Sample records for npcc serc spp

  1. SERC Grants Interactive Map

    Broader source: Energy.gov [DOE]

    View SERC Grants in a larger map. To report corrections, please email SustainableEnergyWAP@ee.doe.gov.

  2. Critical in PROJECT TITLE COMMENTS BPA NPCC

    E-Print Network [OSTI]

    PLANNING AND CONSERVATION COUNCIL AND BONNEVILLE POWER ADMINISTRATION "RANKINGS" FOR PROJECTS UNDER in annual planning budget and feasibility of approach to achieve efficiencies. BPA reduced by $250PROJECT NUMBER (BiOp Critical in Italics) PROJECT TITLE COMMENTS BPA NPCC 35019 Develop

  3. Microsoft PowerPoint - Till.ppt

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Kentucky Utilities (E.ON)* TVA Big Rivers Electric Coop Ameren* AECI Batesville Balancing Authority NPCC MRO RFC SPP SERC FRCC Central TVA & CPPP - Central to the Eastern...

  4. SERC Projects | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page onYouTube YouTube Note: Since the.pdfBreakingMay 2015 <Department of iiBiodiesel | Department ofSERC Projects SERC

  5. Recording of SERC Monitoring Technologies- Solar Photovoltaics

    Broader source: Energy.gov [DOE]

    This document provides a transcript of the of SERC Monitoring Technologies - Solar Photovoltaics webinar, presented on 10/20/2011 by Peter McNutt.

  6. Sustainable Energy Resources for Consumers (SERC) -Geothermal...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    This presentation, aimed at Sustainable Energy Resources for Consumers (SERC) grantees, provides information on Monitoring Checklists for the installation of Geothermal...

  7. Sustainable Energy Resources for Consumers (SERC) -Geothermal...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of a presentation, aimed at Sustainable Energy Resources for Consumers (SERC) grantees, provides information on Monitoring Checklists for the installation of Geothermal...

  8. Sustainable Energy Resources for Consumers (SERC) Vermont Highlight...

    Broader source: Energy.gov (indexed) [DOE]

    on Vermont's innovative strategy for helping low-income families save energy through its Sustainable Energy Resources for Consumers (SERC) program. sercvthighlight.pdf More...

  9. Sustainable Energy Resources for Consumers (SERC) Success Story...

    Broader source: Energy.gov (indexed) [DOE]

    Low-Income Weatherization Efforts. sercmthighlight.pdf More Documents & Publications Sustainable Energy Resources for Consumers (SERC) - Solar Hot Water Sustainable Energy...

  10. Sustainable Energy Resources for Consumers (SERC)- Solar Photovoltaics

    Broader source: Energy.gov [DOE]

    This presentation, aimed at Sustainable Energy Resources for Consumers (SERC) grantees, provides information on Monitoring Checklists for the installation of Solar Photovoltaics.

  11. Sustainable Energy Resources for Consumers (SERC)- On-Demand Tankless Water Heaters

    Broader source: Energy.gov [DOE]

    This presentation, aimed at Sustainable Energy Resources for Consumers (SERC) grantees, provides information on Monitoring Checklists for the installation of On-Demand Tankless Water Heaters.

  12. Property:EIA/861/NercSerc | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov YouKizildere I Geothermal PwerPerkins County, Nebraska:PrecourtOid Jump to: navigation,AltFuelVehicle2 JumpNercSerc Jump

  13. Sustainable Energy Resources for Consumers (SERC) Vermont Highlight (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2012-01-01T23:59:59.000Z

    Case study on Vermont's innovative strategy for helping low-income families save energy through its Sustainable Energy Resources for Consumers (SERC) program. The DOE Weatherization Assistance Program (WAP) granted Vermont to give its weatherization clients access to solar energy systems and one-on-one assistance from energy efficiency coaches to help clients achieve meaningful and long-lasting reductions in their energy bills. Vermont-SERC is administered by the Vermont Office of Economic Opportunity and is carried out by five local weatherization agencies. The purpose of the program is to identify technologies and new approaches-in this case, solar energy and energy efficiency coaches-that can improve weatherization services to low-income clients. The program selects households that have previously received weatherization services. This has several advantages. First, the clients already understand how weatherization works and are willing to strive for additional energy savings. Second, the weatherization agencies are working with clients who have previously had weatherization and therefore have complete energy usage data from utility bills collected during the first energy upgrade installation. This allows the agencies to select the best potential candidates for solar energy. Agencies have existing knowledge of the homes and can pre-screen them for potential structural problems or lack of south-facing exposure.

  14. Analysis of Unit-Level Changes in Operations with Increased SPP Wind from EPRI/LCG Balancing Study

    SciTech Connect (OSTI)

    Hadley, Stanton W [ORNL

    2012-01-01T23:59:59.000Z

    Wind power development in the United States is outpacing previous estimates for many regions, particularly those with good wind resources. The pace of wind power deployment may soon outstrip regional capabilities to provide transmission and integration services to achieve the most economic power system operation. Conversely, regions such as the Southeastern United States do not have good wind resources and will have difficulty meeting proposed federal Renewable Portfolio Standards with local supply. There is a growing need to explore innovative solutions for collaborating between regions to achieve the least cost solution for meeting such a renewable energy mandate. The Department of Energy funded the project 'Integrating Midwest Wind Energy into Southeast Electricity Markets' to be led by EPRI in coordination with the main authorities for the regions: SPP, Entergy, TVA, Southern Company and OPC. EPRI utilized several subcontractors for the project including LCG, the developers of the model UPLAN. The study aims to evaluate the operating cost benefits of coordination of scheduling and balancing for Southwest Power Pool (SPP) wind transfers to Southeastern Electric Reliability Council (SERC) Balancing Authorities (BAs). The primary objective of this project is to analyze the benefits of regional cooperation for integrating mid-western wind energy into southeast electricity markets. Scenarios were defined, modeled and investigated to address production variability and uncertainty and the associated balancing of large quantities of wind power in SPP and delivery to energy markets in the southern regions of the SERC. DOE funded Oak Ridge National Laboratory to provide additional support to the project, including a review of results and any side analysis that may provide additional insight. This report is a unit-by-unit analysis of changes in operations due to the different scenarios used in the overall study. It focuses on the change in capacity factors and the number of start-ups required for each unit since those criteria summarize key aspects of plant operations, how often are they called upon and how much do they operate. The primary analysis of the overall project is based on security-constrained unit commitment (SCUC) and economic dispatch (SCED) simulations of the SPP-SERC regions as modeled for the year 2022. The SCUC/SCED models utilized for the project were developed through extensive consultation with the project utility partners, to ensure the various regions and operational practices are represented as best as possible in the model. SPP, Entergy, Oglethorpe Power Company (OPC), Southern Company, and the Tennessee Valley Authority (TVA) actively participated in the project providing input data for the models and review of simulation results and conclusions. While other SERC utility systems are modeled, the listed SERC utilities were explicitly included as active participants in the project due to the size of their load and relative proximity to SPP for importing wind energy.

  15. Annual Energy Outlook 2015 - Appendix F

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    15. SRCE SERC Central 16. SRVC SERC VACAR 17. SPNO SPP North 18. SPSO SPP South 19. AZNM WECC Southwest 20. CAMX WECC California 21. NWPP WECC Northwest 22. RMPA WECC Rockies...

  16. alexandrium spp samples: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    spp., Oils, 1982 and 1983 JEANNE D. JOSEPH Introduction Menhaden, Brevoortia spp., oil, the commercial fish oil produced in great- est volume 73 Four new Ceratocystis spp....

  17. Monitoring SERC Technologies — Solar Photovoltaics

    Broader source: Energy.gov [DOE]

    A webinar by National Renewable Energy Laboratory's Market Transformation Center electrical engineer Peter McNutt about Solar Photovoltaics and how to properly monitor its installation.

  18. Solar Energy Research Center (SERC)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level:Energy: Grid Integration Redefining What'sis Taking Over Our Instagram Secretary Moniz9MorganYou areInnovationPriority |GoingSolar - * . .

  19. anopheles spp diptera: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    (Pongo spp.) on Borneo and Sumatra Environmental Sciences and Ecology Websites Summary: Review Distribution and conservation status of the orang-utan (Pongo spp.) on Borneo and...

  20. SEXUAL SIGNALING IN PERIODICAL CICADAS, MAGICICADA SPP. (HEMIPTERA: CICADIDAE)

    E-Print Network [OSTI]

    Simon, Chris

    SEXUAL SIGNALING IN PERIODICAL CICADAS, MAGICICADA SPP. (HEMIPTERA: CICADIDAE) by JOHN R. COOLEY1 behavior of periodical cicadas (Insecta: Hemiptera: Magicicada spp.) has been considered enigmatic because

  1. An Examination of Temporal Trends in Electricity Reliability Based on Reports from U.S. Electric Utilities

    E-Print Network [OSTI]

    Eto, Joseph H.

    2013-01-01T23:59:59.000Z

    SAIDI SAIFI SERC SPP TRE WECC Alaska Systems CoordinatingElectricity Coordinating Council (WECC) Midwest ReliabilityCoordinating Council (WECC). Completeness of reported

  2. NPCC emphasizes that the DOE 2012 congestion analysis should...

    Broader source: Energy.gov (indexed) [DOE]

    analysis should consider the northeast as a whole, not only modeling those transmission, demand response, and generating resource projects in the United States, but also those...

  3. Property:EIA/861/NercNpcc | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolve JumpallowedAltFuelVehicle

  4. Monitoring SERC Technologies — Solar Hot Water

    Broader source: Energy.gov [DOE]

    A webinar by National Renewable Energy Laboratory analyst Eliza Hotchkiss on Solar Hot Water systems and how to properly monitor their installation.

  5. Sustainable Energy Resources for Consumers (SERC) - Geothermal...

    Broader source: Energy.gov (indexed) [DOE]

    electricity. And I have three pictures here. The one on the left is the ground source heat pump system and shows the loop field being buried underground that will be used for...

  6. SERC Grant Webinar | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels DataDepartment of Energy Your Density Isn'tOrigin ofEnergy atLLC - FE DKT. 10-160-LNG - ORDER 2913 |DepartmentEECBG ReportingGrant

  7. SERC Photovoltaics for Residential Buildings Webinar Transcript |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels DataDepartment of Energy Your Density Isn'tOrigin ofEnergy atLLC - FE DKT. 10-160-LNG - ORDER 2913 |DepartmentEECBG

  8. Sustainable Energy Resources for Consumers (SERC) -

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels DataDepartment of Energy Your Density Isn'tOriginEducationVideoStrategic Safety

  9. Sustainable Energy Resources for Consumers (SERC) -

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels DataDepartment of Energy Your Density Isn'tOriginEducationVideoStrategic SafetyGeothermal/Ground-Source Heat Pumps | Department of

  10. Genomics and Transcriptomics of Plant Beneficial Serratia spp.

    E-Print Network [OSTI]

    Genomics and Transcriptomics of Plant Beneficial Serratia spp. Saraswoti Neupane Faculty of Natural. proteamaculans S4 (photo: S. Neupane) #12;Genomics and transcriptomics of plant beneficial Serratia spp. Abstract, and have potential as possible biocontrol agents in agriculture. This thesis provides the detailed genomic

  11. The glass beakers of the eleventh-century Serc?e Limani shipwreck: a preliminary study 

    E-Print Network [OSTI]

    Kitson-MimMack, Joy Joan

    1988-01-01T23:59:59.000Z

    and composed of deep shades. And las+ly, despite 'ooth vessel shapes having engraved examples, the design themes on short cylinders are significantly 'ess varied than those on truncated cones. The beaker is one of the most ancient forms of drinking vessels... and Classification to the Sixteenth Century New York 1927 2 vole. L'E o ue romaine Musee d'Histoire et d' Art, La Verrerie de 1' ' 66 * 1 6~1969 Ettinghausen R. Ettinghausen, "The 'Beveled Style' in the Post-Samarra Period, " in George C. Miles, ed...

  12. The glass beakers of the eleventh-century Serc?e Limani shipwreck: a preliminary study

    E-Print Network [OSTI]

    Kitson-MimMack, Joy Joan

    1988-01-01T23:59:59.000Z

    , Islamic Glass: A Brief History (New York 1986). JGS Journal of Glass Studies. Karanis D. B. Harden, Roman Glass from Karanis (University of Michigan Studies, Humanistic Series 41, Ann Arbor, Michigan 1936). ~Kt t K t Ko tische Kunst: Christentum am...THE GLASS BEAKERS OF THE ELEVENTH-CENTURY SERGE LIMANI SHIPNRECK-- A PRELIMINAR1' STUDY A Thesis by JOY JOAN KITSON-MINMACK Submitted to the Graduate College of Texas AAM University in partial fulfillment of the requirements for the degree...

  13. Ecological analysis of secondary metabolite production in Aspergillus spp.

    E-Print Network [OSTI]

    Ramaswamy, Anitha

    2002-01-01T23:59:59.000Z

    A complex and fascinating aspect of fungal development is the production of secondary metabolites. One of the best characterized secondary metabolite pathway is the aflatoxin (AF) and sterigmatocystin (ST) pathway, found in many Aspergillus spp...

  14. Toxicity studies with Sesbania spp. in domestic and laboratory animals

    E-Print Network [OSTI]

    Whall, Jeffrey DePass

    1982-01-01T23:59:59.000Z

    May 1982 Major Subject: Veterinary Toxicology TOXICITY STUDIES WITH SESBANIA SPP. IN DOMESTIC AND LABORATORY ANIMALS A Thesis by JEFFREY DEPASS WHALL Approved as to style and content by: (- ~ -) Chy an of Comm ttee) Head f Depar t) (Member...

  15. Antimicrobial Interventions to Reduce Listeria spp. Contamination on Shrimp

    E-Print Network [OSTI]

    Wong, Tsui-Yin

    2010-01-14T23:59:59.000Z

    The effects of selected antimicrobials, applied singularly or in combination, and frozen or refrigerated storage conditions on the survival of Listeria spp. on inoculated shrimp was evaluated in this study. A combination of 0.5% CPC (Cetylpyridinium...

  16. The relationship between iron and nitrogen fixation in Trichodesmium spp.

    E-Print Network [OSTI]

    Chappell, Phoebe Dreux

    2009-01-01T23:59:59.000Z

    Trichodesmium spp. are considered the dominant nitrogen (N) fixing cyanobacteria in tropical and subtropical oceans, regimes frequently characterized by low iron (Fe). Limited information exists about what levels of Fe ...

  17. Biofouling of groundwater distribution systems by Thiothrix spp.

    SciTech Connect (OSTI)

    Brigmon, R.L. [Westinghouse Savannah River Co., Aiken, SC (United States); Martin, H.W. [National Spleological Society, Greenville, DE (United States); Aldrich, H.C. [Florida Univ., Gainesville, FL (United States). Dept. of Microbiology & Cell Science

    1995-12-01T23:59:59.000Z

    Thiothrix spp., sulfide oxidizing filamentous bacteria, were found to be the main bacterial component of aquatic biofilms causing biofouling in selected municipal water storage tanks, private wells, and drip irrigation systems in Florida. The water originated from the upper Floridan aquifer and associated aquifers in Central and North Florida. Samples were examined where visible biofilms had a white, slimy, filamentous appearance indicative of Thiothrix spp. The detection of Thiothrix spp. was confirmed by enzyme-liked immunosorbent assay (ELISA). These observations confirm that these bacteria and associated extracellular material play an important role in formation of biofilms, which in turn may induce physical changes leading to significant biofouling. These studies suggest that Thiothrix spp.-associated biofouling occurs at an interface where reduced sulfide-containing water contacts aerated water and a surface or substrate is available for attachment.

  18. http://spp.sagepub.com/ Social Psychological and Personality Science

    E-Print Network [OSTI]

    Lehman, Barbara J.

    ://spp.sagepub.com/content/1/1/51 The online version of this article can be found at: DOI: 10.1177/1948550609354924 2010 1: 51://www.sagepub.com/journalsReprints.navReprints: http://www.sagepub.com/journalsPermissions.navPermissions: http://spp.sagepub.com/content/1/1/51.refs studies of its situational determinants remain scarce. This work investigates the correlates of naturally

  19. Formation, regeneration and fusion of protoplasts from Gliocladium spp.

    E-Print Network [OSTI]

    Seh, Monica Leigh

    1987-01-01T23:59:59.000Z

    FORMATION, REGENERATION AND FUSION OF PROTOPLASTS FROM GLIOCLADIUM SPP. A Thesis by MONICA LEIGH SEH Submitted to the Graduate College of Texas ARM University in partial fulfillment of the requirements of the degree of MASTER OF SCIENCE... August 1987 Major Subject: Plant Pathology FORMATION, REGENERATION AND FUSION OF PROTOPLASTS FROM GLIOCLADIUM SPP. A Thesis MONICA LEIGH SEH Approved as to style and content by: Charles M. X nerle (Chairperson of Committee) ic ael D. Thomas...

  20. Request for Addition or Change to SPP Submitted By

    E-Print Network [OSTI]

    Kamat, Vineet R.

    Request for Addition or Change to SPP UM AEC Submitted By: Phone: E-mail: General Product Information Manufacturer/Product Name List of Installations within 50 Miles of Ann Arbor Years Product in Use Certification Certified wood Green Seal Standard GS-11 and Green Seal Plus (iaq) Greenguard Primarily indoor air

  1. ECOGEOGRAPHIC DISTRIBUTION OF PHASEOLUS SPP. (FABACEAE) IN BOLIVIA 1

    E-Print Network [OSTI]

    Gepts, Paul

    ECOGEOGRAPHIC DISTRIBUTION OF PHASEOLUS SPP. (FABACEAE) IN BOLIVIA 1 ROSANNAFREYRE PairumanL Cochabamba, Bolivia), and Daniel G. Debouck (CIAT, Apartado Adreo 6713, Cali, Colombia America. Previous to this study, only four accessions of wild P. vulgaris beans from Bolivia had been

  2. Property:EIA/861/RtoSpp | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSpp Jump to: navigation, search Property

  3. Microsoft PowerPoint - spp_presentation.ppt

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville PowerCherries 82981-1cnHighandSWPA / SPRA / USACE SWPA / SPRAresults from phasedKenneth7,GridSPP

  4. Sustainable Energy Resources for Consumers (SERC) Success Story...

    Broader source: Energy.gov (indexed) [DOE]

    upgrade measures to maximize savings. sercmdhighlight.pdf More Documents & Publications Sustainable Energy Resources for Consumers Fact Sheet July 2011 Building America Webinar:...

  5. SERC Community-Based Social Marketing for Weatherization Programs Webinar

    Broader source: Energy.gov [DOE]

    A presentation sponsored by the U.S. Department of Energy about fostering sustainable behaviors in a community for saving energy.

  6. Monitoring SERC Technologies: On-Demand Tankless Water Heaters

    Broader source: Energy.gov [DOE]

    A webinar by Ethan MacCormick, VP for Services to Energy Businesses at Performance Systems Development, about On-Demand Tankless Water Heaters and how to properly monitor the installation.

  7. Monitoring SERC Technologies —Geothermal/Ground Source Heat Pumps

    Broader source: Energy.gov [DOE]

    A webinar by National Renewable Energy Laboratory Project Leader Dave Peterson about Geothermal/Ground Source Heat Pumps and how to properly monitor its installation.

  8. The history of the anchorage at Serce Liman, Turkey

    E-Print Network [OSTI]

    Slane, Dorothy Anne

    1982-01-01T23:59:59.000Z

    opposite the island of Rhodes there is a small natural harbor known as Serge Liman (Fig. 1, p. 2). Bere an eleventh-century A. B. shipwreck was excavated between 1977 and 1979 by the Institute of Nautical Archaeology (INA) in conjunction with Texas As...M University (Bass and van Doorninck 1978: 119). During the course of this excavation, broken pottery was observed scattered on the slope above the wrecksite and was also found beneath the ship's hull remains. The pottery, examined in passing, did...

  9. Sustainable Energy Resources for Consumers (SERC) Idaho Highlight |

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn April 23, 2014,Zaleski -BlueprintThis documentEnergy Local Government

  10. Sustainable Energy Resources for Consumers (SERC) Success Story: Maryland |

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn April 23, 2014,Zaleski -BlueprintThis documentEnergy Local GovernmentDepartment of

  11. Sustainable Energy Resources for Consumers (SERC) Success Story: Montana |

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn April 23, 2014,Zaleski -BlueprintThis documentEnergy Local GovernmentDepartment

  12. Sustainable Energy Resources for Consumers (SERC) Vermont Highlight (Fact

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn April 23, 2014,Zaleski -BlueprintThis documentEnergy Local

  13. Sustainable Energy Resources for Consumers (SERC) - Solar Hot Water |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels DataDepartment of Energy Your Density Isn'tOriginEducationVideoStrategic SafetyGeothermal/Ground-Source Heat Pumps | Department ofDepartment

  14. Sustainable Energy Resources for Consumers (SERC) - Solar Hot Water |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels DataDepartment of Energy Your Density Isn'tOriginEducationVideoStrategic SafetyGeothermal/Ground-Source Heat Pumps | Department

  15. Sustainable Energy Resources for Consumers (SERC) Idaho Highlight

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels DataDepartment of Energy Your Density Isn'tOriginEducationVideoStrategic SafetyGeothermal/Ground-Source Heat Pumps | Department Idaho

  16. Sustainable Energy Resources for Consumers (SERC) Success Story: Maryland

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels DataDepartment of Energy Your Density Isn'tOriginEducationVideoStrategic SafetyGeothermal/Ground-Source Heat Pumps | Department Idaho

  17. Sustainable Energy Resources for Consumers (SERC) Success Story: Montana

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels DataDepartment of Energy Your Density Isn'tOriginEducationVideoStrategic SafetyGeothermal/Ground-Source Heat Pumps | Department IdahoMontana

  18. PREDATION ON CAPITEllA SPP. BY SMALL-MOUTHED PLEURONECTIDS IN PUGET SOUND, WASHINGTON!

    E-Print Network [OSTI]

    PREDATION ON CAPITEllA SPP. BY SMALL-MOUTHED PLEURONECTIDS IN PUGET SOUND, WASHINGTON! D. SCO-bottom habitats of Puget Sound. Washington. Sampling was conducted throughout the diel cycle during May and June flatfishes Puget Sound, WA on Capitella spp., a well-known group of opportunis- tic

  19. The glass lamps from the 11th-century shipwreck at Serc?e Liman, Turkey: a thesis

    E-Print Network [OSTI]

    Morden, Margaret Elizabeth

    1982-01-01T23:59:59.000Z

    writ1ng during the 4th century, describes a hanging lamp in the following terms: "From the center of panelled ceil1ngs 1n spac1ous rooms . . . openwork bronze lamps were suspended by cable . like a kind of tree w1th pliant vine-like branches... to the three major forms of lamp development discussed earlier. Paul the S1lentiary, in h1s description of Sancta Soph1a in Constantinople, describes the lighting of the entire church (see Appendix III). In the center of the church a lamp was suspended 37...

  20. DOE: Integrating Southwest Power Pool Wind Energy into Southeast Electricity Markets

    SciTech Connect (OSTI)

    Brooks, Daniel, EPRI; Tuohy, Aidan, EPRI; Deb, Sidart, LCG Consulting; Jampani, Srinivas, LCG Consulting; Kirby, Brendan, Consultant; King, Jack, Consultant

    2011-11-29T23:59:59.000Z

    Wind power development in the United States is outpacing previous estimates for many regions, particularly those with good wind resources. The pace of wind power deployment may soon outstrip regional capabilities to provide transmission and integration services to achieve the most economic power system operation. Conversely, regions such as the Southeastern United States do not have good wind resources and will have difficulty meeting proposed federal Renewable Portfolio Standards with local supply. There is a growing need to explore innovative solutions for collaborating between regions to achieve the least cost solution for meeting such a renewable energy mandate. The DOE-funded project 'Integrating Southwest Power Pool Wind Energy into Southeast Electricity Markets' aims to evaluate the benefits of coordination of scheduling and balancing for Southwest Power Pool (SPP) wind transfers to Southeastern Electric Reliability Council (SERC) Balancing Authorities (BAs). The primary objective of this project is to analyze the benefits of different balancing approaches with increasing levels of inter-regional cooperation. Scenarios were defined, modeled and investigated to address production variability and uncertainty and the associated balancing of large quantities of wind power in SPP and delivery to energy markets in the southern regions of the SERC. The primary analysis of the project is based on unit commitment (UC) and economic dispatch (ED) simulations of the SPP-SERC regions as modeled for the year 2022. The UC/ED models utilized for the project were developed through extensive consultation with the project utility partners, to ensure the various regions and operational practices are represented as accurately as possible realizing that all such future scenario models are quite uncertain. SPP, Entergy, Oglethorpe Power Company (OPC), Southern Company, and the Tennessee Valley Authority (TVA) actively participated in the project providing input data for the models and review of simulation results and conclusions. While other SERC utility systems are modeled, the listed SERC utilities were explicitly included as active participants in the project due to the size of their load and relative proximity to SPP for importing wind energy. The analysis aspects of the project comprised 4 primary tasks: (1) Development of SCUC/SCED model of the SPP-SERC footprint for the year 2022 with only 7 GW of installed wind capacity in SPP for internal SPP consumption with no intended wind exports to SERC. This model is referred to as the 'Non-RES' model as it does not reflect the need for the SPP or SERC BAs to meet a federal Renewable Energy Standard (RES). (2) Analysis of hourly-resolution simulation results of the Non-RES model for the year 2022 to provide project stakeholders with confidence in the model and analytical framework for a scenario that is similar to the existing system and more easily evaluated than the high-wind transfer scenarios that are analyzed subsequently. (3) Development of SCUC/SCED model of the SPP-SERC footprint for the year 2022 with sufficient installed wind capacity in SPP (approximately 48 GW) for both SPP and the participating SERC BAs to meet an RES of 20% energy. This model is referred to as the 'High-Wind Transfer' model with several different scenarios represented. The development of the High-Wind Transfer model not only included identification and allocation of SPP wind to individual SERC BAs, but also included the evaluation of various methods to allow the model to export the SPP wind to SERC without developing an actual transmission plan to support the transfers. (4) Analysis of hourly-resolution simulation results of several different High-Wind Transfer model scenarios for the year 2022 to determine balancing costs and potential benefits of collaboration among SPP and SERC BAs to provide the required balancing.

  1. PART 2. Narrative Project ID: New resident fish monitoring project called for by NPCC' Mainstem

    E-Print Network [OSTI]

    years except the lowest 20th percentile water supply; during drought years, the draft could be increased the lowest 20th percentile water supply; during drought years, the summer draft could be increased to 20 feet

  2. Overview of Avista GHG Modeling NPCC Greenhouse Gas and the Regional Power System Conference

    E-Print Network [OSTI]

    Natural Gas CO2 Emissions A Bridge to a Low Carbon Future, or the Future? 815 1,190 lbs/MWh Gas CCCT has 210 CCCT CT Colstrip 3/4 #12;6/5/2013 2 Avista CO2 Emissions Forecast Rising emissions overall 2030 2031 2032 2033 #12;6/5/2013 4 WECC CO2 Emissions Forecast CO2 Prices

  3. Demography of auklets Aethia spp. in relation to introduced Norway rats Rattus norvegicus at Kiska

    E-Print Network [OSTI]

    Jones, Ian L.

    Demography of auklets Aethia spp. in relation to introduced Norway rats Rattus norvegicus at Kiska................................................................................................4 Norway Rat Abundance and Distribution .........................................................5................................................................................................6 Norway Rat Abundance and Distribution.........................................................7

  4. Terpenoid biosynthesis in Euphorbia lathyris and Copaifera spp

    SciTech Connect (OSTI)

    Skrukrud, C.L.

    1987-07-01T23:59:59.000Z

    Biosynthesis of triterpenoids by isolated latex of Euphorbia lathyris was investigated. The rate of in vitro incorporation of mevalonic acid into triterpenoids was thirty times greater than acetate incorporation indicating that the rate-limiting step in the pathway occurs prior to mevalonate. Both HMG-CoA reductase (EC 1.1.1.34) and HMG-CoA lyase (EC 4.1.3.4) activities were detected in isolated latex. HMG-CoA reductase was localized to a membrane-bound fraction of a 5000g pellet of latex. The rate of conversion of HMG-CoA to mevalonate by this enzyme is comparable to the overall rate of acetate incorporation into the triterpenoids suggesting that this enzyme is rate-determining in the biosynthesis of triterpenoids in E. lathyris latex. HMG-CoA reductase of E. lathyris vegetative tissue was localized to the membrane-bound portion of a particulate fraction (18,000g), and was solubilized by treatment with 2% polyoxyethylene ether W-1. Differences in the optimal pH for activity of HMG-CoA reductase from the latex and vegetative tissue suggest that isozymes of the enzyme may be present in the two tissue types. Studies of the incorporation of various precursors into leaf discs and cuttings taken from Copaifera spp. show differences in the rate of incorporation into Copaifera sesquiterpenes suggesting that the site of sesquiterpene biosynthesis may differ in its accessibility to the different substrates and/or reflecting the metabolic controls on carbon allocation to the terpenes. Mevalonate incorporation by Copaifera langsdorfii cuttings into sesquiterpenes was a hundred-fold greater than either acetate or glucose incorporation, however, its incorporation into squalene and triterpenoids was also a hundred-fold greater than the incorporation into sesquiterpenes. 119 refs., 58 figs., 16 tabs.

  5. A review of the effects of catch-and-release angling on black bass, Micropterus spp.: implications for

    E-Print Network [OSTI]

    Cooke, Steven J.

    bass, Micropterus spp., to facilitate management and conservation of these fish. Traditionally million days fishing for black bass each year (US Fish and Wildlife Service 2002). In addition, more thanA review of the effects of catch-and-release angling on black bass, Micropterus spp.: implications

  6. Managing scab diseases of potato and radish caused by Streptomyces spp. using Bacillus amyloliquefaciens BAC03 and other biomaterials

    E-Print Network [OSTI]

    Douches, David S.

    Managing scab diseases of potato and radish caused by Streptomyces spp. using Bacillus Field evaluation Biomaterials a b s t r a c t Streptomyces spp. cause scab in plants like potato ) significantly reduced the severity of common scab in potato and/or radish. In two Michigan fields in 2011

  7. Evolutionary biogeography of water shrews (Neomys spp.) in the western Palaearctic Region

    E-Print Network [OSTI]

    Davison, Angus

    Krystufek et al.Introduction The Balkan peninsula is one of the major foci of biodiver- sity in the westernEvolutionary biogeography of water shrews (Neomys spp.) in the western Palaearctic Region B. teres) represented by samples from the Balkans and Asia Minor. Adaptations to semi-aquatic life (large

  8. A study of the developmental morphology, structure and quality of prickly pear fruit, Opuntia spp

    E-Print Network [OSTI]

    Hannan, Mohammad Abdul

    1965-01-01T23:59:59.000Z

    A STUDY OF THE DEVELOPMENTAL MORPHOLOGY, ' STRUCTURE AND QUALITY OF PRICKLY PEAR FRUIT, OPUNTIA SPP ~ By MOHAMMAD ABDUL HANNAH Submitted to the Graduate College of the Texas A8eM University in partis1 fu1fillment of the re...

  9. Aurapex penicillata gen. sp. nov. from native Miconia theaezans and Tibouchina spp. in Colombia

    E-Print Network [OSTI]

    Aurapex penicillata gen. sp. nov. from native Miconia theaezans and Tibouchina spp. in Colombia in Colombia. Fruiting structures of the fungus could be distinguished from those of C. cubensis by their distinctly orange conidiomatal necks. This fungus also was found on several plant species native to Colombia

  10. Effect of Temperature on Photosynthesis and Growth in Marine Synechococcus spp.1[C][OPEN

    E-Print Network [OSTI]

    Paytan, Adina

    of temperatures by using state transitions and altering the abundance of photosynthetic proteins. These strategies in the abundance of PBS pigment proteins, as well as higher abundance of subunits of the PSII, photosystem I underlie the larger geographic range of this group relative to Prochlorococcus spp., which lack a PBS

  11. GENERAL TECHNICAL REPORT PSW-GTR-240 Breeding for Disease Resistance in Hevea spp. -

    E-Print Network [OSTI]

    Standiford, Richard B.

    GENERAL TECHNICAL REPORT PSW-GTR-240 240 Breeding for Disease Resistance in Hevea spp. - Status be implemented to tackle such future threats of epidemics. Hevea clones clearly exhibit variable levels from H. benthamiana "F4542." Few other attempts for inter-specific hybridization have been made

  12. Molecular detection and speciation of pathogenic Leptospira spp. in blood from patients with culture-negative leptospirosis

    E-Print Network [OSTI]

    Boonsilp, Siriphan; Thaipadungpanit, Janjira; Amornchai, Premjit; Wuthiekanun, Vanaporn; Chierakul, Wirongrong; Limmathurotsakul, Direk; Day, Nicholas P; Peacock, Sharon J

    2011-12-13T23:59:59.000Z

    Abstract Background Pathogenic Leptospira spp. present in the blood of patients with leptospirosis during the first week of symptoms can be detected using culture or PCR. A proportion of patients who are positive by PCR are negative by culture...

  13. A rapid, nondestructive method for screening rootstocks of stone fruits and almonds (Prunus spp.) for salt tolerance

    E-Print Network [OSTI]

    Ottman, Yvonne

    1986-01-01T23:59:59.000Z

    A RAPID, NONDESTRUCTIVE METFIOD FOR SCREENING ROOTSTOCKS OF STONE FRUITS AND ALMONDS lPRIJNUS SPP. ) FOR SALT TOLERANCE A Thesis YVONNE OTTMAN Submttted to the Graduate College of Texas ARM University in partial fulfillment... of the requirements for the degree of MASTER OF SCIENCE December 1986 Major Subject: Horticulture A RAPID, NONDESTRUCTIVE METHOD FOR SCREENING ROOTSTOCKS OF STONE FRUITS AND ALMONDS (PRUNUS SPP. ) FOR SALT TOLERANCE A Thesis by YVONNE OTTMAN Approved...

  14. The comparison of three methods for isolation of Arcobacter spp. in raw ground pork

    E-Print Network [OSTI]

    Ohlendorf, Dawn Suzanne

    2000-01-01T23:59:59.000Z

    RNA of the bacteria result in a base pair region from copied genomic DNA that is amplified when electrophoresed onto an agarose gel stained with ethidium bromide. Specifically for Arcobacrcr the primers used for identifying Arcobacter spp. are Arco I (5'-AGA GAT 21... TAG CCT GTA TTG TAT C-3') and Arco II (5'-TAG CAT CCC CGC TTC GAA TGA-3'). This reaction consistently yields an amplified 1223 bp region...

  15. Supraoptimal root-zone temperature effects on water use of three Cercis spp 

    E-Print Network [OSTI]

    Lawrence, Beth Jez

    1993-01-01T23:59:59.000Z

    Committee: Dr. Jayne M. Zajicek Stem flow rates of three Cercis spp. exposed to supraoptimal root- zone temperatures were characterized in a controlled environment chamber using a water bath to maintain treatment temperatures. Flow rates of sap... in the xylem were measured every 15 sec and averaged over 15 min intervals. Sap flow measurements were correlated to root-zone temperatures recorded during the same time intervals. Whole plant transpiration was also measured gravimetrically. Root...

  16. Three-Step Review Process. NPCC, November 2006, document 2006-21 Three-Step Review Process

    E-Print Network [OSTI]

    significantly the number of fish being introduced; (d) change stocks or the number of stocks, and/or (e) change to take place, so that efforts are not restrictive, and still close enough to provide choices to be made

  17. SPP Staff appreciates the opportunity to provide input regarding the Draft Conge

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels DataDepartment of Energy Your Density Isn'tOrigin ofEnergy atLLC - FE DKT. 10-160-LNG - ORDER 2913|| Department Advanced ResearchU.S.SPP

  18. Fuel Cell-Shaft Power Packs (FC-SPP) Frank Elefsen, Centre Manager, Ph.D., and Sten Frandsen, Head of Section

    E-Print Network [OSTI]

    Fuel Cell-Shaft Power Packs (FC-SPP) Frank Elefsen, Centre Manager, Ph.D., and Sten Frandsen, Head and an improved environment. 1 Fuel Cell-Shaft Power Packs (FC-SPP) A. Background In line with the growing global technology is receiving a great deal of attention. Hydrogen and fuel cells have the potential to replace

  19. U(VI) reduction to mononuclear U(VI) by desulfitobacterium spp.

    SciTech Connect (OSTI)

    Fletcher, K. E.; Boyanov, M. I.; Thomas, S. H.; Wu, Q.; Kemner, K. M.; Loffler, F. E. (Biosciences Division); (Georgia Inst. of Tech.)

    2010-06-15T23:59:59.000Z

    The bioreduction of U(VI) to U(IV) affects uranium mobility and fate in contaminated subsurface environments and is best understood in Gram-negative model organisms such as Geobacter and Shewanella spp. This study demonstrates that U(VI) reduction is a common trait of Gram-positive Desulfitobacterium spp. Five different Desulfitobacterium isolates reduced 100 {mu}M U(VI) to U(IV) in <10 days, whereas U(VI) remained soluble in abiotic and heat-killed controls. U(VI) reduction in live cultures was confirmed using X-ray absorption near-edge structure (XANES) analysis. Interestingly, although bioreduction of U(VI) is almost always reported to yield the uraninite mineral (UO{sub 2}), extended X-ray absorption fine structure (EXAFS) analysis demonstrated that the U(IV) produced in the Desulfitobacterium cultures was not UO{sub 2}. The EXAFS data indicated that the U(IV) product was a phase or mineral composed of mononuclear U(IV) atoms closely surrounded by light element shells. This atomic arrangement likely results from inner-sphere bonds between U(IV) and C/N/O- or P/S-containing ligands, such as carbonate or phosphate. The formation of a distinct U(IV) phase warrants further study because the characteristics of the reduced material affect uranium stability and fate in the contaminated subsurface.

  20. Metabolic Flux Analysis of Shewanella spp. Reveals Evolutionary Robustness in Central Carbon Metabolism

    SciTech Connect (OSTI)

    Tang, Yinjie J.; Martin, Hector Garcia; Dehal, Paramvir S.; Deutschbauer, Adam; Llora, Xavier; Meadows, Adam; Arkin, Adam; Keasling, Jay D.

    2009-08-19T23:59:59.000Z

    Shewanella spp. are a group of facultative anaerobic bacteria widely distributed in marine and fresh-water environments. In this study, we profiled the central metabolic fluxes of eight recently sequenced Shewanella species grown under the same condition in minimal med-ium with [3-13C] lactate. Although the tested Shewanella species had slightly different growth rates (0.23-0.29 h31) and produced different amounts of acetate and pyruvate during early exponential growth (pseudo-steady state), the relative intracellular metabolic flux distributions were remarkably similar. This result indicates that Shewanella species share similar regulation in regard to central carbon metabolic fluxes under steady growth conditions: the maintenance of metabolic robustness is not only evident in a single species under genetic perturbations (Fischer and Sauer, 2005; Nat Genet 37(6):636-640), but also observed through evolutionary related microbial species. This remarkable conservation of relative flux profiles through phylogenetic differences prompts us to introduce the concept of metabotype as an alternative scheme to classify microbial fluxomics. On the other hand, Shewanella spp. display flexibility in the relative flux profiles when switching their metabolism from consuming lactate to consuming pyruvate and acetate.

  1. SPP Membership

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Western Area Power Administration (Western) Transmission and Ancillary Services Formula Rates for Pick-Sloan Missouri Basin Program--Eastern Division (P-SMBP--ED ) was...

  2. The rig of the eleventh-century ship at Serce Liman, Turkey

    E-Print Network [OSTI]

    Matthews, Sheila Diane

    1983-01-01T23:59:59.000Z

    was designed for maximum cargo capacity. The hydrostatic properties of this hull were such that it probably would have retained sufficient righting ability and speed with a double-lateen rig. Thus, the proposed two-masted lateen rig for this ship would have... and Recording Procedures Off-Site Recording Procedures Preliminary Hull Reconstruction Hull Remains Ship's Gear: Anchors Ship's Gear: Rigging Elements Ship's Cargo: Date and Nationality of the Vessel 1 3 8 9 11 16 16 19 CHAPTER II. MEDIEVAL RIGS...

  3. The gaming pieces from the glass wreck at Serce Limani, Turkey

    E-Print Network [OSTI]

    Cassavoy, Kenneth Albert

    1985-01-01T23:59:59.000Z

    THE GAMING PIECES FROM THE GLASS WRECK AT SERgE LIMANI, TURKEY A Thesis by KENNETH ALBERT CASSAVOY Submitted to the Graduate College of Texas ARM University in partial fulfillment of the requirements for the degree of MASTER OF ARTS August... ml (Member) g n M. Bryant Jr (Head, Anthropo gy August 1985 ABSTRACT The Gaming Pieces from the Glass Wreck at Serge Limani, Turkey. (August 1985) Kenneth Albert Cassavoy, B. A. , Trent University Chairman of Advisory Committee: Dr. George F...

  4. Sustainable Energy Resources for Consumers (SERC) Vermont Highlight (Fact Sheet), Weatherization And Intergovernmental Programs (WIP)

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels DataDepartment of Energy Your Density Isn'tOriginEducationVideoStrategic SafetyGeothermal/Ground-Source Heat Pumps | Department

  5. Comparative Genomics of Gossypium spp. through GBS and Candidate Genes – Delving into the Controlling Factors behind Photoperiodic Flowering 

    E-Print Network [OSTI]

    Young, Carla Jo Logan

    2013-08-09T23:59:59.000Z

    COMPARATIVE GENOMICS OF GOSSYPIUM SPP. THROUGH GBS AND CANDIDATE GENES ? DELVING INTO THE CONTROLLING FACTORS BEHIND PHOTOPERIODIC FLOWERING A Dissertation by CARLA JO LOGAN YOUNG Submitted to the Office of Graduate Studies of Texas A.../Deletion Polymorphism IPGB Institute for Plant Genomics and Biotechnology Ka Non-synonymous Nucleotide Substitution Rate kb Kilobase(s) kDa KiloDalton Ks Synonymous Nucleotide Substitution Rate LD Long Day LD Linkage Disequilibrium MAS Marker Assisted...

  6. Comparative Genomics of Gossypium spp. through GBS and Candidate Genes – Delving into the Controlling Factors behind Photoperiodic Flowering

    E-Print Network [OSTI]

    Young, Carla Jo Logan

    2013-08-09T23:59:59.000Z

    COMPARATIVE GENOMICS OF GOSSYPIUM SPP. THROUGH GBS AND CANDIDATE GENES ? DELVING INTO THE CONTROLLING FACTORS BEHIND PHOTOPERIODIC FLOWERING A Dissertation by CARLA JO LOGAN YOUNG Submitted to the Office of Graduate Studies of Texas A.../Deletion Polymorphism IPGB Institute for Plant Genomics and Biotechnology Ka Non-synonymous Nucleotide Substitution Rate kb Kilobase(s) kDa KiloDalton Ks Synonymous Nucleotide Substitution Rate LD Long Day LD Linkage Disequilibrium MAS Marker Assisted...

  7. Invasion of a Sphagnum-peatland by Betula spp and Molinia caerulea impacts on organic matter biochemistry. Implications for carbon and

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    the extent of the influence of this invasion on the biochemical characteristics of the peat. Elemental substrate injection as invading plants have a lower ratio than Sphagnum spp and Sphagnum peat. Total the availability of resources to other species (Jones et al, 1994). Sphagnum species, by regulating

  8. Cerne, Lavras, v. 18, n. 1, p. 105-116, jan./mar. 2012 105Structural characterization of canopies ...STRUCTURAL CHARACTERIZATION OF CANOPIES OF Eucalyptus spp. USING

    E-Print Network [OSTI]

    Hammerton, James

    on which date data were acquired. Results indicated a significant difference between models based, reflectância de dosséis. CARACTERIZA��O ESTRUTURAL DE DOSS�IS DE Eucalyptus spp. MEDIANTE DADOS RADIOM�TRICOS estabelecimento de conexões lógicas entre variáveis radiométricas provenientes de dados remotamente coletados e

  9. AUTOMATED DEAD-END ULTRAFILTRATION FOR ENHANCED SURVEILLANCE OF LEGIONELLA 2 PNEUMOPHILA AND LEGIONELLA SPP. IN COOLING TOWER WATERS

    SciTech Connect (OSTI)

    Brigmon, R.; Leskinen, S.; Kearns, E.; Jones, W.; Miller, R.; Betivas, C.; Kingsley, M.; Lim, D.

    2011-10-10T23:59:59.000Z

    Detection of Legionella pneumophila in cooling towers and domestic hot water systems involves concentration by centrifugation or membrane filtration prior to inoculation onto growth media or analysis using techniques such as PCR or immunoassays. The Portable Multi-use Automated Concentration System (PMACS) was designed for concentrating microorganisms from large volumes of water in the field and was assessed for enhancing surveillance of L. pneumophila at the Savannah River Site, SC. PMACS samples (100 L; n = 28) were collected from six towers between August 2010 and April 2011 with grab samples (500 ml; n = 56) being collected before and after each PMACS sample. All samples were analyzed for the presence of L. pneumophila by direct fluorescence immunoassay (DFA) using FITC-labeled monoclonal antibodies targeting serogroups 1, 2, 4 and 6. QPCR was utilized for detection of Legionella spp. in the same samples. Counts of L. pneumophila from DFA and of Legionella spp. from qPCR were normalized to cells/L tower water. Concentrations were similar between grab and PMACS samples collected throughout the study by DFA analysis (P = 0.4461; repeated measures ANOVA). The same trend was observed with qPCR. However, PMACS concentration proved advantageous over membrane filtration by providing larger volume, more representative samples of the cooling tower environment, which led to reduced variability among sampling events and increasing the probability of detection of low level targets. These data highlight the utility of the PMACS for enhanced surveillance of L. pneumophila by providing improved sampling of the cooling tower environment.

  10. The effectiveness of chemical herbicides for the control of prickly pear cactus (Opuntia spp.) in the vicinity of the Sonora Ranch Experiment Station

    E-Print Network [OSTI]

    Gleason, Lowell S

    1951-01-01T23:59:59.000Z

    of sodium tricrcloroacetate and 2, 4, 5-T esters 22 VI Percentages of kill and regrowth of prickly pear cactus obtained from applications of various oils and mixtures of oils and 2, 4, 5-T eaters VII. The number of points affected by applications...THE EFFECTIVENESS OF CHEHICAL HERMCIDES FOR THE CONTROL OF PRICKLY PEAR CACTUS (~tia spp. ) IN THE VICINITY OF THE SONORA RANCH EXPERINENT STATION A Thesis LONELL S ~ GLEASCN Approved as to style and content bF Chairaan of Cosssittee August...

  11. Questions Asked during the Financing Residential Energy Efficiency...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Residential Energy Efficiency with Carbon Offsets Transcript Financing Residential Energy Efficiency with Carbon Offsets SERC Photovoltaics for Residential Buildings Webinar...

  12. Appendix A -1 Appendix A: The Columbia River Basin Fish and Wildlife

    E-Print Network [OSTI]

    Appendix A - 1 Appendix A: The Columbia River Basin Fish and Wildlife Program The 2000 Fish and Wildlife Program is the fifth revision of the Columbia River Basin Fish and Wildlife Program since the NPCC principles. The 2000 NPCC Fish and Wildlife Program marks a significant departure from past versions, which

  13. Rates of consumption of juvenile salmonids and alternative prey fish by northern squawfish, walleyes, smallmouth bass, and channel catfish in John Day Reservoir, Columbia River. [Ptychocheilus oregonensis; Stizostedion vitreum; Micropterus dolomieu; Ictalurus punctatus; Oncorhynchus spp

    SciTech Connect (OSTI)

    Vigg, S.; Poe, T.P.; Prendergast, L.A.; Hansel, H.C. (Fish and Wildlife Service, Cook, WA (United States))

    1991-07-01T23:59:59.000Z

    Adult northern squawfish Ptychocheilus oregonesis, walleyes Stizostedion vitreum, smallmouth bass Micropterus dolomieu, and channel catfish Ictalurus punctatus were sampled from four regions of John Day Reservoir from April to August 1983-1986 to quantify their consumption of 13 species of prey fish, particularly seaward-migrating juvenile Pacific salmon and steelhead (Oncorhynchus spp.). Consumption rates were estimated from field data on stomach contents and digestion rate relations determined in previous investigations. For each predator, consumption rates varied by reservoir area, month, time of day, and predator size or age. The greatest daily consumption of salmonids by northern squawfish and channel catfish occurred in the upper end of the reservoir below McNary Dam. Greatest daily predation by walleyes and smallmouth bass occurred in the middle and lower reservoir. Consumption rates of all predators were highest in July, concurrent with maximum temperature and abundance of juvenile salmonids. Feeding by the predators tended to peak after dawn and near midnight. Northern squawfish below McNary Dam exhibited this pattern, but fed mainly in the morning hours down-reservoir. The daily ration of total prey fish was highest for northern squawfish over 451 mm fork length, for walleyes 201-250 mm, for smallmouth bass 176-200 mm, and for channel catfish 401-450 mm. Averaged over all predator sizes and sampling months (April-August), the total daily ration (fish plus other prey) of smallmouth bass was about twice that of channel catfish, northern squawfish, and walleyes. However, northern squawfish was clearly the major predator on juvenile salmonids.

  14. The influence of Streptococcus spp., Lactobacillus spp. and Pediococcus spp. on production of volatile sulfhydryl compounds in Cheddar cheese slurries

    E-Print Network [OSTI]

    Dagerath, Michael Lynn

    1989-01-01T23:59:59.000Z

    resulted from the failure of the direct acidified cheese to reach and maintain the low oxidation- reduction potential needed for volatile compound existence (21, 22). With the exception of hydrogen sulfide (51, 24), it does not appear that lactobacilli... 19 dimethyl sulfide (Aldrich Chemicals, Milwaukee, Wisconsin) into a plastic pouch with 500 ml of previously added nitrogen. The pouch was incubated at 30 ~C. One ml of the gas mixture was removed and injected into a second pouch which contained...

  15. Introduction The quahog, Mercenaria spp., rang-

    E-Print Network [OSTI]

    's southern State of Campeche, Quahogs in Eastern North America: Part II, History by Province and State CLYDE, Ciudad del Carmen, Campeche, Mexico C.P. 24120. Mention of trade names or commer- cial firms

  16. Introduction The quahog, Mercenaria spp., rang-

    E-Print Network [OSTI]

    's southern State of Campeche, has long provided NorthAmericans with Quahogs in Eastern North America: Part I, Campeche, Mexico C.P. 24120. Mention of trade names or commercial firms in this paper does not imply

  17. Symmetric and asymmetric hybridization in citrus spp.

    E-Print Network [OSTI]

    Bona, Claudine M.

    2009-05-15T23:59:59.000Z

    The United States is the second largest producer of oranges and grapefruit. However, the US citrus industry experiences constraints in production due to pests, diseases and environmental concerns. Furthermore, due to the low diversity in current...

  18. Springfield Processing Plant (SPP) Facility Information

    SciTech Connect (OSTI)

    Leach, Janice; Torres, Teresa M.

    2012-10-01T23:59:59.000Z

    The Springfield Processing Plant is a hypothetical facility. It has been constructed for use in training workshops. Information is provided about the facility and its surroundings, particularly security-related aspects such as target identification, threat data, entry control, and response force data.

  19. Statewide Pricing Pilot (SPP) Overview and Results

    E-Print Network [OSTI]

    as a function of appliances, weather and notification period · Evaluate customer use and acceptance of Advanced and industrial customers understand and overwhelmingly prefer dynamic rates to existing inverted tier rates

  20. SPP Frequently Asked Questions | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level:Energy: Grid Integration Redefining What's PossibleRadiation Protection245C Unlimited ReleaseWelcome ton n u a l r e p

  1. Strategic Partnership Projects (SPP) | The Ames Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOE Office of ScienceandMesa del Sol HomeFacebookScholarshipSpiralingSecurity217,354Strategic Focus Areas Lockheed

  2. EIA - State Electricity Profiles

    U.S. Energy Information Administration (EIA) Indexed Site

    1. 2012 Summary Statistics (Connecticut) Item Value U.S. Rank NERC Region(s) NPCC Primary Energy Source Nuclear Net Summer Capacity (megawatts) 9,060 35 Electric Utilities 152 46...

  3. EIA - State Electricity Profiles

    U.S. Energy Information Administration (EIA) Indexed Site

    1. 2012 Summary statistics (Vermont) Item Value U.S. Rank NERC Region(s) NPCC Primary Energy Source Nuclear Net Summer Capacity (megawatts) 1,235 50 Electric Utilities 329 45...

  4. EIA - State Electricity Profiles

    U.S. Energy Information Administration (EIA) Indexed Site

    2012 Summary statistics (New Hampshire) Item Value U.S. Rank NERC Region(s) NPCC Primary Energy Source Nuclear Net Summer Capacity (megawatts) 4,323 44 Electric Utilities 1,121 41...

  5. DOE Webinar ? Residential Geothermal Heat Pump Retrofits (Presentatio...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Sustainable Energy Resources for Consumers (SERC) - GeothermalGround-Source Heat Pumps Measuring the Costs and Economic, Social, and Environmental Benefits of Nationwide...

  6. Southeast Regional Clean Energy Policy Analysis

    Office of Energy Efficiency and Renewable Energy (EERE)

    This report covers the states that largely fall into the Southeastern Reliability Corporation (SERC) region: Alabama, Arkansas, Georgia, Louisiana, Kentucky, Missouri, Mississippi, North Carolina, South Carolina, and Tennessee.

  7. Life-Cycle Water Impacts of U.S. Transportation Fuels

    E-Print Network [OSTI]

    Scown, Corinne Donahue

    2010-01-01T23:59:59.000Z

    Photovoltaic Produced Water Renewable Fuels Association ReliabilityFirst Corporation Reverse Osmosis Steam Assisted Gravity Drainage Soybean Meal Synthetic Crude Oil SERC Reliability

  8. Timeline Variability The Variability of Binding Time of Variation Points

    E-Print Network [OSTI]

    Utrecht, Universiteit

    Eelco Visser Technical Report UU-CS-2003-052 Institute of Information and Computing Sciences Utrecht-3275 Address: Eelco Dolstra Utrecht University, P.O. Box 80089, 3508 TB Utrecht, The Netherlands eelco@cs.uu.nl Gert Florijn SERC, P.O. Box 424, 3500 AK Utrecht, The Netherlands florijn@serc.nl Eelco Visser Utrecht

  9. Energy Research and Development Division FINAL PROJECT REPORT

    E-Print Network [OSTI]

    Principal Economist at Itron Inc., in interpreting and analyzing Itron energy efficiency data. Likewise: California Energy Commission Prepared by: Schatz Energy Research Center #12; Prepared by: Primary Alstone, Adam Schumaker, Colin Sheppard, and Jim Zoellick, SERC Schatz Energy Research Center (SERC) 1

  10. The same or just much the same? Problems with coreference from the reader's perspective

    E-Print Network [OSTI]

    ". The poet handed over part of the prize to the "SERCE" Foundation. the first task should identify precision cz nagrody ­ part of the prize nagrody ­ the prize poetka ­ the poet Fundacji ,,SERCE, poetk ­ Wislawa Szymborska, her, the poet Nagrod Nobla, nagrody ­ the Nobel Prize, the prize. All

  11. aeromonas spp strains: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Websites Summary: THE AMERICAN ALLIGATOR, Alligator mi8sissippiensis R. W. GORDEN,T. C. HAZEN, a G. W. ESCH and C. B. FLIERMANS Abstract: Aeromonas hydrophila was isolated...

  12. Molecular characterization of Theileria spp. using ribosomal RNA

    E-Print Network [OSTI]

    Bendele, Kylie Gayle

    2005-11-01T23:59:59.000Z

    (Chair of Committee) (Member) ____________________________ _____________________________ Pete D. Teel Ann B. Kier (Member) (Head of Department) August 2004 Major: Veterinary Parasitology iii... of the variable (V4) region the SSU rRNA gene. The Theileria isolates came from different geographic locations including Korea, Japan and several locations in North America. Types A, B, C, D and E were found in parasites from cattle, type E in parasites from...

  13. The parabiotic relationship between Phymatotrichum omnivorum and Gossypium spp.

    E-Print Network [OSTI]

    Kruse, David Howard

    1984-01-01T23:59:59.000Z

    if td tto ts. I U. ~h Dogridge the only anatomical feature distinguishing it from more susceptible cultivars is the increased number of raphides. Raphides are typically formed from the calcium salt of oxalic acid. Perry (40) observed that expression... this type of pathogenic action. Oxalic acid has been suggested as the toxic substance (40). Oxalic acid has been shown to participate in the pathogenic complex of several fungi such as Sclerotinia sclerotiorum (31, 35) and Endothia 2 iti (22). As yet th...

  14. Isolation and chemical studies of an abortifacient from Gutierrezia spp

    E-Print Network [OSTI]

    Shaver, Ted Neil

    1962-01-01T23:59:59.000Z

    Review of the Literature Exper imental Determination of Estrogenic Content of Gutierrezia ~s Isolation of a Toxic Component from Broomweed Effect of Saponins on Isolated Smooth Muscle Toxicity of Saponins When ~ected Intravenously Oral Toxicity... of Broomweed Saponin Chemical Studies on the Isolated Compound 5 6 9 11 17 21 Discussion Intravenous Injection of Broomweed Saponin Oral Administrathm of Broomweed Saponln Chemical Studies on isolated Sapogenln 26 2V 28 Summary References 30...

  15. aeromonas spp como: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Angela Faustino Jozala 2005-01-01 229 Potencial de reduo de emisses de GEE do bioetanol: contributo da anlise de ciclo de vida da beterraba sacarina e do cardo como...

  16. Bentgrass (Agrostis spp.) Species and Cultivar Tolerance to Methiozolin

    E-Print Network [OSTI]

    Hoisington, Nicholas Ryan

    2013-01-01T23:59:59.000Z

    Kreuser W. C. and D. J. Soldat. 2011. A Growing Degree DayYelverton 2000; Kreuser and Soldat 2011). Creeping bentgrass

  17. BEHAVIOR, CHEMICAL ECOLOGY Lutzomyia spp. (Diptera: Psychodidae) Response to Olfactory

    E-Print Network [OSTI]

    Kaufman, Phillip E.

    - and Light Emitting Diode-Modified Mosquito Magnet X (MM-X) Traps RAJINDER S. MANN,1 PHILLIP E. KAUFMAN-green- red light-emitting diodes and olfactory attractants to determine the response of Lutzomyia shannoni

  18. Maturity and Fecundity in the Rockfishes, Sebastes spp., a Review

    E-Print Network [OSTI]

    and South Africa (Chen, 1971). Rockfishes are gonochoristic, with internal fertilization. Eggs incubate in the North Atlantic (Kendall, 1991) and at least one is found in the southern hemi sphere off South America studies have suggested that developing young use exogenous energy prior to birth (Boehlert and Yoldavich

  19. http://spp.sagepub.com/ Social Psychological and Personality Science

    E-Print Network [OSTI]

    Maddox, W. Todd

    ; they crossed this factor with a self-regulation manipulation in which participants did or did not suppress seems to be from a lack of self-regulatory capacity, not fatigue. Keywords self-regulation, self-control to show poor self-regulation subsequently. This pattern has been said to support a limited-resource model

  20. alternative neisseria spp: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    in pure culture and in inoculated (more) Hu, Xiaopei 2005-01-01 53 November 2008 Alternative Energy Environmental Sciences and Ecology Websites Summary: November 2008...

  1. RESEARCH ARTICLE Open Access Histoplasma capsulatum and Pneumocystis spp.

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    as a probable reservoir and disperser; however, the co-infection of bats with both of these microorganisms has found in bat guano accumulated in confined spaces such as caves and abandoned mines and buildings

  2. acinetobacter spp isolates: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    ???, ????? 1996-01-01 2 Diversity of acinetobacter baumannii isolates from Egypt Edinburgh, University of - Research Archive Summary: Acinetobacter baumannii is an...

  3. arachis spp silvestres: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    hazards, to avoid the development of resistant strains and to reduce the cost of cultivation. This paper reviews the literature on Sclerotium rolfsii inducing stem rot...

  4. amphibians rana spp: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    individuals in aquatic and ter- restrial environments (Werner 1986). Agricultur- al cultivation (i.e., arable 79409, USA Abstract: Agricultural land use may indirectly affect the...

  5. Identification of Saprolegnia Spp. Pathogenic in Chinook Salmon : Final Report.

    SciTech Connect (OSTI)

    Whisler, Howard C.

    1997-06-01T23:59:59.000Z

    This project has developed procedures to assess the role of the fungal parasite, Saprolegnia in the biology of salmon, particularly adult Chinook, in the Columbia River Basin. Both morphological and DNA ``fingerprinting`` surveys reveal that Saprolegnia parasitica (=S. diclina, Type I) is the most common pathogen of these fish. In the first phase of this study 92% of 620 isolates, from salmon lesions, conformed to this taxa of Saprolegnia. In the current phase, the authors have developed variants of DNA fingerprinting (RAPD and SWAPP analysis) that permit examination of the sub-structure of the parasite population. These results confirm the predominance of S. parasitica, and suggest that at least three different sub-groups of this fungus occur in the Pacific N.W., USA. The use of single and paired primers with PCR amplification permits identification of pathogenic types, and distinction from other species of the genus considered to be more saprophytic in character. A year`s survey of saprolegniaceous fungi from Lake Washington indicated that the fish-pathogen was not common in the water column. Where and how fish encounter this parasite can be approached with the molecular tags identified in this project.

  6. Property:EIA/861/NercSpp | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolve JumpallowedAltFuelVehicleNercRfc Jump

  7. EIA - State Electricity Profiles

    U.S. Energy Information Administration (EIA) Indexed Site

    2012 Summary statistics (South Carolina) Item Value U.S. Rank NERC Region(s) SERC Primary Energy Source Nuclear Net Summer Capacity (megawatts) 23,083 18 Electric Utilities 21,280...

  8. Modeling Interregional Transmission Congestion in the National Energy Modeling System

    E-Print Network [OSTI]

    Gumerman, Etan; Chan, Peter; Lesieutre, Bernard; Marnay, Chris; Wang, Juan

    2006-01-01T23:59:59.000Z

    Administration. 2005a. Annual Energy Outlook 2005. EIA/DOE.RON SERC TWh WECC Annual Energy Outlook U.S. Department ofAccording to the Annual Energy Outlook (AEO) 2004 Reference

  9. Cornell University, Office of Sponsored Programs

    E-Print Network [OSTI]

    Lab of O - Programs SERC BUILDING THE FIELD OF PARTICIPATION IN SCIENTIFIC RESEARCH 68149 $ 22 $ 73,881.00 FORTIER, LISA Clinical Sciences NYS HEALTH STEM CELL TRAINING OF VETERINARY STUDENTS

  10. Modeling Interregional Transmission Congestion in the National Energy Modeling System

    E-Print Network [OSTI]

    Gumerman, Etan; Chan, Peter; Lesieutre, Bernard; Marnay, Chris; Wang, Juan

    2006-01-01T23:59:59.000Z

    5 Figure 1-4 Four-Node Example Based on the WECC6 Figure 1-5 Four-Node Example Based on the WECCPAE PBA RA RON SERC TWh WECC Annual Energy Outlook U.S.

  11. U.S. Energy Information Administration (EIA) - Sector

    Annual Energy Outlook 2013 [U.S. Energy Information Administration (EIA)]

    by Fuel - SERC Reliability Corporation Virginia-Carolina XLS Table 58.17. Renewable Energy Generation by Fuel - Southwest Power Pool North XLS Table 58.18. Renewable Energy...

  12. Development of Conceptual Framework Renewable Energy Certificate Mechanism for India

    E-Print Network [OSTI]

    Columbia University

    Delhi Electricity Regulatory Commission DMRPS Dynamic Minimum Renewable Purchase Standard EA 2003 Renewable Obligation Certificate RPS Renewable Purchase Specification RPO Renewable Purchase Obligation RPC Regional Power Committee Rs Rupees SERC State Electricity Regulatory Commission SLDC State Load Despatch

  13. Coordination of Retail Demand Response with Midwest ISO Markets

    E-Print Network [OSTI]

    Bharvirkar, Ranjit

    2008-01-01T23:59:59.000Z

    MISO MP MRO MWDRI M&V NYISO PJM PUC RAP RFC RTO RTP SERC AirRTOs such as New England or PJM. In 2005 MISO became theEdison is a member of PJM). Interruptible (Total = 3398, N =

  14. *Support from EPRI, NSF and ORNL for this work is gratefully acknowledged.

    E-Print Network [OSTI]

    Amin, S. Massoud

    of the power produced, rights of way and assts, but it also creates challenges: · 1) Regulatory Challenges be taken into account. #12;0.6 0.7 0.8 0.9 1 1.1 1989 1994 1999 2004 2009 TransmissionCapacity(1989=1) NPCC TRANSMISSIONINVESTMENT(billion1999-$/ -$117 million/year Transmission investment ($) since 1975 Transmission capacity

  15. ISRP Retrospective Report:ISRP Retrospective Report: 19971997 20052005

    E-Print Network [OSTI]

    .D., NPCC #12;ISRP RetrospectiveISRP Retrospective ·· Presents an overview of ISRP activities from 1997 toPresents an overview of ISRP activities from 1997 to 2005 and evaluates the cumulative effect of our2005 and evaluates

  16. Northwest Power and Conservation Council Kennecott Energy comments on 5 year plan

    E-Print Network [OSTI]

    applaud the NPCC's forward thinking when it comes to coal gasification and Kennecott Energy is involved in a number of initiatives that would help make coal gasification an economic reality. However, until plan and would like to submit comments on the plan as it pertains to the future use of coal. Kennecott

  17. Microbial interactions associated with biofilms attached to Trichodesmium spp. and detrital particles in the ocean

    E-Print Network [OSTI]

    Hmelo, Laura Robin

    2010-01-01T23:59:59.000Z

    Quorum sensing (QS) via acylated homoserine lactones (AHLs) was discovered in the ocean, yet little is known about its role in the ocean beyond its involvement in certain symbiotic interactions. The objectives of this ...

  18. Marine bryozoans Bugula neritina and Watersipora spp. and their proteobacterial symbionts

    E-Print Network [OSTI]

    Anderson, Christine Marie

    2006-01-01T23:59:59.000Z

    Normalized absorbance Riboflavin Wavelength (nm) FIG 6.4.larval extract and riboflavin. References Anthoni, U. , P.extract and riboflavin………………………………………………………………..142 viii

  19. aflatoxin-producing aspergillus spp: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    A de Aspergillus nidulans. Open Access Theses and Dissertations Summary: ??O Bioetanol um combustvel alternativo particularmente interessante, pois paralelamente s...

  20. Identification and distribution of Botryosphaeria spp. associated with grapevine cankers in California

    E-Print Network [OSTI]

    Urbez-Torres, J R; Leavitt, G M; Voegel, T M; Gubler, W D

    2006-01-01T23:59:59.000Z

    grapevine decline in Western Australia. Aust. Plant Pathol.Australia (2,37). In Western Australia, B. australis and B.grapevine cuttings in Western Australia (37). Several

  1. An antigenic and serologic study of six strains of Trichomonas SPP

    E-Print Network [OSTI]

    Speights, Stephen Ryan

    1974-01-01T23:59:59.000Z

    LITERATURE CITED 99 VITA 103 LIST OF TABLES Table Page Summary of virulence studies using "non-immune" pigeons 39 Summary of virulence studies using a modified mouse assay 41 III. IV. VI . Summary of AT strain agglutination reactions Summary of SB... strain agglutination reactions Summary of ZM strain agglutination reactions Summary of CS strain agglutination reactions 69 70 71 72 VII . Summary of JB VI strain agglutination reactions . . 73 VIII. IX, XI. XII . Summary of AT strain IFA...

  2. Investigating the role of Trichodesmium spp. in the oceanic nitrogen cycle through observations and models

    E-Print Network [OSTI]

    Olson, Elise Marie Black

    2014-01-01T23:59:59.000Z

    This work concerns the nitrogen fixation and abundance of Trichodesmium colonies in the western subtropical-tropical North Atlantic and their connections with physical processes. Data were collected in fall 2010 and spring ...

  3. Phylogenetic reassessment of Mycosphaerella spp. and their anamorphs occurring on Eucalyptus. II.

    E-Print Network [OSTI]

    "Do Areeiro" Subida a la Robleda S/N E-36153 Pontevedra, Spain; 4 Departemento de Fitopatologia known teleomorphs (Crous & Braun 2003). Of these, 55 species from eucalypts were treated by Crous (1998) and several additional species have been described more recently (Carnegie & Keane 1998, Braun & Dick 2002

  4. MAXIMUM YIELD ESTIMATES FOR THE PACIFIC THREAD HERRING, OPISTHONEMA SPP., FISHERY IN COSTA RICA

    E-Print Network [OSTI]

    . According to Berry and Barrett (1963), three Pacific species (Opis- thonema libertate, O. bulleri, and O

  5. Physiological tolerances across latitudes: thermal sensitivity of larval marine snails (Nucella spp.)

    E-Print Network [OSTI]

    Zippay, Mackenzie L.; Hofmann, Gretchen E.

    2010-01-01T23:59:59.000Z

    were less tolerant of heat stress than those from centralinduced by the acute heat stress, a second experiment wasegg capsules with no heat stress (“control”), survival rates

  6. HELMINTHS OF MURRES (ALCIDAE: URIA SPP.): MARKERS OF ECOLOGICAL CHANGE IN THE MARINE ENVIRONMENT

    E-Print Network [OSTI]

    Jones, Ian L.

    , College of Science, United Arab Emirates University, P.O. Box 17551, Al Ain, United Arab Emirates 3

  7. New Products and Markets for Menhaden, Brevoortia spp. MALCOLM B. HALE, PAUL E. BAUERSFELD,

    E-Print Network [OSTI]

    economic future ofthe fish meal and oil industry. Meal and oil prices recovered sharply between 1986and beneficialrefinedmenhaden oil is not yet available. Refined menhaden oil is cur rently the raw material for biomedical test. Menhaden oil also faces price competition, and the traditional market in Europe is uncertain. Menhaden rep

  8. Molecular and genetic analysis of Cryptosporidium spp. oocysts : sources and genotypes in the environment

    E-Print Network [OSTI]

    Jellison, Kristen L. (Kristen Leigh), 1975-

    2003-01-01T23:59:59.000Z

    Cryptosporidium parvum is responsible for an acute gastrointestinal disease that is self-limiting in immunocompetent people but potentially life-threatening for the immunocompromised. Until recently, C. parvum was the only ...

  9. Wide Hybridization, Genomic, and Overwintering Characterization of High-Biomass Sorghum Spp. Feedstocks

    E-Print Network [OSTI]

    Whitmire, David Kyle

    2012-10-19T23:59:59.000Z

    ). The leaf 19 tissue used for DNA extraction was harvested from the youngest exposed leaf and was kept on ice until being stored in a -80°C freezer. At the time of extraction, the leaf material was removed from the -80°C freezer and 50-100 mg of leaf... chromosome regions and genes associated with disease resistance. Regions and/or genes relating to freezing tolerance in Medicago sativa L., alfalfa, and apomixis in Pennisetum cilare (L.) Link, bufflegrass, have been successfully identified using...

  10. A survey of Meloidogyne spp. parasitizing peaches in Texas and their effects on four peach rootstocks

    E-Print Network [OSTI]

    Johnson, Jerral D

    1964-01-01T23:59:59.000Z

    nit ~inc lta, although stunted, were still alive and producing new growth at the end of three years. The locations of M. T ntca samples are given ln plgure 4. 1 listing s to th *unties ln hl h N. ~avanlea was found and the number of samples found...

  11. Market Protocols for SPP Integrated Marketplace Version 2.0 7/12/2011 584

    E-Print Network [OSTI]

    Tesfatsion, Leigh

    into or out of CBA or SA OCL Over Collected Losses Settlement surplus related to marginal loss pricing, which Response Load reduction which can be metered DRL Demand Response Load A meter location discretely representing the load behind which a demand response resource is located. A DRL is not necessarily associated

  12. Phytochemical analyses and inheritance of resistance to TEV (Tobacco Etch Virus) in pepper (Capsicum spp.)

    E-Print Network [OSTI]

    Lee, Jinsuk

    2002-01-01T23:59:59.000Z

    contents were highest in Banana Supreme. Banana Supreme and Jaloro showed high beta-carotene and zeaxanthin contents at Weslaco, and Orange Habanero showed high lutein. In the flavonoid analysis, PI 357509 had a high content of quercetin and Rio Grande Gold...

  13. Over 90 species of rockfish (Sebastes spp.) are found in kelp beds, rocky

    E-Print Network [OSTI]

    ): a bioenergetics approach Chris J. Harvey Northwest Fisheries Science Center National Marine Fisheries Service 2725 by the Scientific Editor. Fish. Bull. 103:71­83 (2005). Fish bioenergetics models relate the energy consumption (Madenjian et al., 2000). At the scale of the indi- vidual fish, bioenergetics models can estimate effects

  14. PERFORMANCE OF A SPECTRAL ELEMENT ATMOSPHERIC MODEL SEAM ON THE HP EXEMPLAR SPP2000.

    E-Print Network [OSTI]

    Baer, Ferdinand

    discretization strategy taken from NCAR's Community Climate Model Version 3 (CCM3) [9]. Spectral elements have avoiding clustering points at the poles. Secondly, by using a local coordinate system within each element Fournier for helpful comments. This work was supported in part by the U.S. Department of Energy; Oce

  15. Identification and genetic diversity of Rosellinia spp. associated with root rot of coffee in Colombia

    E-Print Network [OSTI]

    in Colombia Bertha L. Castro & Angela J. Carreńo & Narmer F. Galeano & Jolanda Roux & Michael J. Wingfield rot on a wide range of herbaceous and woody hosts. In Colombia, these fungi cause serious diseases (Fernández and López 1964; Castro and Esquivel 1991). Other than in Colombia, these pathogens are known

  16. Wide Hybridization, Genomic, and Overwintering Characterization of High-Biomass Sorghum Spp. Feedstocks 

    E-Print Network [OSTI]

    Whitmire, David Kyle

    2012-10-19T23:59:59.000Z

    feedstocks incentivizes the development of versatile biomass products with greater end-use possibilities, as in either a forage or bioenergy system. High-biomass, perennial grasses offer dual-use potential in either forage or biofuel systems. In 2009...

  17. The effects of management practices on thatch accumulation in a Tifgreen bermudagrass (Cynodon spp.) putting green

    E-Print Network [OSTI]

    Meinhold, Vaun Harold

    1973-01-01T23:59:59.000Z

    increased thatch accumu- lation 30X, increased the lignin/cellulose ratio 21X and resulted in 30X less C evolved from microbial activity as compared to the low level of N. The Milorganite treatments produced 12X less thatch, decreased the lignin... evident mid-way through the growing season. Because of the fungicide treatment, total thatch accumulation decreased 16X, the lignin/cellulose ratio~decreased 20X, and microbial activity increased 30X. These results may have been due to an alteration...

  18. The Association of Virulent Vibrio Spp. Bacteria on Gafftopsail and Hardhead Catfish in Galveston Bay

    E-Print Network [OSTI]

    Gilbert, Leslie Deanne

    2011-10-21T23:59:59.000Z

    ................... 21 II. 5. Distribution of V. parahaemolyticus tlh by A) fish length, B) sub-bay, and C) species of fish ................................................................................ 26 II. 6. Correlation of V. parahaemolyticus tlh... comparison .................................................... 19 II. 4. Kolmogorov-Smirnov results for V. vulnifiucs .......................................... 21 II. 5. ANOVA results for quantity of V. vulnifiucs versus length of fish...

  19. Candidate Species for Florida Aquaculture: Discus Symphysodon spp., a Profitable but Challenging Species

    E-Print Network [OSTI]

    Watson, Craig A.

    of organic matter. These acids impart the dark brown color to the water and make itacidic (pH usually below 5, their body base colors usually range from dark brownish to blue and green hues. They are spotted and striated for the aquarium trade from the wild in water tributaries belonging to the Amazon River of Brazil, Colombia

  20. The Association of Virulent Vibrio Spp. Bacteria on Gafftopsail and Hardhead Catfish in Galveston Bay 

    E-Print Network [OSTI]

    Gilbert, Leslie Deanne

    2011-10-21T23:59:59.000Z

    Vibrio vulnificus (Vv) and V. parahaemolyticus (Vp) are gram negative, halophilic bacteria that occur naturally in estuarine waters of Galveston Bay. Both bacteria have the potential to cause infections in humans either via consumption or direct...

  1. IDENTIFICATION OF DROUGHT-RELATED QUANTITATIVE TRAIT LOCI (QTLs) IN SUGARCANE (Saccharum spp.) USING GENIC MARKERS

    E-Print Network [OSTI]

    Sharma, Vivek

    2011-08-08T23:59:59.000Z

    associations in this study. Fifty-six polymorphisms produced by 13 EST-SSR primers were used to produce genetic similarity matrix for 80 genotypes. Dendrogram prepared from this genetic similarity matrix will be useful in selecting parents carrying diversity...

  2. Species differences in courtship acoustic signals among five Lake Malawi cichlid species (Pseudotropheus spp.)

    E-Print Network [OSTI]

    ~ao em Eco-Etologia, ISPA, Rua Jardim do Tabaco 34, 1149-041 Lisboa, Portugal, Departamento de Biologia of the sounds produced in the early stage of court- ship by males of three closely related species from Lake

  3. Marine bryozoans Bugula neritina and Watersipora spp. and their proteobacterial symbionts

    E-Print Network [OSTI]

    Anderson, Christine Marie

    2006-01-01T23:59:59.000Z

    colony collected from Ventura, July, 2005…………..82 W. “colony collected from Ventura, July, 2005. FIG. 4.8. W. “AY647167) W. “subtorquata,” Ventura, Jul-2005 (DQ417457)

  4. Microsoft PowerPoint - MISO-SPP Market Impacts HydPwrConf 2014

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville PowerCherries 82981-1cnHighand RetrievalsFinalModule8.ppt MicrosoftDOE'sR.G. VanInChanging Energy

  5. JOURNAL DE PHYSIQUE Colloque C8, supplbment au no 12, Tome 47, dkcembre 1986

    E-Print Network [OSTI]

    Boyer, Edmond

    [ O S ~ ( C O ) ~ ~ ]avec HS(CH2)jSIL conduit la formation de HOs3(CO)10 [S(CH2)3 S I ~ ]dont la on Line 7 of the Synchrotron Radiation Source at the SERC Daresbury Laboratory. The procedures used

  6. Aging of Development: the Saemangeum Tideland Reclamation Project (STRP) in South Korea and Sustainable Development of the Two Townships in and out of the STRP

    E-Print Network [OSTI]

    Choi, In Huck

    2012-07-16T23:59:59.000Z

    quality (or its improvement methods) and the change of the coastal or ocean ecosystem. For example, the Saemangeum Environmental Research Center (SERC) was founded by the researchers of oceanography, environmentology, chemistry, chemical engineering... to the Fieldwork Sites ........................................................................ 34 2.3 Methods.................................................................................................................... 37 2.3.1 Surveys and interviews...

  7. Chile-Japan Joint Workshop for Non-ferrous Mining

    E-Print Network [OSTI]

    Tokyo, University of

    , University of Chile Director, Energy Center, Solar Energy Research Center (SERC-Chile), University of Chile break 16:00­18:00 Session-III Chair: Prof. Leandro A. Voisin (University of Chile) Energy Challenges materials under strict environmental regulations to preserve mineral resources. is endowed unit develops new

  8. INTER-MOUNTAIN BASINS MIXED SALT DESERT SCRUB extent exaggerated for display

    E-Print Network [OSTI]

    , Picrothamnus desertorum (= Artemisia spinescens), Frankenia salina, Artemisia frigida, Chrysothamnus spp

  9. 18 2010 Proceedings Symposium on Ash in North America GTR-NRS-P-72 GENETIC TRANSFORMATION OF FRAXINUS SPP. FOR

    E-Print Network [OSTI]

    in cold storage. This regeneration system provided a foundation for developing a genetic modification, the nursery and forest products industries, and the U.S. foreign trade of ash lumber and logs. This research

  10. Rhizoctonia spp. associated with brown patch of St. Augustinegrass: isolate characterization, host range, and screening for resistance

    E-Print Network [OSTI]

    Hurd, Bernadette Murphy

    1982-01-01T23:59:59.000Z

    Resistance CONCLUSION LITERATURE CITED 13 13 18 18 25 27 34 41 45 VITA 50 LIST OF TABLES Page TABLE 1. Dates St. Augustinegrsss displaying brown patch symptoms was collected, location of the collection sites, and type of host tissue from..., drained, and placed under a laminar- flow hood on paper towels for 10 min to remove excess water. The cut end of each tip was dipped in molten Paraplast (Lancer Co. , St. Louis, NO. , 63103) to seal the wound. One tip was placed in each of the WA...

  11. American Journal of Botany 97(2): 337356. 2010. Puya, a large genus (ca. 200 spp.; Luther, 2004) of terrestrial,

    E-Print Network [OSTI]

    Sytsma, Kenneth J.

    /Deutero- cohnia/Dyckia (among others) apart from Pitcairnia (subtribe Puyinae: Mez, 1896; tribe Puyeae: Mez, 1934

  12. A clinical, histopathological, and immuno-fluorescent study of Babesia spp. infection in white-tailed deer 

    E-Print Network [OSTI]

    Emerson, Harold Ray

    1969-01-01T23:59:59.000Z

    ' 1 *d t* ' ' 1 1 th th U 'td States in the nineteenth and twentieth centuries and was finally 1'' tdbythd' t' f't t'k t . ~BI'1 lt Babesia canis, which produces a disease in dogs, and Babesia ecCui and Babesia cabelli, which produce diseases... Tyler County in East Texas. Anemia and death occurred in a susceptible, Theileria- 9 free, splenectoxnized white-tailed deer inoculated with 10 ml. of blood taken from a deer in Tyler County. An increase in body texnpexature to 104. 5 F...

  13. A clinical, histopathological, and immuno-fluorescent study of Babesia spp. infection in white-tailed deer

    E-Print Network [OSTI]

    Emerson, Harold Ray

    1969-01-01T23:59:59.000Z

    by the kidneys and produced the hemoglobinuria which was charac- teristic of the acute disease. Bilirubin was produced by the reticulo-endothelial system during the degradation of hemoglobin which was released by severe erythrocytic lysis. The inability...

  14. To be cited as: BORSA P., ANDRFOUT S., JUNCKER M. 2012. Records of bottlenose dolphins, Tursiops spp., in New Caledonian

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    that indents the darker-grey dorsal cape towards the basis of the dorsal fin while morphotype-A individuals. Wounds inflicted by large sharks, including the tiger shark, were documented for morphotype-A bottlenose

  15. Effects of Tissue Nitrogen and Media Nitrate on Trace Metal Uptake and Trophic Transfer by Ulva spp.

    E-Print Network [OSTI]

    Sankaran, Sonya Meenakshi

    2012-01-01T23:59:59.000Z

    Research 47: 175-184. Bruland, K. W. , E. L. Rue and G. J.this region via upwelling (Bruland et al. 2001; Chase et al.

  16. Leptospirosis: time to move to molecular epidemiology Comments on "Reassessment of MLST schemes for Leptospira spp. typing worldwide" by

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    animal reservoirs) both by abandoning the time- consuming and fastidious culture and strain isolation as animal reservoir studies most frequently identified the putative infecting strain using the reference molecular epidemiology data is a real need until animal reservoir studies also move to molecular approaches

  17. Prevalence and abundance of Cryptosporidium parvum and Giardia spp. in wild rural rodents from the Mazury Lake

    E-Print Network [OSTI]

    Nottingham, University of

    species of rodents from forests and abandoned agricultural fields in N.E. Poland (Clethrionomys glareolus rodents as reservoir hosts and sources of infection for local human communities. Key words: Clethrionomys (Griffiths, 1998; de Graaf et al. 1999). A wide range of natural reservoir hosts has been reported for C

  18. Pseudacteon spp. (Diptera: Phoridae) Effect on Foraging Strategies of Solenopsis invicta (Hymenoptera: Formicidae) and Spatiotemporal Monitoring in Urban Habitats

    E-Print Network [OSTI]

    Reed, Janis Johnson

    2013-11-07T23:59:59.000Z

    Prairie, WI) contained the bait cups containing an experimental lab made bait containing 1:1 protein to carbohydrate ratio (EB1:1) and an industry provided bait (TC-206 Advance Granular Carpenter Ant Scatter Bait, BASF, St. Louis, MO), (CABB) offered... Ant Scatter Bait, BASF, St. Louis, MO). This bait will be referred to as CABB, carpenter ant bait blank in this dissertation. This was compared to a 1:1 protein to carbohydrate experimental bait (Cook et al. 2010). This experimental bait...

  19. The distribution and relative abundance of Nematopsis spp., as found in Crassostrea virginica (Gmelin) in the Galveston Bay area

    E-Print Network [OSTI]

    Anderson, Roger Dean

    1969-01-01T23:59:59.000Z

    the first porosporid in America, ~Nt ' t, h'hh f d' tl, g'll d 1 t' fth ll yt . g 1 ~ii'd th d gt t't 'fth ' b, ~ph b. t' d~E ~d* . H p*tt*d' f t' f yt g gf M*bj k Bay, Virginia, to Lake Barre, Louisiana. After a variety of field and lb t*N P ' t, h gg... Further Stud of Nemato sis th gh ' p ' f~Nt ' k, th 1'f y 1 f* a number of species remains to be described. Two of the most recent species to be identified reveal only known decapod hosts. Ball (1951)d 'b dN. ~o-'* th*b ' fg gr' ' f tt ~p* 'd t 1' d P...

  20. Feeding ecology of Liza spp. in a tidal flat: Evidence of the importance of primary production (biofilm) and associated meiofauna

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    mullets are unique among temperate-region fish species in their ability to feed on mudflat biofilm into the mudflat but exported mud, biofilm, and associated meiofauna. The results of mullet stomach content flat ecosystems are discussed. Keywords: Grey mullets; Feeding ecology; Mudflat; Microphytobenthos

  1. Demonstrating biocompatibility with supercritical CO? : biphasic cultivation of Bacillus spp. and probing acclimation mechanisms through proteome and lipid analysis

    E-Print Network [OSTI]

    Peet, Kyle Creighton

    2015-01-01T23:59:59.000Z

    Supercritical (sc) CO? usage is increasing globally with applications as a sterilizing agent, as a non-toxic solvent, and as the form of the greenhouse gas CO? injected underground for geologic carbon sequestration (GCS). ...

  2. Coexistence of congeneric native and invasive species: The case of the green algae Codium spp. in northwestern Spain

    E-Print Network [OSTI]

    Provan, Jim

    Biological invasions have increased in number in coastal eco- systems in recent decades, although until are carried with the sand and rock ballast of ships, such as seaweeds, molluscs and arthro- pods (Carlton

  3. Biodiversity Conservation in Sub-Saharan Africa: A Case Study of the African Dwarf Crocodiles (Osteolaemus Spp.)

    E-Print Network [OSTI]

    Smolensky, Nicole Limunga

    2014-11-20T23:59:59.000Z

    Overexploitation of wildlife is a leading threat to biodiversity in tropical Africa. Effective management requires integrating information on the extent of exploitation, distribution, and status of exploited species. I explore how trade filters...

  4. Clinch River Breeder Reactor: an assessment of need for power and regulatory issues

    SciTech Connect (OSTI)

    Hamblin, D M; Tepel, R C; Bjornstad, D J; Hill, L J; Cantor, R A; Carroll, P J; Cohn, S M; Hadder, G R; Holcomb, B D; Johnson, K E

    1983-09-01T23:59:59.000Z

    The purpose of this report is to present the results of a research effort designed to assist the US Department of Energy in: (1) reviewing the need for power from the Clinch River Breeder Reactor (CRBR) in the Southeastern Electric Reliability Council (SERC) region, not including Florida, and (2) isolating specific regulatory and institutional issues and physical transmission capacities that may constrain the market for CRBR power. A review of existing electric power wheeling arrangements in the Southeast and specific federal and state regulatory obstacles that may affect power sales from the CRBR was undertaken. This review was a contributing factor to a decision to target the service territory to SERC-less Florida.

  5. 6 A QUANTUM LEAP 13 THE POWER OF

    E-Print Network [OSTI]

    Beaumont, Christopher

    applications in materials research are grounded in the basic sciences of physics, chemistry, engineeringSerc ­ nATUrAl ScienceS AnD enGineerinG reSeArch coUncil oF cAnADA makes strategic investments in Canada's researchers pursue projects with social and economic benefits in virtually any sector. The fund helps Nova

  6. Yakima/Klickitat Fisheries Project Monitoring and Evaluation, Final Report For the Performance Period May 1, 2008 through April 30, 2009.

    SciTech Connect (OSTI)

    Sampson, Melvin R. [The Confederated Tribes and Bands of the Yakama Nation

    2009-07-30T23:59:59.000Z

    The Yakima-Klickitat Fisheries Project (YKFP) is a joint project of the Yakama Nation (lead entity) and the Washington State Department of Fish and Wildlife (WDFW) and is sponsored in large part by the Bonneville Power Administration (BPA) with oversight and guidance from the Northwest Power and Conservation Council (NPCC). It is among the largest and most complex fisheries management projects in the Columbia Basin in terms of data collection and management, physical facilities, habitat enhancement and management, and experimental design and research on fisheries resources. Using principles of adaptive management, the YKFP is attempting to evaluate all stocks historically present in the Yakima subbasin and apply a combination of habitat restoration and hatchery supplementation or reintroduction, to restore the Yakima Subbasin ecosystem with sustainable and harvestable populations of salmon, steelhead and other at-risk species. The original impetus for the YKFP resulted from the landmark fishing disputes of the 1970s, the ensuing legal decisions in United States versus Washington and United States versus Oregon, and the region's realization that lost natural production needed to be mitigated in upriver areas where these losses primarily occurred. The YKFP was first identified in the NPCC's 1982 Fish and Wildlife Program (FWP) and supported in the U.S. v Oregon 1988 Columbia River Fish Management Plan (CRFMP). A draft Master Plan was presented to the NPCC in 1987 and the Preliminary Design Report was presented in 1990. In both circumstances, the NPCC instructed the Yakama Nation, WDFW and BPA to carry out planning functions that addressed uncertainties in regard to the adequacy of hatchery supplementation for meeting production objectives and limiting adverse ecological and genetic impacts. At the same time, the NPCC underscored the importance of using adaptive management principles to manage the direction of the Project. The 1994 FWP reiterated the importance of proceeding with the YKFP because of the added production and learning potential the project would provide. The YKFP is unique in having been designed to rigorously test the efficacy of hatchery supplementation. Given the current dire situation of many salmon and steelhead stocks, and the heavy reliance on artificial propagation as a recovery tool, YKFP monitoring results will have great region-wide significance. Supplementation is envisioned as a means to enhance and sustain the abundance of wild and naturally-spawning populations at levels exceeding the cumulative mortality burden imposed on those populations by habitat degradation and by natural cycles in environmental conditions. A supplementation hatchery is properly operated as an adjunct to the natural production system in a watershed. By fully integrating the hatchery with a naturally-producing population, high survival rates for the component of the population in the hatchery can raise the average abundance of the total population (hatchery component + naturally-producing component) to a level that compensates for the high mortalities imposed by human development activities and fully seeds the natural environment. The objectives of the YKFP are to: use Ecosystem Diagnosis and Treatment (EDT) and other modeling tools to facilitate planning for project activities, enhance existing stocks, re-introduce extirpated stocks, protect and restore habitat in the Yakima Subbasin, and operate using a scientifically rigorous process that will foster application of the knowledge gained about hatchery supplementation and habitat restoration throughout the Columbia River Basin. The YKFP is still in the early stages of evaluation, and as such the data and findings presented in this report should be considered preliminary until results are published in the peer-reviewed literature. The following is a brief summary of current YKFP activities by species.

  7. CONTACT: Randy Wilkerson, 720-962-7050, PublicAffairs@wapa.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    addressed in a WesternSPP membership agreement as well as likely changes to the SPP tariff andor bylaws. Those changes will be worked through the normal SPP committee...

  8. A study of Staphylococcus, Salmonella and Listeria on the bacteriological quality of beef and pork livers

    E-Print Network [OSTI]

    Choi, Vai Man

    1988-01-01T23:59:59.000Z

    with other microorganisms such as Corynebacterium pyogenes, Bacteroides spp. , Streptococcus spp. , and Staphylococcus spp. (29, 45). But the role of such other organisms on the formation of liver abscesses has not sufficiently been investigated...

  9. Femtosecond Nanofocusing with Full Optical Waveform Control....

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    has been a long-standing challenge in optics. Previous approaches using surface plasmon polariton (SPP) resonant nanostructures or SPP waveguides have suffered from, for...

  10. 2009 Wind Technologies Market Report

    E-Print Network [OSTI]

    Wiser, Ryan

    2010-01-01T23:59:59.000Z

    Midwest, Mountain, Texas, PJM, SPP, and Northwest regions.the The queues surveyed include PJM Interconnection, MidwestMidwest, Mountain, Texas, PJM, SPP, and Northwest regions:

  11. Can Hedgerows Attract Beneficial Insects and Improve Pest Control? A Study of Hedgerows on Central Coast Farms

    E-Print Network [OSTI]

    Pisani Gareau, Tara; Shennan, Carol

    2010-01-01T23:59:59.000Z

    plant bug (Lygus hesperus, Hemiptera: Miridae) and aphids (pirate bugs (Orius spp. , Hemiptera: Generalist Predatorseyed bugs (Geocoris spp. , Hemiptera: Lygaeidae), Herbivores

  12. Method and applications of time-resolved space-heterodyne imaging

    E-Print Network [OSTI]

    Rokitski, Rostislav

    2006-01-01T23:59:59.000Z

    of SPP pulse provides additional electromagnetic ?eldof SPP pulse provides additional electromagnetic ?eldpulses leads to com- plete 3D and temporal localization of electromagnetic ?

  13. Distribution, abundance and persistence of species of Orasema (Hym: Eucharitidae) parasitic on fire ants in South America

    E-Print Network [OSTI]

    Varone, L.; Heraty, J.M.; Calcaterra, L.A.

    2010-01-01T23:59:59.000Z

    sites with Orasema spp. in Bolivia, Paraguay and Uruguay.Country Locality Bolivia Trinidad Paraguay Asuncion UruguaySolenopsis spp. in Argentina, Bolivia, Paraguay and Uruguay.

  14. Utilization of DNA as a Sole Source of Phosphorus, Carbon, and Energy by Shewanella spp.: Ecological and Physiological Implications for Dissimilatory Metal Reduction

    SciTech Connect (OSTI)

    Pinchuk, Grigoriy E.; Ammons, Christine G.; Culley, David E.; Li, Shu-Mei; McLean, Jeffrey S.; Romine, Margaret F.; Nealson, Kenneth H.; Fredrickson, Jim K.; Beliaev, Alex S.

    2008-02-15T23:59:59.000Z

    As a constituent of dissolved organic matter, DNA may be consumed by microorganisms inhabiting various freshwater and marine environments. In this study, we demonstrate that dissolved extracellular DNA can serve as a sole source of carbon, energy, nitrogen, and phosphorus for microorganisms residing in the upper layer of Columbia River (WA, USA) water column as well as a sole source of phosphorus for the dissimilatory metal-reducing bacteria Shewanella oneidensis MR-1 and Geobacter sulfurreducens and for Bacillus subtilis ATCC 49760. Our results suggest that DNA assimilation by S. oneidensis is linked to the activity of Ca2+-dependent nuclease(s) and extracellular phosphatase(s). The ability to use DNA as the sole source of phosphorus may be of particular ecological advantage for microorganisms living under Fe(III)-reducing conditions where bioavailability of inorganic phosphate may be limited by the formation of vivianite [Fe3(PO4)2•8H20].

  15. Effects of Lactic Acid and Commercial Chilling Processes on Survival of Salmonella spp., Yersinia enterocolitica, and Campylobacter coli in Pork Variety Meats

    E-Print Network [OSTI]

    King, Amanda Mardelle

    2011-10-21T23:59:59.000Z

    /sample. The greatest reductions were observed on samples treated with lactic acid (Treatments 1 and 3) (1.3-5.0 log CFU/sample) while the smallest reductions were reported for samples without any spray treatment (Treatments 2 and 4) (0.7-4.5 log CFU/sample). Large...

  16. Science and Public Policy, 34(2), March 2007, pages 109116 DOI: 10.3152/030234207X190964; http://www.ingentaconnect.com/content/beech/spp

    E-Print Network [OSTI]

    Neff, Jason

    Science and Public Policy, 34(2), March 2007, pages 109­116 DOI: 10.3152/030234207X190964; http and policy circles. This paper reviews the literature on climate forecasting information and explores three, flooding in Peru and Ecuador and drought- related famine in southern Africa and India, revealed

  17. A comparison of diagnostic techniques for detecting salmonella spp in equine fecal samples using culture methods, gel-based pcr, and real-time pcr assays

    E-Print Network [OSTI]

    Smith, Shelle Ann

    2007-09-17T23:59:59.000Z

    (TTH) [BD Diagnostics, Franklin Lakes, NJ, prepared by the Department of Veterinary Pathobiology (VTPB) 10 media kitchen] with 5 drops of iodine solution added. The MacConkey Agar plates, XLT4 plates, and inoculated Tetrathionate broth were..., prepared by the Department of Veterinary Pathobiology (VTPB) media kitchen] was then inoculated with solution from the Tetrathionate broth mixture using a sterile swab. The MAC plates, XLT4 plates, and inoculated RV broth were then incubated for 24 hrs...

  18. Analysis of BAC-end sequences (BESs) and development of BES-SSR markers for genetic mapping and hybrid purity assessment in pigeonpea (Cajanus spp.)

    E-Print Network [OSTI]

    2011-01-01T23:59:59.000Z

    to these SSR markers as CcM (Cajanus cajan Microsatellite) (content (PIC) value of each CcM marker, and thus inferdiscriminatory power of these CcM markers. PIC values ranged

  19. Effects of Lactic Acid and Commercial Chilling Processes on Survival of Salmonella spp., Yersinia enterocolitica, and Campylobacter coli in Pork Variety Meats 

    E-Print Network [OSTI]

    King, Amanda Mardelle

    2011-10-21T23:59:59.000Z

    /sample, the application of lactic acid before chilling and freezing variety meats results in significantly larger (P<0.05) reductions in microorganisms. Results also show that aerobic plate counts, E. coli, and coliforms follow similar trends to the pathogens....

  20. The effect of resource provisioning and sugar composition of foods on longevity of three Gonatocerus spp., egg parasitoids of Homalodisca vitripennis

    E-Print Network [OSTI]

    Irvin, Nicola A; Hoddle, M S; Castle, S J

    2007-01-01T23:59:59.000Z

    Hymenoptera Conference, Canberra, Australia, January 1999.CSIRO, Canberra, Australia, pp. 396–403. Irvin, N.A. ,

  1. Title: Predicting yields of short-rotation hybrid poplar (Populus spp.) for the contiguous US1 through model-data synthesis2

    E-Print Network [OSTI]

    Dietze, Michael

    ). In the US the Advanced5 Energy Initiative (AEI) mandates that renewable bioethanol displace 30% of 2005

  2. Auklet (Charadriiformes: Alcidae, Aethia spp.) chick meals from the Aleutian Islands, Alaska, have a very low incidence of plastic marine debris

    E-Print Network [OSTI]

    Jones, Ian L.

    , have a very low incidence of plastic marine debris Alexander L. Bond a,*, Ian L. Jones a , Jeffrey C t i c l e i n f o Keywords: Plastic Marine debris North Pacific Ocean Auklet Aethia Aleutian Islands a b s t r a c t The ingestion of plastic marine debris is a chronic problem for some of the world

  3. Factors influencing the suppression of Heliothis spp. and Anthonomous grandis Boheman by the predator, Solenopsis invicta Buren, in a cotton agroecosystem

    E-Print Network [OSTI]

    Agnew, C. W

    1981-01-01T23:59:59.000Z

    e h a by the p edato, ~S1 o sis invicta Buren, in a Cotton Agroecosystem. (Nay 1981) Charles William Agnew, B. S. , Purdue University Chairman of Advisory Committee: Dr. Winfield Sterling Th1s study is concerned with evaluating the role... to my major advisor, Dr. W. L. Sterling for hi s time, advice, patience and cr1ticism during the course of this study and to the members of my consnittee for their service. Special thanks to Mr. Al len Dean for all types of assistance including...

  4. The effect of resource provisioning and sugar composition of foods on longevity of three Gonatocerus spp., egg parasitoids of Homalodisca vitripennis

    E-Print Network [OSTI]

    Irvin, Nicola A; Hoddle, M S; Castle, S J

    2007-01-01T23:59:59.000Z

    ment. The honey–water treatment produced the longest averagespecies were produced on the honey–water treatment wherewater only treatment (Table 1). Coccus hesperidum honeydew produced

  5. A study of physical and chemical fruit qualities of O?p?u?n?t?i?a? s?p?p?.?

    E-Print Network [OSTI]

    Stalling, Max Brown

    1991-01-01T23:59:59.000Z

    and vegetative pads are a food commodity in many cultures including Sicilian, South African, Egyptian, Latin American and certain segments of the United States population. The fruit can be eaten as a dessert fruit or used in processed products; while some... following spine removal. The moisture filled pads Documentation follows Journal of Food Science. provide a source of water and nutrients. The prickly pear has been called "nature's fodder bank and silo" and "the camel of the plant world" (Brutsch, 1984...

  6. 86 S. Afr. J. Bot. 1996,62(2); 86-88 Sphaeropsis sapinea and Botryosphaeria dothidea endophytic in Pinus spp. and

    E-Print Network [OSTI]

    86 S. Afr. J. Bot. 1996,62(2); 86-88 Sphaeropsis sapinea and Botryosphaeria dothidea endophytic these fungi as symptomless endophytes in healthy pine and eucalypt tissue was demonstrated. $phaeropsis in stressed or damaged trees might therefore be explained by their endophytic habit. *To whom correspondence

  7. Biological and Ecological Aspects of Field Released Fire Ant Decapitating Flies Pseudacteon spp. (Diptera: Phoridae), Parasitoids of Red Imported Fire Ants Solenopsis invicta Buren (Hymenoptera: Formicidae)

    E-Print Network [OSTI]

    Puckett, Robert T.

    2010-01-14T23:59:59.000Z

    Multiple Pseudacteon phorid fly species, including P. tricuspis and P. curvatus, have been released in the southern United States beginning in 1997 and 2003 (respectively) to serve as biological control agents against red imported fire ants...

  8. The Interaction of Propanil+Thiobencarb with Imazethapyr and Imazamox for Enhanced Red Rice (Oryza spp.) Control in Imidazolinone-Tolerant Rice (Oryza sativa L.)

    E-Print Network [OSTI]

    Jones, Trevor Nelson

    2014-04-28T23:59:59.000Z

    on imidazolinone-tolerant crops. BASF Corporation. 26 2 Newpath, Clearpath, Beyond. Imidazolinone herbicides utilized in Clearfield Production Systems. BASF Corporation. 26 Davis Drive, Research Triangle Park, NC 27709. 5 5-ethyl-3-pyridinecarboxylic... part of BASF’s Clearfield production system. The imidazolinone family’s mode of action is acetolactate synthase inhibition (ALS) (Senseman, 2007). Newpath provides excellent control of many grasses and is therefore an effective tool in the control...

  9. The effect of intraspecific competition on progeny sex ratio in Gonatocerus spp. for Homalodisca coagulata egg masses: Economic implications for mass rearing and biological control

    E-Print Network [OSTI]

    Irvin, Nicola A; Hoddle, M S

    2006-01-01T23:59:59.000Z

    Homalodisca coagulata (Hemiptera: Cicadellidae) in Florida.Oncometopia orbona (Fabricius) (Hemiptera: Clypeorrhyncha:of Homalodisca coagulata (Hemiptera: Cicadellidae) egg ages

  10. The effect of resource provisioning and sugar composition of foods on longevity of three Gonatocerus spp., egg parasitoids of Homalodisca vitripennis

    E-Print Network [OSTI]

    Irvin, Nicola A; Hoddle, M S; Castle, S J

    2007-01-01T23:59:59.000Z

    Homalodisca vitripen- nis (Say) (Hemiptera: Clypeorrhyncha:sharp- shooter (Hemiptera: Cicadellidae: Cicadellinae). Ann.citri (Ashmead) (Hemiptera: Aleyrodidae) honeydew compared

  11. Phase-Trafficking Methods in Natural Products, Modulators of Organic Anion Transporting Polypeptides from Rollinia emarginata, and Pregnane and Cardiac Glycosides from Asclepias spp.

    E-Print Network [OSTI]

    Araya Barrantes, Juan Jose

    2012-05-31T23:59:59.000Z

    .............................................................................................................. 1 1.1. Relevance of natural products in medicinal chemistry ............................................... 2 1.2. Natural products-based drug discovery ....................................................................... 5 1.2.1. Biomass... workflow Explora?on Lead Selec?on Lead Op?miza?on Preclinical development Clinical phases 6 1.2.1. Biomass procurement: selection, collection, and identification The first step in any natural products-based drug...

  12. Some Fungi and Water Molds in Waters of Lake Michigan with Emphasis on Those Associated with the Benthic Amphipod Diporeia spp.

    E-Print Network [OSTI]

    from Lake Michigan water. When dead Diporeia and other organic sub- strates (snake skin and hemp seeds

  13. Plasmon Enhanced Photoemission

    E-Print Network [OSTI]

    Polyakov, Aleksandr

    2013-01-01T23:59:59.000Z

    56 SPP Surface Plasmon7 SPR Surface Plasmon Resonance . . . . . .Quantum Efficiency . . . 1.3 Plasmon Enhancement . . . . .

  14. OCEAN THERMAL ENERGY CONVERSION (OTEC) PROGRAMMATIC ENVIRONMENTAL ANALYSIS

    E-Print Network [OSTI]

    Sands, M. D.

    2011-01-01T23:59:59.000Z

    skipjack tuna, Katsuwonnus pelamis, in an offshore area oflittle tuna), Katsuwonus pelamis (skipj ack), spp. ,

  15. The effects of washing upon the bacterial flora of the stallion prepuce

    E-Print Network [OSTI]

    Tobin, Nancy Batterton

    1983-01-01T23:59:59.000Z

    ~soasarg s ( pfg t*d) ~v ~~t Pseudomonas spp. ~tpy pp. ( g 1 s p ltl ) ~tpy ?pp. ( gl s gtl ) Streptococcus e uisimilis ~tr*pt* oc s spp. non ta h olytlc) ~St p ?pp. (gt h lytl) ( tld ttflhl) St pt ? ~ale 5 ~py * *pg. * API identification system... pp. tttaspp. Klebsiella pneumoniae g ? ?s spp. Proteus snconstans Proteus mi rabi li s l)roteus spp. Proteus vulgaris p d ~* ~ooas * g a( aplgm td) ~p* as ~top Pseudomonas spp. ~p y ? spp, ( q l s* p*sltlv*) ~st py o*?spp. ( aq las gtl...

  16. SF-424 A Budget Information - Non Construction Programs

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page onYouTube YouTube Note: Since the.pdfBreakingMay 2015 <Department of iiBiodiesel | Department ofSERC1 OMB Control

  17. Property:EIA/861/NercWecc | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov YouKizildere I Geothermal PwerPerkins County, Nebraska:PrecourtOid Jump to: navigation,AltFuelVehicle2 JumpNercSerc

  18. Property:Email | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov YouKizildere I Geothermal PwerPerkins County, Nebraska:PrecourtOid Jump to: navigation,AltFuelVehicle2 JumpNercSercProperty

  19. A radio-tracking study of home range, movements, and habitat uses of the fox squirrel (Sciurus niger) in East Texas

    E-Print Network [OSTI]

    Geeslin, Herbert Glyn

    1970-01-01T23:59:59.000Z

    - briar (Smilax bona-nox), hawthorn (Crataegus spp. ), and increased amounts of hollies (Ilex spp. ). This are- was rather low ly. ng and contained two temporary drainage streams. Standing water existed for 1 or 2 days following moderate to heavy...

  20. Order MACROSCELIDEA Nmb.r of digits on Lr.f.otll'indto.l

    E-Print Network [OSTI]

    J?.h.t,o, spp.), suLeaudalgland, po\\t anal glanl (AlIdDg!, spp. onlr), r(lal glaNl and scba.cou\\ glands

  1. Spectral dependence of the magnetic modulation of surface plasmon polaritons in noble/ferromagnetic/noble metal films

    E-Print Network [OSTI]

    Temnov, Vasily V.

    The magnetic field is an interesting candidate for the development of active plasmonic devices as it is able to modify the surface plasmon polariton (SPP) wave vector. Both real and imaginary parts of the SPP wave vector ...

  2. Statewide Evaluation of Trace Element Accumulation from Long-Term Disposal of Wastewater

    E-Print Network [OSTI]

    Olson, Betty H; Hill, Deborah C; Rigby, Martin G

    1983-01-01T23:59:59.000Z

    parvi fi ora L. Raphanus sativus L. Bromus spp. Cynodon41 (continued) Cd Raphanus sativus L. Beta vulgaris CapsellaThe Medicago spp. and Raphanus sativus, L. collected from

  3. Bacterial and fungal organisms in the vagina of normal cows and cows with vaginitis

    E-Print Network [OSTI]

    Husted, James Ross

    2005-02-17T23:59:59.000Z

    frequent aerobic isolates included Acinetobacter lwoffii, Arcanobacterium pyogenes, Escherichia coli, Corynebacterium spp., and Streptococcus spp. These organisms were isolated from both groups of cows, but more frequently from the vaginitis group...

  4. Local Field Topology behind Light Localization and Metamaterial Topological Transitions

    E-Print Network [OSTI]

    Tong, Jonathan K.

    We revisit the mechanisms governing the sub-wavelength spatial localization of light in surface plasmon polariton (SPP) modes by investigating both local and global features in optical powerflow at SPP frequencies. Close ...

  5. The Cost of Transmission for Wind Energy: A Review of Transmission Planning Studies

    E-Print Network [OSTI]

    Mills, Andrew D.

    2009-01-01T23:59:59.000Z

    Cb2 SCE - ISM - I SCE - IR ERCOT - TOS - 4 ERCOT - P4 SCE-LA/Kern SPP - EHV ERCOT - TOS - 3 RMATS - 2 SCE - ISM - EDM2020H Tehachapi ERCOT - TOS - 2 EPTP - 1 SPP - OK - 2020N

  6. Summary Xylem vulnerability to cavitation is a promising criterion for identifying trees with high drought tolerance, but

    E-Print Network [OSTI]

    Mencuccini, Maurizio

    Summary Xylem vulnerability to cavitation is a promising criterion for identifying trees with high drought tolerance, but traditional techniques for measuring cavitation resistance are unsuitablefor throughput screening of cavitation resistance in five poplar (Populus spp.) andfour willow (Salix spp

  7. Supplement 15, Parasite-Subject Catalogue, Subject Headings, Treatment

    E-Print Network [OSTI]

    Humphrey, Judith M.; Segal, Dorothy B.; Beard, Mary I.; Edwards, Shirley J.; Kirby, Margie D.

    1966-01-01T23:59:59.000Z

    of roundworms of cattle in Wyoming Anemia Foote, L. E.; Hansard, S. L.; anaplasmosis and Parker, J., I962 a Anemia Foy, H.; and Nelson, G. S., etiology in tropics 19?? a ? helminths Anaemia, Human Heinivaara, 0.; and Kaipainen, bone marrow studies in W. J... contortus; Trichostrongylus colubriformis; T. spp.; T. axei; Oesophagostomum radiatum; Fasciola hep- ?tica; Hypoderma spp.; ?stertagia spp.; 0. venulosum; Chabertia ovina; Amblyomma triguttatum; Nematodirus spp.; A. queenslandensis; A. ornatissimum; A...

  8. Vineyard managers and researchers seek sustainable solutions for mealybugs, a changing pest complex

    E-Print Network [OSTI]

    2008-01-01T23:59:59.000Z

    genus Ferrisia Fullaway (Hemiptera: Pseudococcidae) from theto control Planococcus ficus (Hemiptera: Pseudococcidae) inof Planococcus spp. (Hemiptera: Pseudo- coccidae), with

  9. Bacteria recovered from endometritis and pyometra in the beef cow

    E-Print Network [OSTI]

    Mikulec, Rashel Thi

    1999-01-01T23:59:59.000Z

    at establishing the normal flora of the uterus, and a variety of opinions are expressed regarding the sterility of the uterine environment. Wall, in 1915, isolated Arcanobacterium pyogenes (formerly referred to as Acti nomyces pyogenes and Corynebacterium..., They found that moderate endometritis was associated with populations of Corynebacterium spp, Staphylococcus spp, Escherichia coli, and Streptococcus spp, whereas the presence of Corynebacteri um spp (particularly C. pyogenes, now referred...

  10. Historical Logbook Databases from California's Commercial Passenger Fishing Vessel (Partyboat) Fishery, 1936-1997

    E-Print Network [OSTI]

    Hill, Kevin T.; Schneider, Niklas

    1999-01-01T23:59:59.000Z

    Tuna, longtail Katsuwonus pelamis Tuna, skipjack Euthynnusthresher Katsuwonus pelamis Tuna, skipjack Leptocottusmarmoratus Katsuwonus pelamis Citharichthys spp. Sebastes

  11. Wetland Plant Influence on Sediment Ecosystem Structure and Trophic Function

    E-Print Network [OSTI]

    Whitcraft, Christine R.

    2007-01-01T23:59:59.000Z

    energy and structure Spartina foJiosa, Sarcocornia pacifica (aka Saäcorma wgmręa) Tamarix spp 7 / » X microalgae

  12. Published by ORNL's Energy Efficiency and Renewable Energy Program (www.ornl.gov/Energy_Eff) November 1998 ORNL Reaches Out to State Energy AgenciesORNL Reaches Out to State Energy AgenciesORNL Reaches Out to State Energy AgenciesORNL Reaches Out to State

    E-Print Network [OSTI]

    Pennycook, Steve

    Published by ORNL's Energy Efficiency and Renewable Energy Program (www.ornl.gov/Energy. By Kathi Vaughan, 423-241-4292, vhk@ornl.gov SPP Projects Cross All Energy Efficiency/Renewable Energy SectorsSPP Projects Cross All Energy Efficiency/Renewable Energy SectorsSPP Projects Cross All Energy

  13. Resident Fish Stock Status above Chief Joseph and Grand Coulee Dams; 2002-2003 Annual Report.

    SciTech Connect (OSTI)

    Connor, Jason M. (Kalispel Tribe of Indians, Usk, WA); McLellan, Jason G. (Washington Department of Fish and Wildlife); Butler, Chris (Spokane Tribe of Indians, Wellpinit, WA)

    2006-02-01T23:59:59.000Z

    In 1980, the United States Congress enacted the Northwest Power Planning and Conservation Act (PL 96-501, 1980), which established the Northwest Power and Conservation Council (NPCC), formerly the Northwest Power Planning Council. The NPCC was directed by Congress to develop a regional Power Plan and also the Columbia River Basin Fish and Wildlife Program (FWP) to restore or replace losses of fish caused by construction and operation of hydroelectric dams in the Columbia River Basin. In developing the FWP, Congress specifically directed NPCC to solicit recommendations for measures to be included in the Program from the region's fish and wildlife agencies and Indian tribes. All measures adopted by the Council were also required to be consistent with the management objectives of the agencies and tribes [Section 4.(h)(6)(A)], the legal rights of Indian tribes in the region [Section 4.(h)(6)(D)] and be based upon and supported by the best available scientific knowledge [Section 4.(h)(6)(B)]. The Resident Fish Stock Status above Chief Joseph and Grand Coulee Dams Project, also known as the Joint Stock Assessment Project (JSAP) specifically addresses NPPC Council measure 10.8B.26 of the 1994 program. The Joint Stock Assessment Project is a management tool using ecosystem principles to manage artificial and native fish assemblages in altered environments existing in the Columbia River System above Chief Joseph and Grand Coulee Dams (Blocked Area). A three-phase approach of this project will enhance the fisheries resources of the Blocked Area by identifying data gaps, filling data gaps with research, and implementing management recommendations based on research results. The Blocked Area fisheries information is housed in a central location, allowing managers to view the entire system while making decisions, rather than basing management decisions on isolated portions of the system. The JSAP is designed and guided jointly by fisheries managers in the Blocked Area. The initial year of the project (1997) identified the need for a central data storage and analysis facility, coordination with the StreamNet project, compilation of Blocked Area fisheries information, and a report on the ecological condition of the Spokane River System. These needs were addressed in 1998 by acquiring a central location with a data storage and analysis system, coordinating a pilot project with StreamNet, compiling fisheries distribution data throughout the Blocked Area, identifying data gaps based on compiled information, and researching the ecological condition of the Spokane River. In order to ensure that any additional information collected throughout the life of this project will be easily stored and manipulated by the central storage facility, it was necessary to develop standardized methodologies between the JSAP fisheries managers. Common collection and analytical methodologies were developed in 1999. The project began addressing identified data gaps throughout the Blocked Area in 1999. Data collection of established projects and a variety of newly developed sampling projects are ongoing. Projects developed and undertaken by JSAP fisheries managers include investigations of the Pend Orielle River and its tributaries, the Little Spokane River and its tributaries, and water bodies within and near the Spokane Indian Reservation. Migration patterns of adfluvial and reservoir fish in Box Canyon Reservoir and its tributaries, a baseline assessment of Boundary Reservoir and its tributaries, ecological assessment of mountain lakes in Pend Oreille County, and assessments of streams and lakes on the Spokane Indian Reservation were completed by 2001. Assessments of the Little Spokane River and its tributaries, Spokane River below Spokane Falls, tributaries to the Pend Oreille River, small lakes in Pend Oreille County, WA, and water bodies within and near the Spokane Indian Reservation were conducted in 2002 and 2003. This work was done in accordance with the scope of work approved by Bonneville Power Administration (BPA).

  14. Resident Fish Stock above Chief Joseph and Grand Coulee Dams; 2003-2004 Annual Report.

    SciTech Connect (OSTI)

    Connor, Jason M. (Kalispel Tribe of Indians, Usk, WA); McLellan, Jason G. (Washington Department of Fish and Wildlife, Olympia, WA); Butler, Chris (Spokane Tribe of Indians, Wellpinit, WA)

    2005-11-01T23:59:59.000Z

    In 1980, the United States Congress enacted the Northwest Power Planning and Conservation Act (PL 96-501, 1980), which established the Northwest Power and Conservation Council (NPCC), formerly the Northwest Power Planning Council. The NPCC was directed by Congress to develop a regional Power Plan and also the Columbia River Basin Fish and Wildlife Program (FWP) to restore or replace losses of fish caused by construction and operation of hydroelectric dams in the Columbia River Basin. In developing the FWP, Congress specifically directed NPCC to solicit recommendations for measures to be included in the Program from the region's fish and wildlife agencies and Indian tribes. All measures adopted by the Council were also required to be consistent with the management objectives of the agencies and tribes [Section 4.(h)(6)(A)], the legal rights of Indian tribes in the region [Section 4.(h)(6)(D)] and be based upon and supported by the best available scientific knowledge [Section 4.(h)(6)(B)]. The Resident Fish Stock Status above Chief Joseph and Grand Coulee Dams Project, also known as the Joint Stock Assessment Project (JSAP) specifically addresses NPPC Council measure 10.8B.26 of the 1994 program. The Joint Stock Assessment Project is a management tool using ecosystem principles to manage artificial and native fish assemblages in altered environments existing in the Columbia River System above Chief Joseph and Grand Coulee Dams (Blocked Area). A three-phase approach of this project will enhance the fisheries resources of the Blocked Area by identifying data gaps, filling data gaps with research, and implementing management recommendations based on research results. The Blocked Area fisheries information is housed in a central location, allowing managers to view the entire system while making decisions, rather than basing management decisions on isolated portions of the system. The JSAP is designed and guided jointly by fisheries managers in the Blocked Area. The initial year of the project (1997) identified the need for a central data storage and analysis facility, coordination with the StreamNet project, compilation of Blocked Area fisheries information, and a report on the ecological condition of the Spokane River System. These needs were addressed in 1998 by acquiring a central location with a data storage and analysis system, coordinating a pilot project with StreamNet, compiling fisheries distribution data throughout the Blocked Area, identifying data gaps based on compiled information, and researching the ecological condition of the Spokane River. In order to ensure that any additional information collected throughout the life of this project will be easily stored and manipulated by the central storage facility, it was necessary to develop standardized methodologies between the JSAP fisheries managers. Common collection and analytical methodologies were developed in 1999. The project began addressing identified data gaps throughout the Blocked Area in 1999. Data collection of established projects and a variety of newly developed sampling projects are ongoing. Projects developed and undertaken by JSAP fisheries managers include investigations of the Pend Orielle River and its tributaries, the Little Spokane River and its tributaries, and water bodies within and near the Spokane Indian Reservation. Migration patterns of adfluvial and reservoir fish in Box Canyon Reservoir and its tributaries, a baseline assessment of Boundary Reservoir and its tributaries, ecological assessment of mountain lakes in Pend Oreille County, and assessments of streams and lakes on the Spokane Indian Reservation were completed by 2001. Assessments of the Little Spokane River and its tributaries, Spokane River below Spokane Falls, tributaries to the Pend Oreille River, small lakes in Pend Oreille County, WA, and water bodies within and near the Spokane Indian Reservation were conducted in 2002 and 2003. This work was done in accordance with the scope of work approved by Bonneville Power Administration (BPA).

  15. Resident Fish Stock above Chief Joseph and Grand Coulee Dams; 2002 Annual Report.

    SciTech Connect (OSTI)

    Connor, Jason M. (Kalispel Department of Natural Resources, Usk, WA); McLellan, Jason G. (Washington Department of Fish and Wildlife, Spokane, WA); Butler, Chris (Spokane Tribe of Indians, Department of Natural Resources, Wellpinit, WA)

    2003-09-01T23:59:59.000Z

    In 1980, the United States Congress enacted the Northwest Power Planning and Conservation Act (PL 96-501, 1980), which established the Northwest Power and Conservation Council (NPCC), formerly the Northwest Power Planning Council. The NPCC was directed by Congress to develop a regional Power Plan and also the Columbia River Basin Fish and Wildlife Program (FWP) to restore or replace losses of fish caused by construction and operation of hydroelectric dams in the Columbia River Basin. In developing the FWP, Congress specifically directed NPCC to solicit recommendations for measures to be included in the Program from the region's fish and wildlife agencies and Indian tribes. All measures adopted by the Council were also required to be consistent with the management objectives of the agencies and tribes [Section 4.(h)(6)(A)], the legal rights of Indian tribes in the region [Section 4.(h)(6)(D)] and be based upon and supported by the best available scientific knowledge [Section 4.(h)(6)(B)]. The Resident Fish Stock Status above Chief Joseph and Grand Coulee Dams Project, also known as the Joint Stock Assessment Project (JSAP) specifically addresses NPPC Council measure 10.8B.26 of the 1994 program. The Joint Stock Assessment Project is a management tool using ecosystem principles to manage artificial fish assemblages and native fish in altered environments existing in the Columbia River System above Chief Joseph and Grand Coulee Dams (Blocked Area). A three-phase approach of this project will enhance the fisheries resources of the Blocked Area by identifying data gaps, filling data gaps with research, and implementing management recommendations based on research results. The Blocked Area fisheries information is housed in a central location, allowing managers to view the entire system while making decisions, rather than basing management decisions on isolated portions of the system. The JSAP is designed and guided jointly by fisheries managers in the Blocked Area. The initial year of the project (1997) identified the need for a central data storage and analysis facility, coordination with the StreamNet project, compilation of Blocked Area fisheries information, and a report on the ecological condition of the Spokane River System. These needs were addressed in 1998 by acquiring a central location with a data storage and analysis system, coordinating a pilot project with StreamNet, compiling fisheries distribution data throughout the Blocked Area, identifying data gaps based on compiled information, and researching the ecological condition of the Spokane River. In order to ensure that any additional information collected throughout the life of this project will be easily stored and manipulated by the central storage facility, it was necessary to develop standardized methodologies between the JSAP fisheries managers. Common collection and analytical methodologies were developed in 1999. In 1999, 2000, and 2001 the project began addressing some of the identified data gaps throughout the Blocked Area. Data collection of established projects and a variety of newly developed sampling projects are ongoing. Projects developed and undertaken by JSAP fisheries managers include investigations of the Pend Orielle River and its tributaries, the Little Spokane River and its tributaries, and water bodies within and near the Spokane Indian Reservation. Migration patterns of adfluvial and reservoir fish in Box Canyon Reservoir and its tributaries, a baseline assessment of Boundary Reservoir and its tributaries, ecological assessment of mountain lakes in Pend Oreille County, and assessments of streams and lakes on the Spokane Indian Reservation were completed by 2001. Assessments of the Little Spokane River and its tributaries, tributaries to the Pend Oreille River, small lakes in Pend Oreille County, WA, and water bodies within and near the Spokane Indian Reservation were conducted in 2002. This work was done in accordance with the scope of work approved by Bonneville Power Administration (BPA).

  16. Evaluation of the Biological Effects of the Northwest Power Conservation Council's Mainstem Amendment on the Fisheries Upstream and Downstream of Libby Dam, Montana, 2007-2008 Annual Report.

    SciTech Connect (OSTI)

    Sylvester, Ryan; Stephens, Brian; Tohtz, Joel [Montana Fish, Wildlife & Parks

    2009-04-03T23:59:59.000Z

    A new project began in 2005 to monitor the biological and physical effects of improved operations of Hungry Horse and Libby Dams, Montana, called for by the Northwest Power and Conservation Council (NPCC) Mainstem Amendment. This operating strategy was designed to benefit resident fish impacted by hydropower and flood control operations. Under the new operating guidelines, July through September reservoir drafts will be limited to 10 feet from full pool during the highest 80% of water supply years and 20 feet from full pool during the lowest 20% of water supply (drought) years. Limits were also established on how rapidly discharge from the dams can be increased or decreased depending on the season. The NPCC also directed the federal agencies that operate Libby and Hungry Horse Dams to implement a new flood control strategy (VARQ) and directed Montana Fish, Wildlife & Parks to evaluate biological responses to this operating strategy. The Mainstem Amendment operating strategy has not been fully implemented at the Montana dams as of June 2008 but the strategy will be implemented in 2009. This report highlights the monitoring methods used to monitor the effects of the Mainstem Amendment operations on fishes, habitat, and aquatic invertebrates upstream and downstream of Libby Dam. We also present initial assessments of data and the effects of various operating strategies on physical and biological components of the systems upstream and downstream of Libby Dam. Annual electrofishing surveys in the Kootenai River and selected tributaries, along with gill net surveys in the reservoir, are being used to quantify the impacts of dam operations on fish populations upstream and downstream of Libby Dam. Scales and otoliths are being used to determine the age structure and growth of focal species. Annual population estimates and tagging experiments provide estimates of survival and growth in the mainstem Kootenai River and selected tributaries. Radio telemetry will be used to validate an existing Instream Flow Incremental Methodology (IFIM) model developed for the Kootenai River and will also be used to assess the effect of changes in discharge on fish movements and habitat use downstream of Libby Dam. Passive integrated transponder (PIT) tags will be injected into rainbow, bull, and cutthroat trout throughout the mainstem Kootenai River and selected tributaries to provide information on growth, survival, and migration patterns in relation to abiotic and biotic variables. Model simulations (RIVBIO) are used to calculate the effects of dam operations on the wetted perimeter and benthic biomass in the Kootenai River below Libby Dam. Additional models (IFIM) will also be used to evaluate the impacts of dam operations on the amount of available habitat for different life stages of rainbow and bull trout in the Kootenai River.

  17. Distribution and food habits of the inland silverside, Menidia beryllina, and the northern brook silverside, Labidesthes sicculus, in Lake Conroe, Texas

    E-Print Network [OSTI]

    Morris, Joseph Eugene

    1982-01-01T23:59:59.000Z

    ?LN ~L* ~Nt t tlt N. texanus N. venustus N. lutrensis N. spp. ~Pt h 1 ~ttt . Noturus 8Erinus 1 dl ~h F. notatus F. olivaceus Gambusia affinis ~Le omis ~ulosus L. macrochirus L. ~t L. ~ttt L. ~th L. 1 tt L ~*t L. hybrid L. spp. ~M1.... venustus N. lutrensis N. spp. ~Pt h 1 ~ttt Noturus ~rinus P d 1 ~ht F. notatus F. olivaceus Gambusia affinis ~Le omis ~iosus L. macrochirus L. ~lt L. ~ttt L. ~ML h L. N t t L. ~s msetricus L. hybrid L. spp. ~lf t* t 1 td P*t ~d P. spp...

  18. Human Capacity Building in Energy Efficiency and Renewable Energy System Maintenance for the Yurok Tribe

    SciTech Connect (OSTI)

    Engel, R. A.' Zoellick, J J.

    2007-07-31T23:59:59.000Z

    From July 2005 to July 2007, the Schatz Energy Research Center (SERC) assisted the Yurok Tribe in the implementation of a program designed to build the Tribe’s own capacity to improve energy efficiency and maintain and repair renewable energy systems in Tribal homes on the Yurok Reservation. Funding for this effort was provided by the U.S. Department of Energy’s Tribal Program under First Steps grant award #DE-FG36-05GO15166. The program’s centerpiece was a house-by-house needs assessment, in which Tribal staff visited and conducted energy audits at over fifty homes. The visits included assessment of household energy efficiency and condition of existing renewable energy systems. Staff also provided energy education to residents, evaluated potential sites for new household renewable energy systems, and performed minor repairs as needed on renewable energy systems.

  19. Mitigation for the Construction and Operation of Libby Dam, 2004-2005 Annual Report.

    SciTech Connect (OSTI)

    Dunnigan, James; DeShazer, Jay; Garrow, Larry (Montana Department of Fish, Wildlife and Parks, Libby, MT)

    2005-06-01T23:59:59.000Z

    ''Mitigation for the Construction and Operation of Libby Dam'' is part of the Northwest Power and Conservation Council's (NPCC) resident fish and wildlife program. The program was mandated by the Northwest Planning Act of 1980, and is responsible for mitigating damages to fish and wildlife caused by hydroelectric development in the Columbia River Basin. The objective of Phase I of the project (1983 through 1987) was to maintain or enhance the Libby Reservoir fishery by quantifying seasonal water levels and developing ecologically sound operational guidelines. The objective of Phase II of the project (1988 through 1996) was to determine the biological effects of reservoir operations combined with biotic changes associated with an aging reservoir. The objectives of Phase III of the project (1996 through present) are to implement habitat enhancement measures to mitigate for dam effects, to provide data for implementation of operational strategies that benefit resident fish, monitor reservoir and river conditions, and monitor mitigation projects for effectiveness. This project completes urgent and high priority mitigation actions as directed by the Kootenai Subbasin Plan. Montana Fish, Wildlife & Parks (MFWP) uses a combination of techniques to collect physical and biological data within the Kootenai River Basin. These data serve several purposes including: the development and refinement of models used in management of water resources and operation of Libby Dam; investigations into the limiting factors of native fish populations, gathering basic life history information, tracking trends in endangered and threatened species, and the assessment of restoration or management activities designed to restore native fishes and their habitats.

  20. atlantic region including: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    (Morchella spp.) are prized wild 18 Probabilistic Projections of Anthropogenic Climate Change Impacts on Precipitation for the Mid-Atlantic Region of the United States* Geosciences...

  1. atlantic rainforest region: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    (Morchella spp.) are prized wild 19 Probabilistic Projections of Anthropogenic Climate Change Impacts on Precipitation for the Mid-Atlantic Region of the United States* Geosciences...

  2. Quantization of surface plasmon polariton by Green's tensor method in amplifying and attenuating media

    E-Print Network [OSTI]

    Z. Allameh; R. Roknizadeh; R. Masoudi

    2015-05-04T23:59:59.000Z

    In this paper we will present a quantization method for SPP (Surface Plasmon Polariton) based on Green's tensor method, which is applied usually for quantization of EM-field in various dielectric media. This method will be applied for a semi-infinite structure, which contains metal and dielectric regions with one interface. Moreover, by introducing the quantized SPP, we will investigate the SPP propagation in the attenuating and amplifying systems. We will also consider two modes of SPP, i.e., coherent and squeezed states, and finally compare the propagation of these modes in the amplifying media.

  3. Evolution of shell loss in Opisthobranch gastropods: sea hares (Opisthobranchia, Anaspidea) as a model system

    E-Print Network [OSTI]

    Vue, Zer

    2009-01-01T23:59:59.000Z

    in Seventeenth Slovenian-Croatian Crystallographic Meeting.spp. in Sixteenth Croatian-Slovenian CrystallographicMeeting. . 2007. Croatian Academy of Sciences and Arts,

  4. adapted swimming pool reactor austria: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Summary: participation in wholesale energy markets; and sponsored abe indexed to wholesale energy market prices (i.e. eitherWholesale Markets in the Southwest Power Pool SPP...

  5. area southwest wyoming: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    to wholesale energy market prices (i.e. eitherWholesale Markets in the Southwest Power Pool SPP administers an Energy Imbalance Service (EIS) market; Bharvirkar, Ranjit...

  6. Phylum Arthropoda Phylum Arthropoda

    E-Print Network [OSTI]

    Wagner, Diane

    ;6 Spermatophore Life in the undergrowth Orders No. described spp. 1. Aranae ~37,000 2. Acari ~45,200 (~500,000 new

  7. Retail Demand Response in Southwest Power Pool

    E-Print Network [OSTI]

    Bharvirkar, Ranjit

    2009-01-01T23:59:59.000Z

    23 ii Retail Demand Response in SPP List of Figures and10 Figure 3. Demand Response Resources by11 Figure 4. Existing Demand Response Resources by Type of

  8. Traditional and Host-Associated Fecal Indicator Bacterial Patterns in Southern California Watersheds: Field Source Identification Studies and Laboratory Microcosms Investigating Presence and Persistence in Water and Sediments

    E-Print Network [OSTI]

    Mika, Kathryn

    2012-01-01T23:59:59.000Z

    the survival of Escherichia coli in marine waters. Applied &marine water quality standards for Escherichia coli and / orEscherichia coli and Enterococcus spp. in freshwater and marine

  9. atoll national wildlife: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of Refuge flora. Aggressive species such as narrow-leaved cattail (Typha angustifolia), common reed (Phragmites australis), and willow (Salix spp.), all prevalent on the Refuge,...

  10. arctic national wildlife: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of Refuge flora. Aggressive species such as narrow-leaved cattail (Typha angustifolia), common reed (Phragmites australis), and willow (Salix spp.), all prevalent on the Refuge,...

  11. assessing national remote: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of Refuge flora. Aggressive species such as narrow-leaved cattail (Typha angustifolia), common reed (Phragmites australis), and willow (Salix spp.), all prevalent on the Refuge,...

  12. auklet ptychoramphus aleuticus: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    to nestlings in order 9 Demography of auklets Aethia spp. in relation to introduced Norway rats Rattus norvegicus at Kiska Environmental Sciences and Ecology Websites Summary:...

  13. Southwestern Power Administration Update, October- December 2004

    SciTech Connect (OSTI)

    none,

    2004-12-01T23:59:59.000Z

    On October 29, 2004, Southwestern and Southwest Power Pool, Inc. (SPP) reached agreement on interim arrangements to be implemented after the October 31, 2004, expiration of the membership agreement between the two parties. According to Jim McDonald, Director of Southwestern’s Division of Customer Service, the interim agreement forged between Southwestern and SPP seeks to minimize impacts to SPP as well as to Southwestern and its customers while Southwestern and SPP work on a seams/coordination agreement to succeed the expired membership agreement.

  14. Report of the Secretary of Energy Task Force on DOE National...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Board SNL Sandia National Laboratories SPP Strategic Partnership Projects SRNL Savannah River National Laboratory TF Task Force TJNAF Thomas Jefferson National Accelerator...

  15. Ecological Applications, 18(3), 2008, pp. 681700 2008 by the Ecological Society of America

    E-Print Network [OSTI]

    . To determine the consequences of avian predation, we used a bioenergetics approach to estimate the consumption; bioenergetics modeling; Columbia River; dams; larids; mergansers; northern pikeminnow; Oncorhynchus spp

  16. Systematics and Ethnobotany of Salvia Subgenus Calosphace and Origins of the Hallucinogenic Sage, Salvia divinorum

    E-Print Network [OSTI]

    Jenks, Aaron Allon

    2008-01-01T23:59:59.000Z

    endemic to the island of Hispaniola (10 spp), for which weupon the islands of Hispaniola (Haiti and the Dominicanendemic to the island of Hispaniola. Staminal Evolution in

  17. CONTACT: Randy Wilkerson, 720-962-7050, PublicAffairs@wapa.gov

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    approval is contingent upon Federal Energy Regulatory Commission approval of the SPP tariff changes without significant modification to the negotiated provisions that allow...

  18. Distribution, abundance and persistence of species of Orasema (Hym: Eucharitidae) parasitic on fire ants in South America

    E-Print Network [OSTI]

    Varone, L.; Heraty, J.M.; Calcaterra, L.A.

    2010-01-01T23:59:59.000Z

    sp. Cnia. Hughes C. del Uruguay S. quinquecuspis Buenossites with Orasema spp. in Bolivia, Paraguay and Uruguay.Trinidad Paraguay Asuncion Uruguay Atlantida Paysandu

  19. aquatic plant biomass: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    (ani- mal fodder, conservation tillage systems on erodible soils, as well as green manure Petanidou, Theodora 418 Conversion Factors for Dreissena spp. Biomass. Open Access...

  20. Graphene-Based Surface Plasmon-Polaritons for Terahertz Applications

    E-Print Network [OSTI]

    Gu, Xuefeng

    2013-01-01T23:59:59.000Z

    efficient excitation of graphene-metal SPP mode using narrowwith the advancement of graphene fabrication technology, ourOF CALIFORNIA Los Angeles Graphene-Based Surface Plasmon-

  1. Distribution and Invasion Potential of Limonium ramosissimum subsp. provinciale in San Francisco Estuary Salt Marshes

    E-Print Network [OSTI]

    Archbald, Gavin; Boyer, Katharyn E.

    2014-01-01T23:59:59.000Z

    on identification of Limonium spp. in the Carpinteria SaltMarsh Reserve (Carpinteria, CA). Traut BH. 2005. The role ofclimate estuarine wetland at Carpinteria, California: plant

  2. Solar Energy Research Center Instrumentation Facility

    SciTech Connect (OSTI)

    Meyer, Thomas, J.; Papanikolas, John, P.

    2011-11-11T23:59:59.000Z

    SOLAR ENERGY RESEARCH CENTER INSTRUMENTATION FACILITY The mission of the Solar Energy Research Center (UNC SERC) at the University of North Carolina at Chapel Hill (UNC-CH) is to establish a world leading effort in solar fuels research and to develop the materials and methods needed to fabricate the next generation of solar energy devices. We are addressing the fundamental issues that will drive new strategies for solar energy conversion and the engineering challenges that must be met in order to convert discoveries made in the laboratory into commercially available devices. The development of a photoelectrosynthesis cell (PEC) for solar fuels production faces daunting requirements: (1) Absorb a large fraction of sunlight; (2) Carry out artificial photosynthesis which involves multiple complex reaction steps; (3) Avoid competitive and deleterious side and reverse reactions; (4) Perform 13 million catalytic cycles per year with minimal degradation; (5) Use non-toxic materials; (6) Cost-effectiveness. PEC efficiency is directly determined by the kinetics of each reaction step. The UNC SERC is addressing this challenge by taking a broad interdisciplinary approach in a highly collaborative setting, drawing on expertise across a broad range of disciplines in chemistry, physics and materials science. By taking a systematic approach toward a fundamental understanding of the mechanism of each step, we will be able to gain unique insight and optimize PEC design. Access to cutting-edge spectroscopic tools is critical to this research effort. We have built professionally-staffed facilities equipped with the state-of the-art instrumentation funded by this award. The combination of staff, facilities, and instrumentation specifically tailored for solar fuels research establishes the UNC Solar Energy Research Center Instrumentation Facility as a unique, world-class capability. This congressionally directed project funded the development of two user facilities: TASK 1: SOLAR DEVICE FABRICATION LABORATORY DEVELOPMENT The space allocated for this laboratory was �¢����shell space�¢��� that required an upfit in order to accommodate nano-fabrication equipment in a quasi-clean room environment. This construction project (cost $279,736) met the non-federal cost share requirement of $250,000 for this award. The central element of the fabrication laboratory is a new $400,000+ stand-alone system, funded by other sources, for fabricating and characterizing photovoltaic devices, in a state-of-the-art nanofabrication environment. This congressionally directed project also included the purchase of an energy dispersive x-ray analysis (EDX) detector for a pre-existing transmission electron microscope (TEM). This detector allows elemental analysis and elemental mapping of materials used to fabricate solar energy devices which is a key priority for our research center. TASK 2: SOLAR ENERGY SPECTROSCOPY LABORATORY DEVELOPMENT (INSTRUMENTATION) This laboratory provides access to modern spectroscopy and photolysis instrumentation for characterizing devices, materials and components on time scales ranging from femtoseconds to seconds and for elucidating mechanisms. The goals of this congressionally directed project included the purchase and installation of spectroscopy and photolysis instrumentation that would substantially and meaningfully enhance the capabilities of this laboratory. Some changes were made to the list of equipment proposed in the original budget. These changes did not represent a change in scope, approach or aims of this project. All of the capabilities and experiments represented in the original budget were maintained. The outcome of this Congressionally Directed Project has been the development of world-class fabrication and spectroscopy user facilities for solar fuels research at UNC-CH. This award has provided a significant augmentation of our pre-existing instrumentation capabilities which were funded by earlier UNC SERC projects, including the Energy Frontier

  3. Spinorbit coupling and luminescence characteristics of conjugated organic molecules. I. Polyacenes

    E-Print Network [OSTI]

    Abstract Spin±orbit coupling (SOC) of the ground and ppp , spp , psp , ssp singlet and triplet excited be neglected in the ppp excitations. The rate constants of radiative decay of Żuorescent and phosphorescent.V. Prezhdo). #12;between singlet and triplet states of various orbital origins, including ppp and spp , ppp

  4. www.ext.vt.edu Produced by Communications and Marketing, College of Agriculture and Life Sciences,

    E-Print Network [OSTI]

    Liskiewicz, Maciej

    which are similar in description and life cycle. While small numbers of these organisms on a fish gen and ultimately, death of fish. Small fish and fry are espe- cially susceptible, and mortality can occur quickly if undiagnosed. How does Trichodina spp. affect the fish? Trichodina spp. cause irritation by feeding on the epi

  5. 648 www.newphytologist.org Blackwell Publishing Ltd

    E-Print Network [OSTI]

    Snow, Allison A.

    -generation (F3) radish hybrids (Raphanus raphanistrum × Raphanus sativus) and weedy R. raphanistrum and increases the relative fecundity of crop­wild radish hybrids (Raphanus spp.) Lesley G. Campbell and Allison populations, hybridization, life-history trade-offs, path analysis, Raphanus spp., response surface

  6. LJournal of Experimental Marine Biology and Ecology, 240 (1999) 161178

    E-Print Network [OSTI]

    Scheibling, Robert Eric

    21 ration of kelp (Laminaria spp., 6 days week ) supplemented with mussel flesh (Mytilus spp., 1 21 21 day week ) (KM), or a low ration of kelp (1 day week ) (KL). Larvae were fed either a high 21 21 (such as kelp beds) may metamorph- ose sooner than those of adults from nutritionally poor habitats

  7. The Cost of Transmission for Wind Energy in the United States: A Review of Transmission Planning Studies.

    E-Print Network [OSTI]

    Wiser, Ryan

    2014-01-01T23:59:59.000Z

    kV JCSP 765 kV and 800 kV HVDC Southern California Edison (2 345 kV ERCOT - TOS - 3 345 kV and HVDC ERCOT - TOS - 4345 kV and HVDC Southwest Power Pool (SPP) SPP - 2 345 kV

  8. Establishment phase greenhouse gas emissions in short rotation woody biomass plantations

    E-Print Network [OSTI]

    Turner, Monica G.

    to short-rotation woody biomass crops (SRWC) for bioenergy in the Northern U.S. Lake States. GHG debts-rotation woody bio- energy crops (SRWC), specifically hybrid-poplar (Populus spp.) and willow (Salix spp.), being in the Northern Lake States, USA Marin M. Palmer a, *, Jodi A. Forrester a , David E. Rothstein b , David J

  9. A Literature Review, Bibliographic Listing, and Organization of Selected References Relative to Pacific salmon (Oncorhynchus spp.) and Abiotic and Biotic Attributes of the Columbia River Estuary and Adjacent Marine and Riverine Environs for Various Historical Periods : Measure 7.1A of the Northwest Power Planning Council`s 1994 Fish and Wildlife Program : Report 4 of 4, Final Report.

    SciTech Connect (OSTI)

    Costello, Ronald J.

    1996-05-01T23:59:59.000Z

    This report contains the results of a literature review on the carrying capacity of Pacific salmon in the Columbia River Basin. The objective of the review was to find the information gaps relative to the determinants of salmon carrying capacity in the Columbia River Basin. The review was one activity designed to answer questions asked in Measure 7.1A of the Councils Fish and Wildlife Program. Based, in part, on the information learned during the literature review and the other work accomplished during this study the Pacific Northwest National Laboratory (PNNL) state concluded that the approach inherent in 7.1A will not increase understanding of ecology, carrying capacity, or limiting factors that influence salmon under current conditions. To increase understanding of ecology, carring capacity, and limiting factors, it is necessary to deal with the complexity of the sustained performance of salmon in the Columbia River Basin. The PNNL team suggests that the regions evaluated carrying capacity from more than one view point. The PNNL team recommends that the region use the contextualistic view for evaluating capacity.

  10. Tribal Utility Feasibility Study

    SciTech Connect (OSTI)

    Engel, R. A.; Zoellick, J. J.

    2007-06-30T23:59:59.000Z

    The Schatz Energy Research Center (SERC) assisted the Yurok Tribe in investigating the feasibility of creating a permanent energy services program for the Tribe. The original purpose of the DOE grant that funded this project was to determine the feasibility of creating a full-blown Yurok Tribal electric utility to buy and sell electric power and own and maintain all electric power infrastructure on the Reservation. The original project consultant found this opportunity to be infeasible for the Tribe. When SERC took over as project consultant, we took a different approach. We explored opportunities for the Tribe to develop its own renewable energy resources for use on the Reservation and/or off-Reservation sales as a means of generating revenue for the Tribe. We also looked at ways the Tribe can provide energy services to its members and how to fund such efforts. We identified opportunities for the development of renewable energy resources and energy services on the Yurok Reservation that fall into five basic categories: • Demand-side management – This refers to efforts to reduce energy use through energy efficiency and conservation measures. • Off-grid, facility and household scale renewable energy systems – These systems can provide electricity to individual homes and Tribal facilities in areas of the Reservation that do not currently have access to the electric utility grid. • Village scale, micro-grid renewable energy systems - These are larger scale systems that can provide electricity to interconnected groups of homes and Tribal facilities in areas of the Reservation that do not have access to the conventional electric grid. This will require the development of miniature electric grids to serve these interconnected facilities. • Medium to large scale renewable energy development for sale to the grid – In areas where viable renewable energy resources exist and there is access to the conventional electric utility grid, these resources can be developed and sold to the wholesale electricity market. • Facility scale, net metered renewable energy systems – These are renewable energy systems that provide power to individual households or facilities that are connected to conventional electric utility grid.

  11. Contingency Analysis of Cascading Line Outage Events

    SciTech Connect (OSTI)

    Thomas L Baldwin; Magdy S Tawfik; Miles McQueen

    2011-03-01T23:59:59.000Z

    As the US power systems continue to increase in size and complexity, including the growth of smart grids, larger blackouts due to cascading outages become more likely. Grid congestion is often associated with a cascading collapse leading to a major blackout. Such a collapse is characterized by a self-sustaining sequence of line outages followed by a topology breakup of the network. This paper addresses the implementation and testing of a process for N-k contingency analysis and sequential cascading outage simulation in order to identify potential cascading modes. A modeling approach described in this paper offers a unique capability to identify initiating events that may lead to cascading outages. It predicts the development of cascading events by identifying and visualizing potential cascading tiers. The proposed approach was implemented using a 328-bus simplified SERC power system network. The results of the study indicate that initiating events and possible cascading chains may be identified, ranked and visualized. This approach may be used to improve the reliability of a transmission grid and reduce its vulnerability to cascading outages.

  12. Hydrogen Technology and Energy Curriculum (HyTEC)

    SciTech Connect (OSTI)

    Nagle, Barbara

    2013-02-28T23:59:59.000Z

    The Lawrence Hall of Science of the University of California, Berkeley has collaborated with scientists and engineers, a local transit agency, school districts, and a commercial curriculum publisher to develop, field-test nationally, and publish a two-week curriculum module on hydrogen and fuel cells for high school science. Key partners in this project are the Schatz Energy Research Center (SERC) of Humboldt State University, the Alameda-Contra Costa Transit District (AC Transit), FilmSight Productions, Lab-Aids, Inc., and 32 teachers and 2,370 students in field-test classrooms in California, Connecticut, Ohio, New York, South Carolina, and Washington. Field-test teachers received two to three days of professional development before teaching the curriculum and providing feedback used for revision of the curriculum. The curriculum, titled Investigating Alternative Energy: Hydrogen and Fuel Cells and published by Lab-Aids, Inc., includes a teachers guide (with lesson plans, resources, and student handout pages), two interactive computer animations, a video, a website, and a laboratory materials kit. The project has been disseminated to over 950 teachers through awareness workshops at state, regional, and national science teacher conferences.

  13. Evaluation of Two CEDA Weatherization Pilot Implementations of an Exterior Insulation and Over-Clad Retrofit Strategy for Residential Masonry Buildings in Chicago

    SciTech Connect (OSTI)

    Neuhauser, K.

    2013-08-01T23:59:59.000Z

    This project examines the implementation of an exterior insulation and over-clad strategy for brick masonry buildings in Chicago. The strategy was implemented at a free-standing two story two-family dwelling and a larger free-standing multifamily building. The test homes selected for this research represent predominant housing types for the Chicago area. High heating energy use typical in these buildings threaten housing affordability. Uninsulated mass masonry wall assemblies also have a strongly detrimental impact on comfort. Significant changes to the performance of masonry wall assemblies is generally beyond the reach of typical weatherization (Wx) program resources. The Community and Economic Development Association of Cook County, Inc. (CEDA) has secured a Sustainable Energy Resources for Consumers (SERC) innovation grant sponsored by the United States Department of Energy (DOE). This grant provides CEDA the opportunity to pursue a pilot implementation of innovative approaches to retrofit in masonry wall enclosures. The exterior insulation and over-clad strategy implemented through this project was designed to allow implementation by contractors active in CEDA weatherization programs and using materials and methods familiar to these contractors. The retrofit measures are evaluated in terms of feasibility, cost and performance. Through observations of the strategies implemented, the research described in this report identifies measures critical to performance as well as conditions for wider adoption. The research also identifies common factors that must be considered in determining whether the exterior insulation and over-clad strategy is appropriate for the building.

  14. Effects of Microhabitat Selection on Feeding Rates of Net-Spinning Caddisfly Larvae

    E-Print Network [OSTI]

    Georgian, Ted; Thorp, James H.

    1992-02-01T23:59:59.000Z

    of the stream bed ranges from gravels to large cobbles and boulders. Rocks with diameters of > 10-15 cm are covered with growths of aquatic mosses. At the study site the river flows between gorge walls of 40-50 m height, limiting direct penetration... Filter feeders Method of measurement (%/m) Reference ti t ti ti 0.006 . 0.010 . . . al Diplectrona modesta, Parapsyche cordis, 2 sites Hydropsychids, 3 spp. and philopotamids, 3 spp., 3 sites Cheumatopsyche sp. Hydropsyche, 3 spp...

  15. Tunable THz surface plasmon polariton based on a topological insulator/layered superconductor hybrid structure

    E-Print Network [OSTI]

    Li, Mingda

    We theoretically investigate the surface plasmon polariton (SPP) at the interface between a three-dimensional strong topological insulator (TI) and a layered superconductor/magnetic insulator structure, within the random ...

  16. Near-field Localization in Plasmonic Superfocusing: a Nanoemitter...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    even resorting to a multitude of new strategies based on near-field effects, surface plasmon polaritons, and metamaterials1-7. The propagation of surface plasmon polaritons (SPP)...

  17. Intertidal Ecology of Riprap Jetties and Breakwaters: Marine Communities Inhabiting Anthropogenic Structures along the West Coast of North America

    E-Print Network [OSTI]

    Pister, Benjamin A.

    2007-01-01T23:59:59.000Z

    spp. Unid green crust (microalgae) Unid Red Watersipora sp.Crust Unid Green Crust (Microalgae) Unid Orange Crust UnidCrust Unid Green Crust (Microalgae) Yellow Mite H1-1 H1-2

  18. Intertidal ecology of riprap jetties and breakwaters : marine communities inhabiting anthropogenic structures along the west coast of North America

    E-Print Network [OSTI]

    Pister, Benjamin Alan

    2007-01-01T23:59:59.000Z

    spp. Unid green crust (microalgae) Unid Red Watersipora sp.Crust Unid Green Crust (Microalgae) Unid Orange Crust UnidCrust Unid Green Crust (Microalgae) Yellow Mite H1-1 H1-2

  19. V.1 AN ANALYSIS OF SIX GROUPS OF ZOOPLANKTON IN SAMPLES TAKEN IN 1978/79 AT THE PROPOSED OTEC SITE IN THE EASTERN GULF OF MEXICO OFF TAMPA BAY

    E-Print Network [OSTI]

    Flock, Mark E.

    2012-01-01T23:59:59.000Z

    conditions at a potential OTEC site in the Gulf of Mexico;in the upper 1000 m at the OTEC station off Tampa Bay. + = OTEC site. Taxon Ahyla spp.

  20. Simultaneous estimation of actual litter enzymatic catalysis and respiration rates with a simple model of C dynamics in Sphagnum-dominated peatlands.

    E-Print Network [OSTI]

    Boyer, Edmond

    caerulea, Betula spp, soluble carbohydrates, Water Extractable Organic Carbon. insu-00852055,version1-19Aug and decomposition, leading to organic matter (OM) accumulation and long-term C-sequestration in peat (Clymo, 1984

  1. Demand Response in U.S. Electricity Markets: Empirical Evidence

    E-Print Network [OSTI]

    Cappers, Peter

    2009-01-01T23:59:59.000Z

    Independent System Operator (MISO) and Southwest PowerTo help inform the debate at MISO and SPP concerning how tosettled using the EIS market. MISO administers a day-ahead

  2. An evaluation of forage production, vegetational composition, tree growth, and physical characteristics of soils under varying densities of oak woodland overstory

    E-Print Network [OSTI]

    Koshi, Paul T.

    1957-01-01T23:59:59.000Z

    americana L.), tree huckleberry (Vaccinium arboreum Marsh.), and haw (Crataegus spp.). Under natural woodland conditions, some herbaceous plants prefer the shaded areas, but most species are not shade tolerant* The grasses constituted 95 percent or more...

  3. Evaluation of stand and site factors affecting declining post oak (Quercus stellata Wangh.) in the post oak savanna region of Central Texas

    E-Print Network [OSTI]

    Service, Sara

    2000-01-01T23:59:59.000Z

    (Quercus maniandica Muenchh. ), water oak (Quercus nigra L. ), hawthorn (Crataegus spp. ) and gum bumelia (Bumeiia 21 /snug/nosa (Michx. ) Pers. ). The understory was composed primarily of yaupon holly (//ex vomiforia Ait. ). Other species found...

  4. TPCP: Armillaria Root Rot ARMILLARIA ROOT ROT

    E-Print Network [OSTI]

    , Armillaria, has been reported from many parts of the world and on a wide variety of hosts. Armillaria spp of black "shoe-lace- like" rhizomorphs (not seen in South Africa) and/or the production of mushrooms near

  5. 2010 Wind Technologies Market Report

    E-Print Network [OSTI]

    Wiser, Ryan

    2012-01-01T23:59:59.000Z

    ET2/TL-08-1474. May 19, 2010 Wind Technologies Market ReportAssociates. 2010. SPP WITF Wind Integration Study. Little10, 2010. David, A. 2009. Wind Turbines: Industry and Trade

  6. 2011 Wind Technologies Market Report

    E-Print Network [OSTI]

    Bolinger, Mark

    2013-01-01T23:59:59.000Z

    Associates. 2010. SPP WITF Wind Integration Study. LittlePool. David, A. 2011. U.S. Wind Turbine Trade in a Changing2011. David, A. 2010. Impact of Wind Energy Installations on

  7. Water-wise bee garden plants for the Sacramento region Christine Casey, UC Davis Hagen-Dazs Honey Bee Haven

    E-Print Network [OSTI]

    Ferrara, Katherine W.

    Water-wise bee garden plants for the Sacramento region Christine Casey, UC Davis Häagen-Dazs Honey Bee Haven This is a suggested list of water Purple Manzanita Arctostaphylos spp. Heather (Ericaceae) December to April; varies

  8. Improving chemical aqueous based intervention methods for microorganism elimination from fresh produce surfaces

    E-Print Network [OSTI]

    Puerta-Gomez, Alex Frank

    2006-04-12T23:59:59.000Z

    (Fragaria spp.), tomatoes (Lycopersicon esculentum var. roma) curly parsley (Petroselinum crispum) and Italian parsley (Petroselinum crispum var. neapolitanum) were purchased from a local market, while non-waxed coated oranges (Citrus sinensis var. navel...

  9. Beth Aubuchon MS Candidate

    E-Print Network [OSTI]

    Gray, Matthew

    its exact modes of dispersal · Distance travels byy wind · Potting substances Continuing monitoring.M., Slaughter, G.W., Koike, S.T. 2002. Phytophthora ramorum as the cause of extensive mortality of Quercus spp

  10. Business Plan for a New Engineering Consulting Firm in the Electrical Utility Market

    E-Print Network [OSTI]

    Gois, Roberto Cavalcanti

    2009-05-15T23:59:59.000Z

    has been experiencing steady growth for more than ten years. Along with energy market regulatory agencies such as the Federal Energy Regulatory Commission (FERC) and Southwest Power Pool (SPP), electrical utilities must ensure that the electricity...

  11. Use of PRD1 bacteriophage in groundwater viral transport, inactivation, and attachment studies

    E-Print Network [OSTI]

    Ryan, Joe

    -negative bacterial hosts, which include pseudomonads and strains of Escherichia coli and Salmonella spp [13]. However studies Ronald W. Harvey a,*, Joseph N. Ryan b a US Geological Survey, 3215 Marine St., Suite E-127

  12. Intraspecific Gene Flow and Vector Competence among Periplaneta americana Cockroaches (Blattodea: Blattidae) in Central Texas

    E-Print Network [OSTI]

    Pechal, Jennifer

    2010-01-16T23:59:59.000Z

    -borne illnesses, including abdominal cramping, diarrhea, nausea, and fever. Analyzing spatial distributions of Escherichia coli and Campylobacter spp. in relationship to collected cockroaches allowed for prevalence of bacteria species to be identified among...

  13. Supplement 23, Part 6, Section A. Subject Headings: A-I, Parasite-Subject Catalogue, Subject Headings and Treatment

    E-Print Network [OSTI]

    Hanfman, Deborah T.; Hood, Martha W.; Edwards, Shirley J.; Kirby, Margie D.; Rayburn, Judith H.; Zidar, Judith A.

    1982-01-01T23:59:59.000Z

    . C.; and Chute, ?. ?. , 1978 , J. Parasitol., v. 64 (3), 425 Histomonas meleagridis, in vitro-adapted strain, inhibition of growth in conventional or gnotobiotic turkeys inoculated with 5 spp. of bacteria used for in vitro cultivation, supports...

  14. Quantifying sources of variation in the frequency of fungi associated with spruce beetles: Implications for

    E-Print Network [OSTI]

    Aukema, Brian

    ; received in revised form 27 May 2005; accepted 27 May 2005 Abstract The spruce beetle, Dendroctonus rufipennis (Kirby), causes landscape level mortality to mature spruce (Picea spp.) throughout western

  15. Soil seed bank reproductive properties of selected graminoids as influenced by microtopographic variation within a San Antonio Prairie

    E-Print Network [OSTI]

    Toledo, Mercily

    1986-01-01T23:59:59.000Z

    Brittoniana Carex microdonta C erus acuminatus C erus esculentus 0 erus ovularis Dichanthelium oli osanth Dichanthelium s haerocar Eleocharis com ressa Era rostis intermedia Fimbrist lis uberula Juncus spp. Pas alum dilatatumm Setaria eniculata...

  16. NAUERT ET AL. VOL. XXX ' NO. XX ' 000000 ' XXXX www.acsnano.org

    E-Print Network [OSTI]

    Zubarev, Eugene

    Furthermore, NWs show great promise as a sensing platform for remote-excitation surface-enhanced Raman through both radiative (scattering) and nonradiative (Joule heating) pathways, limiting the SPP

  17. LIST OF PUBLICATIONS G. W. Minshall

    E-Print Network [OSTI]

    :55-58. (R. L. Newell and G. W. Minshall). 21. 1979 Bioenergetics of a stream "collector" organism. 1979 Bioenergetics of lotic filter-feeding insects Simulium spp. (Diptera) and Hydropsyche occidentalis

  18. Resonant scattering of surface plasmon polaritons by dressed quantum dots

    SciTech Connect (OSTI)

    Huang, Danhong; Cardimona, Dave [Air Force Research Laboratory, Space Vehicles Directorate, Kirtland Air Force Base, New Mexico 87117 (United States); Easter, Michelle [Department of Mechanical Engineering, Stevens Institute of Technology, 1 Castle Point Terrace, Hoboken, New Jersey 07030 (United States); Gumbs, Godfrey [Department of Physics and Astronomy, Hunter College of the City University of New York, 695 Park Avenue, New York, New York 10065 (United States); Maradudin, A. A. [Department of Physics and Astronomy, University of California, Irvine, California 92697 (United States); Lin, Shawn-Yu [Department of Electrical, Computer and Systems Engineering, Rensselaer Polytechnic Institute, 110 8th Street, Troy, New York 12180 (United States); Zhang, Xiang [Department of Mechanical Engineering, 3112 Etcheverry Hall, University of California at Berkeley, Berkeley, California 94720 (United States)

    2014-06-23T23:59:59.000Z

    The resonant scattering of surface plasmon-polariton waves (SPP) by embedded semiconductor quantum dots above the dielectric/metal interface is explored in the strong-coupling regime. In contrast to non-resonant scattering by a localized dielectric surface defect, a strong resonant peak in the spectrum of the scattered field is predicted that is accompanied by two side valleys. The peak height depends nonlinearly on the amplitude of SPP waves, reflecting the feedback dynamics from a photon-dressed electron-hole plasma inside the quantum dots. This unique behavior in the scattered field peak strength is correlated with the occurrence of a resonant dip in the absorption spectrum of SPP waves due to the interband photon-dressing effect. Our result on the scattering of SPP waves may be experimentally observable and applied to spatially selective illumination and imaging of individual molecules.

  19. Evidence for a Structural Role for Acid-Fast Lipids in Oocyst Walls of Cryptosporidium, Toxoplasma, and Eimeria

    E-Print Network [OSTI]

    Bushkin, G. Guy

    Coccidia are protozoan parasites that cause significant human disease and are of major agricultural importance. Cryptosporidium spp. cause diarrhea in humans and animals, while Toxoplasma causes disseminated infections in ...

  20. Fishery Bulletin Index Volume 100(14), 2002

    E-Print Network [OSTI]

    . James Blick and Peter T. Hagen. 11 Local distribution and abundance of swimming crabs (Callinectes spp nell, Michael Arendt, Jon Lucy, Cheryl Watson, and David Foley 168 Differences in diet of Atlantic

  1. 2008 WIND TECHNOLOGIES MARKET REPORT

    E-Print Network [OSTI]

    Bolinger, Mark

    2010-01-01T23:59:59.000Z

    the Midwest, Texas, Southwest, and PJM regions: wind in the52 GW), SPP (48 GW), and PJM (43 GW) account for over 70% ofThe queues surveyed include PJM Interconnection, Midwest

  2. Two new Phytophthora species from South African Eucalyptus plantations

    E-Print Network [OSTI]

    Africa (Linde et al. 1999). Phytophthora collar and root rot is a widespread disease af- fecting a number of cold-tolerant Eucalyptus spp. in South Africa (Linde et al. 1994a,b). This disease hampers progress

  3. Beta decay of 32Ar for fundamental tests

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    of 32 Ar and 33 Ar data 1999 result: 0.9980(52) stat (39) syst Adelberger et al., PRL 83 (1999) 1299 But, since then... * Precision measurement of 32 S(p,p) 32 S 3374.7-...

  4. Microsoft PowerPoint - Public Information Forum Presentation...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    2013, 2014 and 2015 IS rates in place prior to joining SPP when calculating the rates. * True-up will only include Western-UGP's portion of IS revenue requirement. 11192014 17...

  5. Emerging Pests and Diseases A Global Crisis ?

    E-Print Network [OSTI]

    (Fusarium circinatum) in Spain since late 2000's Origin probably Central America Impact on Pinus radiata in N. Spain but European pine spp. at risk Spread internationally via transport of contaminated seed

  6. IOWA STATE UNIVERSITY Department of Economics

    E-Print Network [OSTI]

    Tesfatsion, Leigh

    : namely, CAISO, ERCOT, ISO-NE, MISO, NYISO, PJM, and SPP. Over the years, however, a variety definitions omit many services important for ensuring the efficient and reliable operation of power systems

  7. Enhanced light emission from top-emitting organic light-emitting diodes by optimizing surface plasmon polariton losses

    E-Print Network [OSTI]

    Fuchs, Cornelius; Wieczorek, Martin; Gather, Malte C; Hofmann, Simone; Reineke, Sebastian; Leo, Karl; Scholz, Reinhard

    2015-01-01T23:59:59.000Z

    We demonstrate enhanced light extraction for monochrome top-emitting organic light-emitting diodes (OLEDs). The enhancement by a factor of 1.2 compared to a reference sample is caused by the use of a hole transport layer (HTL) material possessing a low refractive index (1.52). The low refractive index reduces the in-plane wave vector of the surface plasmon polariton (SPP) excited at the interface between the bottom opaque metallic electrode (anode) and the HTL. The shift of the SPP dispersion relation decreases the power dissipated into lost evanescent excitations and thus increases the outcoupling efficiency, although the SPP remains constant in intensity. The proposed method is suitable for emitter materials owning isotropic orientation of the transition dipole moments as well as anisotropic, preferentially horizontal orientation, resulting in comparable enhancement factors. Furthermore, for sufficiently low refractive indices of the HTL material, the SPP can be modeled as a propagating plane wave within ot...

  8. Bacteria recovered from endometritis and pyometra in the beef cow 

    E-Print Network [OSTI]

    Mikulec, Rashel Thi

    1999-01-01T23:59:59.000Z

    One hundred and one uteri from beef cows with pyometra were collected from a slaughterhouse. Samples of uterine exudate were cultured for aerobic, microaerophilic, and anaerobic bacteria, and also tested for Trichomonas spp. A section of uterine...

  9. Computational Biology and Bioinformatics

    E-Print Network [OSTI]

    Steels, Luc

    angles 8Sunday 10 February 2013 #12;Folding 2 The sequence of amino acids folds in the lowest energy GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHL DDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYH >sp|P68871|2-147|beta

  10. Chiao, Jung-chih Subject: FW: Yuan, Discover a Micro Windmill for Your Cell Phone

    E-Print Network [OSTI]

    Chiao, Jung-Chih

    , Bluetooth 2.1 + EDR stack, serial port profile (SPP), AT command set API and antenna. This cost engineered controller. The BT 2.1 + EDR stack provides secure, reliable, high-speed data connections using Secure Simple

  11. Multi mode nano scale Raman echo quantum memory

    E-Print Network [OSTI]

    S. A. Moiseev; E. S. Moiseev

    2010-01-31T23:59:59.000Z

    Low loss magnetic surface plasmon polariton (SPP) modes characterized by enhanced electrical field component and subwavelength confinement on the dielectric and negative-index metamaterial interface are presented. We demonstrate a possibility of storage and perfect retrieval of the low loss magnetic SPP fields by using a photon echo quantum memory on Raman atomic transition. We describe specific properties of the proposed technique which opens a possibility for efficient nano scale multi-mode quantum memory.

  12. S. K. Meidel R. E. Scheibling Effects of food type and ration on reproductive maturation

    E-Print Network [OSTI]

    Scheibling, Robert Eric

    in which we fed sea urchins four diets: (1) kelp (Laminaria spp.) for 6 d wkA1 and mussel (Mytilus spp.) ¯esh for 1 d wkA1 (KM); (2) kelp for 7 d wkA1 (high ration, KH); (3) kelp for 1 d wkA1 (low ration, KL% in all fed sea urchins but sig- ni®cantly lower in unfed ones. The feeding rate on kelp was signi

  13. StreamNet; Northwest Aquatic Information Network, 2003-2004 Annual Report.

    SciTech Connect (OSTI)

    Schmidt, Bruce (Pacific States Marine Fisheries Commission, Portland, OR); Roger, Phil (Columbia River Inter-Tribal Fish Commission, Portland, OR); Butterfield, Bart (Idaho Department of Fish and Game, Boise, ID)

    2005-01-01T23:59:59.000Z

    StreamNet is a cooperative data compilation, development, and distribution project involving the state, tribal and federal fish and wildlife agencies in the Columbia River basin. It is funded by the Bonneville Power Administration (BPA) through the Fish and Wildlife Program (FWP) of the Northwest Power and Conservation Council (NPCC), and is administered by the Pacific States Marine Fisheries Commission (PSMFC). The project is organized to perform three broad functions: Agency support: The project supports staff in the Idaho, Montana, Oregon and Washington state fish and wildlife agencies; the Columbia River Inter Tribal Fish Commission (CRITFC); and the U.S. Fish and Wildlife Service (USFWS) who locate, obtain, quality check and format specific types of fish related data. They convert these data into a standard data exchange format (DEF) and submit them, with references, to the regional StreamNet office. Regional Support: The regional component of StreamNet at PSMFC administers the project, coordinates with the FWP and other regional entities, and disseminates data regionally. As data are received from cooperators they are again quality checked then imported into the StreamNet database. Access to the data is provided on-line via a tabular data query system and interactive map applications at www.streamnet.org. The web site also provides access to independent data sets from other projects, pre-sorted data sets useful for specific purposes (such as for a recent pesticide spraying ruling or subbasin assessments), and general fish information for education purposes. Reference Support: The StreamNet Library, located at CRITFC, maintains access to all reference documents supporting the data in the StreamNet database, and provides full library services for patrons interested in fish and wildlife in the Pacific Northwest. The StreamNet Library also maintains probably the largest collection of agency gray literature related to fish and wildlife resources in the basin. The library participates in the Inter Library Loan program, and can exchange literature worldwide. This report summarizes StreamNet Project activities during fiscal year 2004 (FY-04). Detailed descriptions of accomplishments by individual objective and task are provided in the Project's quarterly progress reports, available on the reports and publications page of the StreamNet web site.

  14. Integrated Quantum Controlled-NOT Gate Based on Dielectric-Loaded Surface Plasmon Polariton Waveguide

    E-Print Network [OSTI]

    S. M. Wang; Q. Q. Cheng; Y. X. Gong; P. Xu; L. Li; T. Li; S. N. Zhu

    2014-08-09T23:59:59.000Z

    It has been proved that surface plasmon polariton (SPP) can well conserve and transmit the quantum nature of entangled photons. Therefore, further utilization and manipulation of such quantum nature of SPP in a plasmonic chip will be the next task for scientists in this field. In quantum logic circuits, the controlled-NOT (CNOT) gate is the key building block. Here, we implement the first plasmonic quantum CNOT gate with several-micrometer footprint by utilizing a single polarization-dependent beam-splitter (PDBS) fabricated on the dielectric-loaded SPP waveguide (DLSPPW). The quantum logic function of the CNOT gate is characterized by the truth table with an average fidelity of. Its entangling ability to transform a separable state into an entangled state is demonstrated with the visibilities of and for non-orthogonal bases. The DLSPPW based CNOT gate is considered to have good integratability and scalability, which will pave a new way for quantum information science.

  15. Electrically tunable graded index planar lens based on graphene

    SciTech Connect (OSTI)

    Nasari, H., E-mail: Hadiseh-Nasari@ee.kntu.ac.ir; Abrishamian, M. S. [Department of Electrical and Computer Engineering, K. N. Toosi University of Technology, Tehran 16314 (Iran, Islamic Republic of)

    2014-08-28T23:59:59.000Z

    The realization of electrically tunable beam focusing using a properly designed conductivity pattern along a strip on a background single graphene flake with operation in the terahertz regime is proposed and numerically investigated. The strip is illuminated with a guided surface plasmon polaritons (SPP) plane wave and the physical origin of the design procedure is evaluated from the phase of effective mode index of propagating SPP wave on graphene. Upon tuning a gate voltage between the graphene sheet and the substrate, the focus tuning is achieved. Finite- difference time-domain numerical technique is employed to explore the propagation characteristic of SPP wave and the performance parameters of the lens include the focal length, full-width half-maximum, and focusing efficiency. Such a one atom thick planar lens with the capability of electrical focus tuning besides the compatibility with current planar optoelectronic systems can find valuable potential applications in the field of transformational plasmon optics.

  16. Facilitation of polymer looping and giant polymer diffusivity in crowded solutions of active particles

    E-Print Network [OSTI]

    Shin, J; Kim, W K; Metzler, R

    2015-01-01T23:59:59.000Z

    We study the dynamics of polymer chains in a bath of self-propelled particles (SPP) by extensive Langevin dynamics simulations in a two dimensional system. Specifically, we analyse the polymer looping properties versus the SPP activity and investigate how the presence of the active particles alters the chain conformational statistics. We find that SPPs tend to extend flexible polymer chains while they rather compactify stiffer semiflexible polymers, in agreement with previous results. Here we show that larger activities of SPPs yield a higher effective temperature of the bath and thus facilitate looping kinetics of a passive polymer chain. We explicitly compute the looping probability and looping time in a wide range of the model parameters. We also analyse the motion of a monomeric tracer particle and the polymer's centre of mass in the presence of the active particles in terms of the time averaged mean squared displacement, revealing a giant diffusivity enhancement for the polymer chain via SPP pooling. Our...

  17. Polarization dependent formation of femtosecond laser-induced periodic surface structures near stepped features

    SciTech Connect (OSTI)

    Murphy, Ryan D. [Applied Physics Program, University of Michigan, Ann Arbor, Michigan 48109 (United States); Torralva, Ben [Department of Atmospheric, Oceanic and Space Sciences, University of Michigan, Ann Arbor, Michigan 48109 (United States); Adams, David P. [Sandia National Laboratories, Albuquerque, New Mexico 87123 (United States); Yalisove, Steven M. [Department of Materials Science and Engineering, University of Michigan, Ann Arbor, Michigan 48109 (United States)

    2014-06-09T23:59:59.000Z

    Laser-induced periodic surface structures (LIPSS) are formed near 110?nm-tall Au microstructured edges on Si substrates after single-pulse femtosecond irradiation with a 150 fs pulse centered near a 780 nm wavelength. We investigate the contributions of Fresnel diffraction from step-edges and surface plasmon polariton (SPP) excitation to LIPSS formation on Au and Si surfaces. For certain laser polarization vector orientations, LIPSS formation is dominated by SPP excitation; however, when SPP excitation is minimized, Fresnel diffraction dominates. The LIPSS orientation and period distributions are shown to depend on which mechanism is activated. These results support previous observations of the laser polarization vector influencing LIPSS formation on bulk surfaces.

  18. Efficient out-coupling and beaming of Tamm optical states via surface plasmon polariton excitation

    SciTech Connect (OSTI)

    Lopez-Garcia, M.; Ho, Y.-L. D.; Taverne, M. P. C.; Chen, L.-F.; Rarity, J. G.; Oulton, R. [Department of Electrical and Electronic Engineering, University of Bristol, Faculty of Engineering, Queen's Building, University Walk, Bristol BS8 1TR (United Kingdom); Murshidy, M. M. [Department of Physics and Mathematics, University of Hull, Cottingham Road, HU6 7RX Hull (United Kingdom); Department of Physics, Faculty of Science, Helwan University, Helwan (Egypt); Yousef Jameel Science and Technology Research Center, The American University in Cairo (Egypt); Edwards, A. P.; Adawi, A. M. [Department of Physics and Mathematics, University of Hull, Cottingham Road, HU6 7RX Hull (United Kingdom); Serry, M. Y. [Yousef Jameel Science and Technology Research Center, The American University in Cairo (Egypt)

    2014-06-09T23:59:59.000Z

    We present evidence of optical Tamm states to surface plasmon polariton (SPP) coupling. We experimentally demonstrate that for a Bragg stack with a thin metal layer on the surface, hybrid Tamm-SPP modes may be excited when a grating on the air-metal interface is introduced. Out-coupling via the grating to free space propagation is shown to enhance the transmission as well as the directionality and polarization selection for the transmitted beam. We suggest that this system will be useful on those devices, where a metallic electrical contact as well as beaming and polarization control is needed.

  19. The Making of a Proficiency Test Sample: Vibrio cholerae in Blended, Pasteurized Oysters Chrissy M. Leopold Wager1, Lacey M. Guillen1, Christopher L. Conway1, Shannon M. Dugan1, Vishnu Y. Patel2, Glenn Tillman3, Wei Zhang1, and Ravinder M. Reddy2

    E-Print Network [OSTI]

    Heller, Barbara

    -Yeast Extract + 3% NaCl (TSB-YE 3% NaCl) and Alkaline Peptone Water (APW) were compared for suitability as ideal of cholera, infects thousands of people annually and is spread by contaminated food, water, or direct fecal of Vibrio spp. Various trials followed using raw oysters, post-harvest processed (PHP) oysters, and canned

  20. Biological vision Many slides adapted from

    E-Print Network [OSTI]

    Jacobs, David

    /Teaching/ppt/691a/CV%2 0UNIT%20Light/691A_UNIT_Light_1.ppt.pdf) ­ David Heeger (http/Teaching/Computational-Vision/)LectureNotes/ICBV- Lecture-Notes-12-Sensing-2-The-Human-Eye-1SPP.pdf ­ Erik Learned-Miller (http://people.cs.umass.edu/~elm

  1. The Chemical Composition of Forage Grasses from the Gulf Coast Prairie as Related to Soils and to Requirements for Range Cattle.

    E-Print Network [OSTI]

    Fraps, G. S. (George Stronach); Fudge, J. F. (Joseph Franklin)

    1944-01-01T23:59:59.000Z

    grass or sacahuiste (Spartina spartinae) occurs only along the coast where the soils contain considerable salt. Bermuda (Cynodon dactylon), Dallis (Papsalurn dilatatum) , and carpet (Axonopxs affinis) grasses occur usually on more fertile soils which... saccharoides Cynodon dactylon Poa annua Andropogon provincialis Andropogon rcoparius Setaria viridir Setaria ~utescens Andropogon virginicus Medicago lupulzna Buchloe dactyloides Phalaris caroliniana Phalaris minor Axonopur affinis Medicago spp...

  2. Burning biodiversity: Woody biomass use by commercial and subsistence groups in western Uganda's forests

    E-Print Network [OSTI]

    Kammen, Daniel M.

    har- vests across large areas. The tea industry consumes mainly eucalyptus wood (Eucalyptus spp.) from-exploitation, policy makers should target the charcoal and tea industry for reform. Support for local land management. Heavy reliance on woodfuels can result in a range of negative environmental impacts, with both local

  3. Description of a New Planktonic Mixotrophic Dinoflagellate Paragymnodinium shiwhaense n. gen., n. sp. from the Coastal Waters off Western Korea

    E-Print Network [OSTI]

    Jeong, Hae Jin

    , College of Agriculture and Life Sciences, Seoul National University, Seoul 151-921, Korea, and g Marine not have a nuclear envelope chamber nor a nuclear fibrous connective (NFC). Cells contain chloroplasts the Gymnodinium sensu stricto clade. However, in contrast to Gymnodinium spp., cells lack nuclear envelope

  4. Accetped by Journal of Eukaryotic Microbiology KANG ET AL.---Paragymnodinium shiwhaense n. gen., n. sp.

    E-Print Network [OSTI]

    Jeong, Hae Jin

    for Environmental Management, College of Agriculture and Life Sciences, Seoul National University, Seoul 151. Paragymnodinium shiwhaense does not have a nuclear envelope chamber nor a nuclear fibrous connective (NFC). Cells nuclear envelope chambers, NFC, and an apical groove. Unlike Polykrikos spp. which have a taeniocyst

  5. Woods Safety SFRC UF 7/09

    E-Print Network [OSTI]

    Watson, Craig A.

    Woods Safety SFRC UF 7/09 #12;Working alone #12;Poison Plants Poison ivy (Toxicodendron radicans) Poison oak (Toxicodendron pubescens) #12;Commonly Mistaken Plants Virginia creeper (Parthenocissus quinquefolia) Blackberry (Rubus spp.) Three leaflets let it be! #12;Poison Ivy/Oak Prevention: · Wear long

  6. 1240 IEEE TRANSACTIONS ON POWER SYSTEMS, VOL. 15, NO. 4, NOVEMBER 2000 State Estimation Distributed Processing

    E-Print Network [OSTI]

    Baldick, Ross

    ) and the Southwest Power Pool (SPP) systems. I. INTRODUCTION TO HOST SCADA and Energy Management System soft- ware1240 IEEE TRANSACTIONS ON POWER SYSTEMS, VOL. 15, NO. 4, NOVEMBER 2000 State Estimation Distributed- rithm to Power Systems State Estimation. We apply the Auxiliary Problem Principle to develop

  7. The nature of biodiversity has long been a central focus in biology. This may not seem the case any longer,

    E-Print Network [OSTI]

    restricted set of organisms--the house mouse (Mus musculus), the fruit fly (Drosophila spp.), the nematode of diversity is, in a sense, provided by"adaptation"to an "ecological niche." Adaptation results from the force of selection; and the notion of the ecological niche,to which the organism adapts,remains obscure and poorly

  8. Long-Term Stewardship of Mixed Wastes: Passive Reactive Barriers for Simultaneous In Situ Remediation of Chlorinated Solvent, Heavy Metal, and Radionuclide Contaminants

    SciTech Connect (OSTI)

    Gerlach, Robin; Cunningham, Al; Peyton, Brent

    2005-06-01T23:59:59.000Z

    The collaborative project was designed to evaluate the possibility developing a subsurface remediation technology for mixed wastes at Department of Energy sites using a group of common soil bacteria of the genus Cellulomonas. We have been gaining a better understanding of microbial transformation of chromium, uranium, iron minerals, and trinitrotoluene (TNT) by Cellulomonas spp. in simulated subsurface environments.

  9. Leigh Tesfatsion Professor of Econ, Math, and Electrical & Computer Engineering

    E-Print Network [OSTI]

    Tesfatsion, Leigh

    2012 AMES Wholesale Power Market Test Bed #12;2 Presentation Outline Wholesale power market design Commission (FERC) proposed a wholesale electric power market design for common adoption throughout U.S. Over), Midwest/Manitoba (MISO), & Southwest (SPP) #12;4 FERC Wholesale Power Market Design Adopters to Date http

  10. N e v a d a A r i z o n a

    E-Print Network [OSTI]

    Air Force Base Fort Irwin Naval Air Weapons Station China Lake Naval Air Weapons Station China Lake CACA 048254 Lucerne Solar Chevron Energy Solutions CACA 049561 Desert Sunlight - First Solar CACA 048649 Ridgecrest SPP CACA 049016 09-AFC-9 Beacon Solar Energy Project 08-AFC-2 Palmdale Hybrid Power

  11. July 25, 2006 RHIC Stochastic Cooling

    E-Print Network [OSTI]

    (abandoned at SppS and Tevatron) ­ Not part of RHIC base line design #12;July 25, 2006 Heavy ions should before (red) and after (blue) cooling, Wall Current Monitor Schottky spectrum before cooling: blue trace "hot" beam best ·Good for counteracting IBS ·Effective for tails of distribution ·E-cooling cools "cold

  12. 2792 IEEE TRANSACTIONS ON ELECTRON DEVICES, VOL. 56, NO. 11, NOVEMBER 2009 Active Terahertz Spoof Surface Plasmon

    E-Print Network [OSTI]

    Mazumder, Pinaki

    in the THz domain have penetrated in the market, the THz EM spectrum has recently evoked a considerable promising applications like astronomical remote sensing, medical imaging systems, military detection was recently developed for guiding THz radiation in the form of surface plasmon polariton (SPP) that propagates

  13. Engineering Dissimilatory metal-reducing bacteria (DMRB) are a

    E-Print Network [OSTI]

    in microbial fuel cells (MFCs) for alternative energy generation and for degradation of organic wastes paradigm in which soluble oxidants are transported into cells for reduction during metabolism. The unique. In the case of Geobacter spp., anode biofilms can grow to be many microbes thick, confounding long

  14. www.ext.vt.edu Produced by Communications and Marketing, College of Agriculture and Life Sciences, Virginia Polytechnic Institute and State University, 2010

    E-Print Network [OSTI]

    Liskiewicz, Maciej

    chlorhexidine products) 180-300 ml hypertonic saline IMM infusionPseudomonas spp. Environmental Water and wet Yeast and mold Environmental Soil, plants, water Dirty infusions Aseptic infusions No treatment and DCT Prototheca Environmental Soil, plants, water Dirty infusions, infected udders Aseptic infusions

  15. BOOK REVIEW Silliman, B. R., E. D. Grosholz,

    E-Print Network [OSTI]

    Neubauer, Scott C.

    marshes, both in North America and abroad, and 2) integrate this information and provide it to coastal focuses on lessons learned from research in North American salt marshes, the international authorship covers Invasions in North American Salt Marshes. The global invasion of Spartina spp., with an emphasis

  16. Forschung und EU-Hochschulbro, Technologietransfer September 2014

    E-Print Network [OSTI]

    Nejdl, Wolfgang

    Nachwuchswissenschaftler/innen 4 1.2. LEIT: Information and communication technologies 4 1.2.1. Öffentliche Konsultation zu Programme Chemical Biology of Native Nucleic Acid Modifications (SPP 1784) 13 4.1.4. Volkswagen.1.8. NIH: Research Grants 16 5. Umweltwissenschaften und Energie 16 5.1.1. EU/KIC InnoEnergy: Call

  17. ELAEOPHOROSIS IN FREE-RANGING MULE DEER IN SOUTH DAKOTA --Elaeophora schneideri is an intraarterial parasitic nematode transmitted by

    E-Print Network [OSTI]

    deer populations through- out many of the western United States is fairly common and rates of infection and portions of the southeastern United States. Deer (Odocoileus spp.) infected with E. schneideri generally of this parasite in mule deer in the northcentral United States and to our knowledge, the first occurrences

  18. Who needs nodules? A short world tour of nitrogen fixation by

    E-Print Network [OSTI]

    alia Temperature extremes hot and cold pH extremes acid and alkaline Salinity NaCl, Ca or Mg salts Flooding salt and fresh water Drought High levels of soil aluminium Low levels of soil phosphorus #12;In hotspot for biodiversity. Soils are acid, high in Al and low in nutrients The most common (in spp

  19. Journal of Biogeography (1992)I9,383-390 Habitat distribution of canary chaffinchesamong islands

    E-Print Network [OSTI]

    Carrascal, Luis M.

    1992-01-01T23:59:59.000Z

    Journal of Biogeography (1992)I9,383-390 Habitat distribution of canary chaffinchesamong islands studied for the Canary Islands (Tenerife and El Hierro). The Common Chaffinch was significantly denser time. Key words. Canary Islands, Chaffinches (Fringilla spp.), habitat preferences, competitive

  20. Effect of Bare and Coated Nanoscale Zerovalent Iron on tceA

    E-Print Network [OSTI]

    Alvarez, Pedro J.

    and Environmental Engineering, Rice University, Houston, Texas 77005, and Department of Civil and Environmental Engineering, Carnegie Mellon University, Pittsburgh, Pennsylvania 15213 Received May 26, 2010. Revised of dechlorinating genes and the concurrent or sequential participation of Dehalococcoides spp. in the remediation

  1. GENERAL TECHNICAL REPORT PSW-GTR-240 Breeding for Resistance in Norway Spruce to the

    E-Print Network [OSTI]

    Standiford, Richard B.

    GENERAL TECHNICAL REPORT PSW-GTR-240 162 Breeding for Resistance in Norway Spruce to the Root Results from previous studies of resistance in Norway spruce (Picea abies (L.) Karst.) to the pathogens Heterobasidion spp. show significant genotypic variation in fungal growth and spore susceptibility among Norway

  2. Antecedentes del Sirex noctilio (Hymenoptera-Siricidae) en el Valle de Calamuchita, Cordoba, Argentina

    E-Print Network [OSTI]

    , Argentina SUMMARY In 1994, the wood wasp parasite Sirex noctilio was identified in Pinus spp. growing in the Calamuchita Valley of Cordoba, Argentina. This insect causes direct and indirect damage to trees, eventually in the Calamuchita Valley, CĂłrdoba, Argentina ADLIH LOPEZ, MARCELA DEMAESTRI, ESTEBAN ZUPAN, OMAR BAROTTO Facultad de

  3. Market Technical Analysis for the iMarket Meter Data Management System

    E-Print Network [OSTI]

    Lowe, Patrick

    2005-12-16T23:59:59.000Z

    price possible for reliable electric service . The Commission’s policy with regard to RTOs is contained in Order 2000. Throughout the United States, RTOs have been formed or are being formed to comply with FERC’s RTO requirements. The SPP has recently...

  4. Fertile sporophore production of Typhula phacorrhiza in the field is related to temperatures

    E-Print Network [OSTI]

    Hsiang, Tom

    , soil moisture, and soil­sand media were tested in 50 mL screw-cap tubes incubated at 4 °C, the limiting sclerotia of six isolates from three Typhula spp. were placed into pots filled with a sand and soil mixture diseases of grasses and cereals. A third, T. phacorrhiza Fries, has been implicated as a biological control

  5. The Influence of Fire and Other Disturbance on Ericaceous Shrubs in Xeric Pine-Oak Forests of the Appalachian Mountains

    E-Print Network [OSTI]

    Pipkin, Ashley

    2012-07-16T23:59:59.000Z

    were compared with Southern Pine Beetle (SPB) outbreaks and the Palmer Drought Severity Index. There were no significant correlations, but field observations suggest that SPB may be providing conditions suitable for Ericaceae establishment... for geography education. vii NOMENCLATURE JMP Statistical Software PDSI Palmer Drought Severity Index SPB Southern Pine Beetle spp. Species SPSS Statistical Software viii TABLE OF CONTENTS Page ABSTRACT...

  6. Texas 4-H Forestry Invitational Handbook

    E-Print Network [OSTI]

    Bruton, Derrick

    2009-04-05T23:59:59.000Z

    ) Pinewebworm Tetralopha robustella (Zeller) Fallwebworm Hyphantria cunea (Drury) *Bronzebirchborer Agrilus anxius (Gory) Blackturpentinebeetle Dendroctonus terebrans (Olivier) Ipsengraverbeetles Ips spp. Conifersawflies Hymenoptera: Diprionidae... Spinyelmcaterpillar Nymphalis antiopa (Linnaeus) Southernpinebeetle Dendroctonus frontalis (Zimmerman) Tussockmoth Lepidoptera: Lymantriidae *Locustleafminer Odontota dorsalis (Thunberg) Whiteoakborer Goes tigrinus (DeGeer) Palesweevil Hylobius pales (Hbst...

  7. Graphene-based terahertz tunable plasmonic directional coupler

    SciTech Connect (OSTI)

    He, Meng-Dong, E-mail: hemendong@sohu.com; Wang, Kai-Jun; Wang, Lei; Li, Jian-Bo [Institute of Mathematics and Physics, Central South University of Forestry and Technology, Changsha 410004 (China); Liu, Jian-Qiang [College of Science, Jiujiang University, Jiujiang 332005 (China); Huang, Zhen-Rong; Wang, Lingling [Key Laboratory for Micro-Nano Optoelectronic Devices of Ministry of Education, Hunan University, Changsha 410082 (China); Wang, Lin; Hu, Wei-Da; Chen, Xiaoshuang [National Laboratory for Infrared Physics, Shanghai Institute of Technical Physics, Chinese Academy of Science, Shanghai 200083 (China)

    2014-08-25T23:59:59.000Z

    We propose and numerically analyze a terahertz tunable plasmonic directional coupler which is composed of a thin metal film with a nanoscale slit, dielectric grating, a graphene sheet, and a dielectric substrate. The slit is employed to generate surface plasmon polaritons (SPPs), and the metal-dielectric grating-graphene-dielectric constructs a Bragg reflector, whose bandgap can be tuned over a wide frequency range by a small change in the Fermi energy level of graphene. As a graphene-based Bragg reflector is formed on one side of the slit, the structure enables SPP waves to be unidirectionally excited on the other side of the slit due to SPP interference, and the SPP waves in the Bragg reflector can be efficiently switched on and off by tuning the graphene's Fermi energy level. By introducing two optimized graphene-based Bragg reflectors into opposite sides of the slit, SPP waves can be guided to different Bragg reflectors at different Fermi energy levels, thus achieving a tunable bidirectional coupler.

  8. Rust disease of eucalypts, caused by Puccinia psidii, did not originate via host jump from guava in Brazil

    E-Print Network [OSTI]

    in Brazil RODRIGO N. GRACß A,*1 AMY L. ROSS-DAVIS, NED B. KLOPFENSTEIN, MEE-SOOK KIM, TOBIN L. PEEVER,§ PHIL Fitopatologia, Universidade Federal de Vicßosa, Vicßosa, MG 36570-000, Brazil, USDA Forest Service ­ Rocky, Puccinia psidii, is a devastating pathogen of introduced eucalypts (Eucalyptus spp.) in Brazil where

  9. Ontogenetic Shifts in Diet and Habitat by Juvenile Green Sea Turtles (Chelonia mydas) along the Middle and Lower Texas Coast

    E-Print Network [OSTI]

    Howell, Lyndsey

    2012-10-19T23:59:59.000Z

    ., Scyphozoa spp., and plastic debris. Diet analysis of 25-34.9 cm SCL turtles implied regional differences existed in macroalgae and seagrass consumption. Enriched delta13C and delta15N values in newest scute suggest most turtles inhabited the jetty...

  10. Vegetation changes on an abandoned rice field following herbicide and fertilizer treatments

    E-Print Network [OSTI]

    Cwik, Michael Joseph

    1973-01-01T23:59:59.000Z

    ass (pa icum ~v(r turn L. ), a d rownseed nasn I (~nas alum plicat I ~ Michx. ). In co treat, vegetation of abend ed rice land is composed principally of annual forbs intermixed with three-awns (Aristida spp. ). Forbs, as used in this paper, wili...

  11. Mycosphaerella species associated with leaf disease of Eucalyptus globulus in Ethiopia

    E-Print Network [OSTI]

    Mycosphaerella species associated with leaf disease of Eucalyptus globulus in Ethiopia By Alemu, Forestry Research Sector, Addis Ababa, Ethiopia; 2 Department of Plant Pathology and Microbiology, Tree spp. are among the most widely planted exotic trees in Ethiopia. Several damaging leaf pathogens

  12. The Kansas Black Bass Tournament Monitoring Program

    E-Print Network [OSTI]

    The Kansas Black Bass (Micropterus spp.) Tournament Monitoring Program was begun by the Kansas Fish and Game program of the Kansas Fish and Game Commission avoids both of these prob- lems. The Kansas Black Bass annually to each of the bass clubs in Kansas before the bulk of fishing begins, and clubs are asked

  13. Can Habitat Alteration and Spring Angling Explain Largemouth Bass Nest Success?

    E-Print Network [OSTI]

    Micropterus spp. As keystone predators and valued sport fish in North American lakes, black basses MicropterusCan Habitat Alteration and Spring Angling Explain Largemouth Bass Nest Success? TYLER WAGNER, 13 Natural Resources Building, East Lansing, Michigan 48824, USA Abstract.--Largemouth bass

  14. AbstractLarge (>458 mm) striped bass (Morone saxatilis) are dominant

    E-Print Network [OSTI]

    fishes and anadromous herrings (Alosa spp.) also contibuted large percentages of striped bass diet of striped Dorazio et al., 1994). After spawning, bass experienced drastic declines in the these fish leave414 Abstract­Large (>458 mm) striped bass (Morone saxatilis) are dominant predators in Chesapeake

  15. Site fidelity, home range behaviour and habitat utilization of male harlequin toads (Amphibia:Atelopus hoogmoedi)

    E-Print Network [OSTI]

    Hödl, Walter

    :Atelopus hoogmoedi) from Suriname:relevant aspects for conservation breeding SALAMANDRA 1 45 Abstract. Recently, neotropical harlequin toads (Atelopus spp.) have undergone drastic population de- clines. Captive breeding has rainy season (April to August) at Brownsberg Nature Park, Suriname. Dur- ing this period, males

  16. Habitat Use by Beaver Along the Big Sioux River in Eastern South Dakota

    E-Print Network [OSTI]

    to livestock grazing (Smith and Flake 1983). Grazing can have negative effects on beaver Castor canadensis~ 0.01) than uncuttrees. Mean distance from water of cut trees was less (P ~ 0.01) than for uncut a gradual decline in stands of willow Salix spp. because beaver harvest mature woody plants and cattle

  17. DACS-P-01725 Florida Department of Agriculture and Consumer Services, Division of Plant Industry

    E-Print Network [OSTI]

    Jawitz, James W.

    pests of legumes in Asia. The insects are voracious feeders on kudzu (Pueraria spp.) (Zhang 1985 all year (Thippeswamy and Rajagopal 2005). HOSTS: Numerous legumes, especially kudzu and soybean (please see above). ECONOMIC IMPORTANCE: Although their appetite for kudzu may be a good thing, bean

  18. Pasture degradation impacts soil phosphorus storage via changes to aggregate-associated soil organic matter in highly weathered tropical

    E-Print Network [OSTI]

    Gilli, Adrian

    Pasture degradation impacts soil phosphorus storage via changes to aggregate-associated soil. degraded pas- tures in the deforested Amazon Basin of Colombia. Paired plots of productive (dominated by planted Brachiaria spp.) vs. degraded pasture were identified on nine farms in the Department of Caquetá

  19. TheCondor96:4SS-467 0 The CooperOrnithologicalSociety1994

    E-Print Network [OSTI]

    -skinnedHawk (Accipiterstriates)pairsnestingin aspen(Populustremuloides),conifer (Abies,Picea spp.), and mixed aspen, Sharp-shinned Hawks breed in quaking aspen (Populustremuloides)and conifer (Abies,Picea, Pseudotsuga)forests.Forests in which hunting Sharp-shinned Hawks have been observed in- clude mature aspen, conifer, and mixed aspen

  20. University of Alberta Adaptation of trembling aspen and hybrid poplars to frost

    E-Print Network [OSTI]

    Hamann, Andreas

    University of Alberta Adaptation of trembling aspen and hybrid poplars to frost and drought performance and survival of hybrid poplars (Populus spp.) and trembling aspen (Populus tremuloides Michx these two plant groups. The results showed that trembling aspen is more resistant to drought stress and more

  1. Metadata for Nearshore Fish Atlas of Alaska Definitions of field names

    E-Print Network [OSTI]

    of bays; kelps (e.g., Saccharina latissima, Alaria marginata) often attached to bedrock faces Catch understory kelps growing as dense, low-lying mats on rocky substrates; dominant kelps (e.g., Saccharina latissima, Cymathere triplicata, Alaria spp.) Latitude: decimal degrees, WGS84 datum, northern hemisphere

  2. Silicides for infrared surface plasmon resonance biosensors J. W. Cleary1

    E-Print Network [OSTI]

    Peale, Robert E.

    Silicides for infrared surface plasmon resonance biosensors J. W. Cleary1 , R. E. Peale1,2 , D, University of Central Florida, 4000 Central Florida Blvd., Orlando, FL 32816, U.S.A. 3 AFRL/RYHC, Sensors on silicon were evaluated as conducting hosts for surface plasmon polaritons (SPP) in proposed long-wave IR

  3. Cryphonectria canker on Tibouchina in Colombia By M. J. WINGFIELD

    E-Print Network [OSTI]

    Cryphonectria canker on Tibouchina in Colombia By M. J. WINGFIELD 1 , C. RODAS 2 , H. MYBURG 3 , M.Wing®eld@fabi.up.ac.za; 2 Smur®t Carton de Colombia, Cali, Colombia and Wright Forest Management Consultants Inc., Cary NC canker disease on Tibouchina spp. (Melastomataceae) in Colombia. We used morphological studies

  4. Ecology, 88(1), 2007, pp. 1825 2007 by the Ecological Society of America

    E-Print Network [OSTI]

    Rudgers, Jennifer

    arundinaceum (tall fescue), hosts a fungal endophyte that is toxic to herbivores. In replicated experimental grasslands, the presence of the endophyte in tall fescue reduced tree abundance and size, altered tree spp.) was 65% higher in plots with the endophyte at the one grassland site where these data were

  5. The pathogenic potential of endophytic Botryosphaeriaceous fungi on Terminalia species in Cameroon

    E-Print Network [OSTI]

    The pathogenic potential of endophytic Botryosphaeriaceous fungi on Terminalia species in Cameroon are endophytic fungi and latent pathogens that can result in wood stain, cankers, die-back and death of trees the Botryosphaeriaceae occurring as endophytes of Terminalia spp. in Cameroon, as part of a larger project to identify

  6. Understory vegetation 3 years after implementing uneven-aged silviculture in a shortleaf pine-oak stand. Forest Service research paper

    SciTech Connect (OSTI)

    Shelton, M.G.; Murphy, P.A.

    1997-09-01T23:59:59.000Z

    The effects of retaining overstory hardwoods on understory vegetation were determined after implementing uneven-aged silviculture using single-tree selection in a shortleaf pin-oak stand (Pinus echinata Mill. and Quercus spp.) in the Ouachita Mountains. Treatments were the following hardwood basal areas (square feet per acre) and spatial arrangement: 0, 15-grouped, 15 scattered, 30-scattered, and untreated control.

  7. Tree-based delimitation of morphologically ambiguous taxa: A study of the lizard malaria parasites on the Caribbean island of Hispaniola q

    E-Print Network [OSTI]

    Mahler, D. Luke

    on the Caribbean island of Hispaniola q Bryan G. Falk a, , D. Luke Mahler b , Susan L. Perkins a a Richard Gilder from the Caribbean island of Hispaniola. All six infect lizards in the genus Anolis, but only two Hispaniola. Fifty-five of these lizards were infected with Plasmodium spp., representing several new host

  8. RESEARCH NOTE DISTANCE CHEMORECEPTION AND THE DETECTION OF

    E-Print Network [OSTI]

    Boal, Jean

    California), frozen on dry ice, shipped to Texas and stored at 2808C until extraction. Eggs were individually of recirculating artificial seawater (ASW) made from Instant OceanTM brand salts (salinity 34 +2 ppt, temp- erature. Subjects were fed thawed frozen shrimp or live fiddler crabs (Uca spp.) each day after experimental trials

  9. ORIGINAL ARTICLE Big dams and salmon evolution: changes in thermal

    E-Print Network [OSTI]

    Angilletta, Michael

    ORIGINAL ARTICLE Big dams and salmon evolution: changes in thermal regimes and their potential (Oncorhynchus spp.) across portions of their natural range, dams have arguably played a major role in many locations (NRC 1996; Lichatowich 1999; Ruckelshaus et al. 2002). Large dams (>15 m tall)­ designed

  10. ECOGRAPHY 23: 732742. Copenhagen 2000 Selectivity in the exploitation of floral resources by hoverflies

    E-Print Network [OSTI]

    Hemptinne, Jean-Louis

    and Platycheirus spp. are dominant in the communi- ties of Syrphinae from open habitats, all over western Europe attempts have been made to enhance the density, the diversity and the regulating action of predators (Schneider 1948, Stu¨rken 1964, Haslett 1989b). On the other hand, nectar supplies fuel for the energy

  11. Vol. 15, No. 9, 2002 / 875 MPMI Vol. 15, No. 9, 2002, pp. 875882. Publication no. M-2002-0708-02R. 2002 The American Phytopathological Society

    E-Print Network [OSTI]

    Cohen, Michael F.

    Azolla spp. on hrmA Gene Induction in the Cyanobacterium Nostoc punctiforme Michael F. Cohen,1 Yasuko-2234 Japan Submitted 11 February 2002. Accepted 19 April 2002. The hrmA gene of the N2-fixing cyanobacterium to induction of hrmA expression. Aqueous extract from fronds of the fern Azolla pinnata, a host of symbiotic

  12. WAIVER OF RIGHT TO PRE-TERMINATION HEARING FOR CLASSIFIED STAFF ONLY

    E-Print Network [OSTI]

    Rhoads, James

    WAIVER OF RIGHT TO PRE-TERMINATION HEARING FOR CLASSIFIED STAFF ONLY Office of Human Resources Rev Discipline and SPP 1011 Involuntary Terminations, you are entitled to a pre-termination hearing prior to the effective date of termination stated in your Notice of Intent to Recommend Termination. The purpose

  13. Determination of the pole and (MS)-bar masses of the top quark from the tt-bar cross section

    E-Print Network [OSTI]

    Baringer, Philip S.; Bean, Alice; Carrasco-Lizarraga, M. A.; Chen, G.; Clutter, Justace Randall; McGivern, Carrie Lynne; Sekaric, Jadranka; Wilson, Graham Wallace; D0 Collaboration; Abazov, V. M.; Abbott, B.; Acharya, B.S.; Adams, M.; Adams, T.

    2011-09-20T23:59:59.000Z

    , Marseille, France AL, Université Paris-Sud, CNRS/IN2P3, Orsay, France PNHE, Universités Paris VI and VII, CNRS/IN2P3, Paris, France EA, Irfu, SPP, Saclay, France PHC, Université de Strasbourg, CNRS/IN2P3, Strasbourg, France PNL, Université Lyon 1, CNRS/IN2P3...

  14. Texas Range Plants Poisonous to Livestock. 

    E-Print Network [OSTI]

    Sperry, Omer Edison

    1955-01-01T23:59:59.000Z

    College Staiion, Texas CONTENTS Page Pap INTRODUCTION ........................... .------------------ , 3 PART 11. PLANTS LESS COMMONLY TOXIC TO LIVESTOCK THE PROBLEM --------.--------.----------.------------------ 3 Aloysia lycioides, Whitebrush... ------.-.-------... ... 35 ACKNOWLEDGMENTS 3 Amaranthzts spp., Careless weed ----------.-.... 3.5 PART 1. IPLAKTS MOST COMMONLY TOXIC TO LIVESTOCK A pocynum canna binum, Dogbane, Indian hemp 35 Cicuta curtissii. Water hemlock -_--------.-...... 36 Acacia berlandieri...

  15. Large-scale (100s km) distributions of tuna larvae (family Scombridae), par-

    E-Print Network [OSTI]

    abundance and fecundity of T. albacares (yellowfin tuna) and K. pelamis (skipjack tuna) in the western. pelamis larvae. Other possible explanations, however, are that previous sampling scales of 100s km between waters (Miller, 1979), and Thunnus spp. and K. pelamis larvae were up to 100 times more concentrated

  16. Pelagic Predators Food Habits Project Tim Essington and Mary Hunsicker

    E-Print Network [OSTI]

    Hawai'i at Manoa, University of

    .pelamisinthedietofsharks %N %W %O %IRI N = 42 N = 5 Katsuwonus pelamis 0.00% 5.00% 10.00% 15.00% 20.00% 25.00% 30.00% 35 Thunnus albacares Thunnus alalunga Unid.Scombridae Sarda orientalis Katsuwonus pelamis Elagatis Unid.Scombridae Sarda orientalis Katsuwonus pelamis Elagatis bipinnulata Coryphaena hippurus Auxis spp

  17. EIS-0294: Sutter Power Project, Sutter County, California

    Broader source: Energy.gov [DOE]

    This EIS analyzes Western Area Power Administration's (Western) decision to support Calpine Corporation (Calpine) to construct an electric generating facility and associated 230-kilovolt (kV) transmission line, approximately 3.5 miles in length, known as the Sutter Power Plant (SPP).

  18. Marine Fisheries On the cover, top to

    E-Print Network [OSTI]

    Marine Fisheries ~@WD@W On the cover, top to bollom: Yelloweye rock fish, Sebastes ruberrimus Maturity and Fecundity in the Rockfishes, Sebastes spp., a Review Joy Clark, Wade Griffin, Jerry Clark.25 foreign. Publication of material from sources outside the NMFS is not an endorsement and the NMFS

  19. L'EVOLUTION DU DESIGN DES SYSTEMES DE PILOTAGE DE LA PERFORMANCE DANS LES

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    ) et, essentiellement, des systčmes de pilotage de la performance (SPP) en contexte hospitalier; (2) ŕ of the management control systems and, mainly, performance monitoring systems in a hospital context; (2 in a conceptual contingent model allowing to understand how the management control systems of the hospital

  20. Plasmonics in the near-infrared : spatial, spectral, and temporal studies of surface plasmon polaritons

    E-Print Network [OSTI]

    Tetz, Kevin

    2006-01-01T23:59:59.000Z

    of SPP pulse provides additional electromagnetic ?eldpulses using a time-resolved spatial heterodyne imaging technique to obtain spatial distributions of the electromagnetic ?pulses using a time-resolved spatial heterodyne imaging (TRSHI) technique to obtain spatial distributions of the electromagnetic ?

  1. 14TH INTERNATIONAL SYMPOSIUM ON INSECT-PLANT INTERACTIONS Estimating direct resistance in willows against a

    E-Print Network [OSTI]

    ) have a high energy quotum and efficient nitrogen use, resulting in a high and stable biomass production biomass yields over several years, durable plant resis- tance is necessary. We have developed a reliable of energy is increasing. In Sweden and other parts of Europe, willows (Salix spp.; Salicaceae), are grown

  2. OCTOBER 2010 SPECIAL INSTRUCTIONS TO DESIGNERS SID-S SUSTAINABLE PRODUCTS PORTFOLIO

    E-Print Network [OSTI]

    Kamat, Vineet R.

    by the Sustainability Team at the University of Michigan (U-M) Department of Architecture, Engineering & ConstructionSID-S OCTOBER 2010 SPECIAL INSTRUCTIONS TO DESIGNERS SID-S SUSTAINABLE PRODUCTS PORTFOLIO Page 1 of 2 SUSTAINABLE PRODUCTS PORTFOLIO General The Sustainable Products Portfolio (SPP) is maintained

  3. Extraordinary infrared transmission through a periodic bowtie aperture array

    E-Print Network [OSTI]

    Xu, Xianfan

    Extraordinary infrared transmission through a periodic bowtie aperture array Edward C. Kinzel to surface plasmon polariton (SPP) resonances and/or Rayleigh­Wood anomalies (RWA). Bowtie apertures to be strongly resonant. We demonstrate here that the total transmission through a bowtie aperture array can

  4. Published: November 17, 2011 r 2011 American Chemical Society 1044 dx.doi.org/10.1021/es203005k |Environ. Sci. Technol. 2012, 46, 10441054

    E-Print Network [OSTI]

    Alvarez-Cohen, Lisa

    -generating dehalorespiration process of Dehalococcoides spp., chlorinated ethenes serve as electron acceptors, coupling that the microbial populations were constantly changing during the course of the study. Dynamic analysisChip analyses in this study have provided insights into the microbial ecology and population dynamics at the TCE

  5. P A L A E O E C O L O G Y O F A P O S T -E X T I N C T I O N R E E F : F A M E N N I A N ( L A T E D E V O N I A N ) O F T H E CA N N I N G

    E-Print Network [OSTI]

    framework, Ortonella, and Girvanella were secondary encrusters, and Shuguria spp. occupied small crypts 2 demonstrate that no protracted interval of time was necessarily required for post-extinction `recovery focused, however, on post-extinction recovery, and no consensus has yet emerged as to the importance

  6. Forest soil characteristics under varing tree species in East Texas: implications for sustained productivity

    E-Print Network [OSTI]

    Scott, David Andrew

    1998-01-01T23:59:59.000Z

    productivity, and tree species may alter nutrient cycles within the same location and soil type through time. This study examined the influence of 33 years of sit occupancy by lobolly pine (Pinus taeda L.) and oak (Quercus spp.) plantations on forest floor mass...

  7. A Study in the Use of a High Concentration of CO2 in a Modified

    E-Print Network [OSTI]

    atmospheres 10 preserve fish during shipment has been limited because of eco- nomic and technical reasons. Recenl interest in the use a/the technique to ship Pacific salmon. Oncorhynchus spp.. aUla/ Alaska has shipped in large containers or vans. Harold 1. Barnett, Research Chemist; Frederick E. Stone. Chemist

  8. Does Pathogen Spillover from Commercially Reared Bumble Bees Threaten Wild Pollinators?

    E-Print Network [OSTI]

    Thomson, James D.

    Does Pathogen Spillover from Commercially Reared Bumble Bees Threaten Wild Pollinators? Michael C'); yet, we still have little understanding of the cause(s) of bee declines. Wild bumble bees (Bombus spp pathogen commonly found in commercial Bombus. We also monitored wild bumble bee populations near

  9. Forest soil characteristics under varing tree species in East Texas: implications for sustained productivity 

    E-Print Network [OSTI]

    Scott, David Andrew

    1998-01-01T23:59:59.000Z

    productivity, and tree species may alter nutrient cycles within the same location and soil type through time. This study examined the influence of 33 years of sit occupancy by lobolly pine (Pinus taeda L.) and oak (Quercus spp.) plantations on forest floor mass...

  10. Effect of the band structure of InGaN/GaN quantum well on the surface plasmon enhanced light-emitting diodes

    SciTech Connect (OSTI)

    Li, Yi; Zhang, Rong, E-mail: rzhang@nju.edu.cn, E-mail: bliu@nju.edu.cn; Liu, Bin, E-mail: rzhang@nju.edu.cn, E-mail: bliu@nju.edu.cn; Xie, Zili; Zhang, Guogang; Tao, Tao; Zhuang, Zhe; Zhi, Ting; Zheng, Youdou [Jiangsu Provincial Key Laboratory of Advanced Photonic and Electronic Materials, School of Electronic Science and Engineering, Nanjing University, Nanjing 210093 (China); Nanjing National Laboratory of Microstructures, Nanjing University, Nanjing 210093 (China)

    2014-07-07T23:59:59.000Z

    The spontaneous emission (SE) of InGaN/GaN quantum well (QW) structure with silver(Ag) coated on the n-GaN layer has been investigated by using six-by-six K-P method taking into account the electron-hole band structures, the photon density of states of surface plasmon polariton (SPP), and the evanescent fields of SPP. The SE into SPP mode can be remarkably enhanced due to the increase of electron-hole pairs near the Ag by modulating the InGaN/GaN QW structure or increasing the carrier injection. However, the ratio between the total SE rates into SPP mode and free space will approach to saturation or slightly decrease for the optimized structures with various distances between Ag film and QW layer at a high injection carrier density. Furthermore, the Ga-face QW structure has a higher SE rate than the N-face QW structure due to the overlap region of electron-hole pairs nearer to the Ag film.

  11. Hard di raction at HERA in the dipole model of BFKL dynamics

    E-Print Network [OSTI]

    Boyer, Edmond

    . Royon (DAPNIA/SPP) | Commissariat a l'Energie Atomique, Saclay, F-91191 Gif-sur-Yvette Cedex France are discussed, namely the e ective pomeron intercept, the scaling violations and the beta dependence. A di and lead to very large values at high beta and large virtuality Q which may lead to a discrimination

  12. Engineering of thermotolerant Bacillus coagulans for production of D(-)-lactic acid

    DOE Patents [OSTI]

    Wang, Qingzhao; Shanmugam, Keelnatham T; Ingram, Lonnie O

    2014-12-02T23:59:59.000Z

    Genetically modified microorganisms having the ability to produce D(-)-lactic acid at temperatures between 30.degree. C. and 55.degree. C. are provided. In various embodiments, the microorganisms may have the chromosomal lactate dehydrogenase (ldh) gene and/or the chromosomal acetolactate synthase (alsS) gene inactivated. Exemplary microorganisms for use in the disclosed methods are Bacillus spp., such as Bacillus coagulans.

  13. Libby Mitigation Program, 2007 Annual Progress Report: Mitigation for the Construction and Operation of Libby Dam.

    SciTech Connect (OSTI)

    Dunnigan, James; DeShazer, J.; Garrow, L.

    2009-05-26T23:59:59.000Z

    Libby Reservoir was created under an International Columbia River Treaty between the United States and Canada for cooperative water development of the Columbia River Basin (Columbia River Treaty 1964). Libby Reservoir inundated 109 stream miles of the mainstem Kootenai River in the United States and Canada, and 40 miles of tributary streams in the U.S. that provided habitat for spawning, juvenile rearing, and migratory passage (Figure 1). The authorized purpose of the dam is to provide power (91.5%), flood control (8.3%), and navigation and other benefits (0.2%; Storm et al. 1982). The Pacific Northwest Power Act of 1980 recognized possible conflicts stemming from hydroelectric projects in the northwest and directed Bonneville Power Administration to 'protect, mitigate, and enhance fish and wildlife to the extent affected by the development and operation of any hydroelectric project of the Columbia River and its tributaries' (4(h)(10)(A)). Under the Act, the Northwest Power Planning Council was created and recommendations for a comprehensive fish and wildlife program were solicited from the region's federal, state, and tribal fish and wildlife agencies. Among Montana's recommendations was the proposal that research be initiated to quantify acceptable seasonal minimum pool elevations to maintain or enhance the existing fisheries (Graham et al. 1982). Research to determine how operations of Libby Dam affect the reservoir and river fishery and to suggest ways to lessen these effects began in May 1983. The framework for the Libby Reservoir Model (LRMOD) was completed in 1989. Development of Integrated Rule Curves (IRCs) for Libby Dam operation was completed in 1996 (Marotz et al. 1996). The Libby Reservoir Model and the IRCs continue to be refined (Marotz et al 1999). Initiation of mitigation projects such as lake rehabilitation and stream restoration began in 1996. The primary focus of the Libby Mitigation project now is to restore the fisheries and fish habitat in basin streams and lakes. 'Mitigation for the Construction and Operation of Libby Dam' is part of the Northwest Power and Conservation Council's (NPCC) resident fish and wildlife program. The program was mandated by the Northwest Planning Act of 1980, and is responsible for mitigating damages to fish and wildlife caused by hydroelectric development in the Columbia River Basin. The objective of Phase I of the project (1983 through 1987) was to maintain or enhance the Libby Reservoir fishery by quantifying seasonal water levels and developing ecologically sound operational guidelines. The objective of Phase II of the project (1988 through 1996) was to determine the biological effects of reservoir operations combined with biotic changes associated with an aging reservoir. The objectives of Phase III of the project (1996 through present) are to implement habitat enhancement measures to mitigate for dam effects, to provide data for implementation of operational strategies that benefit resident fish, monitor reservoir and river conditions, and monitor mitigation projects for effectiveness. This project completes urgent and high priority mitigation actions as directed by the Kootenai Subbasin Plan.

  14. The Umatilla Basin Natural Production Monitoring and Evaluation Project, 2008 Annual Progress Report.

    SciTech Connect (OSTI)

    Contor, Craig R.; Harris, Robin; King, Marty [Confederated Tribes of the Umatilla Indian Reservation

    2009-06-10T23:59:59.000Z

    The Umatilla Basin Natural Production Monitoring and Evaluation Project (UBNPMEP) is funded by Bonneville Power Administration (BPA) as directed by section 4(h) of the Pacific Northwest Electric Power Planning and Conservation Act of 1980 (P.L.96-501). This project is in accordance with and pursuant to measures 4.2A, 4.3C.1, 7.1A.2, 7.1C.3, 7.1C.4 and 7.1D.2 of the Northwest Power Planning Council's (NPPC) Columbia River Basin Fish and Wildlife Program (NPPC 1994). Work was conducted by the Fisheries Program of the Confederated Tribes of the Umatilla Indian Reservation (CTUIR). The UBNPMEP is coordinated with two Oregon Department of Fish and Wildlife (ODFW) research projects that also monitor and evaluate the success of the Umatilla Fisheries Restoration Plan. This project deals with the natural production component of the plan, and the ODFW projects evaluate hatchery operations (project No. 1990-005-00, Umatilla Hatchery M & E) and smolt outmigration (project No. 1989-024-01, Evaluation of Juvenile Salmonid Outmigration and Survival in the Lower Umatilla River). Collectively these three projects monitor and evaluate natural and hatchery salmonid production in the Umatilla River Basin. The need for natural production monitoring has been identified in multiple planning documents including Wy-Kan-Ush-Mi Wa-Kish-Wit Volume I, 5b-13 (CRITFC 1996), the Umatilla Hatchery Master Plan (CTUIR & ODFW 1990), the Umatilla Basin Annual Operation Plan, the Umatilla Subbasin Summary (CTUIR & ODFW 2001), the Subbasin Plan (CTUIR & ODFW 2004), and the Comprehensive Research, Monitoring, and Evaluation Plan (CTUIR and ODFW 2006). Natural production monitoring and evaluation is also consistent with Section III, Basinwide Provisions, Strategy 9 of the 2000 Columbia River Basin Fish and Wildlife Program (NPPC 1994, NPCC 2004). The Umatilla Basin M&E plan developed along with efforts to restore natural populations of spring and fall Chinook salmon, (Oncorhynchus tshawytsha), coho salmon (O. kisutch), and enhance summer steelhead (O. mykiss). The need for restoration began with agricultural development in the early 1900's that extirpated salmon and reduced steelhead runs (Bureau of Reclamation, BOR 1988). The most notable development was the construction and operation of Three Mile Falls Dam (TMD) and other irrigation projects which dewatered the Umatilla River during salmon migrations. CTUIR and ODFW developed the Umatilla Hatchery Master Plan to restore fisheries to the basin. The plan was completed in 1990 and included the following objectives which were updated in 1999: (1) Establish hatchery and natural runs of Chinook and coho salmon. (2) Enhance existing summer steelhead populations through a hatchery program. (3) Provide sustainable tribal and non-tribal harvest of salmon and steelhead. (4) Maintain the genetic characteristics of salmonids in the Umatilla River Basin. (5) Increase annual returns to Three Mile Falls Dam to 31,500 adult salmon and steelhead. In the past the M&E project conducted long-term monitoring activities as well as two and three-year projects that address special needs for adaptive management. Examples of these projects include adult passage evaluations, habitat assessment surveys (Contor et al. 1995, Contor et al. 1996, Contor et al. 1997, Contor et al. 1998), and genetic monitoring (Currens & Schreck 1995, Narum et al. 2004). The project's goal is to provide quality information to managers and researchers working to restore anadromous salmonids to the Umatilla River Basin. The status of completion of each of BPA's standardized work element was reported in 'Pisces'(March 2008) and is summarized.

  15. Columbia River Hatchery Reform System-Wide Report.

    SciTech Connect (OSTI)

    Warren, Dan [Hatchery Scientific Review Group

    2009-04-16T23:59:59.000Z

    The US Congress funded the Puget Sound and Coastal Washington Hatchery Reform Project via annual appropriations to the US Fish and Wildlife Service (USFWS) beginning in fiscal year 2000. Congress established the project because it recognized that while hatcheries have a necessary role to play in meeting harvest and conservation goals for Pacific Northwest salmonids, the hatchery system was in need of comprehensive reform. Most hatcheries were producing fish for harvest primarily to mitigate for past habitat loss (rather than for conservation of at-risk populations) and were not taking into account the effects of their programs on naturally spawning populations. With numerous species listed as threatened or endangered under the Endangered Species Act (ESA), conservation of salmon in the Puget Sound area was a high priority. Genetic resources in the region were at risk and many hatchery programs as currently operated were contributing to those risks. Central to the project was the creation of a nine-member independent scientific review panel called the Hatchery Scientific Review Group (HSRG). The HSRG was charged by Congress with reviewing all state, tribal and federal hatchery programs in Puget Sound and Coastal Washington as part of a comprehensive hatchery reform effort to: conserve indigenous salmonid genetic resources; assist with the recovery of naturally spawning salmonid populations; provide sustainable fisheries; and improve the quality and cost-effectiveness of hatchery programs. The HSRG worked closely with the state, tribal and federal managers of the hatchery system, with facilitation provided by the non-profit organization Long Live the Kings and the law firm Gordon, Thomas, Honeywell, to successfully complete reviews of over 200 hatchery programs at more than 100 hatcheries across western Washington. That phase of the project culminated in 2004 with the publication of reports containing the HSRG's principles for hatchery reform and recommendations for Puget Sound/Coastal Washington hatchery programs, followed by the development in 2005 of a suite of analytical tools to support application of the principles (all reports and tools are available at www.hatcheryreform.us). In 2005, Congress directed the National Oceanic and Atmospheric Administration-Fisheries (NOAA Fisheries) to replicate the Puget Sound and Coastal Washington Hatchery Reform Project in the Columbia River Basin. The HSRG was expanded to 14 members to include individuals with specific knowledge about the Columbia River salmon and steelhead populations. This second phase was initially envisioned as a one-year review, with emphasis on the Lower Columbia River hatchery programs. It became clear however, that the Columbia River Basin needed to be viewed as an inter-connected ecosystem in order for the review to be useful. The project scope was subsequently expanded to include the entire Basin, with funding for a second year provided by the Bonneville Power Administration (BPA) under the auspices of the Northwest Power and Conservation Council's (NPCC) Fish and Wildlife Program. The objective of the HSRG's Columbia River Basin review was to change the focus of the Columbia River hatchery system. In the past, these hatchery programs have been aimed at supplying adequate numbers of fish for harvest as mitigation primarily for hydropower development in the Basin. A new, ecosystem-based approach is founded on the idea that harvest goals are sustainable only if they are compatible with conservation goals. The challenge before the HSRG was to determine whether or not conservation and harvest goals could be met by fishery managers and, if so, how. The HSRG determined that in order to address these twin goals, both hatchery and harvest reforms are necessary. The HSRG approach represents an important change of direction in managing hatcheries in the region. It provides a clear demonstration that current hatchery programs can indeed be redirected to better meet both conservation and harvest goals. For each Columbia River Basin Environmentally Significant Unit

  16. Spinning Reserve From Responsive Loads

    SciTech Connect (OSTI)

    Kirby, B.J.

    2003-04-08T23:59:59.000Z

    Responsive load is the most underutilized reliability resource available to the power system today. It is currently not used at all to provide spinning reserve. Historically there were good reasons for this, but recent technological advances in communications and controls have provided new capabilities and eliminated many of the old obstacles. North American Electric Reliability Council (NERC), Federal Energy Regulatory Commission (FERC), Northeast Power Coordinating Council (NPCC), New York State Reliability Council (NYSRC), and New York Independent System Operator (NYISO) rules are beginning to recognize these changes and are starting to encourage responsive load provision of reliability services. The Carrier ComfortChoice responsive thermostats provide an example of these technological advances. This is a technology aimed at reducing summer peak demand through central control of residential and small commercial air-conditioning loads. It is being utilized by Long Island Power Authority (LIPA), Consolidated Edison (ConEd), Southern California Edison (SCE), and San Diego Gas and Electric (SDG&E). The technology is capable of delivering even greater response in the faster spinning reserve time frame (while still providing peak reduction). Analysis of demand reduction testing results from LIPA during the summer of 2002 provides evidence to back up this claim. It also demonstrates that loads are different from generators and that the conventional wisdom, which advocates for starting with large loads as better ancillary service providers, is flawed. The tempting approach of incrementally adapting ancillary service requirements, which were established when generators were the only available resources, will not work. While it is easier for most generators to provide replacement power and non-spinning reserve (the slower response services) than it is to supply spinning reserve (the fastest service), the opposite is true for many loads. Also, there is more financial reward for supplying spinning reserve than for supplying the other reserve services as a result of the higher spinning reserve prices. The LIPAedge program (LIPA's demand reduction program using Carrier ComfortChoice thermostats) provides an opportunity to test the use of responsive load for spinning reserve. With potentially 75 MW of spinning reserve capability already installed, this test program can also make an important contribution to the capacity needs of Long Island during the summer of 2003. Testing could also be done at ConEd ({approx}30 MW), SCE ({approx}15 MW), and/or SDG&E ({approx}15 MW). This paper is divided into six chapters. Chapter 2 discusses the contingency reserve ancillary services, their functions in supporting power system reliability, and their technical requirements. It also discusses the policy and tariff requirements and attempts to distinguish between ones that are genuinely necessary and ones that are artifacts of the technologies that were historically used to provide the services. Chapter 3 discusses how responsive load could provide contingency reserves (especially spinning reserve) for the power system. Chapter 4 specifically discusses the Carrier ComfortChoice responsive thermostat technology, the LIPAedge experience with that technology, and how the technology could be used to supply spinning reserve. Chapter 5 discusses a number of unresolved issues and suggests areas for further research. Chapter 6 offers conclusions and recommendations.

  17. Collaborative Systemwide Monitoring and Evaluation Project (CSMEP) - Year 5 : Annual Report for FY 2008.

    SciTech Connect (OSTI)

    Marmorek, David R.; Porter, Marc; Pickard, Darcy; Wieckowski, Katherine

    2008-11-19T23:59:59.000Z

    The Collaborative Systemwide Monitoring and Evaluation Project (CSMEP) is a coordinated effort to improve the quality, consistency, and focus of fish population and habitat data to answer key monitoring and evaluation questions relevant to major decisions in the Columbia River Basin. CSMEP was initiated by the Columbia Basin Fish and Wildlife Authority (CBFWA) in October 2003. The project is funded by the Bonneville Power Administration (BPA) through the Northwest Power and Conservation Council's Fish and Wildlife Program (NPCC). CSMEP is a major effort of the federal state and Tribal fish and wildlife managers to develop regionally integrated monitoring and evaluation (M&E) across the Columbia River Basin. CSMEP has focused its work on five monitoring domains: status and trends monitoring of populations and action effectiveness monitoring of habitat, harvest, hatcheries, and the hydrosystem. CSMEP's specific goals are to: (1) interact with federal, state and tribal programmatic and technical entities responsible for M&E of fish and wildlife, to ensure that work plans developed and executed under this project are well integrated with ongoing work by these entities; (2) document, integrate, and make available existing monitoring data on listed salmon, steelhead, bull trout and other fish species of concern; (3) critically assess strengths and weaknesses of these data for answering key monitoring questions; and (4) collaboratively design, implement and evaluate improved M&E methods with other programmatic entities in the Pacific Northwest. During FY2008 CSMEP biologists continued their reviews of the strengths and weaknesses (S&W) of existing subbasin inventory data for addressing monitoring questions about population status and trends at different spatial and temporal scales. Work was focused on Lower Columbia Chinook and steelhead, Snake River fall Chinook, Upper Columbia Spring Chinook and steelhead, and Middle Columbia River Chinook and steelhead. These FY2008 data assessments and others assembled over the years of the CSMEP project can be accessed on the CBFWA public website. The CSMEP web database (http://csmep.streamnet.org/) houses metadata inventories from S&W assessments of Columbia River Basin watersheds that were completed prior to FY2008. These older S&W assessments are maintained by StreamNet, but budget cutbacks prevented us from adding the new FY2008 assessments into the database. Progress was made in FY2008 on CSMEP's goals of collaborative design of improved M&E methods. CSMEP convened two monitoring design workshops in Portland (December 5 and 6, 2007 and February 11 and 12, 2008) to continue exploration of how best to integrate the most robust features of existing M&E programs with new approaches. CSMEP continued to build on this information to develop improved designs and analytical tools for monitoring the status and trends of fish populations and the effectiveness of hatchery and hydrosystem recovery actions within the Columbia River Basin. CSMEP did not do any new work on habitat or harvest effectiveness monitoring designs in FY2008 due to budget cutbacks. CSMEP presented the results of the Snake Basin Pilot Study to the Independent Scientific Review Panel (ISRP) in Portland on December 7, 2008. This study is the finalization of CSMEP's pilot exercise of developing design alternatives across different M&E domains within the Snake River Basin spring/summer Chinook ESU. This work has been summarized in two linked reports (CSMEP 2007a and CSMEP 2007b). CSMEP participants presented many of the analyses developed for the Snake Basin Pilot work at the Western Division American Fisheries Society (AFS) conference in Portland on May 4 to 7, 2008. For the AFS conference CSMEP organized a symposium on regional monitoring and evaluation approaches. A presentation on CSMEP's Cost Integration Database Tool and Salmon Viability Monitoring Simulation Model developed for the Snake Basin Pilot Study was also given to the Pacific Northwest Aquatic monitoring Partnership (PNAMP) stee

  18. Fabrication of metal matrix composite by semi-solid powder processing

    SciTech Connect (OSTI)

    Wu, Yufeng [Ames Laboratory

    2012-11-28T23:59:59.000Z

    Various metal matrix composites (MMCs) are widely used in the automotive, aerospace and electrical industries due to their capability and flexibility in improving the mechanical, thermal and electrical properties of a component. However, current manufacturing technologies may suffer from insufficient process stability and reliability and inadequate economic efficiency and may not be able to satisfy the increasing demands placed on MMCs. Semi-solid powder processing (SPP), a technology that combines traditional powder metallurgy and semi-solid forming methods, has potential to produce MMCs with low cost and high efficiency. In this work, the analytical study and experimental investigation of SPP on the fabrication of MMCs were explored. An analytical model was developed to understand the deformation mechanism of the powder compact in the semi-solid state. The densification behavior of the Al6061 and SiC powder mixtures was investigated with different liquid fractions and SiC volume fractions. The limits of SPP were analyzed in terms of reinforcement phase loading and its impact on the composite microstructure. To explore adoption of new materials, carbon nanotube (CNT) was investigated as a reinforcing material in aluminum matrix using SPP. The process was successfully modeled for the mono-phase powder (Al6061) compaction and the density and density distribution were predicted. The deformation mechanism at low and high liquid fractions was discussed. In addition, the compaction behavior of the ceramic-metal powder mixture was understood, and the SiC loading limit was identified by parametric study. For the fabrication of CNT reinforced Al6061 composite, the mechanical alloying of Al6061-CNT powders was first investigated. A mathematical model was developed to predict the CNT length change during the mechanical alloying process. The effects of mechanical alloying time and processing temperature during SPP were studied on the mechanical, microstructural and compositional properties of the Al6061-CNT composites. A shear lag model was applied to predict the mechanical property (hardness) of the composite. This work demonstrated the promising potential of SPP in the fabrication of particle/fiber (nanotube) reinforced MMCs.

  19. Differentiating swarming models by mimicking a frustrated anti-Ferromagnet

    E-Print Network [OSTI]

    Daniel J. G. Pearce; Matthew S. Turner

    2014-08-07T23:59:59.000Z

    Self propelled particle (SPP) models are often compared with animal swarms. However, the collective behaviour observed in experiments usually leaves considerable unconstrained freedom in the structure of these models. To tackle this degeneracy, and better distinguish between candidate models, we study swarms of SPPs circulating in channels (like spins) where we permit information to pass through windows between neighbouring channels. Co-alignment between particles then couples the channels (antiferromagnetically) so that they tend to counter-rotate. We study channels arranged to mimic a geometrically frustrated antiferromagnet and show how the effects of this frustration allow us to better distinguish between SPP models. Similar experiments could therefore improve our understanding of collective motion in animals. Finally we discuss how the spin analogy can be exploited to construct universal logic gates and therefore swarming systems that can function as Turing machines.

  20. Seasonal food habits of the coyote in the South Carolina coastal plain.

    SciTech Connect (OSTI)

    Schrecengost, J., D.; Kilgo, J., C.; Mallard, D.; Ray, H., S.; Miller, K., V.

    2008-07-01T23:59:59.000Z

    Abstract - Spatial and temporal plasticity in Canis latrans (coyote) diets require regional studies to understand the ecological role of this omnivorous canid. Because coyotes have recently become established in South Carolina, we investigated their food habits by collecting 415 coyote scats on the Savannah River Site in western South Carolina from May 2005-July 2006. Seasonally available soft mast was the most common food item in 12 of the 15 months we sampled. Odocoileus virginianus (white-tailed deer) was the most common food item during December (40%) and March (37%). During May-June, fruits of Prunus spp. and Rubus spp. were the most commonly occurring food items. Fawns were the most common mammalian food item during May and June of both years despite low deer density.

  1. Tuning the Fano resonance between localized and propagating surface plasmon resonances for refractive index sensing applications

    E-Print Network [OSTI]

    Lodewijks, Kristof; Van Roy, Willem; Borghs, Gustaaf; Lagae, Liesbet; Van Dorpe, Pol

    2012-01-01T23:59:59.000Z

    Localized and propagating surface plasmon resonances are known to show very pronounced interactions if they are simultaneously excited in the same nanostructure. Here we study the fano interference that occurs between localized (LSPR) and propagating (SPP) modes by means of phase sensitive spectroscopic ellipsometry. The sample structures consist of periodic gratings of gold nanodisks on top of a continuous gold layer and a thin dielectric spacer, in which the structural dimensions were tuned in such a way that the dipolar LSPR mode and the propagating SPP modes are excited in the same spectral region. We observe pronounced anti-crossing and strongly asymmetric line shapes when both modes move to each others vicinity, accompagnied of largely increased phase differences between the respective plasmon resonances. Moreover we show that the anti-crossing can be exploited to increase the refractive index sensitivity of the localized modes dramatically, which result in largely increased values for the Figure-Of-Mer...

  2. Special population planner, version 4.0.

    SciTech Connect (OSTI)

    Kuiper, J.; Tanzman, E.; Metz, W.

    2007-03-26T23:59:59.000Z

    Emergencies happen every day. Many are caused by storms or auto accidents and can be planned for, if not predicted. Emergencies resulting from natural hazards often affect a large number of people, and planning for them can be difficult, since knowledge of the needs of the people involved is generally unavailable. Emergencies resulting from accidents at industrial and military facilities can also be large scale in nature if people must be evacuated or sheltered in place. Federal planning for large scale emergencies is the responsibility of the Federal Emergency Management Agency (FEMA), which provides assistance to various emergency management agencies at the national, state and local level. More information about FEMA is available at http://www.fema.gov/. The purpose of the Special Population Planner (SPP) is to help emergency planners address the needs of persons with special needs. The exact definition of 'special population' is a policy decision. Policymakers have included a variety of groups in this term, such as persons with disabilities, those who do not have vehicles with which to evacuate, children who are unattended at times (latchkey children), and many others. The SPP was developed initially for the Alabama Emergency Management Agency as part of its Chemical Stockpile Emergency Preparedness Program (CSEPP), which aids emergency planning and preparedness in communities surrounding military installations across the United States where chemical weapons are stored pending their destruction under federal law. Like that specialized application, this open-source version contains a set of specialized Geographic Information System (GIS) tools to facilitate emergency planning on behalf of persons with special needs, regardless of how the term is defined. While the original SPP system was developed for emergency planning relating to chemical hazards, it can be applied to other threats as well. It is apparent from Hurricane Katrina and other natural and man-made disasters that many of the problems posed by emergency planning for a chemical weapons agent release are shared by other hazards as well. The notion that emergency planning shares common functions underlies the decision by FEMA to include the Chemical Stockpile Emergency Preparedness Program (CSEPP) in its 'all-hazards' planning approach. The CSEPP's official planning guidance operationalizes this approach by suggesting that state and local CSEPP emergency plans 'should be appended to the existing all-hazards emergency plan.' The SPP is programmed as a set of tools within an ESRI ArcMap 9.1 project. ArcMap is a component of both ESRI ArcGIS 9.1 and ESRI ArcView 9.1, and it provides a rich GIS user interface for viewing spatial and tabular data, analyzing it, and producing output reports and maps. This GIS interface has been augmented with the SPP tools for a user interface that provides custom functionality for emergency planning. The system as released also includes some hypothetical example records for special needs populations, facilities, resources, control points and sirens sufficient for showing how the system would work with real information. A GIS database is included with some publicly available example layers. The SPP is designed to support emergency planners as they address emergency management issues, and includes capabilities that support the collection and importing of data, the review of data in a spatial context, and GIS tools for emergency planning. The SPP system allows for the identification and categorization of response zones to allow for multiple levels of preparedness. An Immediate Response Zone (IRZ) might be designated as the area 0 to 10 miles from a facility where the response would be the most urgent. SPP can support more than one set of planning zones to accommodate different types of emergencies or the different jurisdictions of emergency response organizations. These areas can be delineated by any number of criteria that make sense for the area. An area like New Orleans might designate response zones based on the depth above/below s

  3. Supplement 23, Part 6, Section B. Subject Headings: J-Z, Parasite-Subject Headings and Treatment

    E-Print Network [OSTI]

    Hood, Martha W.; Hanfman, Deborah T.; Edwards, Shirley J.; Rayburn, Jane D.; Kirby, Margie D.; Zidar, Judith A.; Shaw, Judith H.

    1982-01-01T23:59:59.000Z

    . ; et al., [1977], Egypt. J. Vet. Sc., v. 13 (1), 1976, 23-28 survey of Eimeria spp., chickens, no signifi- cant seasonal fluctuation of coccidiosis out- breaks: Jordan (Eimeria necatrix; E. acervulina; E. tenella; E. maxima; E. brunetti) Jordan... of Schistosoma mansoni and S. haematobium: Kenya (Ascaris lumbricoides; hookworm; Trichuris trichiura; Hymenolepis nana; Endolimax nana; Entamoeba coli; E. histolytica) Kenya Rijpstra, A. C., 1975, Ann. Soc. Beige Med. Trop., v. 55 (5), 415-425 intestinal...

  4. JOURNAL DE PHYSIQUE Colloque C2, supplment au n2, Tome *6, fvrier 1985 page C2-713

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    OF POLARIZED PROTONS IN SppS AND OTHER HIGH ENERGY HADRON COLLIDERS* E.D. Courant Brookhaven National-350 0.8, 14-30 Tevatron (FNAL) pp 800-1000 10, 150 RHIC (BNL) p-ion 250-350 20-30 HERA (DESY) e-p 850 40. 3. Traversal of polarization resonances in booster synchrotrons (up to 15-70 GeV). 4. Elimination

  5. Venomous Terrestrial Animals of Texas

    E-Print Network [OSTI]

    Jackman, John A.

    2004-08-13T23:59:59.000Z

    but itching may continue. Related Species ? Other species of yellowjackets are also found in Texas. ?Yellowjackets are often called ?hornets.? Southern Yellowjacket Vespula squamosa (Drury) [Hymenoptera: Vespidae] Paper Wasps Polistes spp. [Hymenoptera... to Stings ?Most attacks are bluffs. ? Stings are rapid and the reaction is immediate. Mud Daubers Chalybion, Sceliphron, Trypoxylon and others [Hymenoptera: Sphecidae] Cicada Killer Sphecius speciosus (Drury) [Hymenoptera: Sphecidae] 8 9 Identification...

  6. Supplement 23, Part 2, Parasite-Subject Catalogue, Parasites: Protozoa

    E-Print Network [OSTI]

    Zidar, Judith A.; Shaw, Judith H.; Hanfman, Deborah T.; Kirby, Margie D.; Rayburn, Jane D.; Edwards, Shirley J.; Hood, Martha W.

    1982-01-01T23:59:59.000Z

    . Med. and Hyg., v. 27 (1, pt. 1), 29-38 primary amebic meningoencephalitis, human (brain, pancreas), clinical findings, post- mortem studies, electron microscopy, immuno- histologic studies, evidence slightly more indicative of Acanthamoeba than... Acantha- moeba sp. in immunosuppressed humans Acanthamoeba castellanii Nagington, J., 1975, Tr. Ophth. Soc. United Kingdom, v. 95 (2), 207-209 Acanthamoeba spp. isolated from human eye infections, clinical report, in vitro trials of compounds...

  7. Effects of soil solarization on yields of celery, pepper, onion, control of soil-borne pathogens, and chemical changes in the soil

    E-Print Network [OSTI]

    Avila, Francisco Antonio

    1989-01-01T23:59:59.000Z

    of sublethal temperatures or a combination of thermal and biological control (36). In some of the same experiments, Fusarium spp. were also controlled by solarization (36, 67). Katan et al. (36) found that preheating the soil 45 to 50'C, allowing it to cool... (16) . Effective disease control is correlated with a corresponding reduction in inoculum density of pathogenic fungal propagules in solari zed soil (27, 32, 36, 71, 49, 3, 67, 22 ) . The reduction in inoculum density in solarized soil by thermal...

  8. Mutual Impacts on a Specialist Herbivore and its Host Plants: Variation in Insect Morphology and Plant Tolerance 

    E-Print Network [OSTI]

    Chinchilla-Ramirez, Milena

    2014-12-04T23:59:59.000Z

    , Dávila-Flores et al. (2013) compared the performance of the specialist, sap-sucking herbivore corn leafhopper [Dalbulus maidis (Delong & Wolcott)] (Hemiptera: Cicadellidae) on a suite of Zea spp. representing the plant genus’ evolution from wild... importance in this study is the analysis of tolerance responses to damage by a sap-sucking insect in contrast to tolerance studies carried out with chewing insects. Methods Zea and Dalbulus maidis The genus Zea L. (Poaceae) is native to Mexico...

  9. Distribution and Abundance Patterns of Spiders Inhabiting Cotton in Texas.

    E-Print Network [OSTI]

    Dean, D.A.; Sterling, W.L.

    1987-01-01T23:59:59.000Z

    . L. Sterling Department of Entomology Texas A&M University Abstract Patterns of the distribution and abundance of spiders were determined in the major cotton growing areas of Texas during 1982-83. M isumenops spp., Oxyopes saiticus Hentz... to predict this neutrality is important since spiders could then be eliminated as an important factor in predicting the dynamics of other arthropods. The cotton fleahopper (Pseudatomoscelis seriatus [Reuter]) model (Hartstack and Sterling 1986) uses...

  10. Host Plants of Xylosandrus mutilatus in Mississippi

    SciTech Connect (OSTI)

    Stone, W.D.; Nebeker, T.E. [Department of Entomology and Plant Pathology, Mississippi State University, Box 9775, Mississippi State, MS 39762 (United States); Gerard, P.D. [Experimental Statistics Unit, Mississippi State University, Box 9731, Mississippi State, MS 39762 (United States)

    2007-03-15T23:59:59.000Z

    Host range of Xylosandrus mutilatus (Blandford) in North America is reported here for the first time. Descriptive data such as number of attacks per host, size of stems at point of attacks, and height of attacks above ground are presented. Hosts observed in Mississippi were Acer rubrum L., Acer saccharum Marsh., Acer palmatum Thunb., Ostrya virginiana (Mill.) K. Koch., Cornus florida L., Fagus grandifolia Ehrh., Liquidamber styraciflua L., Carya spp., Liriodendron tulipifera L., Melia azedarach L., Pinus taeda L., Prunus serotina Ehrh., Prunus americana Marsh., Ulmus alata Michaux, and Vitus rotundifolia Michaux. Liquidamber styraciflua had significantly more successful attacks, significantly higher probability of attacks, and significantly higher number of adult beetles per host tree than did Carya spp., A. rubrum, and L. tulipifera. This information is relevant in determining the impact this exotic beetle may have in nurseries, urban areas, and other forestry systems where this beetle becomes established. (author) [Spanish] El rango de hospederos de Xylosandrus mutilatus (Blandford) en America del Norte esta reportado aqui por la primera vez. Se presentan datos descriptivos como el numero de ataques por hospederos, el tamano de los tallos en el punto de ataque y la altura por encima del nivel de tierra de los ataques. Los hospederos observados en el estado de Mississippi fueron Acer rubrum L., Acer saccharum Marsh., Acer palmatum Thunb., Ostrya virginiana (Mill.) K. Koch., Cornus florida L., Fagus grandifolia Ehrh., Liquidamber styraciflua L., Carya spp., Liriodendron tulipifera L., Melia azedarach L., Pinus taeda L., Prunus serotina Ehrh., Prunus americana Marsh., Ulmus alata Michaux y Vitus rotundifolia Michaux. Liquidamber styraciflua tuvo ataques significativamente mas exitosos, una probabilidad significativamente mas alta de ataques y un numero significativamente mayor de adultos de escarabajos por arbol hospedero que Carya spp., A. rubrum y L. tulipifera. Esta informacion es pertinente en determinar el impacto que pueda tener este escarabajo exotico en invernaderos, areas urbanas y otros sistemas forestales donde el escarabajo se establece. (author)

  11. The effects of a steam-electric generating plant on suitability of adjacent estuarine waters for growth of phytoplankton

    E-Print Network [OSTI]

    Kelsey, John Allen

    1974-01-01T23:59:59.000Z

    and Adams (1969) and Adams (1969) im- plied that power plant operations in California's tidal waters have acted to decrease kelp (Macrocystis spp. ) bed densities and the associated biota, when water temperature in the immediate discharge areas reached 2... permanent rise in temperature. Steeman-Nielsen and Jorgensen (1968) showed that some planktonic algae that had not been exposed to adverse influences such as poisons, oronounced nutrient deficiencies, or light shocks, showed little change...

  12. Enzymatic hydrolysis of low substituted carboxymethyl cellulose

    E-Print Network [OSTI]

    Chanona Dominquez, Guadalupe

    1984-01-01T23:59:59.000Z

    by liquid chromatography. Some of the hydrolyzates were subjected to fermentation by Saccharomyces spp. , and ethanol yields were determined by gas chromatography. Subjecting acetate grade cellulose pulp to mild carboxymethyl derivatization conditions...ENZYMATIC HYDROLYSIS OF LOW SUBSTITUTED CARBOXYMETHYL CELLULOSE A Thesis by GUADALUPE CHANONA DOMINGUEZ Submitted to the Graduate College of Texas A&M University in partial fulfillment of the requirements for the degree of MASTER OF SCIENCE...

  13. Statewide Air Emissions Calculations From Wind and Other Renewables Summary Report Draft, a Report to the TCEQ for the Period Sept. 2005 - August 2006

    E-Print Network [OSTI]

    Haberl, J. S.; Culp, C.; Yazdani, B.; Subbarao, K.; Verdict, M.; Liu, Z.; Baltazar-Cervantes, J. C.; Gilman, D.; Fitzpatrick, T.; Turner, W. D.

    2006-10-25T23:59:59.000Z

    Taylor, 120MW, Buffalo Gap 2, 03/2007 29 Kenedy, 300MW, Gulf Wind, 07/2007 30 Culberson, 175MW, Delaware Mountain, 12/2007 31 Kenedy, 400MW, Penascal Wind Farm, 2007 32 Galveston, 150MW, Galveston Offshore Wind, 2010 SPP Region ? 161MW 33 Oldham... weather normalization procedure for a single wind turbine; ? proposed weather normalization procedure for a wind farm containing multiple wind turbines; ? testing of the models; ? weather data collection efforts, and ? proposed modifications...

  14. Biological control of Rhizoctonia solani in greenhouse bedding plant production

    E-Print Network [OSTI]

    Brown, John Michael

    1983-01-01T23:59:59.000Z

    reduced damping-off of Celosia plumosa cv. Red Kewpie seedlings caused by R. solani. An uninoculated wheatbran preparation increased disease incidence. Incorpor ation of a lignite stillage inoculum preparations of Gliocladium spp. and T. harzianum... during the first ten days after sowing 27 Comparison of the wheat bran and lignite-sti llage carriers with biocontrols at the 3XRhizoctonia solani level 33 Comparison of treatment means at a R. solani level of 3X. The figure indicates no significant...

  15. The evolution of parental care in insects: a test of current hypotheses

    E-Print Network [OSTI]

    Gilbert, James D. J.; Manica, Andrea

    2015-04-30T23:59:59.000Z

    mating system of resource-defense polygyny, for exam- ple, in some thrips (e.g., Hoplothrips spp.; Crespi 1986, 1988), were treated as male care (see, e.g., Tallamy 2001; Costa 2006); however, guarding of ovipositing mates from other males, for ex- ample... 1997), or (2) species where costs to males of searching for additional females are prohibitive, such as Hemilepistus isopods (Shachak 1980). Many of these ecological conditions are met si- multaneously in species breeding on rare, defensible “bonanza...

  16. Evaluation of the Gastrointestinal Microbiota in Response to Dietary and Therapeutic Factors in Cats and Dogs Using Molecular Methods

    E-Print Network [OSTI]

    Garcia-Mazcorro, Jose

    2012-02-14T23:59:59.000Z

    .2.1 Culture methods Traditional culture methods for the identification of bacteria rely on phenotypic characterization, including the assessment of the morphology of bacterial cells and colonies, their growth requirements, as well as their fermentation... of intestinal fluid) than in feces (108-1011 cfu/g feces), Staphylococcus spp. and non-fermentative gram-negative rods were more prevalent in the small intestine. Similarly to the observations made by Davis et al. (1977), the authors also showed...

  17. Special Publication No. 3, Ticks and Tickborne Diseases, II. Hosts, Part 1. A-F

    E-Print Network [OSTI]

    Doss, Mildred A.; Farr, Marion M.; Roach, Katharine F.; Anastos, George

    1974-01-01T23:59:59.000Z

    . Rodentia Agouti ???? Amblyomma spp. (Fairchild, G. ?. , Kohls, G. ?. , & Tipton, V. J., (1966A), 167-219) (Panama) Amblyomma coelebs (Fairchild, G. ?. , Kohls, G. ?. , Tipton, V. J., (1966A), 167-219) (Panama) Amblyomma pacae (Fairchild, G.... ?. , Kohls, G. ?. , ? Tipton, V. J., (1966A), 167-219) (Panama & British Honduras) Amblyomma pacae (Os orno-Me s a, ?. , (1940A), 6-24) (lado interno de la cadera; Colombia) Ixodes sp. (Fairchild, G. ?., Kohls, G. ?. , & Tipton, V. J., (1966A), 167...

  18. DOE's Policy Regarding Laboratories, Plants and Sites Engaging in Strategic Partnership Projects with Other Federal Agencies, Independent Organizations, and the Private Sector

    Broader source: Directives, Delegations, and Requirements [Office of Management (MA)]

    2014-12-17T23:59:59.000Z

    The purpose of this Policy is to set the context in which DOE and its laboratories, plants, and sites should pursue Strategic Partnership Projects (SPP) with other Federal government agencies, state and local institutions, universities, foreign entities and/or private companies. The Policy is applicable to the DOE laboratories, plants, and sites, and to the DOE programs that own them and facilitate their work.

  19. Effect of graphene on photoluminescence properties of graphene/GeSi quantum dot hybrid structures

    SciTech Connect (OSTI)

    Chen, Y. L.; Ma, Y. J.; Wang, W. Q.; Ding, K.; Wu, Q.; Fan, Y. L.; Yang, X. J.; Zhong, Z. Y.; Jiang, Z. M., E-mail: zmjiang@fudan.edu.cn [State Key Laboratory of Surface Physics, Key Laboratory of Micro and Nano Photonic Structures (Ministry of Education) and Department of Physics, Fudan University, Shanghai 200433 (China); Chen, D. D.; Xu, F. [SHU-SolarE R and D Lab, Department of Physics, College of Science, Shanghai University, Shanghai 200444 (China)

    2014-07-14T23:59:59.000Z

    Graphene has been discovered to have two effects on the photoluminescence (PL) properties of graphene/GeSi quantum dot (QD) hybrid structures, which were formed by covering monolayer graphene sheet on the multilayer ordered GeSi QDs sample surfaces. At the excitation of 488?nm laser line, the hybrid structure had a reduced PL intensity, while at the excitation of 325?nm, it had an enhanced PL intensity. The attenuation in PL intensity can be attributed to the transferring of electrons from the conducting band of GeSi QDs to the graphene sheet. The electron transfer mechanism was confirmed by the time resolved PL measurements. For the PL enhancement, a mechanism called surface-plasmon-polariton (SPP) enhanced absorption mechanism is proposed, in which the excitation of SPP in the graphene is suggested. Due to the resonant excitation of SPP by incident light, the absorption of incident light is much enhanced at the surface region, thus leading to more exciton generation and a PL enhancement in the region. The results may be helpful to provide us a way to improve optical properties of low dimensional surface structures.

  20. Autecology of Vibrio vulnificus and Vibrio parahaemolyticus in tropical waters

    SciTech Connect (OSTI)

    Rivera, S.; Lugo, T.; Hazen, T.C. [Univ. of Puerto Rico, Rio Piedras (Puerto Rico)

    1988-12-31T23:59:59.000Z

    Water and shellfish samples collected from estuaries, mangroves, and beaches along the coast of Puerto Rico were examined for Vibrio vulnificus and Vibrio parahaemolyticus. An array of water quality parameters were also measured simultaneous with bacteria sampling. Both species of vibrio were associated with estuary and mangrove locations, and neither was isolated from sandy beaches. Densities of V. vulnificus were negatively correlated with salinity, 10--15 ppt being optimal. V. parahaemolyticus was isolated from sites with salinities between 20 and 35 ppt, the highest densities occurring at 20 ppt. Densities of Vibrio spp. and V. parahaemolyticus for a tropical estuary surpassed those reported for temperate estuaries by several orders of magnitude. Both densities of total Vibrio spp. and V. parahaemolyticus in the water were directly related to densities of fecal coliforms, unlike V. vulnificus. The incidence of ONPG(+) strains among sucrose({minus}) Vibrio spp. served as an indicator of the frequency of V. vulnificus in this group. More than 63% of the V. vulnificus isolated were pathogenic. V. vulnificus and V. parahaemolyticus occupy clearly separate niches within the tropical estuarine-marine ecosystem.

  1. Contamination of stream fishes with chlorinated hydrocarbons from eggs of Great Lakes salmon

    SciTech Connect (OSTI)

    Merna, J.W.

    1986-01-01T23:59:59.000Z

    Pacific salmon Oncorhynchus spp. have been stocked in the Great Lakes where they accumulate body burdens of chlorinated hydrocarbons. The transport of these contaminants to resident communities in spawning streams was studied in two tributaries of Lake Michigan accessible to anadromous spawners and one control tributary blocked to them. No polychlorinated biphenyls (PCBs), DDT, or dieldrin were detected in the sediments or biota of the control stream, or in sediments of the test streams. However, trout Salmo spp. and, to a lesser extent, sculpins Cottus spp. accumulated PCBs and DDT as a result of eating contaminated salmon eggs. Eggs constituted as much as 87% (by weight) of the total stomach contents of trout collected during the salmon spawning season early October to early January. Salmon eggs contained 0.46-9.50 mg PCBs/kg,. and 0.14-1.80 mg DDT/kg. Consumption of eggs varied greatly among individual trout, and there was a strong correlation between numbers of eggs in the stomachs and PCB and DDT concentrations in the fillets.

  2. Ecological evaluation of proposed dredged material from St. Andrew Bay, Florida

    SciTech Connect (OSTI)

    Mayhew, H.L.; Word, J.Q.; Kohn, N.P.; Pinza, M.R.; Karle, L.M.; Ward, J.A. [Battelle/Marine Sciences Lab., Sequim, WA (United States)

    1993-10-01T23:59:59.000Z

    The US Army Corps of Engineers (USACE), Mobile District, requested that the Battelle/Marine Sciences Laboratory (MSL) conduct field sampling and chemical and biological testing to determine the suitability of potential dredged material for open ocean disposal. Sediment from St. Andrew Bay was chemically characterized and evaluated for biological toxicity and bioaccumulation of contaminants. The Tier III guidance for ocean disposal testing requires tests of water column effects (following dredged material disposal), deposited sediment toxicity, and bioaccumulation of contaminants from deposited sediment (dredged material). To meet these requirements, the MSL conducted suspended-particulate-phase (SPP) toxicity tests, solid-phase toxicity tests, and bioaccumulation testing on sediment representing potential dredged material from Panama City Harbor. Physical and chemical characterization of sediment to support toxicity and bioaccumulation results was also conducted on both the test and reference sediments. The MSL collected sediment samples from five sites in St. Andrew Bay and one reference site near Lands End Peninsula. The five test sediments and the reference sediment were analyzed for physical and chemical sediment characteristics, SPP chemical contaminants, solid-phase toxicity, SPP toxicity, and bioaccumulation of contaminants.

  3. Overview of Fiscal Year 2002 Research and Development for Savannah River Site's Salt Waste Processing Facility

    SciTech Connect (OSTI)

    H. D. Harmon, R. Leugemors, PNNL; S. Fink, M. Thompson, D. Walker, WSRC; P. Suggs, W. D. Clark, Jr

    2003-02-26T23:59:59.000Z

    The Department of Energy's (DOE) Savannah River Site (SRS) high-level waste program is responsible for storage, treatment, and immobilization of high-level waste for disposal. The Salt Processing Program (SPP) is the salt (soluble) waste treatment portion of the SRS high-level waste effort. The overall SPP encompasses the selection, design, construction and operation of treatment technologies to prepare the salt waste feed material for the site's grout facility (Saltstone) and vitrification facility (Defense Waste Processing Facility). Major constituents that must be removed from the salt waste and sent as feed to Defense Waste Processing Facility include actinides, strontium, cesium, and entrained sludge. In fiscal year 2002 (FY02), research and development (R&D) on the actinide and strontium removal and Caustic-Side Solvent Extraction (CSSX) processes transitioned from technology development for baseline process selection to providing input for conceptual design of the Salt Waste Processing Facility. The SPP R&D focused on advancing the technical maturity, risk reduction, engineering development, and design support for DOE's engineering, procurement, and construction (EPC) contractors for the Salt Waste Processing Facility. Thus, R&D in FY02 addressed the areas of actual waste performance, process chemistry, engineering tests of equipment, and chemical and physical properties relevant to safety. All of the testing, studies, and reports were summarized and provided to the DOE to support the Salt Waste Processing Facility, which began conceptual design in September 2002.

  4. PLUTONIUM FINISHING PLANT (PFP) STABILIZATION & PACKAGING PROJECT

    SciTech Connect (OSTI)

    GERBER, M.S.

    2004-01-14T23:59:59.000Z

    Fluor Hanford is pleased to submit the Plutonium Finishing Plant (PFP) Stabilization and Packaging Project (SPP) for consideration by the Project Management Institute as Project of the Year for 2004. The SPP thermally stabilized and/or packaged nearly 18 metric tons (MT) of plutonium and plutonium-bearing materials left in PFP facilities from 40 years of nuclear weapons production and experimentation. The stabilization of the plutonium-bearing materials substantially reduced the radiological risk to the environment and security concerns regarding the potential for terrorists to acquire the non-stabilized plutonium products for nefarious purposes. The work was done In older facilities which were never designed for the long-term storage of plutonium, and required working with materials that were extremely radioactive, hazardous, pyrophoric, and In some cases completely unique. I n some Instances, one-of-a-kind processes and equipment were designed, installed, and started up. The SPP was completed ahead of schedule, substantially beating all Interim progress milestone dates set by the Defense Nuclear Facilities Safety Board (DNFSB) and in the Hanford Site's Federal Facility Agreement and Consent Order (Tri-Party Agreement or TPA), and finished $1-million under budget.

  5. Retail Demand Response in Southwest Power Pool

    SciTech Connect (OSTI)

    Bharvirkar, Ranjit; Heffner, Grayson; Goldman, Charles

    2009-01-30T23:59:59.000Z

    In 2007, the Southwest Power Pool (SPP) formed the Customer Response Task Force (CRTF) to identify barriers to deploying demand response (DR) resources in wholesale markets and develop policies to overcome these barriers. One of the initiatives of this Task Force was to develop more detailed information on existing retail DR programs and dynamic pricing tariffs, program rules, and utility operating practices. This report describes the results of a comprehensive survey conducted by LBNL in support of the Customer Response Task Force and discusses policy implications for integrating legacy retail DR programs and dynamic pricing tariffs into wholesale markets in the SPP region. LBNL conducted a detailed survey of existing DR programs and dynamic pricing tariffs administered by SPP's member utilities. Survey respondents were asked to provide information on advance notice requirements to customers, operational triggers used to call events (e.g. system emergencies, market conditions, local emergencies), use of these DR resources to meet planning reserves requirements, DR resource availability (e.g. seasonal, annual), participant incentive structures, and monitoring and verification (M&V) protocols. Nearly all of the 30 load-serving entities in SPP responded to the survey. Of this group, fourteen SPP member utilities administer 36 DR programs, five dynamic pricing tariffs, and six voluntary customer response initiatives. These existing DR programs and dynamic pricing tariffs have a peak demand reduction potential of 1,552 MW. Other major findings of this study are: o About 81percent of available DR is from interruptible rate tariffs offered to large commercial and industrial customers, while direct load control (DLC) programs account for ~;;14percent. o Arkansas accounts for ~;;50percent of the DR resources in the SPP footprint; these DR resources are primarily managed by cooperatives. o Publicly-owned cooperatives accounted for 54percent of the existing DR resources among SPP members. For these entities, investment in DR is often driven by the need to reduce summer peak demand that is used to set demand charges for each distribution cooperative. o About 65-70percent of the interruptible/curtailable tariffs and DLC programs are routinely triggered based on market conditions, not just for system emergencies. Approximately, 53percent of the DR resources are available with less than two hours advance notice and 447 MW can be dispatched with less than thirty minutes notice. o Most legacy DR programs offered a reservation payment ($/kW) for participation; incentive payment levels ranged from $0.40 to $8.30/kW-month for interruptible rate tariffs and $0.30 to $4.60/kW-month for DLC programs. A few interruptible programs offered incentive payments which were explicitly linkedto actual load reductions during events; payments ranged from 2 to 40 cents/kWh for load curtailed.

  6. Monitoring and Evaluation of Smolt Migration in the Columbia Basin : Volume XVI : Survival and Transportation Effects for Migrating Snake River Hatchery Chinook Salmon and Steelhead: Historical Estimates from 1996-2003.

    SciTech Connect (OSTI)

    Buchanan, Rebecca A.; Skalski, John R.

    2007-12-07T23:59:59.000Z

    In 2005, the University of Washington developed a new statistical model to analyze the combined juvenile and adult detection histories of PIT-tagged salmon migrating through the Federal Columbia River Power System (FCRPS). This model, implemented by software Program ROSTER (River-Ocean Survival and Transportation Effects Routine), has been used to estimate survival and transportation effects on large temporal and spatial scales for PIT-tagged hatchery spring and summer Chinook salmon and steelhead released in the Snake River Basin from 1996 to 2003. Those results are reported here. Annual estimates of the smolt-to-adult return ratio (SAR), juvenile inriver survival from Lower Granite to Bonneville, the ocean return probability from Bonneville to Bonneville, and adult upriver survival from Bonneville to Lower Granite are reported. Annual estimates of transport-inriver (T/I) ratios and differential post-Bonneville mortality (D) are reported on both a systemwide basis, incorporating all transport dams analyzed, and a dam-specific basis. Transportation effects are estimated only for dams where at least 5,000 tagged smolts were transported from a given upstream release group. Because few tagged hatchery steelhead were transported in these years, no transportation effects are estimated for steelhead. Performance measures include age-1-ocean adult returns for steelhead, but not for Chinook salmon. Annual estimates of SAR from Lower Granite back to Lower Granite averaged 0.71% with a standard error (SE) of 0.18% for spring Chinook salmon from the Snake River Basin for tagged groups released from 1996 through 2003, omitting age-1-ocean (jack) returns. For summer Chinook salmon from the Snake River Basin, the estimates of annual SAR averaged 1.15% (SE=0.31%). Only for the release years 1999 and 2000 did the Chinook SAR approach the target value of 2%, identified by the NPCC as the minimum SAR necessary for recovery. Annual estimates of SAR for hatchery steelhead from the Snake River Basin averaged 0.45% (SE=0.11%), including age-1-ocean returns, for release years 1996 through 2003. For release years when the ocean return probability from Bonneville back to Bonneville could be estimated (i.e., 1999 through 2003), it was estimated that on average approximately 86% of the total integrated mortality for nontransported, tagged hatchery spring and summer Chinook, and 74% for steelhead, occurred during the ocean life stage (i.e., from Bonneville to Bonneville). This suggests that additional monitoring and research efforts should include the ocean and estuary environment. Annual estimates of the systemwide T/I are weighted averages of the dam-specific T/I ratios for each transport dam (with {ge} 5,000 tagged fish transported), weighted by the probabilities of being transported at each dam. The systemwide T/I compares the observed SAR under the existing transportation system with the expected SAR if the transportation system had not been operated. Estimates of 1.0 indicate that the systemwide transportation program has no effect on SAR, while estimates > 1.0 indicate that the transportation program increases SAR. Excluding the 2001 release group, the geometric mean of the systemwide T/I estimates for hatchery spring Chinook salmon from the Snake River Basin was 1.15 (SE=0.03) for release years 1997 through 2003. The geometric mean of the systemwide T/I estimates for hatchery summer Chinook salmon from the Snake River Basin was 1.28 (SE=0.13) for release years 1997 through 2000 and 2003. Estimates were much higher for the 2001 release groups. These estimates reflect transportation from Lower Granite and/or Little Goose for most release years, depending on the number of tagged smolts actually transported at each dam during each release year. Differential post-Bonneville mortality (D) is the ratio of post-Bonneville survival to Lower Granite Dam of transported fish to that of nontransported ('inriver') fish. Excluding the 2001 release year, the geometric mean of the D estimates for hatchery spring Chinook salmon from the Snake River Basin

  7. Monitoring and Evaluation of Smolt Migration in the Columbia Basin : Volume XVIII: Survival and Transportation Effects of Migrating Snake River Wild Chinook Salmon and Steelhead: Historical Estimates From 1996-2004 and Comparison to Hatchery Results. Draft.

    SciTech Connect (OSTI)

    Buchanan, Rebecca A.; Skalski, John R.; Broms, Kristin

    2008-12-03T23:59:59.000Z

    The combined juvenile and adult detection histories of PIT-tagged wild salmonids migrating through the Federal Columbia River Power System (FCRPS) were analyzed using the ROSTER (River-Ocean Survival and Transportation Effects Routine) statistical release-recapture model. This model, implemented by software Program ROSTER, was used to estimate survival on large temporal and spatial scales for PIT-tagged wild spring and summer Chinook salmon and steelhead released in the Snake River Basin upstream of Lower Granite Dam from 1996 to 2004. In addition, annual results from wild salmonids were compared with results from hatchery salmonids, which were presented in a previous report in this series (Buchanan, R. A., Skalski, J. R., Lady, J. L., Westhagen, P., Griswold, J., and Smith, S. 2007, 'Survival and Transportation Effects for Migrating Snake River Hatchery Chinook Salmon and Steelhead: Historical Estimates from 1996-2003', Technical report, Bonneville Power Administration, Project 1991-051-00). These results are reported here. Annual estimates of the smolt-to-adult return ratio (SAR), juvenile inriver survival from Lower Granite to Bonneville, the ocean return probability from Bonneville to Bonneville, and adult upriver survival from Bonneville to Lower Granite are reported. Annual estimates of transport-inriver (T/I) ratios and differential post-Bonneville mortality (D) are reported on a dam-specific basis for release years with sufficient numbers of wild PIT-tagged smolts transported. Transportation effects are estimated only for dams where at least 1,000 tagged wild smolts were transported from a given upstream release group. Because few wild Chinook salmon and steelhead tagged upstream of Lower Granite Dam were transported before the 2003 release year, T/I and D were estimated only for the 2003 and 2004 release years. Performance measures include age-1-ocean adult returns for steelhead, but not for Chinook salmon. Spring and summer Chinook salmon release groups were pooled across the entire Snake River Basin upstream of Lower Granite Dam for this report. Annual estimates of SAR from Lower Granite back to Lower Granite averaged 0.92% with an estimated standard error (dSE) of 0.25% for wild spring and summer Chinook salmon for tagged groups released from 1996 through 2004, omitting age-1-ocean (jack) returns. Only for the 1999 and 2000 release years did the wild Chinook SAR approach the target value of 2%, identified by the NPCC as the minimum SAR necessary for recovery. Annual estimates of SAR for wild steelhead from the Snake River Basin averaged 0.63% (dSE = 0.15%), including age-1-ocean returns, for release years 1996 through 2004. For release years when the ocean return probability from Bonneville back to Bonneville could be estimated (i.e., 1999 through 2004), it was estimated that on average approximately 83% of the total integrated mortality for nontransported, tagged wild spring and summer Chinook, and 78% for steelhead (omitting the 2001 release year), occurred during the ocean life stage (i.e., from Bonneville to Bonneville). This suggests that additional monitoring and research efforts should include the ocean and estuary environment. Annual estimates of the dam-specific T/I for Lower Granite Dam were available for the 2003 and 2004 release years for both wild Chinook salmon and wild steelhead. The estimated T/I for Lower Granite was significantly > 1.0 for Chinook in 2004 (P < 0.0001) and for steelhead in both 2003 (P < 0.0001) and 2004 (P < 0.0001), indicating that for these release years, wild fish transported at Lower Granite returned there in higher proportions than fish that were returned to the river at Lower Granite, or that passed Lower Granite without detection as juveniles. Annual estimates of the dam-specific T/I for Little Goose Dam were available for wild Chinook salmon for both 2003 and 2004. The estimated T/I for Little Goose was significantly > 1.0 for wild Chinook in 2004 (P = 0.0024), but not in 2003 (P = 0.1554). Differential post-Bonneville mortality (D) is the ratio of pos

  8. Science and Technology Highlights of ORNL's Energy Efficiency and Renewable Energy Program, November 1998

    SciTech Connect (OSTI)

    Brown, M.

    1998-11-01T23:59:59.000Z

    ORNL's EE/RE research has always involved partnering with outside organizations, but collaborations tended toward industrial and university partners. Recognizing the value of working with state energy agencies, ORNL began in the early 1990s to establish stronger relations with state energy offices (SEOs) and the Association of State Energy Research and Technology Transfer Institutions (ASERTTI). In a 1993 meeting, states offered to help DOE deliver technology to the marketplace and indicated that the national laboratories could help them solve technology-related problems. In 1994, the National Renewable Energy Laboratory responded with a new program to establish federal-state collaborations. In 1996 ORNL began the State Partnerships Program (SPP), incorporating lessons learned from our sister laboratory. Core funding for SPP is provided by ORNL's EE/RE Program to pay for ORNL staff expertise and assistance. Partners contribute through either direct funding or in-kind resources. SPP has funded 38 projects and technical-assistance activities in 18 states. Partners include SEOS, ASERTTI members, utilities, universities, industrial firms, trade associations, and DOE regional support offices. All four sectors covered by ORNL's EE/RE Program-buildings, transportation, industry, and utility--are represented in the project mix. How can your organization participate? Twice yearly, calls for proposals are issued to ORNL staff, SEOS, and ASERTTI members. (Requests for 2-to 4-day technical assistance efforts are welcome any time!) Proposals must be developed in collaboration with ORNL researchers and must address issues integral to the EE/RE missions of DOE and ORNL.

  9. Functional Role of Infective Viral Particles on Metal Reduction

    SciTech Connect (OSTI)

    Coates, John D.

    2014-04-01T23:59:59.000Z

    A proposed strategy for the remediation of uranium (U) contaminated sites was based on the immobilization of U by reducing the oxidized soluble U, U(VI), to form a reduced insoluble end product, U(IV). Previous studies identified Geobacter sp., including G. sulfurreducens and G. metallireducens, as predominant U(VI)-reducing bacteria under acetate-oxidizing and U(VI)-reducing conditions. Examination of the finished genome sequence annotation of the canonical metal reducing species Geobacter sulfurreducens strain PCA and G. metallireduceans strain GS-15 as well as the draft genome sequence of G. uraniumreducens strain Rf4 identified phage related proteins. In addition, the completed genome for Anaeromyxobacter dehalogenans and the draft genome sequence of Desulfovibrio desulfuricans strain G20, two more model metal-reducing bacteria, also revealed phage related sequences. The presence of these gene sequences indicated that Geobacter spp., Anaeromyxobacter spp., and Desulfovibrio spp. are susceptible to viral infection. Furthermore, viral populations in soils and sedimentary environments in the order of 6.4×10{sup 6}–2.7×10{sup 10} VLP’s cm{sup -3} have been observed. In some cases, viral populations exceed bacterial populations in these environments suggesting that a relationship may exist between viruses and bacteria. Our preliminary screens of samples collected from the ESR FRC indicated that viral like particles were observed in significant numbers. The objective of this study was to investigate the potential functional role viruses play in metal reduction specifically Fe(III) and U(VI) reduction, the environmental parameters affecting viral infection of metal reducing bacteria, and the subsequent effects on U transport.

  10. Hexavalent Chromium Reduction under Fermentative Conditions with Lactate Stimulated Native Microbial Communities

    SciTech Connect (OSTI)

    Somenahally, Anil C [ORNL] [ORNL; Mosher, Jennifer J [ORNL] [ORNL; Yuan, Tong [University of Oklahoma] [University of Oklahoma; Phelps, Tommy Joe [ORNL] [ORNL; Brown, Steven D [ORNL] [ORNL; Yang, Zamin Koo [ORNL] [ORNL; Hazen, Terry C [ORNL] [ORNL; Arkin, Adam [Lawrence Berkeley National Laboratory (LBNL)] [Lawrence Berkeley National Laboratory (LBNL); Palumbo, Anthony Vito [ORNL] [ORNL; Van Nostrand, Dr. Joy D. [Oklahoma University; Zhou, Jizhong [University of Oklahoma] [University of Oklahoma; Elias, Dwayne A [ORNL] [ORNL

    2013-01-01T23:59:59.000Z

    Microbial reduction of toxic hexavalent chromium (Cr(VI)) in-situ is a plausible bioremediation strategy in electron-acceptor limited environments. However, higher [Cr(VI)] may impose stress on syntrophic communities and impact community structure and function. The study objectives were to understand the impacts of Cr(VI) concentrations on community structure and on the Cr(VI)-reduction potential of groundwater communities at Hanford, WA. Steady state continuous flow bioreactors were used to grow native communities enriched with lactate (30 mM) and continuously amended with Cr(VI) at 0.0 (No-Cr), 0.1 (Low-Cr) and 3.0 (High-Cr) mg/L. Microbial growth, metabolites, Cr(VI), 16S rRNA gene sequences and GeoChip based functional gene composition were monitored for 15 weeks. Temporal trends and differences in growth, metabolite profiles, and community composition were observed, largely between Low-Cr and High-Cr bioreactors. In both High-Cr and Low-Cr bioreactors, Cr(VI) levels were below detection from week 1 until week 15. With lactate enrichment, native bacterial diversity substantially decreased as Pelosinus spp., and Sporotalea spp., became the dominant groups, but did not significantly differ between Cr concentrations. The Archaea diversity also substantially decreased after lactate enrichment from Methanosaeta (35%), Methanosarcina (17%) and others, to mostly Methanosarcina spp. (95%). Methane production was lower in High-Cr reactors suggesting some inhibition of methanogens. Several key functional genes were distinct in Low-Cr bioreactors compared to High-Cr. Among the Cr resistant microbes, Burkholderia vietnamiensis, Comamonas testosterone and Ralstonia pickettii proliferated in Cr amended bioreactors. In-situ fermentative conditions facilitated Cr(VI) reduction, and as a result 3.0 mg/L Cr(VI) did not impact the overall bacterial community structure.

  11. Influence of hexavalent chromium on lactate-enriched Hanford groundwater microbial communities.

    SciTech Connect (OSTI)

    Somenahally, Anil C [ORNL] [ORNL; Mosher, Jennifer J [ORNL] [ORNL; Yuan, Tong [University of Oklahoma] [University of Oklahoma; Podar, Mircea [ORNL] [ORNL; Phelps, Tommy Joe [ORNL] [ORNL; Brown, Steven D [ORNL] [ORNL; Yang, Zamin Koo [ORNL] [ORNL; Hazen, Terry C [ORNL] [ORNL; Arkin, Adam [Lawrence Berkeley National Laboratory (LBNL)] [Lawrence Berkeley National Laboratory (LBNL); Palumbo, Anthony Vito [ORNL] [ORNL; Zhou, Jizhong [University of Oklahoma] [University of Oklahoma; Elias, Dwayne A [ORNL] [ORNL

    2013-01-01T23:59:59.000Z

    Microbial reduction and immobilization of chromate (Cr(VI)) is a plausible bioremediation strategy. However, higher Cr(VI) concentrations may impose stress on native Cr-reducing communities. We sought to determine if Cr(VI) would influence the lactate enriched native microbial community structure and function in groundwater from the Cr contaminated site at Hanford, WA. Steady state continuous flow bioreactors were amended with lactate and Cr(VI) (0.0, 0.1 and 3.0 mg/L). Microbial growth, metabolites, Cr(VI) concentrations, 16S rRNA gene sequences and GeoChip based functional gene composition in bioreactors were monitored for 15 weeks. Temporal trends and some differences in growth, metabolite profiles, and community composition were observed, largely between Low-Cr and High-Cr bioreactors. In both High-Cr and Low-Cr bioreactors, Cr(VI) was reduced in the bioreactors. With lactate enrichment, the native communities did not significantly differ between Cr concentrations. Native bacterial communities were diverse, whereas after lactate enrichment, Pelosinus spp., and Sporotalea spp., were the most predominant groups in all bioreactors. Similarly, the Archaea diversity significantly decreased from Methanosaeta (35%), Methanosarcina (17%), Halobacteriales (12%), Methanoregula (8%) and others, to mostly Methanosarcina spp. (95%) after lactate enrichment. Composition of several key functional genes was distinct in Low-Cr bioreactors compared to High-Cr. Among the Cr resistant probes (chrA), Burkholderia vietnamiensis, Comamonas testosterone and Ralstonia pickettii proliferated in Cr amended bioreactors. In-situ fermentative conditions facilitated Cr(VI) reduction, and as a result the 3.0 mg/L Cr(VI) did not appear to give chromate reducing strains a competitive advantage for proliferation or for increasing Cr-reduction.

  12. Hantavirus testing in rodents of north-central New Mexico 1993-1995

    SciTech Connect (OSTI)

    Biggs, J.; Bennett, K.; Salisbury, M. [and others

    1996-03-01T23:59:59.000Z

    In 1993, an outbreak of a new strain of hantavirus in the southwestern US indicated that deer mice (Peromyscus maniculatus) was the primary carrier of the virus. In 1993, 1994, and 1995 the Ecological Studies Team (EST) at Los Alamos National Laboratory surveyed small mammal populations using live capture-recapture methods in Los Alamos County, New Mexico, to determine seroprevalence of hantavirus in this region. EST used trapping grids in 1993 and 1994 and used trapping webs in 1995. Grids were 120 m x 120 m (400 ft x 400 ft) with 144 trap stations at each grid. Three webs consisting of 148 traps each were used in 1995. Trapping took place over 4 to 8 consecutive nights. Programs CAPTURE and Distance were used to determine density estimates for grids and webs, respectively. Blood samples were analyzed in 1993 by the Centers for Disease Control and the University of New Mexico, School of Medicine. The 1994 and 1995 samples were analyzed by the University of New Mexico, School of Medicine. The deer mouse (Peromyscus maniculatus) was the most commonly captured species at all locations except one site where voles (Microtus spp.) were the most commonly captured species. Other species sampled included: harvest mice (Reithrodontomys megalotis), woodrats (Neotoma spp.), shrews (Sorex spp.), white-footed mice (Peromyscus leucopus), pinyon mice (Peromyscus trueii), and brush mouse (Peromyscus boylii). Results of the 1993, 1994, and 1995 testing identified a total overall seroprevalence rate among deer mice of approximately 5.5%, 4.2%, and 0%, respectively. Several other species tested positive for the hantavirus but it is uncertain if it is Sin Nombre virus. Further studies will be necessary to quantify seroprevalence rates in those species. Higher seroprevalence rates were found in males than females. Seroprevalence rates for Los Alamos County were much lower than elsewhere in the region.

  13. In vitro activity of sorghum non-tannin polyphenols against grain molding and weathering fungi

    E-Print Network [OSTI]

    Leungchaikul, Patcharin

    1982-01-01T23:59:59.000Z

    moniliforme (Castor 1981). Grain weather1ng 1s a colonizat1on of mature kernels by saprophytic field fungi such as Alternaria spp. The difference be- tween grain molding and weathering 1s not perfectly distinct and the fungi that cause grain molding can... also cause grain weathering. For example, C. lunata and F. moniliforme can 1nfect sorghum late in kernel development or after maturity and, therefore, cause grain weather1ng (Castor 1981) . Fungal infect1on of grain in the field and/or dur1ng...

  14. Spermatogenesis in Boophilus annulatus (Say) and Boophilus microplus (Canestrini) (Acarina: Ixodidae

    E-Print Network [OSTI]

    Irwin, Billy Wayne

    1973-01-01T23:59:59.000Z

    p d ti t t f 1 ~phil 1 t d ~ghf1 ~1) *dt td d 9 df* f. ~ * d morphological variation. Tissue sections of the gonads were mounted on microscope slides and spermatogenesis was studied in the two species; the immature germ cells, stages of develop.... . . . . . . . . . . . . . . . . . . . . 29 6 Ph t 1 g* ph f tt f ~BM2 pp. testis. 33 5 Photomicrograph of late primary spermatocyte snd 11 ll t ~6622 pp. 6Pht 1 gph f gtttl ti f~BM1 spp. testis 33 36 1 Ph t 6 ph i~phil pp. t ti () d spermatocyte (b) primary spermstids...

  15. Prevalence of Arcobacter species in Texas Gulf Coast oysters and water

    E-Print Network [OSTI]

    Huston, Eileen Shih

    2002-01-01T23:59:59.000Z

    of closely related organisms from mussels and oysters, 4) the consideration of shellfish as a high- risk food, and 5) the distribution of arcobacters in shellfish remains unknown. The purpose of this study was to determine the prevalence of Arco(iucter spp.... The primer set ARCO1-ARCO2 allowed amplification of all Aveohactev strains tested, while the primers ARCOI-BUTZ and ARCO I-SKIR resulted in the exclusive amplification of A. butzlevi and A. skivvowii, respectively. The combination of the ARCOI...

  16. Cooking a Cuban Ajiaco: The Columbian Exchange in a Stewpot

    E-Print Network [OSTI]

    Cushman, Gregory T.

    2006-01-01T23:59:59.000Z

    to squeeze the juice of fresh lime (Citrus aurantifolia) — an early Spanish transplant to the West Indies, first domesticated in southeast Asia — over pip- ing-hot bowls of ajiaco at the dinner table.) American squashes (Cucurbita spp.) rank among the world... to these new cir- cumstances, perhaps its subtle suggestion that “Cuba is fated to suffer . . . a never-end- ing state of ferment” and doomed to “lack a stable, enduring core of cultural indic[ators]” was too radical even for revo- lutionaries to accept.24...

  17. Effects of Marine Mammals on Columbia River Salmon Listed under the Endangered Species Act : Recovery Issues for Threatened and Endangered Snake River Salmon : Technical Report 3 of 11.

    SciTech Connect (OSTI)

    Park, Donn L.

    1993-06-01T23:59:59.000Z

    Most research on the Columbia and Snake Rivers in recent years has been directed to downstream migrant salmon (Oncorhynchus spp.) losses at dams. Comparatively little attentions has been given to adult losses. Recently an estimated 378,4000 adult salmon and steelhead (O. mykiss) were unaccounted-for from Bonneville Dam to terminal areas upstream. It is now apparent that some of this loss was due to delayed mortality from wounded by marine mammals. This report reviews the recent literature to define predatory effects of marine mammals on Columbia River salmon.

  18. High-Energy Physics Strategies and Future Large-Scale Projects

    E-Print Network [OSTI]

    Zimmermann, F

    2014-01-01T23:59:59.000Z

    We sketch the actual European and international strategies and possible future facilities. In the near term the High Energy Physics (HEP) community will fully exploit the physics potential of the Large Hadron Collider (LHC) through its high-luminosity upgrade (HL-LHC). Post-LHC options include a linear e+e- collider in Japan (ILC) or at CERN (CLIC), as well as circular lepton or hadron colliders in China (CepC/SppC) and Europe (FCC). We conclude with linear and circular acceleration approaches based on crystals, and some perspectives for the far future of accelerator-based particle physics.

  19. Fungicidal control of Phthium Aphanidermatum in hydroponically grown tomatoes

    E-Print Network [OSTI]

    Acra, Michel Aftim

    1979-01-01T23:59:59.000Z

    spp. was sustained by periodically inoculating new V-8 agar petr1 d1shes with mycelial plugs obta1ned from older cultures. Identification of the Fungus The isolation method employed was one step in determin1ng the spec1es of the fungus. By r eplat... of the dif- ferent treatments indicated that fentin hydroxide was one of the most ef- f tf f gtctde 1 c t 111gP. ~hid mt I tht t tested (Tables 9 and 10). This is 1n contrast to the petr1 dish experi- ments in wh1ch fentin hydroxide was the least...

  20. Design and Manufacture of the RF Power Supply and RF Transmission Line for SANAEM Project Prometheus

    E-Print Network [OSTI]

    Turemen, G; Unel, G; Alacakir, A

    2015-01-01T23:59:59.000Z

    A 1-5 MeV proton beamline is being built by the Turkish Atomic Energy Authority in collaboration with a number of graduate students from different universities. The most important aspect of the project, is to acquire the design ability and manufacturing capability of all the components locally. SPP will be an accelerator and beam diagnostics test facility and it will also serve the detector development community with its low beam current. This paper discusses the design and construction of the RF power supply and the RF transmission line components such as its waveguide converters and its circulator.

  1. Corn Hybrids for Texas. 

    E-Print Network [OSTI]

    Rogers, J. S.; McAfee, T. E.

    1954-01-01T23:59:59.000Z

    Corn Hybrids for Terns ST LOCATIONS AREA I AREA II ARE4 Ill AREA IV 2Prdrie View 7.Tylw lZ.Lockhart 17.Waxahachie 22San Antonio 3.Cleveland 8.Mt. Pbctont I3Brsnha B.Garland 23Lamposas 4.Colbqe Sta. 9Sulphw Spp. 14Holland l9.0reenvilb 24...Stephenville ,J* 5.K'rbyvilb I0.Cbrkdb 15.Tanpk 2ODetiion 25.Wllothe TEXAS AGRICULTURAL EXPERIMENT STATION R. D. LEWIS. DIRECTOR, COLLEGE STATION, TEXAS DIGEST The Texas corn acreage planted to hybrids increased from less than 1 percent of the total acrea...

  2. Life history and habitat associations of the broad wood cockroach, Parcoblatta lata (Blattaria: Blattellidae) and other native cockroaches in the Coastal Plain of South Carolina.

    SciTech Connect (OSTI)

    Horn, Scott; Hanula, James, L.

    2002-06-18T23:59:59.000Z

    Wood cockroaches are an important prey of the red-cockaded woodpecker, Picoides borealis, an endangered species inhabiting pine forests in the southern United States. These woodpeckers forage on the boles of live pine trees, but their prey consists of a high proportion of wood cockroaches, Parcoblatta spp., that are more commonly associated with dead plant material. Cockroach population density samples were conducted on live pine trees, dead snags and coarse woody debris on the ground. The studies showed that snags and logs are also important habitats of wood cockroaches in pine forests.

  3. Amorphous Silicon Solar cells with a Core-Shell Nanograting Structure

    E-Print Network [OSTI]

    Yang, L; Okuno, Y; He, S

    2011-01-01T23:59:59.000Z

    We systematically investigate the optical behaviors of an amorphous silicon solar cell based on a core-shell nanograting structure. The horizontally propagating Bloch waves and Surface Plasmon Polariton (SPP) waves lead to significant absorption enhancements and consequently short-circuit current enhancements of this structure, compared with the conventional planar one. The perpendicular carrier collection makes this structure optically thick and electronically thin. An optimal design is achieved through full-field numerical simulation, and physical explanation is given. Our numerical results show that this configuration has ultrabroadband, omnidirectional and polarization-insensitive responses, and has a great potential in photovoltaics.

  4. Special Publication No. 6, Subject: Nematoda and Nematode Diseases, Part 3: Supergenera, Genera, Species, and Subspecies: F-M.

    E-Print Network [OSTI]

    Doss, Mildred A.

    ., 1912 h, 128-130 Filaria Mueller, 1787 Theiler, G., 1923 a, 28 Filaria Tornquist, ?., 1931 a, 379, 381, 385 Filaria Travassos, L. P., 1920 h, 69 Filaria Underhill, ?. M., 1920 ?, 227 Filaria Vogelsang-Wil??? ns^ E. G., 1928 d, 428 Filaria O....) sp. Johnston, T. H.; and Mawson, P. ?., 1940 c, 355, 356, 361, fig. 26 Calopsittacus novae-hollandiae : New South Wales Filaria (s.l.) spp. J. and M. Johnston, T. H.; and Mawson, P. ?., 1940 c, 369 Filaria (s.l.) sp. Johnston, T. H...

  5. Property:EZFeed/ExpectedCapacity | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSpp Jump to: navigation, search

  6. Property:EZFeed/InstalledCapacity | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSpp Jump to: navigation, searchProperty

  7. Property:EZFeed/JurisdictionDesc | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSpp Jump to: navigation,

  8. Property:EZFeed/JurisdictionImage | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSpp Jump to: navigation,JurisdictionImage

  9. Property:EZFeed/Relevant | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSpp Jump to:

  10. Property:Ease of Application | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSpp Jump to:Ease of Application Jump to:

  11. Property:Editor | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSpp Jump to:Ease of Application Jump

  12. Property:EndDate | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSpp Jump to:Ease of Application

  13. Property:EndYear | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSpp Jump to:Ease of ApplicationEndYear Jump

  14. Property:EnergyAccessImpactAreas | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSpp Jump to:Ease of ApplicationEndYear

  15. Property:EnergyAccessPartner | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSpp Jump to:Ease of

  16. Property:EnergyAccessPowerSource | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSpp Jump to:Ease ofEnergyAccessPowerSource

  17. Property:EnergyAccessPowerUse | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSpp Jump to:Ease

  18. Property:EnergyAccessWebsite | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSpp Jump to:EaseEnergyAccessWebsite Jump

  19. Property:EnergyAccessYearInitiated | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSpp Jump to:EaseEnergyAccessWebsite

  20. Property:EnergyRateStructure | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSpp Jump

  1. Property:EnergyServicesType | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSpp JumpEnergyServicesType Jump to:

  2. Property:EnergyTechnology | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSpp JumpEnergyServicesType Jump

  3. Property:EnvReview | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSpp JumpEnergyServicesType JumpEnvReview

  4. Property:EnvReviewAgency | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSpp JumpEnergyServicesType

  5. Property:EnvReviewDrilling | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSpp JumpEnergyServicesTypeEnvReviewDrilling

  6. Property:EnvReviewInvasiveExploration | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSpp

  7. Property:EnvReviewLeasing | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSppEnvReviewLeasing Jump to: navigation,

  8. Property:EnvReviewNonInvasiveExploration | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSppEnvReviewLeasing Jump to:

  9. Property:EnvReviewPwrPlantSiting | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSppEnvReviewLeasing Jump

  10. Property:EnvironmentalMitigation | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSppEnvReviewLeasing

  11. Property:EstReservoirVol | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSppEnvReviewLeasingEstReservoirVol Jump to:

  12. Property:Estimated End Date | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSppEnvReviewLeasingEstReservoirVol Jump

  13. Property:EstimatedCostHighUSD | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation,PillarPublicationType JumpDOEInvolveRtoSppEnvReviewLeasingEstReservoirVol

  14. Evaluation of dredged material proposed for ocean disposal from Hudson River, New York

    SciTech Connect (OSTI)

    Gardiner, W.W.; Barrows, E.S.; Antrim, L.D.; Gruendell, B.D.; Word, J.Q.; Tokos, J.J.S. [Battelle/Marine Sciences Lab., Sequim, WA (United States)

    1996-09-01T23:59:59.000Z

    The Hudson River (Federal Project No. 41) was one of seven waterways that the U.S. Army Corps of Engineers-New York District (USACE-NYD) requested the Battelle Marine Sciences Laboratory (MSL) to sample and evaluate for dredging and disposal in March 1994. Sediment samples were collected from the Hudson River. Tests and analyses were conducted on Hudson River sediment core samples. The evaluation of proposed dredged material from the Hudson River included bulk sediment chemical analyses, chemical analyses of site water and elutriate, water-column and benthic acute toxicity tests, and bioaccumulation studies. Individual sediment core samples collected from Hudson River were analyzed for grain size, moisture content, and total organic carbon (TOC). A composite sediment sample, representing the entire area proposed for dredging, was analyzed for bulk density, specific gravity, metals, chlorinated pesticides, polychlorinated biphenyl (PCB) congeners, polynuclear aromatic hydrocarbons (PAH), and 1,4-dichlorobenzene. Site water and elutriate water, prepared from the suspended-particulate phase (SPP) of Hudson River sediment, were analyzed for metals, pesticides, and PCBS. Water-column or SPP toxicity tests were performed with three species. Benthic acute toxicity tests were performed. Bioaccumulation tests were also conducted.

  15. Evaluation of dredged material proposed for ocean disposal from Red Hook/Bay Ridge project areas, New York

    SciTech Connect (OSTI)

    Pinza, M.R.; Barrows, E.S.; Borde, A.B. [Battelle/Marine Sciences Lab., Sequim, WA (United States)

    1996-09-01T23:59:59.000Z

    The objective of the Red HookIBay Ridge project was to evaluate proposed dredged material from these two areas to determine its suitability for unconfined ocean disposal at the Mud Dump Site. Sediment samples were collected from the Red Hook/Bay Ridge project areas. Tests and analyses were conducted. The evaluation of proposed dredged material from the Red Hook/Bay Ridge project areas consisted of bulk sediment chemical analyses, chemical analyses of dredging site water and elutriate, water-column and benthic acute toxicity tests. Twenty-four individual sediment core samples were collected from these two areas and analyzed for grain size, moisture content, and total organic carbon (TOC). Three composite sediment samples, representing Red Hook Channel and the two Bay Ridge Reaches to be dredged, were analyzed for bulk density, specific gravity, metals, chlorinated pesticides, polychlorinated biphenyl (PCB) congeners, polynuclear aromatic hydrocarbons (PAH), and 1,4-dichlorobenzene. Dredging site water and elutriate water, which is prepared from the suspended-particulate phase (SPP) of the three Red Hook Bay Ridge sediment composites, were analyzed for metals, pesticides, and PCBS. Benthic acute toxicity tests were performed. Water-column or SPP toxicity tests were performed. Bioaccumulation tests were also conducted.

  16. LONG-TERM CHANGES IN MERCURY CONCENTRATIONS IN FISH FROM THE MIDDLE SAVANNAH RIVER

    SciTech Connect (OSTI)

    Paller, M; Bill Littrell, B

    2007-01-02T23:59:59.000Z

    Total mercury levels were measured in largemouth bass (Micropterus salmoides), ''sunfishes'' (Lepomis spp)., and ''catfish'' (primarily Ameiurus spp.) from 1971 to 2004 in the middle reaches of the Savannah River, which drains the coastal plain of the southeastern U.S. Mercury levels were highest in 1971 but declined over the next ten years due to the mitigation of point sources of industrial pollution. Mercury levels began to increase in the 1980s as a possible consequence of mercury inputs from tributaries and associated wetlands where mercury concentrations were significantly elevated in water and fish. Mercury levels in Savannah River fish decreased sharply in 2001-2003 coincident with a severe drought in the Savannah River basin, but returned to previous levels in 2004 with the resumption of normal precipitation. Regression models showed that mercury levels in Savannah River fish changed significantly over time and were affected by river discharge. Despite temporal changes, there was little overall difference in Savannah River fish tissue mercury levels between 1971 and 2004.

  17. Evaluation of sustained release polylactate electron donors for removal of hexavalent chromium from contaminated groundwater

    SciTech Connect (OSTI)

    Brodie, E.L.; Joyner, D. C.; Faybishenko, B.; Conrad, M. E.; Rios-Velazquez, C.; Mork, B.; Willet, A.; Koenigsberg, S.; Herman, D.; Firestone, M. K.; Hazen, T. C.; Malave, Josue; Martinez, Ramon

    2011-02-15T23:59:59.000Z

    To evaluate the efficacy of bioimmobilization of Cr(VI) in groundwater at the Department of Energy Hanford site, we conducted a series of microcosm experiments using a range of commercial electron donors with varying degrees of lactate polymerization (polylactate). These experiments were conducted using Hanford Formation sediments (coarse sand and gravel) immersed in Hanford groundwater, which were amended with Cr(VI) and several types of lactate-based electron donors (Hydrogen Release Compound, HRC; primer-HRC, pHRC; extended release HRC) and the polylactate-cysteine form (Metal Remediation Compound, MRC). The results showed that polylactate compounds stimulated an increase in bacterial biomass and activity to a greater extent than sodium lactate when applied at equivalent carbon concentrations. At the same time, concentrations of headspace hydrogen and methane increased and correlated with changes in the microbial community structure. Enrichment of Pseudomonas spp. occurred with all lactate additions, and enrichment of sulfate-reducing Desulfosporosinus spp. occurred with almost complete sulfate reduction. The results of these experiments demonstrate that amendment with the pHRC and MRC forms result in effective removal of Cr(VI) from solution most likely by both direct (enzymatic) and indirect (microbially generated reductant) mechanisms.

  18. Thermal ecology of Naegleria fowleri from a power plant cooling reservoir

    SciTech Connect (OSTI)

    Huizinga, H.W. (Illinois State Univ., Normal (USA)); McLaughlin, G.L. (Univ. of Illinois, Urbana (USA))

    1990-07-01T23:59:59.000Z

    The pathogenic, free-living amoeba Naegleria fowleri is the causative agent of human primary amebic meningoencephalitis. N. fowleri has been isolated from thermally elevated aquatic environments worldwide, but temperature factors associated with occurrence of the amoeba remain undefined. In this study, a newly created cooling reservoir (Clinton Lake, Illinois) was surveyed for Naegleria spp. before and after thermal additions from a nuclear power plant. Water and sediment samples were collected from heated and unheated arms of the reservoir and analyzed for the presence of thermophilic Naegleria spp. and pathogenic N. fowleri. Amoebae were identified by morphology, in vitro cultivation, temperature tolerance, mouse pathogenicity assay, and DNA restriction fragment length analysis. N. fowleri was isolated from the thermally elevated arm but not from the ambient-temperature arm of the reservoir. The probability of isolating thermophilic Naegleria and pathogenic N. fowleri increased significantly with temperature. Repetitive DNA restriction fragment profiles of the N. fowleri Clinton Lake isolates and a known N. fowleri strain of human origin were homogeneous.

  19. Monitoring seasonal and annual wetland changes in a freshwater marsh with SPOT HRV data

    SciTech Connect (OSTI)

    Mackey, H.E. Jr.

    1989-01-01T23:59:59.000Z

    Eleven dates of SPOT HRV data along with near-concurrent vertical aerial photographic and phenological data for 1987, 1988, and 1989 were evaluated to determine seasonal and annual changes in a 400-hectare, southeastern freshwater marsh. Early April through mid-May was the best time to discriminate among the cypress (Taxodium distichum)/water tupelo (Nyssa acquatica) swamp forest and the non-persistent (Ludwigia spp.) and persistent (Typha spp.) stands in this wetlands. Furthermore, a ten-fold decrease in flow rate from 11 cubic meters per sec (cms) in 1987 to one cms in 1988 was recorded in the marsh followed by a shift to drier wetland communities. The Savannah River Site (SRS), maintained by the US Department of Energy, is a 777 km{sup 2} area located in south central South Carolina. Five tributaries of the Savannah River run southwest through the SRS and into the floodplain swamp of the Savannah River. This paper describes the use of SPOT HRV data to monitor seasonal and annual trends in one of these swamp deltas, Pen Branch Delta, during a three-year period, 1987--1989.

  20. Monitoring seasonal and annual wetland changes in a freshwater marsh with SPOT HRV data

    SciTech Connect (OSTI)

    Mackey, H.E. Jr.

    1989-12-31T23:59:59.000Z

    Eleven dates of SPOT HRV data along with near-concurrent vertical aerial photographic and phenological data for 1987, 1988, and 1989 were evaluated to determine seasonal and annual changes in a 400-hectare, southeastern freshwater marsh. Early April through mid-May was the best time to discriminate among the cypress (Taxodium distichum)/water tupelo (Nyssa acquatica) swamp forest and the non-persistent (Ludwigia spp.) and persistent (Typha spp.) stands in this wetlands. Furthermore, a ten-fold decrease in flow rate from 11 cubic meters per sec (cms) in 1987 to one cms in 1988 was recorded in the marsh followed by a shift to drier wetland communities. The Savannah River Site (SRS), maintained by the US Department of Energy, is a 777 km{sup 2} area located in south central South Carolina. Five tributaries of the Savannah River run southwest through the SRS and into the floodplain swamp of the Savannah River. This paper describes the use of SPOT HRV data to monitor seasonal and annual trends in one of these swamp deltas, Pen Branch Delta, during a three-year period, 1987--1989.

  1. Long-term Stewardship of Mixed Wastes: Passive Reactive Barriers for Simultaneous In Situ Remediation of Chlorinated Solvent, Heavy Metal and Radioactive

    SciTech Connect (OSTI)

    Gerlach, Robin

    2005-06-01T23:59:59.000Z

    This project report addresses one part of a 3-way collaboration between researchers (Drs. Robin Gerlach and Al Cunningham) at Montana State University's (MSU's) Center for Biofilm Engineering (CBE), (Dr. Brent Peyton at) the WSU/NSF IGERT Center for Multiphase Environmental Research (CMER) at Washington State University (WSU), and (Drs. William Apel and Frank Roberto at) the Biotechnology Department at the INEEL. Each part of this project is funded under a different contract with the Science Division of the US Department of Energy. The project is designed to evaluate the possibility to develop a subsurface remediation technology for mixed wastes at Department of Energy sites using a group of common soil bacteria of the genus Cellulomonas. We are seeking to gain a better understanding of microbial transformation of chromium, uranium, and carbon tetrachloride by Cellulomonas spp. in simulated subsurface environments.

  2. Evaluation of dredged material proposed for ocean disposal from Shark River Project area

    SciTech Connect (OSTI)

    Antrim, L.D.; Gardiner, W.W.; Barrows, E.S.; Borde, A.B. [Battelle/Marine Sciences Lab., Sequim, WA (United States)

    1996-09-01T23:59:59.000Z

    The objective of the Shark River Project was to evaluate proposed dredged material to determine its suitability for unconfined ocean disposal at the Mud Dump Site. Tests and analyses were conducted on the Shark River sediments. The evaluation of proposed dredged material consisted of bulk sediment chemical and physical analysis, chemical analyses of dredging site water and elutriate, water-column and benthic acute toxicity tests, and bioaccumulation tests. Individual sediment core samples collected from the Shark River were analyzed for grain size, moisture content, and total organic carbon (TOC). One sediment composite was analyzed for bulk density, specific gravity, metals, chlorinated pesticides, polychlorinated biphenyl (PCB) congeners, polynuclear aromatic hydrocarbons (PAHs), and 1,4- dichlorobenzene. Dredging site water and elutriate, prepared from suspended-particulate phase (SPP) of the Shark River sediment composite, were analyzed for metals, pesticides, and PCBs. Benthic acute toxicity tests and bioaccumulation tests were performed.

  3. Active particles in heterogeneous media display new physics: existence of an optimal noise and absence of bands and long-range order

    E-Print Network [OSTI]

    Chepizhko, Oleksandr

    2015-01-01T23:59:59.000Z

    We present a detailed study of the large-scale collective properties of self-propelled particles (SPPs) moving in two-dimensional heterogeneous spaces. The impact of spatial heterogeneities on the ordered, collectively moving phase is investigated. We show that for strong enough spatial heterogeneity, the well-documented high-density, high-ordered propagating bands that emerge in homogeneous space disappears. Moreover, the ordered phase does not exhibit long-range order, as occurs in homogeneous systems, but rather quasi-long range order: i.e. the SPP system becomes disordered in the thermodynamical limit. For finite size systems, we find that there is an optimal noise value that maximizes order. Interestingly, the system becomes disordered in two limits, for high noise values as well as for vanishing noise. This remarkable finding strongly suggests the existence of two critical points, instead of only one, associated to the collective motion transition. Density fluctuations are consistent with these observat...

  4. Multipole surface plasmons in metallic nanohole arrays

    E-Print Network [OSTI]

    Nishida, Munehiro; Kadoya, Yutaka

    2015-01-01T23:59:59.000Z

    The quasi-bound electromagnetic modes for the arrays of nanoholes perforated in thin gold film are analyzed both numerically by the rigorous coupled wave analysis (RCWA) method and semi-analytically by the coupled mode method. It is shown that when the size of the nanohole occupies large portion of the unit cell, the surface plasmon polaritons (SPPs) at both sides of the film are combined by the higher order waveguide modes of the holes to produce multipole surface plasmons: coupled surface plasmon modes with multipole texture on the electric field distributions. Further, it is revealed that the multipole texture either enhances or suppresses the couplings between SPPs depending on their diffraction orders and also causes band inversion and reconstruction in the coupled SPP band structure. Due to the multipole nature of the quasi-bound modes, multiple dark modes coexist to produce variety of Fano resonance structures on the transmission and reflection spectra.

  5. Rock Island Dam Smolt Monitoring; 1996 Annual Report.

    SciTech Connect (OSTI)

    McDonald, Robert (Chelan County Public Utility District No. 1, Power Operations Department, Wenatchee, WA)

    1996-10-01T23:59:59.000Z

    Downstream migrating salmon and steelhead (Oncoryhnchus spp.) smolts were monitored at the Rock Island Dam bypass trap from April 1--August 31, 1996. This was the twelfth consecutive year that the bypass trap was monitored. Data collected included: (1) number of fish collected by species, (2) number of fin clipped and/or Passive Integrated Transponder (PIT) tagged fish caught by species, (3) total number of fish showing signs of gas bubble trauma (GBT), (4) percent of descaled fish, and (5) daily average river flow, powerhouse {number_sign}1 flow, powerhouse {number_sign}2 flow and daily average spill. These data were transmitted to the Fish Passage Center (FPC), which manages the Smolt Monitoring Program throughout the Columbia River Basin. The Smolt Monitoring Program is used to manage the water budget, releasing upstream reservoir water storage allocated to supplement river flows during the downstream migration of juvenile salmonids.

  6. Nonlinear behavior of vibrating molecules on suspended graphene waveguides

    E-Print Network [OSTI]

    Banerjee, Amrita

    2015-01-01T23:59:59.000Z

    Suspended graphene waveguides were deposited on micron-scale periodic metal (plasmonic) structures. Raman scattering of test molecules (B. Megaterium), deposited on the waveguides' surface, exhibited azimuthal cycles upon rotation: at these micron scales, spontaneous Raman ought to be independent of phase matching conditions. In addition, we observed angular-selective quadratic intensity dependence contrary to the typical linear behavior of spontaneous Raman. The effects were observed at very modest pump laser intensities (<10 MW/cm2 at the sample surface, oftenly used in Raman experiments). We attributed these observations to nonlinear coupling between the vibrating molecules and surface plasmon polariton (SPP) modes at the molecular vibration frequency. It was assessed that the polariton mode propagates through fairly long distances (over 100 microns).

  7. Dove Management in Texas

    E-Print Network [OSTI]

    Taylor, Ben; Johnson, Jason; Roberson, Jay; Schwertner, T. Wayne; Silvy, Nova; Linex, Ricky

    2006-05-03T23:59:59.000Z

    spp. Panic grasses Pricklypoppy Sunflowers Wolfberry Plains bristlegrass Saw-leaf daisy Wheat Sorghum alum Snow-on-the-mountain Spurges Vetch Western ragweed 4 In both species, the female typically lays two eggs, each laid 1 day apart (Fig. 6... ?2 16 Plains bristlegrass 3 1 12/1?4/15 1 ?4? 1 ?2 12 Sorghum alum 6 2 12/1?5/31 1 ?4? 1 ?2 16 Sunflower, Maximilian 3 1 12/1?4/15 1 ?4? 1 ?2 20 Western ragweed 7.5 2.5 12/1?4/15 1 ?4? 1 ?2 20 Annuals, warm season Cowpea 6 15 5 4/1?5/31 1?2 20 Kenaf 1...

  8. Constraint on the CKM angle $\\alpha$ from the experimental measurements of CP violation in $B_d^0 \\to \\pi^+ \\pi^-$ decay

    E-Print Network [OSTI]

    Lü, C D; L\\"u, Cai-Dian; Xiao, Zhenjun

    2002-01-01T23:59:59.000Z

    In this paper, we study and try to find the constraint on the CKM angle $\\alpha$ from the experimental measurements of CP violation in $B_d^0 \\to \\pi^+ \\pi^-$ decay, as reported very recently by BaBar and Belle Collaborations. After considering uncertainties of the data and the ratio $r$ of penguin over tree amplitude, we found that: (a) strong constraint on both the CKM angle $\\alpha$ and the strong phase $\\delta$ can be obtained from the measured $\\spp$, $A_{\\pi\\pi}$: only the ranges of $86^\\circ \\leq \\alpha \\leq 148^\\circ$ and $31^\\circ \\leq \\delta \\leq 143^\\circ$ are still allowed by $1\\sigma$ of the averaged data; (b) For Belle's result alone, the limit on $\\alpha$ is $95^\\circ \\leq \\alpha \\leq 152^\\circ$. The angle $\\alpha$ larger than $90^\\circ$ is strongly preferred.

  9. Spectral modeling for the identification and quantification of algal blooms: A test of approach

    SciTech Connect (OSTI)

    Malthus, T.J.; Grieve, L. [Univ. of Edinburgh (United Kingdom); Harwar, M.D. [Univ. of Wolverhampton (United Kingdom)

    1997-06-01T23:59:59.000Z

    The aim of this paper is to develop and test a Monte Carlo modelling approach for the characterization of reflectance for different bloom-forming marine phytoplankton species. The model was tested on optical data for four species (Dunaliella salina, Pavlova pinguis, Emiliania huxleyi and Synechocystes spp.) and simulations performed over a range of chlorophyll concentrations. Discriminant analysis identified 10 key wavelengths which could be used to maximize the separation between the four species. The resulting wavelengths were combined in a neural network to show 100% accuracy in classifying species type. Further simulations were undertaken to investigate the effect of aquatic humus on reflectance characteristics and the change in wavelengths for algal discrimination. The implications for the development of algorithms for the identification of algal bloom species type by remote sensing are briefly discussed.

  10. Quantum plasmonic excitation in graphene and robust-to-loss propagation

    E-Print Network [OSTI]

    Hanson, George W; Lee, Changhyoup; Angelakis, Dimitris G; Tame, Mark

    2015-01-01T23:59:59.000Z

    We investigate the excitation of quantum plasmonic states of light in graphene using end-fire and prism coupling. In order to model the excitation process quantum mechanically we quantize the transverse-electric and transverse-magnetic surface plasmon polariton (SPP) modes in graphene. A selection of regimes are then studied that enable the excitation of SPPs by photons and we show that efficient coupling of photons to graphene SPPs is possible at the quantum level. Futhermore, we study the excitation of quantum states and their propagation under the effects of loss induced from the electronic degrees of freedom in the graphene. Here, we investigate whether it is possible to protect quantum information using quantum error correction techniques. We find that these techniques provide a robust-to-loss method for transferring quantum states of light in graphene over large distances.

  11. The PI3K regulatory subunits p55? and p50? regulate cell death in vivo

    E-Print Network [OSTI]

    Pensa, S.; Neoh, K.; Resemann, H. K.; Kreuzaler, P. A.; Abell, K.; Clarke, N. J.; Reinheckel, T.; Kahn, C. R.; Watson, C. J.

    2014-06-06T23:59:59.000Z

    and 2 respectively) and a subset of these was validated by QRT-PCR (Figure 3c). Interestingly, a number of these genes are associated with cell migration and tissue remodelling and the acute phase response (APR). While osteopontin (Spp1), SAA2 and Tlr2... -fitting handheld homogenizer in 1 ml of subcellular fractionation buffer (HEPES-KOH 20 mM, sucrose 250 mM, KCl 10 mM, MgCl2 1.5 mM, EDTA 1 mM, EGTA 1 mM, dithiothreitol 8 mM, Pefabloc 1mM (Sigma Aldrich, MO, US), at pH 7.5). Debris and nuclei were pelleted at 750g...

  12. Reduction of Health Risks Due to Chromium(VI)Using Mesquite: A Potential Cr Phytoremediator

    SciTech Connect (OSTI)

    Gardea-Torresdey, Jorge L.; Aldrich, Mary V.; Peralta-Videa, Jose R.; Parsons, Jason G.

    2004-03-29T23:59:59.000Z

    Chromium is a transition metal extensively used in industry. Cr mining and industrial operations account for chromium wastes at Superfund sites in the United States. A study was performed to investigate the possibility of using mesquite (Prosopis spp.), which is an indigenous desert plant species, to remove Cr from contaminated sites. In this study, mesquite plants were grown in an agar-based medium containing 75 mg L-1 and 125 mg L-1 of Cr(VI). The Cr content of leaf tissue (992 mg kg-1 of dry weight, from 125 mg L-1 of Cr(VI)) indicated that mesquite could be classified as a chromium hyperaccumulator. X-ray absorption spectroscopy (XAS) studies performed to experimental samples showed that mesquite roots absorbed some of the supplied Cr(VI). However, the data analyses of plant tissues demonstrated that the absorbed Cr(VI) was fully reduced to Cr(III) in the leaf tissue.

  13. How sulphate-reducing microorganisms cope with stress: Lessons from systems biology

    SciTech Connect (OSTI)

    Zhou, J.; He, Q.; Hemme, C.L.; Mukhopadhyay, A.; Hillesland, K.; Zhou, A.; He, Z.; Nostrand, J.D. Van; Hazen, T.C.; Stahl, D.A.; Wall, J.D.; Arkin, A.P.

    2011-04-01T23:59:59.000Z

    Sulphate-reducing microorganisms (SRMs) are a phylogenetically diverse group of anaerobes encompassing distinct physiologies with a broad ecological distribution. As SRMs have important roles in the biogeochemical cycling of carbon, nitrogen, sulphur and various metals, an understanding of how these organisms respond to environmental stresses is of fundamental and practical importance. In this Review, we highlight recent applications of systems biology tools in studying the stress responses of SRMs, particularly Desulfovibrio spp., at the cell, population, community and ecosystem levels. The syntrophic lifestyle of SRMs is also discussed, with a focus on system-level analyses of adaptive mechanisms. Such information is important for understanding the microbiology of the global sulphur cycle and for developing biotechnological applications of SRMs for environmental remediation, energy production, biocorrosion control, wastewater treatment and mineral recovery.

  14. Time-resolved measurement of single pulse femtosecond laser-induced periodic surface structure formation

    E-Print Network [OSTI]

    Kafka, K R P; Li, H; Yi, A; Cheng, J; Chowdhury, E A

    2015-01-01T23:59:59.000Z

    Time-resolved diffraction microscopy technique has been used to observe the formation of laser-induced periodic surface structures (LIPSS) from the interaction of a single femtosecond laser pulse (pump) with a nano-scale groove mechanically formed on a single-crystal Cu substrate. The interaction dynamics (0-1200 ps) was captured by diffracting a time-delayed, frequency-doubled pulse from nascent LIPSS formation induced by the pump with an infinity-conjugate microscopy setup. The LIPSS ripples are observed to form sequentially outward from the groove edge, with the first one forming after 50 ps. A 1-D analytical model of electron heating and surface plasmon polariton (SPP) excitation induced by the interaction of incoming laser pulse with the groove edge qualitatively explains the time-evloution of LIPSS formation.

  15. Runoff water quality and vegetation production on reclaimed mine spoil in the Post Oak Savannah of Texas 

    E-Print Network [OSTI]

    Losensky, Karen Mae

    1986-01-01T23:59:59.000Z

    FALL 1985 6oa 61bc 60ab 28b 22a 25b 58ab 79a 68a 36b 8b 22b 89b 79c 81 c 98a 95a 99a 77c 83c Blbc 80cd 76c 78d 88ab 93ab 89ab 93ab 96a 96a 1 Similar letters in each column are not significantly different at the P 45 level. 26 Planted... NON-SEEDED SPP ALL SPECIES COLLECTION DATES TS OB ALL TS OB ALL TS OB ALL SPRING 1984 S1RUIER 1984 FALL 1984 17ab 26b 46bc 66ab 56b 34b 34b 23a 29ab 47a 25a 36a 36b 23a 29ab 47c 42c 52bc 46c 53bc 46c 37c SPRING 1985 42c SUMl81ER 1985 39c...

  16. Metallurgical evaluation of recycled stainless steel

    SciTech Connect (OSTI)

    Imrich, K.J.

    1997-01-22T23:59:59.000Z

    Recycled Type 304 stainless steel from both Carolina Metals Inc. (CMI) and Manufacturing Science Corporation (MSC) met all the requirements of ASTM A-240 required by Procurement Specification G-SPP-K-00005 Rev. 4. Mechanical strength and corrosion resistance of the material are adequate for service as burial boxes, overpacks, and drums. Inclusion content of both manufacturer`s material was high, resulting in a corresponding decrease in the corrosion resistance. Therefore, an evaluation of the service conditions should be performed before this material is approved for other applications. These heats of stainless steel are not suitable for fabricating DWPF glass canisters because the inclusion and carbon contents are high. However, MSC has recently installed a vacuum induction furnace capable of producing L grade material with a low inclusion content. Material produced from this furnace should be suitable for canister material if appropriate care is taken during the melting/casting process.

  17. Evaluation of dredged material proposed for ocean disposal from Eastchester Project Area, New York

    SciTech Connect (OSTI)

    Antrim, L.D.; Pinza, M.R.; Barrows, E.S.; Gardiner, W.W.; Tokos, J.J.S.; Gruendell, B.D.; Word, J.Q. [Battelle Marine Research Lab., Sequim, WA (United States)

    1996-07-01T23:59:59.000Z

    The objective of the Eastchester project (Federal Project [FP] No. 6) was to evaluate proposed dredged material from the Eastchester project area in the Hutchinson River to determine its suitability for unconfined ocean disposal at the Mud Dump Site. Eastchester was one of seven waterways that the U. S. Army Corps of Engineers-New York District (USACE-NYD) requested the Battelle/Marine Sciences Laboratory (MSL) to sample and evaluate for dredging and disposal in March 1994. The evaluation of proposed dredged material from the Eastchester project area consisted of bulk sediment chemical analyses, chemical analyses of dredging site water and elutriate, water- column and benthic acute toxicity tests, and bioaccumulation studies. Eighteen individual sediment core samples collected from the Eastchester project area were analyzed for grain size, moisture content, and total organic carbon (TOC). Two composite sediment samples, representing the upstream and lower reaches of the area proposed for dredging, were analyzed for bulk density, specific gravity, metals, chlorinated pesticides, polychlorinated biphenyl (PCB) congeners, polynuclear aromatic hydrocarbons (PAHs), and 1,4- dichlorobenzene. Dredging site water and elutriate water, which is prepared from the suspended-particulate phase (SPP) of the two Eastchester sediment composites, were analyzed for metals, pesticides, and PCBS. An additional 1 1 composite samples were created for the USACE-New England Division (USACE-NED) using the same 18 Eastchester core samples but combined into different composites. These composites were analyzed for metals, chlorinated pesticides, PCB congeners, PAHS, and 1,4-dichlorobenzene. Water-column or SPP toxicity tests were performed along with bioaccumulation tests.

  18. Evaluation of Subsurface Flow and Free-water Surface Wetlands Treating NPR-3 Produced Water - Year No. 1

    SciTech Connect (OSTI)

    Myers, J. E.; Jackson, L. M.

    2001-10-13T23:59:59.000Z

    This paper is a summary of some of the activities conducted during the first year of a three-year cooperative research and development agreement (CRADA) between the Department of Energy (DOE) Rocky Mountain Oilfield Testing Center (RMOTC) and Texaco relating to the treatment of produced water by constructed wetlands. The first year of the CRADA is for design, construction and acclimation of the wetland pilot units. The second and third years of the CRADA are for tracking performance of pilot wetlands as the plant and microbial communities mature. A treatment wetland is a proven technology for the secondary and tertiary treatment of produced water, storm water and other wastewaters. Treatment wetlands are typically classified as either free-water surface (FWS) or subsurface flow (SSF). Both FWS and SSF wetlands work well when properly designed and operated. This paper presents a collection of kinetic data gathered from pilot units fed a slipstream of Wyoming (NPR-3) produced water. The pilot units are set up outdoors to test climatic influences on treatment. Monitoring parameters include evapotranspiration, plant growth, temperature, and NPDES discharge limits. The pilot wetlands (FWS and SSF) consist of a series of 100-gal plastic tubs filled with local soils, gravel, sharp sand and native wetland plants (cattail (Typha spp.), bulrush (Scirpus spp.), dwarf spikerush (Eleocharis)). Feed pumps control hydraulic retention time (HRT) and simple water control structures control the depth of water. The treated water is returned to the existing produced water treatment system. All NPDES discharge limits are met. Observations are included on training RMOTC summer students to do environmental work.

  19. Linking ceragenins to water-treatment membranes to minimize biofouling.

    SciTech Connect (OSTI)

    Hibbs, Michael R.; Altman, Susan Jeanne; Feng, Yanshu (Brigham Young University, Provo, Utah); Savage, Paul B. (Brigham Young University, Provo, Utah); Pollard, Jacob (Brigham Young University, Provo, Utah); Branda, Steven S.; Goeres, Darla (Montana State University, Bozeman, MT); Buckingham-Meyer, Kelli (Montana State University, Bozeman, MT); Stafslien, Shane (North Dakota State University, Fargo, ND); Marry, Christopher; Jones, Howland D. T.; Lichtenberger, Alyssa; Kirk, Matthew F.; McGrath, Lucas K. (LMATA, Albuquerque, NM)

    2012-01-01T23:59:59.000Z

    Ceragenins were used to create biofouling resistant water-treatment membranes. Ceragenins are synthetically produced antimicrobial peptide mimics that display broad-spectrum bactericidal activity. While ceragenins have been used on bio-medical devices, use of ceragenins on water-treatment membranes is novel. Biofouling impacts membrane separation processes for many industrial applications such as desalination, waste-water treatment, oil and gas extraction, and power generation. Biofouling results in a loss of permeate flux and increase in energy use. Creation of biofouling resistant membranes will assist in creation of clean water with lower energy usage and energy with lower water usage. Five methods of attaching three different ceragenin molecules were conducted and tested. Biofouling reduction was observed in the majority of the tests, indicating the ceragenins are a viable solution to biofouling on water treatment membranes. Silane direct attachment appears to be the most promising attachment method if a high concentration of CSA-121a is used. Additional refinement of the attachment methods are needed in order to achieve our goal of several log-reduction in biofilm cell density without impacting the membrane flux. Concurrently, biofilm forming bacteria were isolated from source waters relevant for water treatment: wastewater, agricultural drainage, river water, seawater, and brackish groundwater. These isolates can be used for future testing of methods to control biofouling. Once isolated, the ability of the isolates to grow biofilms was tested with high-throughput multiwell methods. Based on these tests, the following species were selected for further testing in tube reactors and CDC reactors: Pseudomonas ssp. (wastewater, agricultural drainage, and Colorado River water), Nocardia coeliaca or Rhodococcus spp. (wastewater), Pseudomonas fluorescens and Hydrogenophaga palleronii (agricultural drainage), Sulfitobacter donghicola, Rhodococcus fascians, Rhodobacter katedanii, and Paracoccus marcusii (seawater), and Sphingopyxis spp. (groundwater). The testing demonstrated the ability of these isolates to be used for biofouling control testing under laboratory conditions. Biofilm forming bacteria were obtained from all the source water samples.

  20. Genomic Analyses of Bacterial Porin-Cytochrome Gene Clusters

    SciTech Connect (OSTI)

    Shi, Liang; Fredrickson, Jim K.; Zachara, John M.

    2014-11-26T23:59:59.000Z

    The porin-cytochrome (Pcc) protein complex is responsible for trans-outer membrane electron transfer during extracellular reduction of Fe(III) by the dissimilatory metal-reducing bacterium Geobacter sulfurreducens PCA. The identified and characterized Pcc complex of G. sulfurreducens PCA consists of a porin-like outer-membrane protein, a periplasmic 8-heme c type cytochrome (c-Cyt) and an outer-membrane 12-heme c-Cyt, and the genes encoding the Pcc proteins are clustered in the same regions of genome (i.e., the pcc gene clusters) of G. sulfurreducens PCA. A survey of additionally microbial genomes has identified the pcc gene clusters in all sequenced Geobacter spp. and other bacteria from six different phyla, including Anaeromyxobacter dehalogenans 2CP-1, A. dehalogenans 2CP-C, Anaeromyxobacter sp. K, Candidatus Kuenenia stuttgartiensis, Denitrovibrio acetiphilus DSM 12809, Desulfurispirillum indicum S5, Desulfurivibrio alkaliphilus AHT2, Desulfurobacterium thermolithotrophum DSM 11699, Desulfuromonas acetoxidans DSM 684, Ignavibacterium album JCM 16511, and Thermovibrio ammonificans HB-1. The numbers of genes in the pcc gene clusters vary, ranging from two to nine. Similar to the metal-reducing (Mtr) gene clusters of other Fe(III)-reducing bacteria, such as Shewanella spp., additional genes that encode putative c-Cyts with predicted cellular localizations at the cytoplasmic membrane, periplasm and outer membrane often associate with the pcc gene clusters. This suggests that the Pcc-associated c-Cyts may be part of the pathways for extracellular electron transfer reactions. The presence of pcc gene clusters in the microorganisms that do not reduce solid-phase Fe(III) and Mn(IV) oxides, such as D. alkaliphilus AHT2 and I. album JCM 16511, also suggests that some of the pcc gene clusters may be involved in extracellular electron transfer reactions with the substrates other than Fe(III) and Mn(IV) oxides.