dogged monotone, ... even the most ingenious intricacy is embalmed lifeless on the page. Indeed both volumes of Nuclear Power read disconcertingly like each other. The first is called ...

Walt Patterson



Whither Nuclear Physics ?  

E-Print Network [OSTI]

Nuclear Physics has had its ups and downs. However in recent years, bucked up by some new and often puzzling data, it has become a potentially very rich field. We review some of these exciting developments in a few important sectors of nuclear physics. Emphasis shall be on the study of exotic nuclei and the new physics that these nuclei are teaching us.

Syed Afsar Abbas



Physics in nuclear safeguards  

Science Journals Connector (OSTI)

International agreements demand that rigorous control procedures are applied to nuclear material. Containment and surveillance techniques are used to monitor the security aspects of dealing with the material whilst accountancy provides quantitative information. The author shows that the methods used to control nuclear material can be conveniently broken down into these two parts

B.W. Hooton



Nuclear wastes: Small disposals  

Science Journals Connector (OSTI)

... Much to the relief of many east coast hospitals, universities and medical schools, the Nuclear Regulatory Commission (NRC) is proposing that liquid scintillation media used for detecting low levels ... for detecting low levels of radioactivity in biological samples need no longer be buried in nuclear ...

David Dickson



Nuclear Explosive Safety  

Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

The directive establishes specific nuclear explosive safety (NES) program requirements to implement the DOE NES standards and other NES criteria for routine and planned nuclear explosive operations. Cancels DOE O 452.2B. Canceled by DOE O 452.2D.



Instrumentation of Nuclear Reactors  

Science Journals Connector (OSTI)

... s Lecture Theatre on January 8, a symposium of papers on the instrumentation of nuclear reactors was organized, at which about five hundred members and visitors attended, including guests from ... the Institution, took the chair and introduced Sir John Cockcroft, whose lecture on "Nuclear Reactors and their Applications" provided a general background for the three specialized papers which followed. ...



[Nuclear theory: Annual report  

SciTech Connect (OSTI)

This report discusses topics on : nuclear structure models; algebraic models of hadronic structure; nuclear reactions; hot rotating nuclei; chaos in nuclei; signatures of the quark-gluon plasma; hadronic spectroscopy; octupole collectivity in nuclei; finite-temperature methods for the many-body problem; and classical limit of algebraic hamiltonians. (LSP)

Iachello, F.; Alhassid, Y.; Kusnezov, D.



(Nuclear theory: Annual report)  

SciTech Connect (OSTI)

This report discusses topics on : nuclear structure models; algebraic models of hadronic structure; nuclear reactions; hot rotating nuclei; chaos in nuclei; signatures of the quark-gluon plasma; hadronic spectroscopy; octupole collectivity in nuclei; finite-temperature methods for the many-body problem; and classical limit of algebraic hamiltonians. (LSP)

Iachello, F.; Alhassid, Y.; Kusnezov, D.


Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Nuclear physics and cosmology  

SciTech Connect (OSTI)

There are important aspects of Cosmology, the scientific study of the large scale properties of the universe as a whole, for which nuclear physics can provide insights. Here, we will focus on Standard Big-Bang Nucleosynthesis and we refer to the previous edition of the School [1] for the aspects concerning the variations of constants in nuclear cosmo-physics.

Coc, Alain [Centre de Sciences Nucléaires et de Sciences de la Matière (CSNSM), CNRS/IN2P3, Université Paris Sud 11, UMR 8609, Bâtiment 104, F-91405 Orsay Campus (France)



Office of Nuclear Threat Science | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

Threat Science | National Nuclear Security Administration Threat Science | National Nuclear Security Administration Our Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response Recapitalizing Our Infrastructure Continuing Management Reform Countering Nuclear Terrorism About Us Our Programs Our History Who We Are Our Leadership Our Locations Budget Our Operations Media Room Congressional Testimony Fact Sheets Newsletters Press Releases Speeches Events Social Media Video Gallery Photo Gallery NNSA Archive Federal Employment Apply for Our Jobs Our Jobs Working at NNSA Blog The National Nuclear Security Administration Office of Nuclear Threat Science Home > About Us > Our Programs > Counterterrorism and Counterproliferation > Office of Nuclear Threat Science Office of Nuclear Threat Science


Electric Power Produced from Nuclear Reactor | National Nuclear...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Electric Power Produced from Nuclear Reactor | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing...


Nuclear Waste Policy Act Signed | National Nuclear Security Administra...  

National Nuclear Security Administration (NNSA)

Waste Policy Act Signed | National Nuclear Security Administration People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency Response...


Nuclear disarmament with a personal touch | National Nuclear...  

National Nuclear Security Administration (NNSA)

disarmament with a personal touch | National Nuclear Security Administration People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy Emergency...


NNSA: Working To Prevent Nuclear Terrorism | National Nuclear...  

National Nuclear Security Administration (NNSA)

secure weapons-grade nuclear material at the Mayak Production Association in Ozersk, Russia. Completed MPC&A upgrades to 15 nuclear material buildings outside of Russia. Returned...


Reducing the Nuclear Weapons Stockpile | National Nuclear Security...  

National Nuclear Security Administration (NNSA)

the Nuclear Weapons Stockpile | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering...


JPRS report supplement: Nuclear developments. Iraq -- Nuclear and missile proliferation  

SciTech Connect (OSTI)

This document contains articles from foreign periodicals from throughout the world, translated into English, that concern nuclear developments, specifically nuclear and missile proliferation in Iraq.




Ultrafast nuclear spin polarization for isotopes with large nuclear spin  

Science Journals Connector (OSTI)

We theoretically investigate the temporal dynamics of nuclear spin induced by short laser pulses. To realize ultrafast nuclear spin polarization, we coherently excite the hyperfine...

Nakajima, Takashi



NUCLEAR ISLANDS International Leasing  

Broader source: Energy.gov (indexed) [DOE]

ISLANDS ISLANDS International Leasing of Nuclear Fuel Cycle Sites to Provide Enduring Assurance of Peaceful Use Christopher E. Paine and Thomas B. Cochran Current International Atomic Energy Agency safeguards do not provide adequate protection against the diversion to military use of materials or technology from certain types of sensitive nuclear fuel cycle facilities. In view of highly enriched uranium's relatively greater ease of use as a nuclear explosive material than plutonium and the significant diseconomies of commercial spent fuel reprocessing, this article focuses on the need for improved international controls over uranium enrichment facilities as the proximate justification for creation of an International Nuclear Fuel Cycle Association (INFCA). In principle, the proposal is equally applicable to alleviating the proliferation concerns provoked by nuclear fuel


Nuclear Facility Design  

Broader source: Energy.gov (indexed) [DOE]

Design Design FUNCTIONAL AREA GOAL: Headquarters and Field organizations and their contractors ensure that nuclear facilities are designed to assure adequate protection for the public, workers, and the environment from nuclear hazards. REQUIREMENTS: ï‚· 10 CFR 830.120 ï‚· 10 CFR 830 subpart B ï‚· DOE O 413.3 ï‚· DOE O 420.1B ï‚· DOE O 414.1C ï‚· DOE O 226.1 ï‚· DOE M 426.1 ï‚· DEAR 970-5404-2 Guidance: ï‚· DOE G 420.1-1 ï‚· Project Management Practices, Integrated Quality ( Rev E, June 2003) ï‚· DOE Implementation Plan for DNSB Recommendation 2004-2 Performance Objective 1: Contractor Program Documentation Contracts between and the contractors who operate nuclear facilities contain adequate requirements concerning the conduct of nuclear facility safety design for nuclear facility capital projects and major modifications and the


World nuclear outlook 1995  

SciTech Connect (OSTI)

As part of the EIA program to provide energy information, this analysis report presents the current status and projections through 2015 of nuclear capacity, generation, and fuel cycle requirements for all countries in the world using nuclear power to generate electricity for commercial use. It also contains information and forecasts of developments in the uranium market. Long-term projections of US nuclear capacity, generation, and spent fuel discharges for two different scenarios through 2040 are developed for the Department of Energy`s Office of Civilian Radioactive Waste Management (OCRWM). In turn, the OCRWM provides partial funding for preparation of this report. The projections of uranium requirements are provided to the Organization for Economic Cooperation and Development (OECD) for preparation of the Nuclear Energy Agency/OECD report, Summary of Nuclear Power and Fuel Cycle Data in OECD Member Countries.




THz Dynamic Nuclear Polarization NMR  

E-Print Network [OSTI]

Dynamic nuclear polarization (DNP) increases the sensitivity of nuclear magnetic resonance (NMR) spectroscopy by using high frequency microwaves to transfer the polarization of the electrons to the nuclear spins. The ...

Nanni, Emilio Alessandro


Neutron and Nuclear Science News  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

News Recent news and events related to neutron and nuclear science at LANSCE. Neutron and Nuclear Science News Links Neutron and Nuclear Science News Media Links Profiles Events at...


Supporting Our Nation's Nuclear Industry  

ScienceCinema (OSTI)

On the 60th anniversary of the world's first nuclear power plant to produce electricity, Assistant Secretary for Nuclear Energy Peter Lyons discusses the Energy Department's and the Administration's commitment to promoting a nuclear renaissance in the United States.

Lyons, Peter




E-Print Network [OSTI]

Letters 24, 1507 (1970); Nuclear Data B4, 663 (1970). 5. R.S. Hager and E. C. Seltzer, Nuclear Data A4, 1 (1968). 6. H.J. Nijgh, and R. Van Lieshout, Nuclear Spectroscopy Tables (

Authors, Various



A Perspective on Nuclear Waste  

Science Journals Connector (OSTI)

The management of spent nuclear fuel and high-level nuclear waste has the deserved reputation as one of ... facing the United States and other nations using nuclear reactors for electric power generation. This pa...

D. Warner North



The Discovery of Nuclear Waste  

Science Journals Connector (OSTI)

When did man discover nuclear waste? To answer this question, we first have to ask if nuclear waste really is something that could be called ... Prize in physics. In early writings within nuclear energy research ...

Göran Sundqvist



Nuclear Waste Disposal Plan Drafted  

Science Journals Connector (OSTI)

Nuclear Waste Disposal Plan Drafted ... Of all the issues haunting nuclear power plants, that of disposing of the radioactive wastes and spent nuclear fuel they generate has been the most vexing. ...



Relativistic Nuclear Energy Density Functionals  

Science Journals Connector (OSTI)

......research-article Articles Relativistic Nuclear Energy Density Functionals Dario Vretenar...196, 2012 137 Relativistic Nuclear Energy Density Functionals Dario Vretenar...and P. Ring 2. Relativistic nuclear energy density functionals Even though......

Dario Vretenar; Tamara Niksic; Peter Ring


Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Energy requirements for nuclear transformations  

Science Journals Connector (OSTI)

Energy requirements for nuclear transformations ... There are several conservation requirements that must be met in nuclear reactions, including the conservation of energy (E = mc2), charge, angular and linear momentum. ... Nuclear / Radiochemistry ...

Benjamin Carrol; Peter F. E. Marapodi



Antineutrino Detection for Nuclear Monitoring  

E-Print Network [OSTI]

covertly acquire these special nuclear materials from: Assembled weapons Raw uranium ore Enriched uranium antineutrino monitoring infrastructure will help avert the spread of covert nuclear reactors and weaponsAntineutrino Detection for Nuclear Monitoring Draft #12;Graphic courtesy Lawrence Livermore

Mcdonough, William F.


Looking for Energy Solutions  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Governments and Schools: Governments and Schools: Looking for Energy Solutions Turn to an ENERGY STAR ® Service and Product Provider Partner ENERGY STAR Service and Product Providers (SPPs) have the experience and access to the tools needed to implement energy- efficient strategies that are right for you. Following the U.S. Environmental Protection Agency's (EPA) Guidelines for Energy Management, a proven strategy developed from ENERGY STAR partner successes, your organization can gain control of energy expenses and demonstrate environmental leadership. SPPs can help you assess your energy performance and recommend low-cost upgrades, cost-effective investments, and longer-term strategies that make the most sense for you. ENERGY STAR SPPs make it easy for you to care for your constituents, your facilities, and your finances.


2010 Water & Aqueous Solutions  

SciTech Connect (OSTI)

Water covers more than two thirds of the surface of the Earth and about the same fraction of water forms the total mass of a human body. Since the early days of our civilization water has also been in the focus of technological developments, starting from converting it to wine to more modern achievements. The meeting will focus on recent advances in experimental, theoretical, and computational understanding of the behavior of the most important and fascinating liquid in a variety of situations and applications. The emphasis will be less on water properties per se than on water as a medium in which fundamental dynamic and reactive processes take place. In the following sessions, speakers will discuss the latest breakthroughs in unraveling these processes at the molecular level: Water in Solutions; Water in Motion I and II; Water in Biology I and II; Water in the Environment I and II; Water in Confined Geometries and Water in Discussion (keynote lecture and poster winners presentations).

Dor Ben-Amotz



US nuclear weapons policy  

SciTech Connect (OSTI)

We are closing chapter one'' of the nuclear age. Whatever happens to the Soviet Union and to Europe, some of the major determinants of nuclear policy will not be what they have been for the last forty-five years. Part of the task for US nuclear weapons policy is to adapt its nuclear forces and the oganizations managing them to the present, highly uncertain, but not urgently competitive situation between the US and the Soviet Union. Containment is no longer the appropriate watchword. Stabilization in the face of uncertainty, a more complicated and politically less readily communicable goal, may come closer. A second and more difficult part of the task is to deal with what may be the greatest potential source of danger to come out of the end of the cold war: the breakup of some of the cooperative institutions that managed the nuclear threat and were created by the cold war. These cooperative institutions, principally the North Atlantic Treaty Organization (NATO), the Warsaw Pact, the US-Japan alliance, were not created specifically to manage the nuclear threat, but manage it they did. A third task for nuclear weapons policy is that of dealing with nuclear proliferation under modern conditions when the technologies needed to field effective nuclear weapons systems and their command and control apparatus are ever more widely available, and the leverage over some potential proliferators, which stemmed from superpower military support, is likely to be on the wane. This paper will make some suggestions regarding these tasks, bearing in mind that the unsettled nature of that part of the world most likely to become involved in nuclear weapons decisions today must make any suggestions tentative and the allowance for surprise more than usually important.

May, M.



Various Boussinesq solitary wave solutions  

SciTech Connect (OSTI)

The generalized Boussinesq (gB) equations have been used to model nonlinear wave evolution over variable topography and wave interactions with structures. Like the KdV equation, the gB equations support a solitary wave solution which propagates without changing shape, and this solitary wave is often used as a primary test case for numerical studies of nonlinear waves using either the gB or other model equations. Nine different approximate solutions of the generalized Boussinesq equations are presented with simple closed form expressions for the wave elevation and wave speed. Each approximates the free propagation of a single solitary wave, and eight of these solutions are newly obtained. The author compares these solutions with the well known KdV solution, Rayleigh`s solution, Laitone`s higher order solution, and ``exact`` numerical integration of the gB equations. Existing experimental data on solitary wave shape and wave speed are compared with these models.

Yates, G.T. [Univ. of Hong Kong (Hong Kong). Dept. of Mechanical Engineering



Nuclear excitation and precompound nuclear reactions  

Science Journals Connector (OSTI)

The angular distribution of nucleons emitted in nucleon-induced precompound nuclear reactions are calculated taking into account the effect of excitation on the kinematics of nucleon-nucleon scattering inside the target-plus-projectile system. The results are compared with quantum mechanical calculations and those of reaction models based on a pure nucleon-nucleon collision picture.

Anuradha De; Siddhartha Ray; Sudip Kumar Ghosh



Bubbles and drops in superheated and supercooled nuclear matter  

Science Journals Connector (OSTI)

Equilibrium solutions of bubbles and drops in superheated and supercooled nuclear matter are studied. The existence of such objects is shown to depend on several factors including Coulomb energy, surface tension, hydrodynamic stability, and fissility. We suggest conditions under which such objects might be formed in the laboratory.

Bao-An Li; Scott Pratt; Philip J. Siemens



Self-consistent methods in nuclear structure physics  

SciTech Connect (OSTI)

The authors present a very brief description of the Hartree Fock method in nuclear structure physics, discuss the numerical methods used to solve the self-consistent equations, and analyze the precision and convergence properties of solutions. As an application, they present results pertaining to quadrupole moments and single-particle quadrupole polarizations in superdeformed nuclei with A {approximately} 60.

Dobaczewski, J. [Warsaw Univ. (Poland). Inst. of Theoretical Physics][Oak Ridge National Lab., TN (United States). Joint Inst. for Heavy Ion Research]|[Univ. of Tennessee, Knoxville, TN (United States). Dept. of Physics



Method of controlling crystallite size in nuclear-reactor fuels  

DOE Patents [OSTI]

Improved spherules for making enhanced forms of nuclear-reactor fuels are prepared by internal gelation procedures within a sol-gel operation and are accomplished by first boiling the concentrated HMTA-urea feed solution before engaging in the spherule-forming operation thereby effectively controlling crystallite size in the product spherules.

Lloyd, Milton H. (Oak Ridge, TN); Collins, Jack L. (Knoxville, TN); Shell, Sam E. (Oak Ridge, TN)



Nuclear Plant Dynamics and Safety - Nuclear Engineering Division (Argonne)  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Nuclear Systems Nuclear Systems Modeling and Design Analysis > Nuclear Plant Dynamics and Safety Capabilities Nuclear Systems Modeling and Design Analysis Reactor Physics and Fuel Cycle Analysis Overview Current Projects Software Nuclear Plant Dynamics and Safety Nuclear Data Program Advanced Reactor Development Nuclear Waste Form and Repository Performance Modeling Nuclear Energy Systems Design and Development Other Capabilities Work with Argonne Contact us For Employees Site Map Help Join us on Facebook Follow us on Twitter NE on Flickr Reactor Physics and Fuel Cycle Analysis Nuclear Plant Dynamics and Safety Bookmark and Share Activities in Nuclear Plant Dynamics and Safety research and development fulfill a primary goal of the Nuclear Engineering (NE) Division to promote improvements in safe and reliable operation of present and future


Chapter 19 - Nuclear Waste Fund  

Broader source: Energy.gov (indexed) [DOE]

Nuclear Waste Fund 19-1 Nuclear Waste Fund 19-1 CHAPTER 19 NUCLEAR WASTE FUND 1. INTRODUCTION. a. Purpose. This chapter establishes the financial, accounting, and budget policies and procedures for civilian and defense nuclear waste activities, as authorized in Public Law 97-425, the Nuclear Waste Policy Act, as amended, referred to hereafter as the Act. b. Applicability. This chapter applies to all Departmental elements, including the National Nuclear Security Administration, and activities that are funded by the Nuclear Waste Fund (NWF) or the Defense Nuclear Waste Disposal appropriation. c. Background. The Act established the Office of Civilian Radioactive Waste Management (OCRWM) and assigned it responsibility for the management


Jordan | National Nuclear Security Administration  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Jordan | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...


Neutron and Nuclear Science Publications  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Publications Recent publications related to neutron and nuclear science at LANSCE. Neutron and Nuclear Science Publications Chi-Nu Publications DANCE Publications GEANIE...


Fuel availability in nuclear power.  

E-Print Network [OSTI]

?? Nuclear power is in focus of attention due to several factors these days and the expression “nuclear renaissance” is getting well known. However, concerned… (more)

Söderlund, Karl



AEC on civilian nuclear power  

Science Journals Connector (OSTI)

AEC on civilian nuclear power ... The Atomic Energy Commission has just sent to the President the 1967 supplement to its 1962 Report on Civilian Nuclear Power. ...



Tennessee Nuclear Profile - Power Plants  

U.S. Energy Information Administration (EIA) Indexed Site

Tennessee nuclear power plants, summer capacity and net generation, 2010" "Plant nametotal reactors","Summer capacity (mw)","Net generation (thousand mwh)","Share of State nuclear...


Minnesota Nuclear Profile - Power Plants  

U.S. Energy Information Administration (EIA) Indexed Site

Minnesota nuclear power plants, summer capacity and net generation, 2010" "Plant nametotal reactors","Summer capacity (mw)","Net generation (thousand mwh)","Share of State nuclear...


Massachusetts Nuclear Profile - Power Plants  

U.S. Energy Information Administration (EIA) Indexed Site

nuclear power plants, summer capacity and net generation, 2010" "Plant nametotal reactors","Summer capacity (mw)","Net generation (thousand mwh)","Share of State nuclear net...


Kansas Nuclear Profile - Power Plants  

U.S. Energy Information Administration (EIA) Indexed Site

Kansas nuclear power plants, summer capacity and net generation, 2010" "Plant nametotal reactors","Summer capacity (mw)","Net generation (thousand mwh)","Share of State nuclear...

Note: This page contains sample records for the topic "nuclear solutions srns" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


Missouri Nuclear Profile - Power Plants  

U.S. Energy Information Administration (EIA) Indexed Site

nuclear power plants, summer capacity and net generation, 2010" "Plant nametotal reactors","Summer capacity (mw)","Net generation (thousand mwh)","Share of State nuclear net...


Nebraska Nuclear Profile - Power Plants  

U.S. Energy Information Administration (EIA) Indexed Site

Nebraska nuclear power plants, summer capacity and net generation, 2010" "Plant nametotal reactors","Summer capacity (mw)","Net generation (thousand mwh)","Share of State nuclear...


Arizona Nuclear Profile - Power Plants  

U.S. Energy Information Administration (EIA) Indexed Site

nuclear power plants, summer capacity and net generation, 2010" "Plant nametotal reactors","Summer capacity (mw)","Net generation (thousand mwh)","Share of State nuclear net...


Georgia Nuclear Profile - Power Plants  

U.S. Energy Information Administration (EIA) Indexed Site

nuclear power plants, summer capacity and net generation, 2010" "Plant nametotal reactors","Summer capacity (mw)","Net generation (thousand mwh)","Share of State nuclear net...


Texas Nuclear Profile - Power Plants  

U.S. Energy Information Administration (EIA) Indexed Site

nuclear power plants, summer capacity and net generation, 2010" "Plant nametotal reactors","Summer capacity (mw)","Net generation (thousand mwh)","Share of State nuclear net...


Next Generation Nuclear Plant Phenomena  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

5 ORNLTM-2007147, Vol. 5 Next Generation Nuclear Plant Phenomena Identification and Ranking Tables (PIRTs) Volume 5: Graphite PIRTs Office of Nuclear Regulatory Research...


Wisconsin Nuclear Profile - Power Plants  

U.S. Energy Information Administration (EIA) Indexed Site

Wisconsin nuclear power plants, summer capacity and net generation, 2010" "Plant nametotal reactors","Summer capacity (mw)","Net generation (thousand mwh)","Share of State nuclear...


Ohio Nuclear Profile - Power Plants  

U.S. Energy Information Administration (EIA) Indexed Site

Ohio nuclear power plants, summer capacity and net generation, 2010" "Plant nametotal reactors","Summer capacity (mw)","Net generation (thousand mwh)","Share of State nuclear net...


Alabama Nuclear Profile - Power Plants  

U.S. Energy Information Administration (EIA) Indexed Site

nuclear power plants, summer capacity and net generation, 2010" "Plant nametotal reactors","Summer capacity (mw)","Net generation (thousand mwh)","Share of State nuclear net...


Virginia Nuclear Profile - Power Plants  

U.S. Energy Information Administration (EIA) Indexed Site

nuclear power plants, summer capacity and net generation, 2010" "Plant nametotal reactors","Summer capacity (mw)","Net generation (thousand mwh)","Share of State nuclear net...


Michigan Nuclear Profile - Power Plants  

U.S. Energy Information Administration (EIA) Indexed Site

nuclear power plants, summer capacity and net generation, 2010" "Plant nametotal reactors","Summer capacity (mw)","Net generation (thousand mwh)","Share of State nuclear net...


Iowa Nuclear Profile - Power Plants  

U.S. Energy Information Administration (EIA) Indexed Site

Iowa nuclear power plants, summer capacity and net generation, 2010" "Plant nametotal reactors","Summer capacity (mw)","Net generation (thousand mwh)","Share of State nuclear net...


Arkansas Nuclear Profile - Power Plants  

U.S. Energy Information Administration (EIA) Indexed Site

nuclear power plants, summer capacity and net generation, 2010" "Plant nametotal reactors","Summer capacity (mw)","Net generation (thousand mwh)","Share of State nuclear net...


Maryland Nuclear Profile - Power Plants  

U.S. Energy Information Administration (EIA) Indexed Site

nuclear power plants, summer capacity and net generation, 2010" "Plant nametotal reactors","Summer capacity (mw)","Net generation (thousand mwh)","Share of State nuclear net...


Vermont Nuclear Profile - Power Plants  

U.S. Energy Information Administration (EIA) Indexed Site

nuclear power plants, summer capacity and net generation, 2010" "Plant nametotal reactors","Summer capacity (mw)","Net generation (thousand mwh)","Share of State nuclear net...


russia | National Nuclear Security Administration  

National Nuclear Security Administration (NNSA)

russia | National Nuclear Security Administration Facebook Twitter Youtube Flickr RSS People Mission Managing the Stockpile Preventing Proliferation Powering the Nuclear Navy...


Nuclear & Particle Physics, Astrophysics, Cosmology  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

production, nuclear weapons, and nuclear threat reduction Proton radiography, muon tomography, proton active interrogation, wide-angle, fast-response optical telescopes, and...


Nuclear Forensics | ornl.gov  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

nuclear facilities, and inorganic mass spectrometry as applied to traditional nuclear forensic science applications. The application of classical forensic science tools (mass...


Developing new methodology for nuclear power plants vulnerability assessment  

Science Journals Connector (OSTI)

The fundamental aim of an efficient regulatory emergency preparedness and response system is to provide sustained emergency readiness and to prevent emergency situations and accidents. But when an event occurs, the regulatory mission is to mitigate consequences and to protect people and the environment against nuclear and radiological damage. The regulatory emergency response system, which would be activated in the case of a nuclear and/or radiological emergency and release of radioactivity to the environment, is an important element of a comprehensive national regulatory system of nuclear and radiation safety. In the past, national emergency systems explicitly did not include vulnerability assessments of the critical nuclear infrastructure as an important part of a comprehensive preparedness framework. But after the huge terrorist attack on 11/09/2001, decision-makers became aware that critical nuclear infrastructure could also be an attractive target to terrorism, with the purpose of using the physical and radioactive properties of the nuclear material to cause mass casualties, property damage, and detrimental economic and/or environmental impacts. The necessity to evaluate critical nuclear infrastructure vulnerability to threats like human errors, terrorist attacks and natural disasters, as well as preparation of emergency response plans with estimation of optimized costs, are of vital importance for assurance of safe nuclear facilities operation and national security. In this paper presented new methodology and solution methods for vulnerability assessment can help the overall national energy sector to identify and understand the terrorist threats to and vulnerabilities of its critical infrastructure. Moreover, adopted methodology could help national regulators and agencies to develop and implement a vulnerability awareness and education programs for their critical assets to enhance the security and a safe operation of the entire energy infrastructure. New methods can also assist nuclear power plants to develop, validate, and disseminate assessment and surveys of new efficient countermeasures. Consequently, concise description of developed new quantitative method and adapted new methodology for nuclear regulatory vulnerability assessment of nuclear power plants are presented.

Venceslav Kostadinov



Virtual nuclear weapons  

SciTech Connect (OSTI)

The term virtual nuclear weapons proliferation and arsenals, as opposed to actual weapons and arsenals, has entered in recent years the American lexicon of nuclear strategy, arms control, and nonproliferation. While the term seems to have an intuitive appeal, largely due to its cyberspace imagery, its current use is still vague and loose. The author believes, however, that if the term is clearly delineated, it might offer a promising approach to conceptualizing certain current problems of proliferation. The first use is in a reference to an old problem that has resurfaced recently: the problem of growing availability of weapon-usable nuclear materials in civilian nuclear programs along with materials made `excess` to defense needs by current arms reduction and dismantlement. It is argued that the availability of these vast materials, either by declared nuclear-weapon states or by technologically advanced nonweapon states, makes it possible for those states to rapidly assemble and deploy nuclear weapons. The second use has quite a different set of connotations. It is derived conceptually from the imagery of computer-generated reality. In this use, one thinks of virtual proliferation and arsenals not in terms of the physical hardware required to make the bomb but rather in terms of the knowledge/experience required to design, assemble, and deploy the arsenal. Virtual weapons are a physics reality and cannot be ignored in a world where knowledge, experience, materials, and other requirements to make nuclear weapons are widespread, and where dramatic army reductions and, in some cases, disarmament are realities. These concepts are useful in defining a continuum of virtual capabilities, ranging from those at the low end that derive from general technology diffusion and the existence of nuclear energy programs to those at the high end that involve conscious decisions to develop or maintain militarily significant nuclear-weapon capabilities.

Pilat, J.F.
