National Library of Energy BETA

Sample records for miles driven avg

  1. AVG Koeln GmbH | Open Energy Information

    Open Energy Info (EERE)

    AVG Koeln GmbH Jump to: navigation, search Name: AVG Koeln GmbH Place: Kln, Germany Zip: 50735 Product: Operating a Waste-to-Energy facility in Kln, Germany. References:...

  2. Chapter 3. Vehicle-Miles Traveled

    U.S. Energy Information Administration (EIA) Indexed Site

    3. Vehicle-Miles Traveled Chapter 3. Vehicle-Miles Traveled Vehicle-miles traveled--the number of miles that residential vehicles are driven--is probably the most important...

  3. Property:CoolingTowerWaterUseAnnlAvgConsumed | Open Energy Information

    Open Energy Info (EERE)

    Property Name CoolingTowerWaterUseAnnlAvgConsumed Property Type Number Description Cooling Tower Water use (annual average) (afday) Consumed. Retrieved from "http:...

  4. Robin Miles

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Robin Miles Mechanical Engineer Robin Miles is an expert at targeting You've been at the Lab 15 years. Where did you start out? I first worked at the LLNL Microfabrication Facility Microtechnology Center where I came to work on NA-22, a DOE program to reduce threats to national security through developing new and novel technology. I was group leader for microfluidics (control of fluids on a sub-millimeter scale) in the bioengineering group. We built systems around sensors for biological and

  5. Property:CoolingTowerWaterUseAnnlAvgGross | Open Energy Information

    Open Energy Info (EERE)

    Property Name CoolingTowerWaterUseAnnlAvgGross Property Type Number Description Cooling Tower Water use (annual average) (afday) Gross. Retrieved from "http:en.openei.orgw...

  6. Miles Hand Grenade

    DOE Patents [OSTI]

    Harrington, John J.; Buttz, James H.; Maish, Alex B.; Page, Ray R.; Metcalf, Herbert E.

    2005-11-15

    A simulated grenade for MILES-type simulations generates a unique RF signal and a unique audio signal. A detector utilizes the time between receipt of the RF signal and the slower-traveling audio signal to determine the distance between the detector and the simulated grenade.

  7. Fact #860 February 16, 2015 Relationship of Vehicle Miles of Travel and the Price of Gasoline

    Broader source: Energy.gov [DOE]

    The prices of gasoline and diesel fuel affect the transportation sector in many ways. For example, fuel prices can impact the number of miles driven and affect the choices consumers make when...

  8. Miles Electric Vehicles | Open Energy Information

    Open Energy Info (EERE)

    Electric Vehicles Jump to: navigation, search Name: Miles Electric Vehicles Place: Santa Monica, California Zip: 90405 Sector: Vehicles Product: California-based developer of...

  9. Mile High: Order (2012-SE-4501)

    Broader source: Energy.gov [DOE]

    DOE ordered Mile High Equipment, LLC to pay a $17,525 civil penalty after finding Mile High had manufactured and distributed in commerce in the U.S. approximately 109 units of lce-O-Matic brand automatic commercial ice maker basic model ICE2106 FW, HW, a noncompliant product.

  10. Mile High: Noncompliance Determination (2012-SE-4501)

    Broader source: Energy.gov [DOE]

    DOE issued a Notice of Noncompliance Determination to Mile High Equipment, LLC finding that Ice-O-Matic brand automatic commercial ice maker basic model ICE2106 FW, HW does not comport with the energy conservation standards.

  11. Mile High: Proposed Penalty (2012-SE-4501)

    Broader source: Energy.gov [DOE]

    DOE alleged in a Notice of Proposed Civil Penalty that Mile High Equipment, LLC manufactured and distributed noncompliant Ice-O-Matic brand automatic commercial ice maker basic model ICE2106 FW, HW in the U.S.

  12. Compound and Elemental Analysis At Seven Mile Hole Area (Larson...

    Open Energy Info (EERE)

    Seven Mile Hole Area (Larson, Et Al., 2009) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Compound and Elemental Analysis At Seven Mile Hole...

  13. Alternative Fuels Data Center: Oregon Celebrates 200 Miles of Electric

    Alternative Fuels and Advanced Vehicles Data Center [Office of Energy Efficiency and Renewable Energy (EERE)]

    Highways Oregon Celebrates 200 Miles of Electric Highways to someone by E-mail Share Alternative Fuels Data Center: Oregon Celebrates 200 Miles of Electric Highways on Facebook Tweet about Alternative Fuels Data Center: Oregon Celebrates 200 Miles of Electric Highways on Twitter Bookmark Alternative Fuels Data Center: Oregon Celebrates 200 Miles of Electric Highways on Google Bookmark Alternative Fuels Data Center: Oregon Celebrates 200 Miles of Electric Highways on Delicious Rank

  14. Pennsylvania Nuclear Profile - Three Mile Island

    U.S. Energy Information Administration (EIA) Indexed Site

    Three Mile Island" "Unit","Summer capacity (mw)","Net generation (thousand mwh)","Summer capacity factor (percent)","Type","Commercial operation date","License expiration date" 1,805,"6,634",94.1,"PWR","application/vnd.ms-excel","application/vnd.ms-excel" ,805,"6,634",94.1

  15. March 28, 1979: Three Mile Island | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    March 28, 1979: Three Mile Island March 28, 1979 A partial meltdown of the core occurs at one of the two reactors at the Three Mile Island nuclear power plant near Harrisburg, ...

  16. Full Useful Life (120,000 miles) Exhaust Emission Performance...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Full Useful Life (120,000 miles) Exhaust Emission Performance of a NOx Adsorber and Diesel ... with Ultralow-Sulfur Fuel Full Useful Life (120,000 miles) Exhaust Emission ...

  17. Salt Wells, Eight Mile Flat | Open Energy Information

    Open Energy Info (EERE)

    Eight Mile Flat Jump to: navigation, search OpenEI Reference LibraryAdd to library Web Site: Salt Wells, Eight Mile Flat Abstract Abstract unavailable. Author Nevada Bureau...

  18. Fact #860 February 16, 2015 Relationship of Vehicle Miles of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Fact 860 February 16, 2015 Relationship of Vehicle Miles of Travel and the Price of Gasoline - Dataset Excel file and dataset for Relationship of Vehicle Miles of Travel and the ...

  19. Focus Series: Denver Energy Advisor Program Helps Homeowners Go the Extra Mile in Mile-High City

    Broader source: Energy.gov [DOE]

    Focus Series: Denver Energy Advisor Program Helps Homeowners Go the Extra Mile in Mile-High City, a publication of the U.S. Department of Energy's Better Buildings Program.

  20. Entiat 4Mile WELLs Completion Report, 2006.

    SciTech Connect (OSTI)

    Malinowksi, Richard

    2007-01-01

    The Entiat 4-mile Wells (Entiat 4-mile) project is located in the Entiat subbasin and will benefit Upper Columbia steelhead, spring Chinook and bull trout. The goal of this project is to prevent juvenile fish from being diverted into an out-of-stream irrigation system and to eliminate impacts due to the annual maintenance of an instream pushup dam. The objectives include eliminating a surface irrigation diversion and replacing it with two wells, which will provide Bonneville Power Administration (BPA) and the Bureau of Reclamation (Reclamation) with a Federal Columbia River Power System (FCRPS) BiOp metric credit of one. Wells were chosen over a new fish screen based on biological benefits and costs. Long-term biological benefits are provided by completely eliminating the surface diversion and the potential for fish entrainment in a fish screen. Construction costs for a new fish screen were estimated at $150,000, which does not include other costs associated with implementing and maintaining a fish screening project. Construction costs for a well were estimated at $20,000 each. The diversion consisted of a pushup dam that diverted water into an off-channel pond. Water was then pumped into a pressurized system for irrigation. There are 3 different irrigators who used water from this surface diversion, and each has multiple water right claims totaling approximately 5 cfs. Current use was estimated at 300 gallons per minute (approximately 0.641 cfs). Some irrigated acreage was taken out of orchard production less than 5 years ago. Therefore, approximately 6.8 acre-feet will be put into the State of Washington Trust Water Right program. No water will be set aside for conservation savings. The construction of the two irrigation wells for three landowners was completed in September 2006. The Lower Well (Tippen/Wick) will produce up to 175 gpm while the Upper Well (Griffith) will produce up to 275 gpm during the irrigation season. The eight inch diameter wells were developed to a depth of 75 feet and 85 feet, respectively, and will be pumped with Submersible Turbine pumps. The irrigation wells have been fitted with new electric boxes and Siemens flowmeters (MAG8000).

  1. Petroleum Reduction Strategies to Reduce Vehicle Miles Traveled

    Broader source: Energy.gov [DOE]

    For reducing greenhouse gas emissions, the table below describes petroleum reduction strategies to reduce vehicle miles traveled, as well as guidance and best practices for each strategy.

  2. Seven Mile Hill Wind Farm | Open Energy Information

    Open Energy Info (EERE)

    www.wsgs.uwyo.eduTopicsEnergyResourceswind.aspx http:renewableenergydev.comredwind-power-seven-mile-hill-wind-energy-project Retrieved from "http:en.openei.orgw...

  3. Innovative Cell Materials and Designs for 300 Mile Range EVs

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Innovative Cell Materials and Design for 300 Mile Range EVs Yimin Zhu, PDPI OneD Material, LLC (former Nanosys Energy Storage) Palo Alto, California June 16 20, 2014 DOE Vehicle ...

  4. China has 6,000-mile pipeline system

    SciTech Connect (OSTI)

    Ming, S.

    1983-08-01

    A dramatic change has taken place in China's oil transport system, with pipelines replacing tank-cars as the most important means of transport for crude oil and petroleum products. According to Petroleum Ministry officials, the volume of crude oil carried by China's pipeline system increased from 23.2 percent in 1971 to 65.6 percent in 1981, while the volume delivered by tank-cars declined from 61.11 percent to 8.4 percent. The remainder was transported by tankers. China's 9,700 km (6,000-mile) pipeline network includes 5,600 km (3,500 miles) designed to carry crude oil and more than 600 km (375 miles) for petroleum products, plus 3,400 km (2,100 miles), mostly in Sichuan province, for natural gas.

  5. "Table 11. Fuel Economy, Selected Survey Years (Miles Per Gallon...

    U.S. Energy Information Administration (EIA) Indexed Site

    Fuel Economy, Selected Survey Years (Miles Per Gallon)" ,"Survey Years" ,1983,1985,1988,1991,1994,2001 "Total",15.1,16.1,18.3,19.3,19.8,20.2 "Household Characteristics" "Census...

  6. Seven Mile, Ohio: Energy Resources | Open Energy Information

    Open Energy Info (EERE)

    article is a stub. You can help OpenEI by expanding it. Seven Mile is a village in Butler County, Ohio. It falls under Ohio's 8th congressional district.12 References ...

  7. Rock Sampling At Seven Mile Hole Area (Larson, Et Al., 2009)...

    Open Energy Info (EERE)

    Seven Mile Hole Area (Larson, Et Al., 2009) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Rock Sampling At Seven Mile Hole Area (Larson, Et...

  8. Isotopic Analysis At Seven Mile Hole Area (Larson, Et Al., 2009...

    Open Energy Info (EERE)

    Seven Mile Hole Area (Larson, Et Al., 2009) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Isotopic Analysis At Seven Mile Hole Area (Larson, Et...

  9. Field Mapping At Seven Mile Hole Area (Larson, Et Al., 2009)...

    Open Energy Info (EERE)

    Seven Mile Hole Area (Larson, Et Al., 2009) Jump to: navigation, search GEOTHERMAL ENERGYGeothermal Home Exploration Activity: Field Mapping At Seven Mile Hole Area (Larson, Et...

  10. New York Nuclear Profile - Nine Mile Point Nuclear Station

    U.S. Energy Information Administration (EIA) Indexed Site

    Nine Mile Point Nuclear Station" "Unit","Summer capacity (mw)","Net generation (thousand mwh)","Summer capacity factor (percent)","Type","Commercial operation date","License expiration date" 1,630,"5,294",95.9,"BWR","application/vnd.ms-excel","application/vnd.ms-excel"

  11. Fact #729: May 28, 2012 Secondary Household Vehicles Travel Fewer Miles

    Broader source: Energy.gov [DOE]

    When a household has more than one vehicle, the secondary vehicles travel fewer miles than the primary vehicle. In a two-vehicle household, the second vehicle travels less than half of the miles...

  12. How much are Chevrolet Volts in The EV Project driven in EV Mode?

    SciTech Connect (OSTI)

    John Smart

    2013-08-01

    This report summarizes key conclusions from analysis of data collected from Chevrolet Volts participating in The EV Project. Topics include how many miles are driven in EV mode, how far vehicles are driven between charging events, and how much energy is charged from the electric grid per charging event.

  13. Analysis of Three Mile Island-Unit 2 accident

    SciTech Connect (OSTI)

    Not Available

    1980-03-01

    The Nuclear Safety Analysis Center (NSAC) of the Electric Power Research Institute has analyzed the Three Mile Island-2 accident. Early results of this analysis were a brief narrative summary, issued in mid-May 1979 and an initial version of this report issued later in 1979 as noted in the Foreword. The present report is a revised version of the 1979 report, containing summaries, a highly detailed sequence of events, a comparison of that sequence of events with those from other sources, 25 appendices, references and a list of abbreviations and acronyms. A matrix of equipment and system actions is included as a folded insert.

  14. Early dismantlement of Three Mile Island Unit 2

    SciTech Connect (OSTI)

    Byrne, J.; Heisey, K.A.

    1996-12-31

    Three Mile Island Unit 2 (TMI-2) nuclear station ceased commercial operation following the March 1979 accident. Following completion of an extensive cleanup effort that included removal and shipment of the damaged core, the U.S. Nuclear Regulatory Commission issued a possession-only license (POL) amendment on September 14, 1993. Postdefueling monitored storage (PDMS) technical specifications were issued on December 28, 1993. Entry into PDMS required that the licensee demonstrate that the plant was in a safe and stable condition and posed no risk to public health and safety.

  15. Vegetation survey of Pen Branch and Four Mile Creek wetlands

    SciTech Connect (OSTI)

    Not Available

    1992-01-01

    One hundred-fifty plots were recently sampled (vegetational sampling study) at the Savannah River Site (SRS). An extensive characterization of the vascular flora, in four predetermined strata (overstory, Understory, shrub layer, and ground cover), was undertaken to determine dominance, co-dominance, and the importance value (I.V.) of each species. These results will be used by the Savannah River Laboratory (SRL) to evaluate the environmental status of Four Mile Creek, Pen Branch, and two upland pine stands. Objectives of this study were to: Describe in detail the plant communities previously mapped with reference to the topography and drainage, including species of plants present: Examine the successional trends within each sampling area and describe the extent to which current vegetation communities have resulted from specific earlier vegetation disturbances (e.g., logging and grazing); describe in detail the botanical field techniques used to sample the flora; describe the habitat and location of protected and/or rare species of plants; and collect and prepare plant species as herbarium quality specimens. Sampling was conducted at Four Mile Creek and Pen Branch, and in two upland pine plantations of different age growth.

  16. Vegetation survey of Pen Branch and Four Mile Creek wetlands

    SciTech Connect (OSTI)

    Not Available

    1992-10-01

    One hundred-fifty plots were recently sampled (vegetational sampling study) at the Savannah River Site (SRS). An extensive characterization of the vascular flora, in four predetermined strata (overstory, Understory, shrub layer, and ground cover), was undertaken to determine dominance, co-dominance, and the importance value (I.V.) of each species. These results will be used by the Savannah River Laboratory (SRL) to evaluate the environmental status of Four Mile Creek, Pen Branch, and two upland pine stands. Objectives of this study were to: Describe in detail the plant communities previously mapped with reference to the topography and drainage, including species of plants present: Examine the successional trends within each sampling area and describe the extent to which current vegetation communities have resulted from specific earlier vegetation disturbances (e.g., logging and grazing); describe in detail the botanical field techniques used to sample the flora; describe the habitat and location of protected and/or rare species of plants; and collect and prepare plant species as herbarium quality specimens. Sampling was conducted at Four Mile Creek and Pen Branch, and in two upland pine plantations of different age growth.

  17. Fact #903: December 14, 2015 Vehicle Miles of Travel is up in 2015 -

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Dataset | Department of Energy 03: December 14, 2015 Vehicle Miles of Travel is up in 2015 - Dataset Fact #903: December 14, 2015 Vehicle Miles of Travel is up in 2015 - Dataset Excel file and dataset for Vehicle Miles of Travel is up in 2015 File fotw#903_web.xlsx More Documents & Publications Project Reports for Salish and Kootenai Tribes, Confederated Tribes of the Flathead Reservation: S&K Holding Company - 2004 Project 2015 GTO Peer Review U.S. LNG Imports and Exports

  18. 51-Mile Hydroelectric Power Project Demonstration of new methodologies to reduce the LCOE for small, hydropower development

    Broader source: Energy.gov [DOE]

    51-Mile Hydroelectric Power Project Demonstration of new methodologies to reduce the LCOE for small, hydropower development

  19. Fact #728: May 21, 2012 Average Trip Length is Less Than Ten Miles

    Broader source: Energy.gov [DOE]

    The average trip length (one-way) is 9.7 miles according to the 2009 Nationwide Personal Transportation Survey. Trip lengths vary by the purpose of the trip. Shopping and family/personal business...

  20. Fact #640: September 13, 2010 Monthly Trends in Vehicle Miles of Travel

    Broader source: Energy.gov [DOE]

    Vehicle travel in the U.S. varies by month. There are many reasons for this, including the fact that some months are shorter than others. The vehicle miles of travel (VMT) recorded in February is...

  1. Fact #552: January 5, 2009 Vehicle Miles of Travel by Region

    Broader source: Energy.gov [DOE]

    Total vehicle miles of travel (VMT) in the U.S. have declined from 2007 to 2008. The latest data available, September 2008, shows a 4.4% decline in travel that varies by region. Comparing September...

  2. 100,000-Mile Evaluation of Transit Buses Operated on Biodiesel...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Evaluation of Transit Buses Operated on Biodiesel Blends (B20) 100,000-Mile Evaluation of Transit Buses Operated on Biodiesel Blends (B20) Presentation given at DEER 2006, ...

  3. Fact #670: April 11, 2011 Vehicle-Miles of Travel Rises in 2010

    Broader source: Energy.gov [DOE]

    The preliminary estimates from the Federal Highway Administration show that vehicle-miles of travel (VMT) increased slightly in 2010 over the previous year, but have not surpassed the peak of 3.03...

  4. Table 5.1. U.S. Number of Vehicles, Vehicle-Miles, Motor Fuel...

    U.S. Energy Information Administration (EIA) Indexed Site

    Table 5.1. U.S. Number of Vehicles, Vehicle-Miles, Motor Fuel Consumption and Expenditures, 1994 (Continued) 1993 Household and 1994 Vehicle Characteristics RSE Column Factor:...

  5. Fact #903: December 14, 2015 Vehicle Miles of Travel is up in...

    Broader source: Energy.gov (indexed) [DOE]

    Vehicle Miles of Travel is up in 2015 File fotw903web.xlsx More Documents & Publications Project Reports for Salish and Kootenai Tribes, Confederated Tribes of the Flathead ...

  6. Bureaucracy in crisis: Three Mile Island, the shuttle Challenger, and risk assessment

    SciTech Connect (OSTI)

    Casamayou, M.H.

    1995-07-01

    This book is a study in organizational theory about how technological bureaucracies perceive, communicate about, and respond to potential risks to public safety, using Three mile island and the Challenger accident as examples.

  7. Table 5.1. U.S. Number of Vehicles, Vehicle-Miles, Motor Fuel...

    U.S. Energy Information Administration (EIA) Indexed Site

    Energy Information AdministrationHousehold Vehicles Energy Consumption 1994 43 Table 5.1. U.S. Number of Vehicles, Vehicle-Miles, Motor Fuel Consumption and Expenditures, 1994...

  8. Long-term Decline of Aggregate Fuel Use per Cargo-ton-mile of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Long-term Decline of Aggregate Fuel Use per Cargo-ton-mile of Commercial Trucking; A Key Enabler of Expanded U.S. Trade and Economic Growth Poster presentation at the 2007 Diesel ...

  9. Operational and Environmental Monitoring Within a Three-Mile Radius of Project Rulison

    Office of Legacy Management (LM)

    FIRST QUARTER 20 08 REPORT Operational and Environmental Monitoring Within a Three-Mile Radius of Project Rulison Prepared by: A U G U S T 2 0 0 8 FIRST QUARTER 2008 REPORT OPERATIONAL AND ENVIRONMENTAL MONITORING WITHIN A THREE-MILE RADIUS OF PROJECT RULISON Prepared for: Noble Energy Production, Inc. Prepared by: URS Corporation 8181 East Tufts Avenue Denver, CO 80237 August 12, 2008 First Quarter 2008 Report August 2008 i TABLE OF CONTENTS Page 1 Introduction

  10. 1982 worldwide pipeline construction will top 21,900 miles, $9. 5 billion

    SciTech Connect (OSTI)

    Hall, D.

    1982-07-01

    Reports that pipeline construction slowed slightly in 1982 because of lowered economic activity worldwide, with an upturn forecast for 1983. Explains that need for new pipelines to transport increasing amounts of oil and gas energy now being discovered, plus use of pipelines to transport other commodities in increasing amounts, has created a backlog of demand for facilities. Indicates that commodities suited for pipeline transport and getting consideration include crude oil; refined products; natural gas liquids; LPG; coal slurries; carbon dioxide (used for enhanced oil recovery); chemicals such as ammonia, ethane, ethylene, and similar petrochemical feedstocks; industrial gases such as oxygen, nitrogen; and solids slurries such as ores, wood chips, and other non-soluble minerals, even items such as wood chips and wood pulp for paper-making. Reveals that there are 10,396 miles of coal slurry pipeline planned for the US and 500 miles in Canada. Major US projects underway in the gas pipeline field include the 797-mile, 36-in. Trailblazer system in Nebraska, Wyoming, Colorado, and Utah. Products/ LPG/NGL pipelines underway include 105 miles of dual 4 and 6-in. line in Kansas. Crude pipeline activity includes 100 miles of 12-in. in California and 80 miles of 4 thru 40-in. in Alaska on the North Slope. Updates plans in Canada, Scotland, Denmark, Ireland, France, the Middle East, Australia, Southeast Asia, Mexico, South America and the USSR.

  11. To Pluto and Beyond: Powering New Horizons' 3-Billion-Mile Journey |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy To Pluto and Beyond: Powering New Horizons' 3-Billion-Mile Journey To Pluto and Beyond: Powering New Horizons' 3-Billion-Mile Journey July 15, 2015 - 11:23am Addthis This image of Pluto, taken by New Horizons after a 9 1/2-year journey, is our highest-resolution photo of the dwarf planet since its discovery by Clyde Tombaugh in 1930. | Photo courtesy of NASA. This image of Pluto, taken by New Horizons after a 9 1/2-year journey, is our highest-resolution photo of the

  12. NUREG-0668 MASTER* TITLE LIST PUBLICLY AVAILABLE DOCUMENTS THREE MILE ISLAND UNIT 2

    Office of Scientific and Technical Information (OSTI)

    RECSIVEP ev Tin JUN 11157^; NUREG-0668 MASTER* TITLE LIST PUBLICLY AVAILABLE DOCUMENTS THREE MILE ISLAND UNIT 2 DOCKET 50-320 Cumulated to May 21,1979 Office of Administration U. S. Nuclear Regulatory Commission NUREG-0668 TITLE LIST PUBLICLY AVAILABLE DOCUMENTS THREE MILE ISLAND UNIT 2 DOCKET 50-320 Cumulated to M a y 2 1 , 1979 Division of Technical Information and Document Control Office of Administration U. S. Nuclear Regulatory Commission Washington, D.C. 20555 . CONTENTS Page Preface. v

  13. Property:AvgWellDepth | Open Energy Information

    Open Energy Info (EERE)

    Springs Geothermal Power Plant + 915 + O Ohaaki Geothermal Power Station + 1,750 + R Raft River Geothermal Facility + 1,829 + Reykjanes Geothermal Power Station + 2,700 +...

  14. Property:AvgReservoirDepth | Open Energy Information

    Open Energy Info (EERE)

    yd + Amedee Geothermal Area + 213 m0.213 km 0.132 mi 698.819 ft 232.939 yd + B Bac-Man Laguna Geothermal Area + 1,500 m1.5 km 0.932 mi 4,921.26 ft 1,640.415 yd + Bad Blumau...

  15. Property:CommercialAvgRate | Open Energy Information

    Open Energy Info (EERE)

    Company AEP Ohio AEP Texas Central Company AEP Texas North Company AES Eastern Energy LP ARCO Products Co-Watson Accent Energy Holdings, LLC Aguila Irrigation District...

  16. Property:IndustrialAvgRate | Open Energy Information

    Open Energy Info (EERE)

    Company AEP Ohio AEP Texas Central Company AEP Texas North Company AES Eastern Energy LP ARCO Products Co-Watson Accent Energy Holdings, LLC Aguila Irrigation District...

  17. Property:AvgAnnlGrossOpCpcty | Open Energy Information

    Open Energy Info (EERE)

    + F Fang Geothermal Power Station + 0.3 + Farinello Geothermal Power Station + 60 + Faulkner I Energy Generation Facility + 49.5 + H Hellisheidi Geothermal Power Station + 303 +...

  18. Property:AvgGeoFluidTemp | Open Energy Information

    Open Energy Info (EERE)

    F 839.07 R + Bouillante Geothermal Area + 528.15 K255 C 491 F 950.67 R + Brady Hot Springs Geothermal Area + 460.15 K187 C 368.6 F 828.27 R + C Cerro Prieto...

  19. Methodology for Calculating Cost-per-Mile for Current and Future Vehicle Powertrain Technologies, with Projections to 2024: Preprint

    SciTech Connect (OSTI)

    Ruth, M.; Timbario, T. A.; Timbario, T. J.; Laffen, M.

    2011-01-01

    Currently, several cost-per-mile calculators exist that can provide estimates of acquisition and operating costs for consumers and fleets. However, these calculators are limited in their ability to determine the difference in cost per mile for consumer versus fleet ownership, to calculate the costs beyond one ownership period, to show the sensitivity of the cost per mile to the annual vehicle miles traveled (VMT), and to estimate future increases in operating and ownership costs. Oftentimes, these tools apply a constant percentage increase over the time period of vehicle operation, or in some cases, no increase in direct costs at all over time. A more accurate cost-per-mile calculator has been developed that allows the user to analyze these costs for both consumers and fleets. The calculator was developed to allow simultaneous comparisons of conventional light-duty internal combustion engine (ICE) vehicles, mild and full hybrid electric vehicles (HEVs), and fuel cell vehicles (FCVs). This paper is a summary of the development by the authors of a more accurate cost-per-mile calculator that allows the user to analyze vehicle acquisition and operating costs for both consumer and fleets. Cost-per-mile results are reported for consumer-operated vehicles travelling 15,000 miles per year and for fleets travelling 25,000 miles per year.

  20. Fact #616: March 29, 2010 Household Vehicle-Miles of Travel by Trip Purpose

    Broader source: Energy.gov [DOE]

    In 2009, getting to and from work accounted for about 27% of household vehicle-miles of travel (VMT). Work-related business was 8.4% of VMT in 2001, but declined to 6.7% in 2009, possibly due to...

  1. Fact #860 February 16, 2015 Relationship of Vehicle Miles of Travel and the

    Broader source: Energy.gov (indexed) [DOE]

    Price of Gasoline - Dataset | Department of Energy Relationship of Vehicle Miles of Travel and the Price of Gasoline File fotw#860_web.xlsx More Documents & Publications Fact #906: January 4, 2016 VMT and the Price of Gasoline Typically Move in Opposition - Dataset 2012 Data File 2013 Wind Technologies Market Report Data

  2. Nondestructive techniques for assaying fuel debris in piping at Three Mile Island Unit 2

    SciTech Connect (OSTI)

    Vinjamuri, K.; McIsaac, C.V.; Beller, L.S.; Isaacson, L.; Mandler, J.W.; Hobbins, R.R. Jr.

    1981-11-01

    Four major categories of nondestructive techniques - ultrasonic, passive gamma ray, infrared detection, and remote video examination - have been determined to be feasible for assaying fuel debris in the primary coolant system of the Three Mile Island Unit 2 (TMI-2) Reactor. Passive gamma ray detection is the most suitable technique for the TMI-2 piping; however, further development of this technique is needed for specific application to TMI-2.

  3. Reactor engineering support of operations at Three Mile Island nuclear station

    SciTech Connect (OSTI)

    Tropasso, R.T.

    1995-12-31

    The purpose of this paper is to detail the activities in which plant nuclear engineering personnel provide direct support to plant operations. The specific activities include steady-state, transient, and shutdown/refueling operation support as well as special project involvement. The paper is intended to describe the experiences at Three Mile Island (TMI) in which significant benefit to the success of the activity is achieved through the support of the nuclear engineers.

  4. Summary Report of Commercial reactor Criticality Data for Three Mile Island Unit 1

    SciTech Connect (OSTI)

    Larry B. Wimmer

    2001-08-29

    The objective of the ''Summary Report of Commercial Reactor Criticality Data for Three Mile Island Unit I'' is to present the CRC data for the TMI-1 reactor. Results from the CRC evaluations will support the development and validation of the neutronics models used for criticality analyses involving commercial spent nuclear fuel. These models and their validation are discussed in the ''Disposal Criticality Analysis Methodology Topical Report'' (YMP 2000).

  5. Science-Driven Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Science-Driven Network Requirements for ESnet Update to the 2002 Office of Science Networking Requirements Workshop Report February 21, 2006 1-1 Science-Driven Network Requirements for ESnet Update to the 2002 Office of Science Networking Requirements Workshop Report February 21, 2006 Contributors Paul Adams, LBNL (Advanced Light Source) Shane Canon, ORNL (NLCF) Steven Carter, ORNL (NLCF) Brent Draney, LBNL (NERSC) Martin Greenwald, MIT (Magnetic Fusion Energy) Jason Hodges, ORNL (Spallation

  6. Fact #848: November 24, 2014 Nearly Three-Fourths of New Cars have Fuel Economy above 25 Miles per Gallon

    Broader source: Energy.gov [DOE]

    In 1975, only three percent of all new cars had a fuel economy above 25 miles per gallon (mpg), but by 2014, 73% did. Great improvements were made in the fuel economy of cars from 1975 to 1985, so...

  7. EIS-0025: Miles City-New Underwood 230-kV Electrical Transmission Line, Montana, North Dakota, and South Dakota

    Broader source: Energy.gov [DOE]

    The U.S. Department of Energy’s Western Area Power Administration prepared this statement to assess the environmental and socioeconomic implications of its proposed action to construct a 3.28-mile, 230-kV transmission line between Miles City and Baker, Montana, Hettinger, North Dakota, and New Underwood, South Dakota, in Custer and Fallon Counties in Montana, Adams, Bowman, and Slope Counties in North Dakota and Meade, Pennington, and Perkins Counties in South Dakota.

  8. Compilation of Earthquakes from 1850-2007 within 200 miles of the Idaho National Laboratory

    SciTech Connect (OSTI)

    N. Seth Carpenter

    2010-07-01

    An updated earthquake compilation was created for the years 1850 through 2007 within 200 miles of the Idaho National Laboratory. To generate this compilation, earthquake catalogs were collected from several contributing sources and searched for redundant events using the search criteria established for this effort. For all sets of duplicate events, a preferred event was selected, largely based on epicenter-network proximity. All unique magnitude information for each event was added to the preferred event records and these records were used to create the compilation referred to as “INL1850-2007”.

  9. Examination of claims of Miles et al. in Pons-Fleischmann-type cold fusion experiments

    SciTech Connect (OSTI)

    Jones, S.E.; Hansen, L.D.

    1995-05-04

    In cold fusion experiments conducted at the Naval Research Laboratory in China Lake, M. H. Miles and co-workers claim to have produced excess heat correlated with helium-4 production, X-rays, and Geiger-counter excitation. However, scrutiny of the claims shows that unreliable calorimetric and nuclear-product detection methods were used. Moreover, inconsistencies and errors are found in the data and data analysis. The juxtaposition of several poor techniques and inconsistent data does not make a compelling case for cold fusion. We conclude that the evidence for cold fusion from these efforts is far from compelling. 20 refs., 2 figs., 2 tabs.

  10. Laboratory measurement verification of laser hazard analysis for miles weapon simulators used in force on force exercises.

    SciTech Connect (OSTI)

    Augustoni, Arnold L.

    2006-08-01

    Due to the change in the batteries used with the Small Arm Laser Transmitters (SALT) from 3-volts dc to 3.6-volts dc and changes to SNL MILES operating conditions, the associated laser hazards of these units required re-evaluation to ensure that the hazard classification of the laser emitters had not changed as well. The output laser emissions of the SNL MILES, weapon simulators and empire guns, used in Force-On-Force (FOF) training exercises, was measured in accordance to the ANSI Standard Z136.4-2005, ''Recommended Practice for Laser Safety Measurements for Hazard Evaluation''. The laser hazard class was evaluated in accordance with the ANSI Standard Z136.1-2000, ''Safe Use of Lasers'', using ''worst'' case conditions associated with these MILES units. Laser safety assessment was conducted in accordance with the ANSI Standard Z136.6-2005, ''Safe Use of Lasers Outdoors''. The laser hazard evaluation of these MILES laser emitters was compared to and supersedes SAND Report SAND2002-0246, ''Laser Safety Evaluation of the MILES and Mini MILES Laser Emitting Components'', which used ''actual'' operating conditions of the laser emitters at the time of its issuance.

  11. Lessons Learned from Three Mile Island Packaging, Transportation and Disposition that Apply to Fukushima Daiichi Recovery

    SciTech Connect (OSTI)

    Layne Pincock; Wendell Hintze; Dr. Koji Shirai

    2012-07-01

    Following the massive earthquake and resulting tsunami damage in March of 2011 at the Fukushima Daiichi nuclear power plant in Japan, interest was amplified for what was done for recovery at the Three Mile Island Unit 2 (TMI-2) in the United States following its meltdown in 1979. Many parallels could be drawn between to two accidents. This paper presents the results of research done into the TMI-2 recovery effort and its applicability to the Fukushima Daiichi cleanup. This research focused on three topics: packaging, transportation, and disposition. This research work was performed as a collaboration between Japan’s Central Research Institute of Electric Power Industry (CRIEPI) and the Idaho National Laboratory (INL). Hundreds of TMI-2 related documents were searched and pertinent information was gleaned from these documents. Other important information was also obtained by interviewing employees who were involved first hand in various aspects of the TMI-2 cleanup effort. This paper is organized into three main sections: (1) Transport from Three Mile Island to Central Facilities Area at INL, (2) Transport from INL Central Receiving Facility to INL Test Area North (TAN) and wet storage at TAN, and (3) Transport from TAN to INL Idaho Nuclear Technology and Engineering Center (INTEC) and Dry Storage at INTEC. Within each of these sections, lessons learned from performing recovery activities are presented and their applicability to the Fukushima Daiichi nuclear power plant cleanup are outlined.

  12. U.S. Department of Energy, Energy Information Administration...

    U.S. Energy Information Administration (EIA) Indexed Site

    3 - Avg VMT by Efficiency","Table A13. U.S. Average Vehicle-Miles Traveled by Vehicle Fuel Economy Category, 2001 (Thousand Miles per Vehicle) " "Std Errors for A13","Relative...

  13. Results of the radiological survey at Two Mile Creek, Tonawanda, New York (TNY002)

    SciTech Connect (OSTI)

    Murray, M.E.; Rodriguez, R.E.; Uziel, M.S.

    1997-08-01

    At the request of the US Department of Energy (DOE), a team from Oak Ridge National Laboratory conducted a radiological survey at Two Mile Creek, Tonawanda, New York. The survey was performed in November 1991 and May 1996. The purpose of the survey was to determine if radioactive materials from work performed under government contract at the Linde Air Products Division of Union Carbide Corporation, Tonawanda, New York, had been transported into the creek. The survey included a surface gamma scan in accessible areas near the creek and the collection of soil, sediment, and core samples for radionuclide analyses. Survey results indicate that no significant material originating at the Linde plant is presently in the creek. Three of the 1991 soil sample locations on the creek bank and one near the lake contained slightly elevated concentrations of {sup 238}U with radionuclide distributions similar to that found in materials resulting from former processing activities at the Linde site.

  14. CURRENT APPLICATIONS OF THREE MILE ISLAND-2 CORE AND DEBRIS HANDLING AT THE IDAHO NATIONAL LABORATORY

    SciTech Connect (OSTI)

    Carmack, William Jonathan; Braase, Lori Ann

    2015-09-01

    Fuel recovery from severe accidents requires careful planning and execution. The Idaho National Laboratory played a key role in the Three Mile Island (TMI) fuel and core recovery. This involved technology development to locate and handle the damaged fuel; characterization of fuel and debris; analysis of fuel interaction with structural components and materials; development of fuel drying technology for long-term storage. However, one of the critical activities from the TMI project was the extensive effort document all the activities and archive the reports and photos. A historical review of the TMI project at the INL leads to the identification of current applications and considerations for facility designs, fuel handling, robotic applications, material characterization, etc.

  15. Wave-driven

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    driven dynamo action in spherical magnetohydrodynamic systems K. Reuter, 1 F. Jenko, 1 A. Tilgner, 2 and C. B. Forest 3 1 Max-Planck-Institut für Plasmaphysik, EURATOM Association, Boltzmannstraße 2, D-85748 Garching, Germany 2 Institute of Geophysics, University of Göttingen, Friedrich-Hund-Platz 1, 37077 Göttingen, Germany 3 Department of Physics, University of Wisconsin-Madison, 1150 University Avenue, Madison, Wisconsin 53706, USA ͑Received 22 September 2009; published 11 November

  16. Cancer incidence among residents of the Three Mile Island accident area: 1982-1995

    SciTech Connect (OSTI)

    Han, Yueh-Ying; Youk, Ada O.; Sasser, Howell; Talbott, Evelyn O.

    2011-11-15

    Background: The Pennsylvania Department of Health established a registry of the Three Mile Island (TMI) nuclear power plant accident in 1979. Over 93% of the population present on the day of the accident within a 5-mile radius was enrolled and interviewed. We used the registry to investigate the potential cancer risk from low-dose radiation exposure among the TMI population. Methods: Cancer incidence data among the TMI cohort were available from 1982 to 1995. Because more than 97% of the population were white and few cancer cases were reported for those younger than 18 years of age, we included whites of age 18 years and older (10,446 men and 11,048 women) for further analyses. Cox regression models were used to estimate the relative risk (RR) per 0.1 m Sv and 95% confident interval (CI) of cancer by radiation-related exposures. The cancers of interest were all malignant neoplasms, cancer of bronchus, trachea, and lung, cancer of lymphatic and hematopoietic tissues, leukemia, and female breast. Results: Among men and women, there was no evidence of an increased risk for all malignant neoplasms among the TMI cohort exposed to higher maximum and likely {gamma} radiation (RR=1.00, 95% CI=0.97, 1.01 and RR=0.99, 95% CI=0.94, 1.03, respectively) after adjusting for age, gender, education, smoking, and background radiation. Elevation in risk was noted for cancer of the bronchus, trachea, and lung in relation to higher background radiation exposure (RR=1.45, 95% CI=1.02-2.05 at 8.0-8.8 {mu}R/h compared to 5.2-7.2 {mu}R/h). An increased risk of leukemia was found among men exposed to higher maximum and likely {gamma} radiation related to TMI exposure during the ten days following the accident (RR=1.15, 95% CI=1.04, 1.29 and RR=1.36, 95% CI=1.08, 1.71, respectively). This relationship was not found in women. Conclusion: Increased cancer risks from low-level radiation exposure within the TMI cohort were small and mostly statistically non-significant. However, additional follow-up on this population is warranted, especially to explore the increased risk of leukemia found in men.

  17. Fact #913: February 22, 2016 The Most Common Warranty for Plug-In Vehicle Batteries is 8 Years/100,000 Miles- Dataset

    Broader source: Energy.gov [DOE]

    Excel file and dataset for The Most Common Warranty for Plug-In Vehicle Batteries is 8 Years/100,000 Miles

  18. Fact #848: November 24, 2014 Nearly Three-Fourths of New Cars have Fuel Economy above 25 Miles per Gallon- Dataset

    Broader source: Energy.gov [DOE]

    Excel file with dataset for Fact #848: November 24, 2014 Nearly Three-Fourths of New Cars have Fuel Economy above 25 Miles per Gallon

  19. Fact #854 January 5, 2015 Driving Ranges for All-Electric Vehicles in Model Year 2014 Vary from 62 to 265 Miles – Dataset

    Broader source: Energy.gov [DOE]

    Excel file with dataset for Driving Ranges for All-Electric Vehicles in Model Year 2014 Vary from 62 to 265 Miles

  20. EA-1985: Virginia Offshore Wind Technology Advancement Project (VOWTAP), 24 nautical miles offshore of Virginia Beach, Virginia

    Broader source: Energy.gov [DOE]

    DOE is proposing to fund Virginia Electric and Power Company's Virginia Offshore Wind Technology Advancement Project (VOWTAP). The proposed VOWTAP project consists of design, construction and operation of a 12 megawatt offshore wind facility located approximately 24 nautical miles off the coast of Virginia Beach, VA on the Outer Continental Shelf.

  1. Muscle-driven nanogenerators

    DOE Patents [OSTI]

    Wang, Zhong L.; Yang, Rusen

    2011-03-01

    In a method of generating electricity, a plurality of living cells are grown on an array of piezoelectric nanowires so that the cells engage the piezoelectric nanowires. Induced static potentials are extracted from at least one of the piezoelectric nanowires when at least one of the cells deforms the at least one of the piezoelectric nanowires. A cell-driven electrical generator that includes a substrate and a plurality of spaced-apart piezoelectric nanowires disposed on the substrate. A plurality of spaced-apart conductive electrodes interact with the plurality of piezoelectric nanowires. A biological buffer layer that is configured to promote growth of cells is disposed on the substrate so that cells placed on the substrate will grow and engage the piezoelectric nanowires.

  2. Historical summary of the Three Mile Island Unit 2 core debris transportation campaign

    SciTech Connect (OSTI)

    Schmitt, R.C.; Tyacke, M.J.; Quinn, G.J.

    1993-03-01

    Transport of the damaged core materials from the Unit 2 reactor of the Three Mile Island Nuclear Power Station (TMI-2) to the Idaho National Engineering Laboratory (INEL) for examination and storage presented many technical and institutional challenges, including assessing the ability to transport the damaged core; removing and packaging core debris in ways suitable for transport; developing a transport package that could both meet Federal regulations and interface with the facilities at TMI-2 and the INEL; and developing a transport plan, support logistics, and public communications channels suited to the task. This report is a historical summary of how the US Department of Energy addressed those challenges and transported, received, and stored the TMI-2 core debris at the INEL. Subjects discussed include preparations for transport, loading at TMI-2, institutional issues, transport operations, receipt and storage at the INEL, governmental inquiries/investigations, and lessons learned. Because of public attention focused on the TMI-2 Core Debris Transport Program, the exchange of information between the program and public was extensive. This exchange is a focus for parts of this report to explain why various operations were conducted as they were and why certain technical approaches were employed. And, because of that exchange, the program may have contributed to a better public understanding of such actions and may contribute to planning and execution of similar future actions.

  3. Evaluation of the Three Mile Island Unit 2 reactor building decontamination process

    SciTech Connect (OSTI)

    Dougherty, D.; Adams, J. W.

    1983-08-01

    Decontamination activities from the cleanup of the Three Mile Island Unit 2 Reactor Building are generating a variety of waste streams. Solid wastes being disposed of in commercial shallow land burial include trash and rubbish, ion-exchange resins (Epicor-II) and strippable coatings. The radwaste streams arising from cleanup activities currently under way are characterized and classified under the waste classification scheme of 10 CFR Part 61. It appears that much of the Epicor-II ion-exchange resin being disposed of in commerical land burial will be Class B and require stabilization if current radionuclide loading practices continue to be followed. Some of the trash and rubbish from the cleanup of the reactor building so far would be Class B. Strippable coatings being used at TMI-2 were tested for leachability of radionuclides and chelating agents, thermal stability, radiation stability, stability under immersion and biodegradability. Actual coating samples from reactor building decontamination testing were evaluated for radionuclide leaching and biodegradation.

  4. Analysis of the Three Mile Island submerged demineralizer system vessel burial data

    SciTech Connect (OSTI)

    Jasen, W.G.; Amir, S.J.

    1989-09-01

    The Submerged Demineralizer System (SDS) was used during the Three Mile Island (TMI) nuclear reactor cleanup to remove cesium and strontium from contaminated water. The SDS vessels are 2-ft-in diameter and 4-ft tall stainless steel cylinders containing up to 60 kCi of radioactive cesium and strontium loaded on damp zeolite. The water in the damp zeolite absorbs some of the ionizing radiation and decomposes to hydrogen and oxygen by a process called radiolysis. Gas generation rates approaching 1 L/h (Quinn et al. 1984) have been calculated and measured for some of these loaded vessels. Each of the SDS vessels contains a catalyst bed to recombine the available hydrogen and oxygen back to water. Tests have proven this hydrogen control method to be highly effective, even under very wet (but unsubmerged) conditions. Nineteen SDS vessels, packaged one at a time in a shielded and licensed shipping cask, were shipped to Rockwell Hanford Operations (Rockwell). Collectively, these vessels contain approximately 7,500 kCi of radioactive material. Sixteen vessels were transloaded into concrete overpacks and buried at the Hanford Site. The contents of the other three vessels were vitrified at Pacific Northwest Laboratory. Subsequent to placement of the SDS vessels in the burial grounds, DOE Order 5820.2A (DOE 1988) was issued in September 1988. This order requires wastes to be evaluated against 10 CFR 61.55 for radioactivity above greater-than-class C(GTCC) limits. Fourteen of the sixteen vessels buried at the Hanford Site have been determined to be GTCC waste. 5 refs., 3 figs., 3 tabs.

  5. Fluid driven reciprocating apparatus

    DOE Patents [OSTI]

    Whitehead, J.C.

    1997-04-01

    An apparatus is described comprising a pair of fluid driven pump assemblies in a back-to-back configuration to yield a bi-directional pump. Each of the pump assemblies includes a piston or diaphragm which divides a chamber therein to define a power section and a pumping section. An intake-exhaust valve is connected to each of the power sections of the pump chambers, and function to direct fluid, such as compressed air, into the power section and exhaust fluid therefrom. At least one of the pistons or diaphragms is connected by a rod assembly which is constructed to define a signal valve, whereby the intake-exhaust valve of one pump assembly is controlled by the position or location of the piston or diaphragm in the other pump assembly through the operation of the rod assembly signal valve. Each of the pumping sections of the pump assemblies are provided with intake and exhaust valves to enable filling of the pumping section with fluid and discharging fluid therefrom when a desired pressure has been reached. 13 figs.

  6. Fluid driven recipricating apparatus

    DOE Patents [OSTI]

    Whitehead, John C.

    1997-01-01

    An apparatus comprising a pair of fluid driven pump assemblies in a back-to-back configuration to yield a bi-directional pump. Each of the pump assemblies includes a piston or diaphragm which divides a chamber therein to define a power section and a pumping section. An intake-exhaust valve is connected to each of the power sections of the pump chambers, and function to direct fluid, such as compressed air, into the power section and exhaust fluid therefrom. At least one of the pistons or diaphragms is connected by a rod assembly which is constructed to define a signal valve, whereby the intake-exhaust valve of one pump assembly is controlled by the position or location of the piston or diaphragm in the other pump assembly through the operation of the rod assembly signal valve. Each of the pumping sections of the pump assemblies are provided with intake and exhaust valves to enable filling of the pumping section with fluid and discharging fluid therefrom when a desired pressure has been reached.

  7. Salinity driven oceanographic upwelling

    DOE Patents [OSTI]

    Johnson, David H.

    1986-01-01

    The salinity driven oceanographic upwelling is maintained in a mariculture device that includes a long main duct in the general shape of a cylinder having perforated cover plates at each end. The mariculture device is suspended vertically in the ocean such that one end of the main duct is in surface water and the other end in relatively deep water that is cold, nutrient rich and relatively fresh in comparison to the surface water which is relatively warm, relatively nutrient deficient and relatively saline. A plurality of elongated flow segregating tubes are disposed in the main duct and extend from the upper cover plate beyond the lower cover plate into a lower manifold plate. The lower manifold plate is spaced from the lower cover plate to define a deep water fluid flow path to the interior space of the main duct. Spacer tubes extend from the upper cover plate and communicate with the interior space of the main duct. The spacer tubes are received in an upper manifold plate spaced from the upper cover plate to define a surface water fluid flow path into the flow segregating tubes. A surface water-deep water counterflow is thus established with deep water flowing upwardly through the main duct interior for discharge beyond the upper manifold plate while surface water flows downwardly through the flow segregating tubes for discharge below the lower manifold plate. During such counterflow heat is transferred from the downflowing warm water to the upflowing cold water. The flow is maintained by the difference in density between the deep water and the surface water due to their differences in salinity. The upwelling of nutrient rich deep water is used for marifarming by fertilizing the nutrient deficient surface water.

  8. Salinity driven oceanographic upwelling

    DOE Patents [OSTI]

    Johnson, D.H.

    1984-08-30

    The salinity driven oceanographic upwelling is maintained in a mariculture device that includes a long main duct in the general shape of a cylinder having perforated cover plates at each end. The mariculture device is suspended vertically in the ocean such that one end of the main duct is in surface water and the other end in relatively deep water that is cold, nutrient rich and relatively fresh in comparison to the surface water which is relatively warm, relatively nutrient deficient and relatively saline. A plurality of elongated flow segregating tubes are disposed in the main duct and extend from the upper cover plate beyond the lower cover plate into a lower manifold plate. The lower manifold plate is spaced from the lower cover plate to define a deep water fluid flow path to the interior space of the main duct. Spacer tubes extend from the upper cover plate and communicate with the interior space of the main duct. The spacer tubes are received in an upper manifold plate spaced from the upper cover plate to define a surface water fluid flow path into the flow segregating tubes. A surface water-deep water counterflow is thus established with deep water flowing upwardly through the main duct interior for discharge beyond the upper manifold plate while surface water flows downwardly through the flow segregating tubes for discharge below the lower manifold plate. During such counterflow heat is transferred from the downflowing warm water to the upflowing cold water. The flow is maintained by the difference in density between the deep water and the surface water due to their differences in salinity. The upwelling of nutrient rich deep water is used for marifarming by fertilizing the nutrient deficient surface water. 1 fig.

  9. Annual Radiological Environmental Monitoring Program Report for the Three Mile Island, Unit 2, Independent Spent Fuel Storage Installation

    SciTech Connect (OSTI)

    G. G. Hall

    2000-02-01

    This report presents the results of the 1999 Radiological Environmental Monitoring Program conducted in accordance with 10 CFR 72.44 for the Three Mile Island, Unit 2, Independent Spent Fuel Storage Installation. A description of the facility and the monitoring program is provided. The results of monitoring the two predominant radiation exposure pathways, potential airborne radioactivity releases and direct radiation exposure, indicate facility operation has not contributed to any increase in the estimated maximum potential dose commitment to the general public.

  10. Annual Radiological Environmental Monitoring Program Report for the Three Mile Island, Unit 2, Independent Spent Fuel Storage Installation

    SciTech Connect (OSTI)

    Hall, Gregory Graham

    2002-02-01

    This report presents the results of the 2001 Radiological Environmental Monitoring Program conducted in accordance with 10 CFR 72.44 for the Three Mile Island, Unit 2, Independent Spent Fuel Storage Installation. A description of the facility and the monitoring program is provided. The results of monitoring the two predominant radiation exposure pathways, potential airborne radioactivity releases and direct radiation exposure, indicate the facility operation has not contributed to any increase in the estimated maximum potential dose commitment to the general public.

  11. Annual Radiological Environmental Monitoring Program Report for the Three Mile Island, Unit 2, Independent Spent Fuel Storage Installation (2005)

    SciTech Connect (OSTI)

    Hall, Gregory Graham

    2001-02-01

    This report presents the results of the 2000 Radiological Environmental Monitoring Program conducted in accordance with 10 CFR 72.44 for the Three Mile Island, Unit 2, Independent Spent Fuel Storage Installation. A description of the facility and the monitoring program is provided. The results of monitoring the two predominant radiation exposure pathways, potential airborne radioactivity releases and direct radiation exposure, indicate the facility operation has not contributed to any increase in the estimated maximum potential dose commitment to the general public.

  12. Annual Radiological Environmental Monitoring Program Report for the Three Mile Island - Unit 2 Independent Spent Fuel Storage Installation

    SciTech Connect (OSTI)

    Gregory G. Hall

    2003-02-01

    This report presents the results of the 2002 Radiological Environmental Monitoring Program conducted in accordance with 10 CFR 72.44 for the Three Mile Island, Unit 2, Independent Spent Fuel Storage Installation. A description of the facility and the monitoring program is provided. The results of monitoring the two predominant radiation exposure pathways, potential airborne radioactivity releases and direct radiation exposure, indicate the facility operation has not contributed to any increase in the estimated maximum potential dose commitment to the general public.

  13. Annual Radiological Environmental Monitoring Program Report for the Three Mile Island, Unit 2, Independent Spent Fuel Storage Installation

    SciTech Connect (OSTI)

    Hall, Gregory Graham

    2001-02-01

    This report presents the results of the 2000 Radiological Environmental Monitoring Program conducted in accordance with 10 CFR 72.44 for the Three Mile Island, Unit 2, Independent Spent Fuel Storage Installation. A description of the facility and the monitoring program is provided. The results of monitoring the two predominant radiation exposure pathways, potential airborne radioactivity releases and direct radiation exposure, indicate the facility operation has not contributed to any increase in the estimated maximum potential dose commitment to the general public.

  14. Are We Forgetting the Lessons From the Accident at Three Mile Island Unit 2, March 1979: A Case Study

    SciTech Connect (OSTI)

    Christie, Bob; Johnson, David H.

    2002-07-01

    The accident at Three Mile Island Unit 2 in March 1979 resulted in major changes to the way emergency procedures were written and operators were trained at nuclear commercial electric generating units. These changes had a major impact on the public health risk of nuclear electric generating units. The record over the last 20 years has been excellent. For approximately 2000 reactor years of operation since 1979, there have been no accidents equivalent to TMI Unit 2 in the USA. Other factors have had an influence on this excellent record but it is clear that more efficient emergency procedures and better operator training had a significant impact on the excellent record achieved over the last 20 plus years. Abnormal events still occur at the nuclear commercial electric generating units in the USA and these events have the potential for causing damage to the reactor core. In some cases, the emergency procedures used in abnormal events and the training received by the operators of the nuclear units have not been based on the lessons learned from the accident at Three Mile Island. The following paper describes one such case. It is clear to the authors of this paper that further changes should be made to make sure that the lessons learned from the accident at Three Mile Island Unit 2 in 1979 are implemented and not forgotten. (authors)

  15. Laser Driven Dynamic Loading of Condensed Matter

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Laser Driven Dynamic Loading of Condensed Matter Laser Driven Dynamic Loading of Condensed Matter Advanced diagnostics of experiments covering many orders of magnitude in strain ...

  16. Review of Destructive Assay Methods for Nuclear Materials Characterization from the Three Mile Island (TMI) Fuel Debris

    SciTech Connect (OSTI)

    Carla J. Miller

    2013-09-01

    This report provides a summary of the literature review that was performed and based on previous work performed at the Idaho National Laboratory studying the Three Mile Island 2 (TMI-2) nuclear reactor accident, specifically the melted fuel debris. The purpose of the literature review was to document prior published work that supports the feasibility of the analytical techniques that were developed to provide quantitative results of the make-up of the fuel and reactor component debris located inside and outside the containment. The quantitative analysis provides a technique to perform nuclear fuel accountancy measurements

  17. Laser driven compact ion accelerator

    DOE Patents [OSTI]

    Tajima, Toshiki

    2005-03-15

    A laser driven compact ion source including a light source that produces an energy pulse, a light source guide that guides the energy pulse to a target and produces an ion beam. The ion beam is transported to a desired destination.

  18. Transformer failure and common-mode loss of instrument power at Nine Mile Point Unit 2 on August 13, 1991

    SciTech Connect (OSTI)

    Not Available

    1991-10-01

    On August 13, 1991, at Nine Mile Point Unit 2 nuclear power plant, located near Scriba, New York, on Lake Ontario, the main transformer experienced an internal failure that resulted in degraded voltage which caused the simultaneous loss of five uninterruptible power supplies, which in turn caused the loss of several nonsafety systems, including reactor control rod position indication, some reactor power and water indication, control room annunciators, the plant communications system, the plant process computer, and lighting at some locations. The reactor was subsequently brought to a safe shutdown. Following this event, the US Nuclear Regulatory Commission dispatched an Incident Investigation Team to the site to determine what happened, to identify the probable causes, and to make appropriate findings and conclusions. This report describes the incident, the methodology used by the team in its investigation, and presents and the team's findings and conclusions. 59 figs., 14 tabs.

  19. Disposal demonstration of a high integrity container (HIC) containing an EPICOR-II prefilter from Three Mile Island

    SciTech Connect (OSTI)

    McConnell, J.W. Jr.; Tyacke, M.J.; Schmitt, R.C.; Reno, H.W.

    1985-02-01

    A high integrity container (HIC) was developed, tested, and certified for use in disposing of unusual low-level radioactive waste from Three Mile Island Unit 2 (TMI-2). The work was coordinated by EG and G Idaho, Inc. and funded by the US Department of Energy. A disposal demonstration using an HIC containing an EPICOR-II prefilter from TMI-2 was completed at the commercial disposal facility in the State of Washington. A Certification of Compliance was issued by the Department of Social and Health Services of the State of Washington to use the HIC in disposing of up to 50 EPICOR-II prefilters. That Certification of Compliance was issued after rigorous review of the HIC design and test program by the State and by the US Nuclear Regulatory Commission. This report describes the processes of loading, transporting, and disposing of the demonstration HIC and briefly describes the design, testing, and approval effort leading up to the demonstration.

  20. Transporting TMI-2 (Three Mile Island Unit 2) core debris to INEL: Public safety and public response

    SciTech Connect (OSTI)

    Schmitt, R.C.; Reno, H.W.; Young, W.R.; Hamric, J.P.

    1987-01-01

    This paper describes the approach taken by the US Department of Energy (DOE) to ensure that public safety is maintained during transport of core debris from the Unit-2 reactor at the Three Mile Island Nuclear Power Station near Harrisburg, PA, to the Idaho National Engineering Laboratory near Idaho Falls, ID. It provides up-to-date information about public response to the transport action and discusses DOE's position on several institutional issues. The authors advise that planners of future transport operations be prepared for a multitude of comments from all levels of federal, state, and local governments, special interest groups, and private citizens. They also advise planners to keep meticulous records concerning all informational transactions.

  1. A reevaluation of cancer incidence near the Three Mile Island nuclear plant: The collision of evidence and assumptions

    SciTech Connect (OSTI)

    Wing, S.; Richardson, D.; Armstrong, D.; Crawford-Brown, D.

    1997-01-01

    Previous studies concluded that there was no evidence that the 1979 nuclear accident at Three Mile Island (TMI) affected cancer incidence in the surrounding area; however, there were logical and methodological problems in earlier reports that led us to reconsider data previously collected. A 10-mile area around TMI was divided into 69 study tracts, which were assigned radiation dose estimates based on radiation readings and models of atmospheric dispersion. Incident cancers from 1975 to 1985 were ascertained from hospital records and assigned to study tracts. Associations between accident doses and incidence rates of leukemia, lung cancer, and all cancer were assessed using relative dose estimates calculated by the earlier investigators. Adjustments were made for age, sex, socioeconomic characteristics, and preaccident variation in incidence. Considering a 2-year latency, the estimated percent increase per dose unit {plus_minus} standard error was 0.020 {plus_minus} 0.012 for all cancer, 0.082 {plus_minus} 0.032 for lung cancer, and 0.116 {plus_minus} 0.067 for leukemia. Adjustment for socioeconomic variables increased the estimates to 0.034 {plus_minus} 0.013, 0.103 {plus_minus} 0.035, and 0.139 {plus_minus} 0.073 for all cancer, lung cancer, and leukemia, respectively. Associations were generally larger considering a 5-year latency, but were based on smaller numbers of cases. Results support the hypothesis that radiation doses are related to increased cancer incidence around TMI. The analysis avoids medical detection bias, but suffers from inaccurate dose classification; therefore, results may underestimate the magnitude of the association between radiation and cancer incidence. These associations would not be expected, based on previous estimates of near-background levels of radiation exposure following the accident. 35 refs., 3 tabs.

  2. Actively driven thermal radiation shield

    DOE Patents [OSTI]

    Madden, Norman W. (Livermore, CA); Cork, Christopher P. (Pleasant Hill, CA); Becker, John A. (Alameda, CA); Knapp, David A. (Livermore, CA)

    2002-01-01

    A thermal radiation shield for cooled portable gamma-ray spectrometers. The thermal radiation shield is located intermediate the vacuum enclosure and detector enclosure, is actively driven, and is useful in reducing the heat load to mechanical cooler and additionally extends the lifetime of the mechanical cooler. The thermal shield is electrically-powered and is particularly useful for portable solid-state gamma-ray detectors or spectrometers that dramatically reduces the cooling power requirements. For example, the operating shield at 260K (40K below room temperature) will decrease the thermal radiation load to the detector by 50%, which makes possible portable battery operation for a mechanically cooled Ge spectrometer.

  3. Property:AvgTempGeoFluidIntoPlant | Open Energy Information

    Open Energy Info (EERE)

    North Brawley Geothermal Power Plant + 520 + O Ormesa IH Geothermal Facility + 296 + R Raft River Geothermal Facility + 270 + Reykjanes Geothermal Power Station + 590 + Retrieved...

  4. Percolation Cooling of the Three Mile Island Unit 2 Lower Head by Way of Thermal Cracking and Gap Formation

    SciTech Connect (OSTI)

    Thomsen, K.L.

    2002-01-15

    Two partial models have been developed to elucidate the Three Mile Island Unit 2 lower head coolability by water percolation from above into the thermally cracking debris bed and into a gap between the debris and the wall. The bulk permeability of the cracked top crust is estimated based on simple fracture mechanics and application of Poiseuille's law to the fractures. The gap is considered as an abstraction representing an initially rugged interface, which probably expanded by thermal deformation and cracking in connection with the water ingress. The coupled flow and heat conduction problem for the top crust is solved in slab geometry based on the two-phase Darcy equations together with quasi-steady mass and energy conservation equations. The resulting water penetration depth is in good agreement with the depth of the so-called loose debris bed. The lower-head and bottom-crust problem is treated analogously by a two-dimensional axisymmetric model. The notion of a gap is maintained as a useful concept in the flow analysis. Simulations show that a central hot spot with a peak wall temperature of 1075 to 1100 deg. C can be obtained, but the quenching rates are not satisfactory. It is concluded that a three-dimensional model with an additional mechanism to explain the sudden water ingress to the hot spot center would be more appropriate.

  5. Data Driven Quality Assurance and Quality Control

    Broader source: Energy.gov [DOE]

    "Data Driven Quality Assurance & Quality Control," Patrick Roche, Conservation Services Group. Provides an overview of data QA/QC system design.

  6. Laser-driven fusion reactor

    DOE Patents [OSTI]

    Hedstrom, J.C.

    1973-10-01

    A laser-driven fusion reactor consisting of concentric spherical vessels in which the thermonuclear energy is derived from a deuterium-tritium (D + T) burn within a pellet'', located at the center of the vessels and initiated by a laser pulse. The resulting alpha -particle energy and a small fraction of the neutron energy are deposited within the pellet; this pellet energy is eventually transformed into sensible heat of lithium in a condenser outside the vessels. The remaining neutron energy is dissipated in a lithium blanket, located within the concentric vessels, where the fuel ingredient, tritium, is also produced. The heat content of the blanket and of the condenser lithium is eventually transferred to a conventional thermodynamic plant where the thermal energy is converted to electrical energy in a steam Rankine cycle. (Official Gazette)

  7. Light-driven phase shifter

    DOE Patents [OSTI]

    Early, James W. (Los Alamos, NM)

    1990-01-01

    A light-driven phase shifter is provided for modulating a transmission light beam. A gaseous medium such as argon is provided with electron energy states excited to populate a metastable state. A tunable dye laser is selected with a wavelength effective to deplete the metastable electron state and may be intensity modulated. The dye laser is directed through the gaseous medium to define a first optical path having an index of refraction determined by the gaseous medium having a depleted metastable electron state. A transmission laser beam is also directed through the gaseous medium to define a second optical path at least partially coincident with the first optical path. The intensity of the dye laser beam may then be varied to phase modulate the transmission laser beam.

  8. miles-99.PDF

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    that gives the quiet air fall spectrum of the entire population of cloud ... Method The Doppler spectrum measured by a cloud radar is the convolution of the quiet air ...

  9. The Nuclear Accident at Three Mile Island a Practical Lesson in the Fundamental Importance of Effective Communications

    SciTech Connect (OSTI)

    DeVine Jr, J.C.

    2008-07-01

    The Three Mile Island Unit 2 (TMI-2) accident in March 1979 had a profound effect on the course of commercial nuclear generation in the United States and around the world. And while the central elements of the accident were matters of nuclear engineering, design and operations, its consequences were compounded, and in some respects superseded, by extraordinarily ineffective communications by all parties at all levels. Communications failures during the accident and its aftermath caused misunderstanding, distrust, and incorrect emergency response - and seeded or reinforced public opposition to nuclear power that persists to this day. There are communications lessons from TMI that have not yet been fully learned, and some that once were learned but are now gradually being forgotten. The more glaring TMI communications problems were in the arena of external interactions and communications among the plant owner, the Nuclear Regulatory Commission (NRC), the media, and the public. Confusing, fragmented, and contradictory public statements early in the accident, regardless of cause, undermined all possibility for reasonable discourse thereafter. And because the TMI accident was playing out on a world stage, the breakdown in public trust had long term and widespread implications. At the plant site, both TMI-2 cleanup and restart of the undamaged TMI-1 unit met with years of public and political criticism, and attendant regulatory pressure. Across the nation, public trust in nuclear power and those who operate it plummeted, unquestionably contributing to the 25+ year hiatus in new plant orders. There were other, less visible but equally important, consequences of ineffective communications at TMI. The unplanned 'precautionary' evacuation urged by the governor two days after the accident - a life changing, traumatic event for thousands of residents - was prompted primarily by misunderstandings and miscommunications regarding the condition of the plant. And today, nearly 30 years after the event, many in our nuclear industry have insufficient knowledge or regard for the underlying nuclear safety vulnerabilities revealed by the accident, in part because these have not been well explained. From this single, compelling experience, many lessons can be drawn. Some of these were recognized early and taken to heart by those who own and operate nuclear plants - but over time, respect for their importance has given way somewhat to the seemingly more urgent practicalities of plant cost, schedule and production goals. In other cases, the lessons have remained largely obscure. This paper will describe in greater detail the communications aspects of the TMI accident, lessons that can be drawn from them, and their implications on current and future nuclear facility operation. The paper reflects the author's personal, direct experience as part of the accident response team and subsequent cleanup operations at TMI. In summary: The Three Mile Accident was the most severe nuclear accident in U.S. history. It also is perhaps the most studied industrial accident of any kind in U.S. history. Exhaustive examinations of the public health consequences of the accident show convincingly that the effects of radioactivity releases, if any, were imperceptibly low. It is generally agreed, however, that there have been perceptible health consequences from the TMI-2 accident - those linked to stress. Stress to members of the public, particularly those living near the plant, was unquestionably high. And for some the combination of rumor, confusion, contradictory reports and uncertainty, all leading to an evacuation recommendation from the governor, took a toll. It could be argued that the ineffective internal and external communications during the course of the event were as influential to the outcome as the equipment and operational breakdowns that are now so well understood. And for that reason alone, this accident points out that communications capabilities - staffing, systems, facilities, training - can be as important to protection of the public, the plant an

  10. Review of the state of criticality of the Three Mile Island Unit 2 core and reactor vessel

    SciTech Connect (OSTI)

    Stratton, W.R. )

    1987-04-15

    The events during the early hours of the Three Mile Island Unit 2 (TMI-2) accident on March 28, 1979 caused the fuel in the reactor core to crumble or disintegrate, and then subside into a rubble structure more compact that its normal configuration. The present height of the core is about seven feet, five feet less than its normal configuration of 12 feet. With the same boron content and some or all of the control rod and burnable poison rod material as the normal core configuration, the collapsed structure is calculated to be more reactive. However, the reactor is assuredly subcritical at present because of the extraordinarily high boron concentration maintained in the coolant water. Four additional and different physical models are discussed briefly in the report to illustrate the margin of subcriticality, to provide a better estimate of the neutron multiplication factor, and to provide some understanding of the criticality effects of the important parameters. Two different finite, cylindrical models of a collapsed core are also presented in this report. The conclusion of this review is that the reactor is now very far subcritical with a boron concentration of 4350 ppM or more, and no conceivable rearrangement of fuel can create a critical state. Careful administrative control to maintain the boron concentration of the reactor coolant close to 5000 ppM, and controls to rigorously exclude addition of unborated water to the primary system, provide additional assurance that subcriticality will be maintained. The immediate corollary is that the defueling of the reactor vessel can proceed as planned, with complete confidence that such operations will remain subcritical. 20 refs.

  11. Lower head creep rupture failure analysis associated with alternative accident sequences of the Three Mile Island Unit 2

    SciTech Connect (OSTI)

    Sang Lung, Chan

    2004-07-01

    The objective of this lower head creep rupture analysis is to assess the current version of MELCOR 1.8.5-RG against SCDAP/RELAP5 MOD 3.3kz. The purpose of this assessment is to investigate the current MELCOR in-vessel core damage progression phenomena including the model for the formation of a molten pool. The model for stratified molten pool natural heat transfer will be included in the next MELCOR release. Presently, MELCOR excludes the gap heat-transfer model for the cooling associated with the narrow gap between the debris and the lower head vessel wall. All these phenomenological models are already treated in SCDAP/RELAP5 using the COUPLE code to model the heat transfer of the relocated debris with the lower head based on a two-dimensional finite-element-method. The assessment should determine if current MELCOR capabilities adequately cover core degradation phenomena appropriate for the consolidated MELCOR code. Inclusion of these features should bring MELCOR much closer to a state of parity with SCDAP/RELAP5 and is a currently underway element in the MELCOR code consolidation effort. This assessment deals with the following analysis of the Three Mile Island Unit 2 (TMI-2) alternative accident sequences. The TMI-2 alternative accident sequence-1 includes the continuation of the base case of the TMI-2 accident with the Reactor Coolant Pumps (RCP) tripped, and the High Pressure Injection System (HPIS) throttled after approximately 6000 s accident time, while in the TMI-2 alternative accident sequence-2, the reactor coolant pumps is tripped after 6000 s and the HPIS is activated after 12,012 s. The lower head temperature distributions calculated with SCDAP/RELAP5 are visualized and animated with open source visualization freeware 'OpenDX'. (author)

  12. Revisiting Insights from Three Mile Island Unit 2 Postaccident Examinations and Evaluations in View of the Fukushima Daiichi Accident

    SciTech Connect (OSTI)

    Joy Rempe; Mitchell Farmer; Michael Corradini; Larry Ott; Randall Gauntt; Dana Powers

    2012-11-01

    The Three Mile Island Unit 2 (TMI-2) accident, which occurred on March 28, 1979, led industry and regulators to enhance strategies to protect against severe accidents in commercial nuclear power plants. Investigations in the years after the accident concluded that at least 45% of the core had melted and that nearly 19 tonnes of the core material had relocated to the lower head. Postaccident examinations indicate that about half of that material formed a solid layer near the lower head and above it was a layer of fragmented rubble. As discussed in this paper, numerous insights related to pressurized water reactor accident progression were gained from postaccident evaluations of debris, reactor pressure vessel (RPV) specimens, and nozzles taken from the RPV. In addition, information gleaned from TMI-2 specimen evaluations and available data from plant instrumentation were used to improve severe accident simulation models that form the technical basis for reactor safety evaluations. Finally, the TMI-2 accident led the nuclear community to dedicate considerable effort toward understanding severe accident phenomenology as well as the potential for containment failure. Because available data suggest that significant amounts of fuel heated to temperatures near melting, the events at Fukushima Daiichi Units 1, 2, and 3 offer an unexpected opportunity to gain similar understanding about boiling water reactor accident progression. To increase the international benefit from such an endeavor, we recommend that an international effort be initiated to (a) prioritize data needs; (b) identify techniques, samples, and sample evaluations needed to address each information need; and (c) help finance acquisition of the required data and conduct of the analyses.

  13. Are GRACE-era Terrestrial Water Trends Driven by Anthropogenic...

    Office of Scientific and Technical Information (OSTI)

    Are GRACE-era Terrestrial Water Trends Driven by Anthropogenic Climate Change? Citation Details In-Document Search Title: Are GRACE-era Terrestrial Water Trends Driven by ...

  14. Convectively driven PCR thermal-cycling (Patent) | DOEPatents

    Office of Scientific and Technical Information (OSTI)

    Convectively driven PCR thermal-cycling Title: Convectively driven PCR thermal-cycling A polymerase chain reaction system provides an upper temperature zone and a lower temperature ...

  15. Pressure-Driven Quantum Criticality in Iron-Selenide Superconductors...

    Office of Scientific and Technical Information (OSTI)

    Pressure-Driven Quantum Criticality in Iron-Selenide Superconductors Title: Pressure-Driven Quantum Criticality in Iron-Selenide Superconductors Authors: Guo, Jing ; Chen, Xiao-Jia ...

  16. Requirements-Driven Diesel Catalyzed Particulate Trap Design...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Requirements-Driven Diesel Catalyzed Particulate Trap Design and Optimization Requirements-Driven Diesel Catalyzed Particulate Trap Design and Optimization 2005 Diesel Engine ...

  17. Accelerator-driven subcritical fission in molten salt core: Closing...

    Office of Scientific and Technical Information (OSTI)

    Accelerator-driven subcritical fission in molten salt core: Closing the nuclear fuel cycle for green nuclear energy Citation Details In-Document Search Title: Accelerator-driven ...

  18. Driven Skyrmions and Dynamical Transitions in Chiral Magnets...

    Office of Scientific and Technical Information (OSTI)

    Driven Skyrmions and Dynamical Transitions in Chiral Magnets Citation Details In-Document Search Title: Driven Skyrmions and Dynamical Transitions in Chiral Magnets Authors: Lin, ...

  19. Engine Driven Combined Heat and Power: Arrow Linen Supply, December...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Engine Driven Combined Heat and Power: Arrow Linen Supply, December 2008 Engine Driven Combined Heat and Power: Arrow Linen Supply, December 2008 This paper describes the Arrow ...

  20. United States Industrial Motor-Driven Systems Market Assessment...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Motor-Driven Systems Market Assessment: Charting a Roadmap to Energy Savings for Industry United States Industrial Motor-Driven Systems Market Assessment: Charting a Roadmap to ...

  1. Building America Case Study: Field Performance of Inverter-Driven...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Performance of Inverter-Driven Heat Pumps in Cold Climates Connecticut, Massachusetts, and Vermont PROJECT INFORMATION Project Name: Field Performance of Inverter-Driven Heat Pumps ...

  2. Density driven structural transformations in amorphous semiconductor

    Office of Scientific and Technical Information (OSTI)

    clathrates (Journal Article) | SciTech Connect Density driven structural transformations in amorphous semiconductor clathrates Citation Details In-Document Search Title: Density driven structural transformations in amorphous semiconductor clathrates Authors: Tulk, C.A. ; dos Santos, A.M. ; Neuefeind, J.C. ; Molaison, J.J. ; Sales, B.C. ; Honkimäki, V. [1] ; ESRF) [2] + Show Author Affiliations (ORNL) ( Publication Date: 2015-09-22 OSTI Identifier: 1221429 Resource Type: Journal Article

  3. Density driven structural transformations in amorphous semiconductor

    Office of Scientific and Technical Information (OSTI)

    clathrates (Journal Article) | SciTech Connect Density driven structural transformations in amorphous semiconductor clathrates Citation Details In-Document Search Title: Density driven structural transformations in amorphous semiconductor clathrates The pressure induced crystalline collapse at 14.7 GPa and polyamorphic structures of the semiconductor clathrate Sr8Ga16Ge30 are reported up to 35 GPa. In-situ total scattering measurements under pressure allow the direct microscopic inspection

  4. Laser Driven Dynamic Loading of Condensed Matter

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Laser Driven Dynamic Loading of Condensed Matter Laser Driven Dynamic Loading of Condensed Matter Advanced diagnostics of experiments covering many orders of magnitude in strain rate Contact Eric Loomis (505) 665-3196 Email Dynamic materials experiments over a wide range of strain rates are essential to studying constitutive relations (e.g., plasticity), damage (e.g., spall), equations of state, phase transitions and kinetics, and novel materials. The Trident laser facility supplies unique,

  5. Energy Management for Motor-Driven Systems | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Management for Motor-Driven Systems Energy Management for Motor-Driven Systems This document assists in establishing an energy management plan, identifying energy savings opportunities, and designing a motor improvement plan. PDF icon Energy Management for Motor-Driven Systems (June 1997) More Documents & Publications Eliminate Voltage Unbalance Optimizing Your Motor-Driven System Continuous Energy Improvement in Motor Driven Systems - A Guidebook for Industry

  6. Gas engine driven chiller development and economics

    SciTech Connect (OSTI)

    Koplow, M.D.; Searight, E.F.; Panora, R.

    1986-03-01

    The TECOGEN Division of Thermo Electron Corporation has developed a nominal 150 ton engine driven chiller system under the sponsorship of the Gas Research Institute. The system incorporates an engine directly driving a screw compressor to produce about 130 tons of cooling capacity and a single effect absorption chiller driven by hot water recovered from engine heat to produce another 30 tons of cooling capacity. An economic analysis shows that it will be possible to recover the cost premium of engine driven chiller systems in most US cities in 3 years or less with the O and M savings of these systems when this cost premium is $30 per ton. 4 references, 13 figures, 5 tables.

  7. Terahertz-driven linear electron acceleration

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Nanni, Emilio A.; Huang, Wenqian R.; Hong, Kyung-Han; Ravi, Koustuban; Fallahi, Arya; Moriena, Gustavo; Dwayne Miller, R. J.; Kärtner, Franz X.

    2015-10-06

    The cost, size and availability of electron accelerators are dominated by the achievable accelerating gradient. Conventional high-brightness radio-frequency accelerating structures operate with 30–50 MeVm-1 gradients. Electron accelerators driven with optical or infrared sources have demonstrated accelerating gradients orders of magnitude above that achievable with conventional radio-frequency structures. However, laser-driven wakefield accelerators require intense femtosecond sources and direct laser-driven accelerators suffer from low bunch charge, sub-micron tolerances and sub-femtosecond timing requirements due to the short wavelength of operation. Here we demonstrate linear acceleration of electrons with keV energy gain using optically generated terahertz pulses. Terahertz-driven accelerating structures enable high-gradient electron/proton acceleratorsmore » with simple accelerating structures, high repetition rates and significant charge per bunch. As a result, these ultra-compact terahertz accelerators with extremely short electron bunches hold great potential to have a transformative impact for free electron lasers, linear colliders, ultrafast electron diffraction, X-ray science and medical therapy with X-rays and electron beams.« less

  8. Microwave-driven ultraviolet light sources

    DOE Patents [OSTI]

    Manos, Dennis M.; Diggs, Jessie; Ametepe, Joseph D.

    2002-01-29

    A microwave-driven ultraviolet (UV) light source is provided. The light source comprises an over-moded microwave cavity having at least one discharge bulb disposed within the microwave cavity. At least one magnetron probe is coupled directly to the microwave cavity.

  9. Light modulated electron beam driven radiofrequency emitter

    DOE Patents [OSTI]

    Wilson, M.T.; Tallerico, P.J.

    1979-10-10

    The disclosure relates to a light modulated electron beam-driven radiofrequency emitter. Pulses of light impinge on a photoemissive device which generates an electron beam having the pulse characteristics of the light. The electron beam is accelerated through a radiofrequency resonator which produces radiofrequency emission in accordance with the electron, hence, the light pulses.

  10. Terahertz-driven linear electron acceleration

    SciTech Connect (OSTI)

    Nanni, Emilio A.; Huang, Wenqian R.; Hong, Kyung-Han; Ravi, Koustuban; Fallahi, Arya; Moriena, Gustavo; Dwayne Miller, R. J.; Kärtner, Franz X.

    2015-10-06

    The cost, size and availability of electron accelerators are dominated by the achievable accelerating gradient. Conventional high-brightness radio-frequency accelerating structures operate with 30–50 MeVm-1 gradients. Electron accelerators driven with optical or infrared sources have demonstrated accelerating gradients orders of magnitude above that achievable with conventional radio-frequency structures. However, laser-driven wakefield accelerators require intense femtosecond sources and direct laser-driven accelerators suffer from low bunch charge, sub-micron tolerances and sub-femtosecond timing requirements due to the short wavelength of operation. Here we demonstrate linear acceleration of electrons with keV energy gain using optically generated terahertz pulses. Terahertz-driven accelerating structures enable high-gradient electron/proton accelerators with simple accelerating structures, high repetition rates and significant charge per bunch. As a result, these ultra-compact terahertz accelerators with extremely short electron bunches hold great potential to have a transformative impact for free electron lasers, linear colliders, ultrafast electron diffraction, X-ray science and medical therapy with X-rays and electron beams.

  11. Simulation of E-Cloud Driven Instability And Its Attenuation...

    Office of Scientific and Technical Information (OSTI)

    Simulation of E-Cloud Driven Instability And Its Attenuation Using a Feedback System in the CERN SPS Citation Details In-Document Search Title: Simulation of E-Cloud Driven ...

  12. Simulation of E-Cloud Driven Instability And Its Attenuation...

    Office of Scientific and Technical Information (OSTI)

    of E-Cloud Driven Instability And Its Attenuation Using a Feedback System in the CERN SPS Citation Details In-Document Search Title: Simulation of E-Cloud Driven Instability...

  13. Interaction Driven Subgap Spin Exciton in the Kondo Insulator...

    Office of Scientific and Technical Information (OSTI)

    Interaction Driven Subgap Spin Exciton in the Kondo Insulator SmB 6 Title: Interaction Driven Subgap Spin Exciton in the Kondo Insulator SmB 6 Authors: Fuhrman, W. T. ; Leiner, J. ...

  14. Laser-driven fusion etching process

    DOE Patents [OSTI]

    Ashby, C.I.H.; Brannon, P.J.; Gerardo, J.B.

    1987-08-25

    The surfaces of solids are etched by a radiation-driven chemical reaction. The process involves exposing a substrate coated with a layer of a reactant material on its surface to radiation, e.g., a laser, to induce localized melting of the substrate which results in the occurrence of a fusion reaction between the substrate and coating material. The resultant reaction product and excess reactant salt are then removed from the surface of the substrate with a solvent which is relatively inert towards the substrate. The laser-driven chemical etching process is especially suitable for etching ionic substrates, e.g., LiNbO/sub 3/, such as used in electro-optical/acousto-optic devices. It is also suitable for applications wherein the etching process is required to produce an etched ionic substrate having a smooth surface morphology or when a very rapid etching rate is desired.

  15. Laser-driven fusion etching process

    DOE Patents [OSTI]

    Ashby, Carol I. H.; Brannon, Paul J.; Gerardo, James B.

    1989-01-01

    The surfaces of solid ionic substrates are etched by a radiation-driven chemical reaction. The process involves exposing an ionic substrate coated with a layer of a reactant material on its surface to radiation, e.g. a laser, to induce localized melting of the substrate which results in the occurrance of a fusion reaction between the substrate and coating material. The resultant reaction product and excess reactant salt are then removed from the surface of the substrate with a solvent which is relatively inert towards the substrate. The laser-driven chemical etching process is especially suitable for etching ionic salt substrates, e.g., a solid inorganic salt such as LiNbO.sub.3, such as used in electro-optical/acousto-optic devices. It is also suitable for applications wherein the etching process is required to produce an etched ionic substrate having a smooth surface morphology or when a very rapid etching rate is desired.

  16. Solvable model of a strongly driven micromaser

    SciTech Connect (OSTI)

    Lougovski, P.; Walther, H.; Casagrande, F.; Lulli, A.; Englert, B.-G.; Solano, E.

    2004-02-01

    We study the dynamics of a micromaser where the pumping atoms are strongly driven by a resonant classical field during their transit through the cavity mode. We derive a master equation for this strongly driven micromaser, involving the contributions of the unitary atom-field interactions and the dissipative effects of a thermal bath. We find analytical solutions for the temporal evolution and the steady state of this system by means of phase-space techniques, providing an unusual solvable model of an open quantum system, including pumping and decoherence. We derive closed expressions for all relevant expectation values, describing the statistics of the cavity field and the detected atomic levels. The transient regime shows the buildup of mixtures of mesoscopic fields evolving towards a super-Poissonian steady-state field that, nevertheless, yields atomic correlations that exhibit stronger nonclassical features than the conventional micromaser.

  17. A signature for turbulence driven magnetic islands

    SciTech Connect (OSTI)

    Agullo, O.; Muraglia, M.; Benkadda, S.; Poyé, A.; Yagi, M.; Garbet, X.; Sen, A.

    2014-09-15

    We investigate the properties of magnetic islands arising from tearing instabilities that are driven by an interchange turbulence. We find that such islands possess a specific signature that permits an identification of their origin. We demonstrate that the persistence of a small scale turbulence maintains a mean pressure profile, whose characteristics makes it possible to discriminate between turbulence driven islands from those arising due to an unfavourable plasma current density gradient. We also find that the island poloidal turnover time, in the steady state, is independent of the levels of the interchange and tearing energy sources. Finally, we show that a mixing length approach is adequate to make theoretical predictions concerning island flattening in the island rotation frame.

  18. Optimizing Your Motor-Driven System | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Your Motor-Driven System Optimizing Your Motor-Driven System This fact sheet presents an overview of electric drive systems and highlights common ways you can improve motor system efficiency and reliability. By optimizing the efficiency of your motor-driven systems, you can increase productivity while saving significant amounts of energy and money. PDF icon Optimizing Your Motor Driven System (September 1996) More Documents & Publications When to Purchase Premium Efficiency Motors Energy

  19. Electrically Driven Technologies for Radioactive Aerosol Abatement

    SciTech Connect (OSTI)

    David W. DePaoli; Ofodike A. Ezekoye; Costas Tsouris; Valmor F. de Almeida

    2003-01-28

    The purpose of this research project was to develop an improved understanding of how electriexecy driven processes, including electrocoalescence, acoustic agglomeration, and electric filtration, may be employed to efficiently treat problems caused by the formation of aerosols during DOE waste treatment operations. The production of aerosols during treatment and retrieval operations in radioactive waste tanks and during thermal treatment operations such as calcination presents a significant problem of cost, worker exposure, potential for release, and increased waste volume.

  20. Chaos control of parametric driven Duffing oscillators

    SciTech Connect (OSTI)

    Jin, Leisheng; Mei, Jie; Li, Lijie, E-mail: L.Li@swansea.ac.uk [College of Engineering, Swansea University, Swansea SA2 8PP (United Kingdom)

    2014-03-31

    Duffing resonators are typical dynamic systems, which can exhibit chaotic oscillations, subject to certain driving conditions. Chaotic oscillations of resonating systems with negative and positive spring constants are identified to investigate in this paper. Parametric driver imposed on these two systems affects nonlinear behaviours, which has been theoretically analyzed with regard to variation of driving parameters (frequency, amplitude). Systematic calculations have been performed for these two systems driven by parametric pumps to unveil the controllability of chaos.

  1. Wave-driven Countercurrent Plasma Centrifuge

    SciTech Connect (OSTI)

    A.J. Fetterman and N.J. Fisch

    2009-03-20

    A method for driving rotation and a countercurrent flow in a fully ionized plasma centrifuge is described. The rotation is produced by radiofrequency waves near the cyclotron resonance. The wave energy is transferred into potential energy in a manner similar to the ? channeling effect. The countercurrent flow may also be driven by radiofrequency waves. By driving both the rotation and the flow pattern using waves instead of electrodes, physical and engineering issues may be avoided.

  2. Current-Driven Filament Instabilities in Relativistic Plasmas. Final report

    SciTech Connect (OSTI)

    Chuang Ren

    2013-02-13

    This grant has supported a study of some fundamental problems in current- and flow-driven instabilities in plasmas and their applications in inertial confinement fusion (ICF) and astrophysics. It addressed current-driven instabilities and their roles in fast ignition, and flow-driven instabilities and their applications in astrophysics.

  3. Advanced motor driven clamped borehole seismic receiver

    DOE Patents [OSTI]

    Engler, Bruce P.; Sleefe, Gerard E.; Striker, Richard P.

    1993-01-01

    A borehole seismic tool including a borehole clamp which only moves perpendicular to the borehole. The clamp is driven by an electric motor, via a right angle drive. When used as a seismic receiver, the tool has a three part housing, two of which are hermetically sealed. Accelerometers or geophones are mounted in one hermetically sealed part, the electric meter in the other hermetically sealed part, and the clamp and right angle drive in the third part. Preferably the tool includes cable connectors at both ends. Optionally a shear plate can be added to the clamp to extend the range of the tool.

  4. Advanced motor driven clamped borehole seismic receiver

    DOE Patents [OSTI]

    Engler, B.P.; Sleefe, G.E.; Striker, R.P.

    1993-02-23

    A borehole seismic tool is described including a borehole clamp which only moves perpendicular to the borehole. The clamp is driven by an electric motor, via a right angle drive. When used as a seismic receiver, the tool has a three part housing, two of which are hermetically sealed. Accelerometers or geophones are mounted in one hermetically sealed part, the electric motor in the other hermetically sealed part, and the clamp and right angle drive in the third part. Preferably the tool includes cable connectors at both ends. Optionally a shear plate can be added to the clamp to extend the range of the tool.

  5. Energy-beam-driven rapid fabrication system

    DOE Patents [OSTI]

    Keicher, David M.; Atwood, Clinton L.; Greene, Donald L.; Griffith, Michelle L.; Harwell, Lane D.; Jeantette, Francisco P.; Romero, Joseph A.; Schanwald, Lee P.; Schmale, David T.

    2002-01-01

    An energy beam driven rapid fabrication system, in which an energy beam strikes a growth surface to form a molten puddle thereon. Feed powder is then injected into the molten puddle from a converging flow of feed powder. A portion of the feed powder becomes incorporated into the molten puddle, forcing some of the puddle contents to freeze on the growth surface, thereby adding an additional layer of material. By scanning the energy beam and the converging flow of feed powder across the growth surface, complex three-dimensional shapes can be formed, ready or nearly ready for use. Nearly any class of material can be fabricated using this system.

  6. Fiber optic mounted laser driven flyer plates

    DOE Patents [OSTI]

    Paisley, Dennis L. (Santa Fe, NM)

    1991-01-01

    A laser driven flyer plate where the flyer plate is deposited directly onto the squared end of an optical fiber. The plasma generated by a laser pulse drives the flyer plate toward a target. In another embodiment, a first metal layer is deposited onto the squared end of an optical fiber, followed by a layer of a dielectric material and a second metal layer. The laser pulse generates a plasma in the first metal layer, but the plasma is kept away from the second metal layer by the dielectric layer until the pressure reaches the point where shearing occurs.

  7. Accelerator driven sub-critical core

    DOE Patents [OSTI]

    McIntyre, Peter M; Sattarov, Akhdiyor

    2015-03-17

    Systems and methods for operating an accelerator driven sub-critical core. In one embodiment, a fission power generator includes a sub-critical core and a plurality of proton beam generators. Each of the proton beam generators is configured to concurrently provide a proton beam into a different area of the sub-critical core. Each proton beam scatters neutrons within the sub-critical core. The plurality of proton beam generators provides aggregate power to the sub-critical core, via the proton beams, to scatter neutrons sufficient to initiate fission in the sub-critical core.

  8. Fiber optic mounted laser driven flyer plates

    SciTech Connect (OSTI)

    Paisley, D.L.

    1990-12-31

    This invention is comprised of a laser driven flyer plate where the flyer plate is deposited directly onto the squared end of an optical fiber. The plasma generated by a laser pulse drives the flyer plate toward a target. In another embodiment, a first metal layer is deposited onto the squared end of an optical fiber, followed by a layer of a dielectric material and a second metal layer. The laser pulse generates a plasma in the first metal layer, but the plasma is kept away from the second metal layer by the dielectric layer until the pressure reaches the point where shearing occurs. 2 figs.

  9. Fiber optic mounted laser driven flyer plates

    SciTech Connect (OSTI)

    Paisley, D.L.

    1991-07-09

    A laser driven flyer plate is described where the flyer plate is deposited directly onto the squared end of an optical fiber. The plasma generated by a laser pulse drives the flyer plate toward a target. In another embodiment, a first metal layer is deposited onto the squared end of an optical fiber, followed by a layer of a dielectric material and a second metal layer. The laser pulse generates a plasma in the first metal layer, but the plasma is kept away from the second metal layer by the dielectric layer until the pressure reaches the point where shearing occurs.

  10. Fiber optic mounted laser driven flyer plates

    SciTech Connect (OSTI)

    Paisley, D.L.

    1990-01-01

    This invention is comprised of a laser driven flyer plate where the flyer plate is deposited directly onto the squared end of an optical fiber. The plasma generated by a laser pulse drives the flyer plate toward a target. In another embodiment, a first metal layer is deposited onto the squared end of an optical fiber, followed by a layer of a dielectric material and a second metal layer. The laser pulse generates a plasma in the first metal layer, but the plasma is kept away from the second metal layer by the dielectric layer until the pressure reaches the point where shearing occurs. 2 figs.

  11. Accelerating Science Driven System Design With RAMP

    SciTech Connect (OSTI)

    Wawrzynek, John

    2015-05-01

    Researchers from UC Berkeley, in collaboration with the Lawrence Berkeley National Lab, are engaged in developing an Infrastructure for Synthesis with Integrated Simulation (ISIS). The ISIS Project was a cooperative effort for “application-driven hardware design” that engages application scientists in the early parts of the hardware design process for future generation supercomputing systems. This project served to foster development of computing systems that are better tuned to the application requirements of demanding scientific applications and result in more cost-effective and efficient HPC system designs. In order to overcome long conventional design-cycle times, we leveraged reconfigurable devices to aid in the design of high-efficiency systems, including conventional multi- and many-core systems. The resulting system emulation/prototyping environment, in conjunction with the appropriate intermediate abstractions, provided both a convenient user programming experience and retained flexibility, and thus efficiency, of a reconfigurable platform. We initially targeted the Berkeley RAMP system (Research Accelerator for Multiple Processors) as that hardware emulation environment to facilitate and ultimately accelerate the iterative process of science-driven system design. Our goal was to develop and demonstrate a design methodology for domain-optimized computer system architectures. The tangible outcome is a methodology and tools for rapid prototyping and design-space exploration, leading to highly optimized and efficient HPC systems.

  12. Flux-driven simulations of turbulence collapse

    SciTech Connect (OSTI)

    Park, G. Y.; Kim, S. S.; Jhang, Hogun; Rhee, T.; Diamond, P. H.; Xu, X. Q.

    2015-03-15

    Using three-dimensional nonlinear simulations of tokamak turbulence, we show that an edge transport barrier (ETB) forms naturally once input power exceeds a threshold value. Profiles, turbulence-driven flows, and neoclassical coefficients are evolved self-consistently. A slow power ramp-up simulation shows that ETB transition is triggered by the turbulence-driven flows via an intermediate phase which involves coherent oscillation of turbulence intensity and E×B flow shear. A novel observation of the evolution is that the turbulence collapses and the ETB transition begins when R{sub T} > 1 at t = t{sub R} (R{sub T}: normalized Reynolds power), while the conventional transition criterion (ω{sub E×B}>γ{sub lin} where ω{sub E×B} denotes mean flow shear) is satisfied only after t = t{sub C} ( >t{sub R}), when the mean flow shear grows due to positive feedback.

  13. Re-evaluation of Spent Nuclear Fuel Assay Data for the Three Mile Island Unit 1 Reactor and Application to Code Validation

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Gauld, Ian C.; Giaquinto, J. M.; Delashmitt, J. S.; Hu, Jianwei; Ilas, Germina; Haverlock, T. J.; Romano, Catherine E.

    2016-01-01

    Destructive radiochemical assay measurements of spent nuclear fuel rod segments from an assembly irradiated in the Three Mile Island unit 1 (TMI-1) pressurized water reactor have been performed at Oak Ridge National Laboratory (ORNL). Assay data are reported for five samples from two fuel rods of the same assembly. The TMI-1 assembly was a 15 X 15 design with an initial enrichment of 4.013 wt% 235U, and the measured samples achieved burnups between 45.5 and 54.5 gigawatt days per metric ton of initial uranium (GWd/t). Measurements were performed mainly using inductively coupled plasma mass spectrometry after elemental separation via highmore » performance liquid chromatography. High precision measurements were achieved using isotope dilution techniques for many of the lanthanides, uranium, and plutonium isotopes. Measurements are reported for more than 50 different isotopes and 16 elements. One of the two TMI-1 fuel rods measured in this work had been measured previously by Argonne National Laboratory (ANL), and these data have been widely used to support code and nuclear data validation. Recently, ORNL provided an important opportunity to independently cross check results against previous measurements performed at ANL. The measured nuclide concentrations are used to validate burnup calculations using the SCALE nuclear systems modeling and simulation code suite. These results show that the new measurements provide reliable benchmark data for computer code validation.« less

  14. Re-evaluation of Spent Nuclear Fuel Assay Data for the Three Mile Island Unit 1 Reactor and Application to Code Validation

    SciTech Connect (OSTI)

    Gauld, Ian C.; Giaquinto, J. M.; Delashmitt, J. S.; Hu, Jianwei; Ilas, Germina; Haverlock, T. J.; Romano, Catherine E.

    2016-01-01

    Destructive radiochemical assay measurements of spent nuclear fuel rod segments from an assembly irradiated in the Three Mile Island unit 1 (TMI-1) pressurized water reactor have been performed at Oak Ridge National Laboratory (ORNL). Assay data are reported for five samples from two fuel rods of the same assembly. The TMI-1 assembly was a 15 X 15 design with an initial enrichment of 4.013 wt% 235U, and the measured samples achieved burnups between 45.5 and 54.5 gigawatt days per metric ton of initial uranium (GWd/t). Measurements were performed mainly using inductively coupled plasma mass spectrometry after elemental separation via high performance liquid chromatography. High precision measurements were achieved using isotope dilution techniques for many of the lanthanides, uranium, and plutonium isotopes. Measurements are reported for more than 50 different isotopes and 16 elements. One of the two TMI-1 fuel rods measured in this work had been measured previously by Argonne National Laboratory (ANL), and these data have been widely used to support code and nuclear data validation. Recently, ORNL provided an important opportunity to independently cross check results against previous measurements performed at ANL. The measured nuclide concentrations are used to validate burnup calculations using the SCALE nuclear systems modeling and simulation code suite. These results show that the new measurements provide reliable benchmark data for computer code validation.

  15. Track C - Market-Driven Research Solutions | Department of Energy

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    C - Market-Driven Research Solutions Track C - Market-Driven Research Solutions Presentations from Track C, Market-Driven Research Solutions of the U.S. Department of Energy Building America program's 2012 Residential Energy Efficiency Stakeholder Meeting are provided below as Adobe Acrobat PDFs. These presentations for this track covered the following topics: Outreach Initiatives; Case Studies; Technical Approach to Home Energy Management; Valuing Energy Efficiency; Software Accuracy Issues in

  16. Molten salt considerations for accelerator-driven subcritical fission to

    Office of Scientific and Technical Information (OSTI)

    close the nuclear fuel cycle (Journal Article) | SciTech Connect Molten salt considerations for accelerator-driven subcritical fission to close the nuclear fuel cycle Citation Details In-Document Search Title: Molten salt considerations for accelerator-driven subcritical fission to close the nuclear fuel cycle The host salt selection, molecular modeling, physical chemistry, and processing chemistry are presented here for an accelerator-driven subcritical fission in a molten salt core

  17. Experimental evidence of space charge driven resonances in high...

    Office of Scientific and Technical Information (OSTI)

    Experimental evidence of space charge driven resonances in high intensity linear accelerators Citation Details In-Document Search Title: Experimental evidence of space charge ...

  18. CESC-Webinar: Building an Innovation and Entrepreneurship Driven...

    Open Energy Info (EERE)

    Innovation and Entrepreneurship Driven Economy: How Policies Can Foster Risk Capital Investment in Renewable Energy Jump to: navigation, search Tool Summary LAUNCH TOOL Name:...

  19. Energy Department Launches New Data-Driven Initiative to Help...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    The open source software application fills a major market need for data-driven energy efficiency program design and implementation, allowing cities and states to combine, manage, ...

  20. Molten salt considerations for accelerator-driven subcritical...

    Office of Scientific and Technical Information (OSTI)

    to close the nuclear fuel cycle Citation Details In-Document Search Title: Molten salt considerations for accelerator-driven subcritical fission to close the nuclear fuel cycle ...

  1. Network-Driven Demand Side Management Website | Open Energy Informatio...

    Open Energy Info (EERE)

    URI: cleanenergysolutions.orgcontentnetwork-driven-demand-side-management Language: English Policies: "Deployment Programs,Regulations" is not in the list of possible...

  2. Community-Driven Development Decision Tools for Rural Development...

    Open Energy Info (EERE)

    (CDD) investment programmes as a way to further enabling rural poor people to overcome poverty in WCA." References "Community-Driven Development Decision Tools" Retrieved from...

  3. Characterization of Heat-Wave Propagation through Laser-Driven...

    Office of Scientific and Technical Information (OSTI)

    Characterization of Heat-Wave Propagation through Laser-Driven Ti-Doped Underdense Plasma Citation Details In-Document Search Title: Characterization of Heat-Wave Propagation...

  4. Save Energy Now in Your Motor-Driven Systems

    SciTech Connect (OSTI)

    2006-01-01

    This DOE Industrial Technologies Program fact sheet describes how manufacturing plants can save energy and money by making energy efficiency improvements to their industrial motor-driven systems.

  5. Ion temperature gradient driven turbulence with strong trapped...

    Office of Scientific and Technical Information (OSTI)

    driven turbulence with strong trapped ion resonance is presented. The role of trapped ion granulations, clusters of trapped ions correlated by precession resonance, is the focus. ...

  6. Continuous Energy Improvement in Motor Driven Systems - A Guidebook...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    More Documents & Publications Energy Management for Motor-Driven Systems Premium Efficiency Motor Selection and Application Guide - A Handbook for Industry MotorMaster+ User Manual

  7. Betatron Radiation from a Beam Driven Plasma Source Litos, M...

    Office of Scientific and Technical Information (OSTI)

    Betatron Radiation from a Beam Driven Plasma Source Litos, M.; Corde, S.; SLAC 43 PARTICLE ACCELERATORS; ACCELERATION; ACCELERATORS; BETATRON OSCILLATIONS; BETATRONS;...

  8. Final Environmental Assessment for the Proposed Consolidation of Certain Dynamic Experimentation Activities at the Two-Mile Mesa Complex Los Alamos National Laboratory, Los Alamos, New Mexico

    SciTech Connect (OSTI)

    N /A

    2003-11-03

    The National Environmental Policy Act of 1969 (NEPA) requires Federal agency officials to consider the environmental consequences of their proposed actions before decisions are made. In complying with NEPA, the United States (U.S.) Department of Energy (DOE), National Nuclear Security Administration (NNSA), follows the Council on Environmental Quality regulations (40 CFR 1500-1508) and DOE's NEPA implementing procedures (10 CFR 1021). The purpose of an environmental assessment (EA) is to provide Federal decision makers with sufficient evidence and analysis to determine whether to prepare an environmental impact statement (EIS) or issue a Finding of No Significant Impact. Los Alamos National Laboratory (LANL) is a national security laboratory located at Los Alamos, New Mexico, that comprises about 40 square miles (mi{sup 2}) (103.6 square kilometers [km{sup 2}]) of buildings, structures, and forested land (Figure 1). It is administered by NNSA for the Federal government and is managed and operated under contract by the University of California (UC). The NNSA must make a decision whether to consolidate and construct new facilities for the Dynamic Experimentation Division (DX) to create a central core area of facilities, including offices, laboratories, and other support structures, at LANL's Two-Mile Mesa Complex, which comprises portions of Technical Area (TA) 6, TA-22, and TA-40. This Proposed Action would involve constructing new buildings; consolidating existing operations and offices; enhancing utilities, roads, and security infrastructure; and demolishing or removing older buildings, structures, and transportables at various technical areas used by DX (Figure 2). This EA has been prepared to assess the potential environmental consequences of this proposed construction, operational consolidation, and demolition project. The objectives of this EA are to (1) describe the underlying purpose and need for NNSA action; (2) describe the Proposed Action and identify and describe any reasonable alternatives that satisfy the purpose and need for agency action; (3) describe baseline environmental conditions at LANL; (4) analyze the potential indirect, direct, and cumulative effects to the existing environment from implementation of the Proposed Action, and (5) compare the effects of the Proposed Action with the No Action Alternative and other reasonable alternatives. For the purposes of compliance with NEPA, reasonable alternatives are identified as being those that meet NNSA's purpose and need for action by virtue of timeliness, appropriate technology, and applicability to LANL. The EA process provides NNSA with environmental information that can be used in developing mitigative actions, if necessary, to minimize or avoid adverse effects to the quality of the human environment and natural ecosystems should NNSA decide to proceed with implementing the Proposed Action at LANL. Ultimately, the goal of NEPA, and this EA, is to aid NNSA officials in making decisions based on an understanding of environmental consequences and in taking actions that protect, restore, and enhance the environment.

  9. A colalborative environment for information driven safeguards

    SciTech Connect (OSTI)

    Scott, Mark R; Michel, Kelly D

    2010-09-15

    For two decades, the IAEA has recognized the need for a comprehensive and strongly integrated Knowledge Management system to support its Information Driven Safeguards activities. In the past, plans for the development of such a system have progressed slowly due to concerns over costs and feasibility. In recent years, Los Alamos National Laboratory has developed a knowledge management system that could serve as the basis for an IAEA Collaborative Environment (ICE). The ICE derivative knowledge management system described in this paper addresses the challenge of living in an era of information overload coupled with certain knowledge shortfalls. The paper describes and defines a system that is flexible, yet ensures coordinated and focused collaboration, broad data evaluation capabilities, architected and organized work flows, and improved communications. The paper and demonstration of ICE will utilize a hypothetical scenario to highlight the functional features that facilitate collaboration amongst and between information analysts and inspectors. The scenario will place these two groups into a simulated planning exercise for a safeguards inspection drawing upon past data acquisitions, inspection reports, analyst conclusions, and a coordinated walk-through of a 3-D model of the facility. Subsequent to the conduct of the simulated facility inspection, the detection of an anomaly and pursuit of follow up activities will illustrate the event notification, information sharing, and collaborative capabilities of the system. The use of a collaborative environment such as ICE to fulfill the complicated knowledge management demands of the Agency and facilitate the completion of annual State Evaluation Reports will also be addressed.

  10. Accelerator Driven Nuclear Energy: The Thorium Option

    ScienceCinema (OSTI)

    Raja, Rajendran

    2010-01-08

    Conventional nuclear reactors use enriched Uranium as fuel and produce nuclear waste which needs to be stored away for over 10,000 years.   At the current rate of use, existing sources of Uranium will last for 50-100 years.  We describe a solution to the problem that uses particle accelerators to produce fast neutrons that can be used to burn existing nuclear waste and produce energy.  Such systems, initially proposed by Carlo Rubbia and collaborators in the 1990's, are being seriously considered by many countries as a possible solution to the green energy problem.  Accelerator driven reactors operate in a sub-critical regime and, thus, are safer and can obtain energy from plentiful elements such as Thorium-232 and Uranium-238. What is missing is the high intensity (10MW) accelerator that produces 1 GeV protons. We will describe scenarios which if implemented will make such systems a reality.  

  11. Target buffer assessment for accelerator driven transmuters.

    SciTech Connect (OSTI)

    Gohar, Y.

    2002-10-08

    Accelerator driven transmuters use a buffer region to protect the structural and the cladding materials of the transmuter from the radiation damage caused by the high-energy spallation neutrons, to accommodate the coolant channels of the self cooled targets, and to have an insignificant effect on the neutron utilization for the transmutation process. These functions are contradicting with respect to the buffer thickness. An extension of the target region in the axial direction (the proton beam direction) is also required to act as a neutron multiplier for the forward component of the high-energy spallation neutrons and a reflector to minimize the neutron leakage. The buffer assessment was performed as a function of its thickness with different proton energies for a self-cooled Lead-Bismuth Eutectic and a sodium-cooled tungsten targets. The analyses show that the number of generated neutrons per proton has a low sensitivity to the buffer thickness. However, the number of neutrons reaching the transmuter is significantly reduced as the buffer thickness is increased. The transmuter neutrons dominate the nuclear responses in the structural material outside the target buffer. The length of the axial target extension is determined as a function of the proton beam energy.

  12. Data flow machine for data driven computing

    DOE Patents [OSTI]

    Davidson, George S.; Grafe, Victor G.

    1995-01-01

    A data flow computer which of computing is disclosed which utilizes a data driven processor node architecture. The apparatus in a preferred embodiment includes a plurality of First-In-First-Out (FIFO) registers, a plurality of related data flow memories, and a processor. The processor makes the necessary calculations and includes a control unit to generate signals to enable the appropriate FIFO register receiving the result. In a particular embodiment, there are three FIFO registers per node: an input FIFO register to receive input information form an outside source and provide it to the data flow memories; an output FIFO register to provide output information from the processor to an outside recipient; and an internal FIFO register to provide information from the processor back to the data flow memories. The data flow memories are comprised of four commonly addressed memories. A parameter memory holds the A and B parameters used in the calculations; an opcode memory holds the instruction; a target memory holds the output address; and a tag memory contains status bits for each parameter. One status bit indicates whether the corresponding parameter is in the parameter memory and one status but to indicate whether the stored information in the corresponding data parameter is to be reused. The tag memory outputs a "fire" signal (signal R VALID) when all of the necessary information has been stored in the data flow memories, and thus when the instruction is ready to be fired to the processor.

  13. Accelerator Driven Nuclear Energy: The Thorium Option

    SciTech Connect (OSTI)

    Raja, Rajendran

    2009-03-18

    Conventional nuclear reactors use enriched Uranium as fuel and produce nuclear waste which needs to be stored away for over 10,000 years.   At the current rate of use, existing sources of Uranium will last for 50-100 years.  We describe a solution to the problem that uses particle accelerators to produce fast neutrons that can be used to burn existing nuclear waste and produce energy.  Such systems, initially proposed by Carlo Rubbia and collaborators in the 1990's, are being seriously considered by many countries as a possible solution to the green energy problem.  Accelerator driven reactors operate in a sub-critical regime and, thus, are safer and can obtain energy from plentiful elements such as Thorium-232 and Uranium-238. What is missing is the high intensity (10MW) accelerator that produces 1 GeV protons. We will describe scenarios which if implemented will make such systems a reality.  

  14. Query-Driven Visualization and Analysis

    SciTech Connect (OSTI)

    Ruebel, Oliver; Bethel, E. Wes; Prabhat, Mr.; Wu, Kesheng

    2012-11-01

    This report focuses on an approach to high performance visualization and analysis, termed query-driven visualization and analysis (QDV). QDV aims to reduce the amount of data that needs to be processed by the visualization, analysis, and rendering pipelines. The goal of the data reduction process is to separate out data that is "scientifically interesting'' and to focus visualization, analysis, and rendering on that interesting subset. The premise is that for any given visualization or analysis task, the data subset of interest is much smaller than the larger, complete data set. This strategy---extracting smaller data subsets of interest and focusing of the visualization processing on these subsets---is complementary to the approach of increasing the capacity of the visualization, analysis, and rendering pipelines through parallelism. This report discusses the fundamental concepts in QDV, their relationship to different stages in the visualization and analysis pipelines, and presents QDV's application to problems in diverse areas, ranging from forensic cybersecurity to high energy physics.

  15. Data flow machine for data driven computing

    DOE Patents [OSTI]

    Davidson, G.S.; Grafe, V.G.

    1988-07-22

    A data flow computer and method of computing is disclosed which utilizes a data driven processor node architecture. The apparatus in a preferred embodiment includes a plurality of First-In-First-Out (FIFO) registers, a plurality of related data flow memories, and a processor. The processor makes the necessary calculations and includes a control unit to generate signals to enable the appropriate FIFO register receiving the result. In a particular embodiment, there are three FIFO registers per node: an input FIFO register to receive input information from an outside source and provide it to the data flow memories; an output FIFO register to provide output information from the processor to an outside recipient; and an internal FIFO register to provide information from the processor back to the data flow memories. The data flow memories are comprised of four commonly addressed memories. A parameter memory holds the A and B parameters used in the calculations; an opcode memory holds the instruction; a target memory holds the output address; and a tag memory contains status bits for each parameter. One status bit indicates whether the corresponding parameter is in the parameter memory and one status bit to indicate whether the stored information in the corresponding data parameter is to be reused. The tag memory outputs a ''fire'' signal (signal R VALID) when all of the necessary information has been stored in the data flow memories, and thus when the instruction is ready to be fired to the processor. 11 figs.

  16. Data flow machine for data driven computing

    SciTech Connect (OSTI)

    Davidson, G.S.; Grafe, V.G.

    1995-11-07

    A data flow computer is disclosed which utilizes a data driven processor node architecture. The apparatus in a preferred embodiment includes a plurality of First-In-First-Out (FIFO) registers, a plurality of related data flow memories, and a processor. The processor makes the necessary calculations and includes a control unit to generate signals to enable the appropriate FIFO register receiving the result. In a particular embodiment, there are three FIFO registers per node: an input FIFO register to receive input information form an outside source and provide it to the data flow memories; an output FIFO register to provide output information from the processor to an outside recipient; and an internal FIFO register to provide information from the processor back to the data flow memories. The data flow memories are comprised of four commonly addressed memories. A parameter memory holds the A and B parameters used in the calculations; an opcode memory holds the instruction; a target memory holds the output address; and a tag memory contains status bits for each parameter. One status bit indicates whether the corresponding parameter is in the parameter memory and one status but to indicate whether the stored information in the corresponding data parameter is to be reused. The tag memory outputs a ``fire`` signal (signal R VALID) when all of the necessary information has been stored in the data flow memories, and thus when the instruction is ready to be fired to the processor. 11 figs.

  17. The evolution of information-driven safeguards

    SciTech Connect (OSTI)

    Budlong-sylvester, Kory W; Pilat, Joseph F

    2010-10-14

    From the adoption of the Model Additional Protocol and integrated safeguards in the 1990s, to current International Atomic Energy Agency (IAEA) efforts to deal with cases of noncompliance, the question of how the Agency can best utilize all the information available to it remains of great interest and increasing importance. How might the concept of 'information-driven' safeguards (IDS) evolve in the future? The ability of the Agency to identify and resolve anomalies has always been important and has emerged as a core Agency function in recent years as the IAEA has had to deal with noncompliance in Iran and the Democratic People's Republic of Korea (DPRK). Future IAEA safeguards implementation should be designed with the goal of facilitating and enhancing this vital capability. In addition, the Agency should utilize all the information it possesses, including its in-house assessments and expertise, to direct its safeguards activities. At the State level, knowledge of proliferation possibilities is currently being used to guide the analytical activities of the Agency and to develop inspection plans. How far can this approach be extended? Does it apply across State boundaries? Should it dictate a larger fraction of safeguards activities? Future developments in IDS should utilize the knowledge resident within the Agency to ensure that safeguards resources flow to where they are most needed in order to address anomalies first and foremost, but also to provide greater confidence in conclusions regarding the absence of undeclared nuclear activities. The elements of such a system and related implementation issues are assessed in this paper.

  18. Comparison between kinetic-ballooning-mode-driven turbulence and ion-temperature-gradient-driven turbulence

    SciTech Connect (OSTI)

    Maeyama, S. Nakata, M.; Miyato, N.; Yagi, M.; Ishizawa, A.; Watanabe, T.-H.; Idomura, Y.

    2014-05-15

    Electromagnetic turbulence driven by kinetic ballooning modes (KBMs) in high-? plasma is investigated based on the local gyrokinetic model. Analysis of turbulent fluxes, norms, and phases of fluctuations shows that KBM turbulence gives narrower spectra and smaller phase factors than those in ion-temperature-gradient (ITG)-driven turbulence. This leads to the smaller transport fluxes in KBM turbulence than those in ITG turbulence even when they have similar linear growth rates. From the analysis of the entropy balance relation, it is found that the entropy transfer from ions to electrons through the field-particle interactions mainly drives electron perturbations, which creates radial twisted modes by rapid parallel motions of electrons in a sheared magnetic geometry. The nonlinear coupling between the dominant unstable mode and its twisted modes is important for the saturation of KBM turbulence, in contrast to the importance of zonal flow shearing in ITG turbulence. The coupling depends on the flux-tube domain with the one-poloidal-turn parallel length and on the torus periodicity constraint.

  19. Similarity-Driven Discovery of Zeolite Materials for Adsorption...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Similarity-Driven Discovery of Zeolite Materials for Adsorption-Based Separations Previous Next List Richard L. Martin, Thomas F. Willems, Li-Chiang Lin, Jihan Kim, Joseph A....

  20. Menu Driven Program Determining Properties of Aqueous Lithium Bromide Solutions

    Energy Science and Technology Software Center (OSTI)

    1992-12-09

    LIMENU is a menu driven program written to compute seven physical properties of a lithium bromide-water solution and three physical properties of water, and to display two plots.

  1. Wave-driven Countercurrent Plasma Centrifuge | Princeton Plasma Physics Lab

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Wave-driven Countercurrent Plasma Centrifuge This is an invention allowing the production of rotation and countercurrent flow patterns in a plasma centrifuge using radiofrequency waves No.: M-801 Inventor(s): Nathaniel J Fisch

  2. Residential Network Members Support New Data-Driven Initiative...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    The open-source software application fills a major market need for data-driven energy efficiency program design and implementation. A SEED user can import data sources, such as ...

  3. Quantum-mechanical aspects of classically chaotic driven systems

    SciTech Connect (OSTI)

    Milonni, P.W.; Ackerhalt, J.R.; Goggin, M.E.

    1987-01-01

    This paper treats atoms and molecules in laser fields as periodically driven quantum systems. The paper concludes by determining that stochastic excitation is possible in quantum systems with quasiperiodic driving. 17 refs. (JDH)

  4. Simple, Ethanol-Driven Synthesis of Core-Shell Nanoparticles...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Find More Like This Return to Search Simple, Ethanol-Driven Synthesis of Core-Shell ... This "green" synthesis method uses ethanol - a simple solvent for metal precursors "as the ...

  5. Mission Driven Science at Argonne | Argonne National Laboratory

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Mission Driven Science at Argonne Share Description Mission driven science at Argonne means applying science and scientific knowledge to a physical and "real world" environment. Examples include testing a theoretical model through the use of formal science or solving a practical problem through the use of natural science. At the laboratory, our materials scientists are leading the way in producing energy solutions today that could help reduce and remove the energy crisis of tomorrow.

  6. Using laser-driven neutrons to stop nuclear smugglers

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Using laser-driven neutrons to stop nuclear smugglers Using laser-driven neutrons to stop nuclear smugglers Researchers have successfully demonstrated for the first time that laser-generated neutrons can be enlisted as a useful tool in the War on Terror. June 4, 2013 A burst of laser energy 50 times greater than the worldwide output of electrical power slams into an extremely thin foil target to produce neutrons at Los Alamos National Laboratory's TRIDENT laser facility during a recent

  7. Electronically- and crystal-structure-driven magnetic structures and

    Office of Scientific and Technical Information (OSTI)

    physical properties of RScSb (R = rare earth) compounds. A neutron diffraction, magnetization and heat capacity study (Journal Article) | SciTech Connect Electronically- and crystal-structure-driven magnetic structures and physical properties of RScSb (R = rare earth) compounds. A neutron diffraction, magnetization and heat capacity study Citation Details In-Document Search Title: Electronically- and crystal-structure-driven magnetic structures and physical properties of RScSb (R = rare

  8. Continuous Energy Improvement in Motor Driven Systems - A Guidebook for

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Industry | Department of Energy Energy Improvement in Motor Driven Systems - A Guidebook for Industry Continuous Energy Improvement in Motor Driven Systems - A Guidebook for Industry This guidebook provides a step-by-step approach to developing a motor system energy-improvement action plan. An action plan includes which motors should be repaired or replaced with higher efficiency models, recommendations on maintaining a spares inventory, and discussion of improvements in maintenance

  9. Entropy-driven structure and dynamics in carbon nanocrystallites (Journal

    Office of Scientific and Technical Information (OSTI)

    Article) | SciTech Connect Journal Article: Entropy-driven structure and dynamics in carbon nanocrystallites Citation Details In-Document Search Title: Entropy-driven structure and dynamics in carbon nanocrystallites New carbon composite materials are being developed that contain carbon nanocrystallites in the range of 5 17 A in radius dispersed within an amorphous carbon matrix. Evaluating the applicability of these materials for use in battery electrodes requires a molecular-level

  10. Experimental evidence of space charge driven resonances in high intensity

    Office of Scientific and Technical Information (OSTI)

    linear accelerators (Journal Article) | SciTech Connect Experimental evidence of space charge driven resonances in high intensity linear accelerators Citation Details In-Document Search Title: Experimental evidence of space charge driven resonances in high intensity linear accelerators Authors: Jeon, Dong-O Publication Date: 2016-01-12 OSTI Identifier: 1235762 Grant/Contract Number: AC05-00OR22725 Type: Published Article Journal Name: Physical Review Accelerators and Beams Additional Journal

  11. NREL Demonstrates Light-Driven Process for Enzymatic Ammonia Production:

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Carbon emissions and energy requirements reduced with new approach | Department of Energy Demonstrates Light-Driven Process for Enzymatic Ammonia Production: Carbon emissions and energy requirements reduced with new approach NREL Demonstrates Light-Driven Process for Enzymatic Ammonia Production: Carbon emissions and energy requirements reduced with new approach April 21, 2016 - 4:03pm Addthis News release from the National Renewable Energy Laboratory, April 21 A new process using light to

  12. Department of Energy Announces First Entry for Market- Driven

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    High-Efficiency Commercial Air Conditioners Challenge | Department of Energy First Entry for Market- Driven High-Efficiency Commercial Air Conditioners Challenge Department of Energy Announces First Entry for Market- Driven High-Efficiency Commercial Air Conditioners Challenge October 4, 2011 - 12:02pm Addthis Washington, D.C. - The U.S. Department of Energy (DOE) today announced that it has received the first official submission by a manufacturer to a voluntary challenge for a new

  13. Computational study of the shock driven instability of a multiphase

    Office of Scientific and Technical Information (OSTI)

    particle-gas system (Journal Article) | SciTech Connect Journal Article: Computational study of the shock driven instability of a multiphase particle-gas system Citation Details In-Document Search This content will become publicly available on February 1, 2017 Title: Computational study of the shock driven instability of a multiphase particle-gas system This paper considers the interaction of a shock wave with a multiphase particle-gas system which creates an instability somewhat similar to

  14. Electronically- and crystal-structure-driven magnetic structures and

    Office of Scientific and Technical Information (OSTI)

    physical properties of RScSb (R = rare earth) compounds. A neutron diffraction, magnetization and heat capacity study (Journal Article) | SciTech Connect Electronically- and crystal-structure-driven magnetic structures and physical properties of RScSb (R = rare earth) compounds. A neutron diffraction, magnetization and heat capacity study Citation Details In-Document Search Title: Electronically- and crystal-structure-driven magnetic structures and physical properties of RScSb (R = rare

  15. Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts Print Wednesday, 28 January 2009 00:00 Catalytic systems based on bimetallic particles with controlled size, composition, and structure dispersed on a high-surface-area support are widely used for catalytic reforming, pollution control, alcohol oxidation, and electrocatalysis in fuel cells. Owing to the nanoscale size of the particles, the modification of the

  16. Scenario-Driven Training | Y-12 National Security Complex

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Scenario-Driven Training Scenario-Driven Training An initial entry team member assesses the overall hazards in a clandestine lab. Y-12's Nuclear and Radiological Field Training Center equips military units, as well as federal, state and local emergency response agencies with the hands-on skills and knowledge they need to safely detect, safeguard and handle real nuclear and radiological sources. To test their skills, Y-12 has developed training exercises that include the following scenarios:

  17. Uniaxial stress-driven coupled grain boundary motion in hexagonal

    Office of Scientific and Technical Information (OSTI)

    close-packed metals: A molecular dynamics study (Journal Article) | SciTech Connect Uniaxial stress-driven coupled grain boundary motion in hexagonal close-packed metals: A molecular dynamics study Citation Details In-Document Search This content will become publicly available on January 1, 2017 Title: Uniaxial stress-driven coupled grain boundary motion in hexagonal close-packed metals: A molecular dynamics study Authors: Zong, Hongxiang ; Ding, Xiangdong ; Lookman, Turab ; Li, Ju ; Sun,

  18. Performance of Gas-Engine Driven Heat Pump Unit

    SciTech Connect (OSTI)

    Abdi Zaltash; Randy Linkous; Randall Wetherington; Patrick Geoghegan; Ed Vineyard; Isaac Mahderekal; Robert Gaylord

    2008-09-30

    Air-conditioning (cooling) for buildings is the single largest use of electricity in the United States (U.S.). This drives summer peak electric demand in much of the U.S. Improved air-conditioning technology thus has the greatest potential impact on the electric grid compared to other technologies that use electricity. Thermally-activated technologies (TAT), such as natural gas engine-driven heat pumps (GHP), can provide overall peak load reduction and electric grid relief for summer peak demand. GHP offers an attractive opportunity for commercial building owners to reduce electric demand charges and operating expenses. Engine-driven systems have several potential advantages over conventional single-speed or single-capacity electric motor-driven units. Among them are variable speed operation, high part load efficiency, high temperature waste heat recovery from the engine, and reduced annual operating costs (SCGC 1998). Although gas engine-driven systems have been in use since the 1960s, current research is resulting in better performance, lower maintenance requirements, and longer operating lifetimes. Gas engine-driven systems are typically more expensive to purchase than comparable electric motor-driven systems, but they typically cost less to operate, especially for commercial building applications. Operating cost savings for commercial applications are primarily driven by electric demand charges. GHP operating costs are dominated by fuel costs, but also include maintenance costs. The reliability of gas cooling equipment has improved in the last few years and maintenance requirements have decreased (SCGC 1998, Yahagi et al. 2006). Another advantage of the GHP over electric motor-driven is the ability to use the heat rejected from the engine during heating operation. The recovered heat can be used to supplement the vapor compression cycle during heating or to supply other process loads, such as water heating. The use of the engine waste heat results in greater operating efficiency compared to conventional electric motor-driven units (SCGC 1998). In Japan, many hundreds of thousands of natural gas-driven heat pumps have been sold (typically 40,000 systems annually) (Yahagi et al. 2006). The goal of this program is to develop dependable and energy efficient GHPs suitable for U.S. commercial rooftop applications (the single largest commercial product segment). This study describes the laboratory performance evaluation of an integrated 10-ton GHP rooftop unit (a 900cc Daihatsu-Aisin natural gas engine) which uses R410A as the refrigerant (GEDAC No.23). ORNL Thermally-Activated Heat Pump (TAHP) Environmental Chambers were used to evaluate this unit in a controlled laboratory environment.

  19. SUPERNOVAE AND AGN DRIVEN GALACTIC OUTFLOWS

    SciTech Connect (OSTI)

    Sharma, Mahavir; Nath, Biman B. E-mail: biman@rri.res.in

    2013-01-20

    We present analytical solutions for winds from galaxies with a Navarro-Frank-White (NFW) dark matter halo. We consider winds driven by energy and mass injection from multiple supernovae (SNe), as well as momentum injection due to radiation from a central black hole. We find that the wind dynamics depends on three velocity scales: (1) v{sub *}{approx}( E-dot / 2 M-dot ){sup 1/2} describes the effect of starburst activity, with E-dot and M-dot as energy and mass injection rate in a central region of radius R; (2) v {sub .} {approx} (GM {sub .}/2R){sup 1/2} for the effect of a central black hole of mass M {sub .} on gas at distance R; and (3) v{sub s}=(GM{sub h} / 2Cr{sub s}){sup 1/2}, which is closely related to the circular speed (v{sub c} ) for an NFW halo, where r{sub s} is the halo scale radius and C is a function of the halo concentration parameter. Our generalized formalism, in which we treat both energy and momentum injection from starbursts and radiation from the central active galactic nucleus (AGN), allows us to estimate the wind terminal speed to be (4v {sup 2} {sub *} + 6({Gamma} - 1)v {sub .} {sup 2} - 4v {sup 2} {sub s}){sup 1/2}, where {Gamma} is the ratio of force due to radiation pressure to gravity of the central black hole. Our dynamical model also predicts the following: (1) winds from quiescent star-forming galaxies cannot escape from 10{sup 11.5} M {sub Sun} {<=} M{sub h} {<=} 10{sup 12.5} M {sub Sun} galaxies; (2) circumgalactic gas at large distances from galaxies should be present for galaxies in this mass range; (3) for an escaping wind, the wind speed in low- to intermediate-mass galaxies is {approx}400-1000 km s{sup -1}, consistent with observed X-ray temperatures; and (4) winds from massive galaxies with AGNs at Eddington limit have speeds {approx}> 1000 km s{sup -1}. We also find that the ratio [2v {sup 2} {sub *} - (1 - {Gamma})v {sub .} {sup 2}]/v {sup 2} {sub c} dictates the amount of gas lost through winds. Used in conjunction with an appropriate relation between M {sub .} and M{sub h} and an appropriate opacity of dust grains in infrared (K band), this ratio has the attractive property of being minimum at a certain halo mass scale (M{sub h} {approx} 10{sup 12}-10{sup 12.5} M {sub Sun }) that signifies the crossover of AGN domination in outflow properties from starburst activity at lower masses. We find that stellar mass for massive galaxies scales as M {sub *}{proportional_to}M {sup 0.26} {sub h}, and for low-mass galaxies, M {sub *}{proportional_to}M {sup 5/3} {sub h}.

  20. Alkali-vapor magnetic resonance driven by fictitious radiofrequency fields

    SciTech Connect (OSTI)

    Zhivun, Elena; Wickenbrock, Arne; Patton, Brian; Budker, Dmitry

    2014-11-10

    We demonstrate an all-optical {sup 133}Cs scalar magnetometer, operating in nonzero magnetic field, in which the magnetic resonance is driven by an effective oscillating magnetic field provided by the AC Stark shift of an intensity-modulated laser beam. We achieve a projected shot-noise-limited sensitivity of 1.7fT/√(Hz) and measure a technical noise floor of 40fT/√(Hz). These results are essentially identical to a coil-driven scalar magnetometer using the same setup. This all-optical scheme offers advantages over traditional coil-driven magnetometers for use in arrays and in magnetically sensitive fundamental physics experiments, e.g., searches for a permanent electric dipole moment of the neutron.

  1. Transition state theory for laser-driven reactions

    SciTech Connect (OSTI)

    Kawai, Shinnosuke; Bandrauk, Andre D.; Jaffe, Charles; Bartsch, Thomas; Palacian, Jesus; Uzer, T.

    2007-04-28

    Recent developments in transition state theory brought about by dynamical systems theory are extended to time-dependent systems such as laser-driven reactions. Using time-dependent normal form theory, the authors construct a reaction coordinate with regular dynamics inside the transition region. The conservation of the associated action enables one to extract time-dependent invariant manifolds that act as separatrices between reactive and nonreactive trajectories and thus make it possible to predict the ultimate fate of a trajectory. They illustrate the power of our approach on a driven Henon-Heiles system, which serves as a simple example of a reactive system with several open channels. The present generalization of transition state theory to driven systems will allow one to study processes such as the control of chemical reactions through laser pulses.

  2. Performance-Driven Interface Contract Enforcement for Scientific Components

    SciTech Connect (OSTI)

    Dahlgren, T L

    2007-10-01

    Performance-driven interface contract enforcement research aims to improve the quality of programs built from plug-and-play scientific components. Interface contracts make the obligations on the caller and all implementations of the specified methods explicit. Runtime contract enforcement is a well-known technique for enhancing testing and debugging. However, checking all of the associated constraints during deployment is generally considered too costly from a performance stand point. Previous solutions enforced subsets of constraints without explicit consideration of their performance implications. Hence, this research measures the impacts of different interface contract sampling strategies and compares results with new techniques driven by execution time estimates. Results from three studies indicate automatically adjusting the level of checking based on performance constraints improves the likelihood of detecting contract violations under certain circumstances. Specifically, performance-driven enforcement is better suited to programs exercising constraints whose costs are at most moderately expensive relative to normal program execution.

  3. Driven Morse oscillator: Classical chaos, quantum theory, and photodissociation

    SciTech Connect (OSTI)

    Goggin, M.E.; Milonni, P.W.

    1988-02-01

    We compare the classical and quantum theories of a Morse oscillator driven by a sinusoidal field, focusing attention on multiple-photon excitation and dissociation. In both the classical and quantum theories the threshold field strength for dissociation may be estimated fairly accurately on the basis of classical resonance overlap, and the classical and quantum results for the threshold are in good agreement except near higher-order classical resonances and quantum multiphoton resonances. We discuss the possibility of ''quantum chaos'' in such driven molecular systems and use the Morse oscillator to test the manifestations of classical resonance overlap suggested semiclassically.

  4. Nematic-driven anisotropic electronic properties of underdoped detwinned Ba

    Office of Scientific and Technical Information (OSTI)

    ( Fe 1 - x Co x ) 2 As 2 revealed by optical spectroscopy (Journal Article) | SciTech Connect Nematic-driven anisotropic electronic properties of underdoped detwinned Ba ( Fe 1 - x Co x ) 2 As 2 revealed by optical spectroscopy Citation Details In-Document Search Title: Nematic-driven anisotropic electronic properties of underdoped detwinned Ba ( Fe 1 - x Co x ) 2 As 2 revealed by optical spectroscopy Authors: Mirri, C. ; Dusza, A. ; Bastelberger, S. ; Chu, J.-H. ; Kuo, H.-H. ; Fisher, I. R.

  5. Suppression of energetic particle driven instabilities with HHFW heating

    SciTech Connect (OSTI)

    Fredrickson, E. D.; Taylor, G.; Bertelli, N.; Darrow, D. S.; Gorelenkov, N.; Kramer, G.; Liu, D.; Crocker, N. A.; Kubota, S.; White, R.

    2015-01-01

    In plasmas in the National Spherical Torus Experiment (NSTX) [Ono et al., Nucl. Fusion 40 (2000) 557] heated with neutral beams, the beam ions typically excite Energetic Particle Modes (EPMs or fishbones), and Toroidal, Global or Compressional Alfvén Eigenmodes (TAE, GAE, CAE). These modes can redistribute the energetic beam ions, altering the beam driven current profile and the plasma heating profile, or they may affect electron thermal transport or cause losses of the beam ions. In this paper we present experimental results where these instabilities, driven by the super-thermal beam ions, are suppressed with the application of High Harmonic Fast Wave heating.

  6. Suppression of energetic particle driven instabilities with HHFW heating

    SciTech Connect (OSTI)

    Fredrickson, E. D.; Taylor, G.; Bertelli, N.; Darrow, D. S.; Gorelenkov, N.; Kramer, G.; Liu, D.; Crocker, N. A.; Kubota, S.; White, R.

    2015-01-01

    In plasmas in the National Spherical Torus Experiment (NSTX) [Ono et al., Nucl. Fusion 40 (2000) 557] heated with neutral beams, the beam ions typically excite Energetic Particle Modes (EPMs or fishbones), and Toroidal, Global or Compressional Alfvn Eigenmodes (TAE, GAE, CAE). These modes can redistribute the energetic beam ions, altering the beam driven current profile and the plasma heating profile, or they may affect electron thermal transport or cause losses of the beam ions. In this paper we present experimental results where these instabilities, driven by the super-thermal beam ions, are suppressed with the application of High Harmonic Fast Wave heating.

  7. Butterfly Floquet Spectrum in Driven SU(2) Systems

    SciTech Connect (OSTI)

    Wang Jiao [Temasek Laboratories, National University of Singapore, 117542 (Singapore); Department of Physics, Institute of Theoretical Physics and Astrophysics, Xiamen University, Xiamen 361005 (China); Gong Jiangbin [Department of Physics and Center of Computational Science and Engineering, National University of Singapore, 117542 (Singapore); NUS Graduate School for Integrative Sciences and Engineering, Singapore 117597 (Singapore)

    2009-06-19

    The Floquet spectrum of a class of driven SU(2) systems is shown to display a butterfly pattern with multifractal properties. The level crossing between Floquet states of the same parity or different parities is studied. The results are relevant to studies of fractal statistics, quantum chaos, coherent destruction of tunneling, and the validity of mean-field descriptions of Bose-Einstein condensates.

  8. Sub-100 ps laser-driven dynamic compression of solid deuterium...

    Office of Scientific and Technical Information (OSTI)

    Journal Article: Sub-100 ps laser-driven dynamic compression of solid deuterium with a 40 J laser pulse Citation Details In-Document Search Title: Sub-100 ps laser-driven ...

  9. Save Energy Now in Your Motor-Driven Systems | Department of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Motor-Driven Systems Save Energy Now in Your Motor-Driven Systems This fact sheet describes how manufacturing plants can save energy and money by making energy efficiency ...

  10. Design and optimization of a bi-axial vibration-driven electromagnetic...

    Office of Scientific and Technical Information (OSTI)

    Design and optimization of a bi-axial vibration-driven electromagnetic generator Citation Details In-Document Search Title: Design and optimization of a bi-axial vibration-driven ...

  11. Bioenergy Demand in a Market Driven Forest Economy (U.S. South...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Bioenergy Demand in a Market Driven Forest Economy (U.S. South) Bioenergy Demand in a Market Driven Forest Economy (U.S. South) Breakout Session 1A: Biomass Feedstocks for the...

  12. A Beam Driven Plasma-Wakefield Linear Collider: From Higgs Factory...

    Office of Scientific and Technical Information (OSTI)

    A Beam Driven Plasma-Wakefield Linear Collider: From Higgs Factory to Multi-TeV Citation Details In-Document Search Title: A Beam Driven Plasma-Wakefield Linear Collider: From Higgs ...

  13. Beam-dynamics driven design of the LHeC energy-recovery linac...

    Office of Scientific and Technical Information (OSTI)

    Journal Article: Beam-dynamics driven design of the LHeC energy-recovery linac Citation Details In-Document Search Title: Beam-dynamics driven design of the LHeC energy-recovery ...

  14. Beam-dynamics driven design of the LHeC energy-recovery linac...

    Office of Scientific and Technical Information (OSTI)

    Beam-dynamics driven design of the LHeC energy-recovery linac Citation Details In-Document Search Title: Beam-dynamics driven design of the LHeC energy-recovery linac The LHeC ...

  15. A DATA-DRIVEN MODEL FOR THE GLOBAL CORONAL EVOLUTION

    SciTech Connect (OSTI)

    Feng Xueshang; Jiang Chaowei; Xiang Changqing; Zhao Xuepu; Wu, S. T. E-mail: cwjiang@spaceweather.ac.cn E-mail: xpzhao@sun.stanford.edu

    2012-10-10

    This work is devoted to the construction of a data-driven model for the study of the dynamic evolution of the global corona that can respond continuously to the changing of the photospheric magnetic field. The data-driven model consists of a surface flux transport (SFT) model and a global three-dimensional (3D) magnetohydrodynamic (MHD) coronal model. The SFT model is employed to produce the global time-varying and self-consistent synchronic snapshots of the photospheric magnetic field as the input to drive our 3D numerical global coronal AMR-CESE-MHD model on an overset grid of Yin-Yang overlapping structure. The SFT model and the 3D global coronal model are coupled through the boundary condition of the projected characteristic method. Numerical results of the coronal evolution from 1996 September 4 to October 29 provide a good comparison with multiply observed coronal images.

  16. Density gradient effects on transverse shear driven lower hybrid waves

    SciTech Connect (OSTI)

    DuBois, Ami M.; Thomas, Edward; Amatucci, William E.; Ganguli, Gurudas

    2014-06-15

    Shear driven instabilities are commonly observed in the near-Earth space, particularly in boundary layer plasmas. When the shear scale length (L{sub E}) is much less than the ion gyro-radius (?{sub i}) but greater than the electron gyro-radius (?{sub e}), the electrons are magnetized in the shear layer, but the ions are effectively un-magnetized. The resulting shear driven instability, the electron-ion hybrid (EIH) instability, is investigated in a new interpenetrating plasma configuration in the Auburn Linear EXperiment for Instability Studies. In order to understand the dynamics of magnetospheric boundary layers, the EIH instability is studied in the presence of a density gradient located at the boundary layer between two plasmas. This paper reports on a recent experiment in which electrostatic lower hybrid waves are identified as the EIH instability, and the effect of a density gradient on the instability properties are investigated.

  17. Strongly driven one-atom laser and decoherence monitoring

    SciTech Connect (OSTI)

    Lougovski, P.; Casagrande, F.; Lulli, A.; Solano, E.

    2007-09-15

    We propose the implementation of a strongly driven one-atom laser, based on the off-resonant interaction of a three-level atom in {lambda} configuration with a single cavity mode and three laser fields. We show that the system can be described equivalently by a two-level atom resonantly coupled to the cavity and driven by a strong effective coherent field. The effective dynamics can be solved exactly, including a thermal field bath, allowing an analytical description of field statistics and entanglement properties. We also show the possible generation of quantum superposition (Schroedinger cat) states for the whole atom-field system and for the field alone after atomic measurement. We propose a way to monitor the system decoherence by measuring atomic populations. Finally, we confirm the validity of our model through numerical solutions.

  18. Continuous third harmonic generation in a terahertz driven modulated nanowire

    SciTech Connect (OSTI)

    Hamilton, Kathleen E. De, Amrit; Pryadko, Leonid P.; Kovalev, Alexey A.

    2015-06-07

    We consider the possibility of observing continuous third-harmonic generation using a strongly driven, single-band one-dimensional metal. In the absence of scattering, the quantum efficiency of frequency tripling for such a system can be as high as 93%. Combining the Floquet quasi-energy spectrum with the Keldysh Green's function technique, we derive a semiclassical master equation for a one-dimensional band of strongly and rapidly driven electrons in the presence of weak scattering by phonons. The power absorbed from the driving field is continuously dissipated by phonon modes, leading to a quasi-equilibrium in the electron distribution. We use the Kronig-Penney model with varying effective mass to establish the growth parameters of an InAs/InP nanowire near optimal for third harmonic generation at terahertz frequency range.

  19. Suppression of energetic particle driven instabilities with HHFW heating

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Fredrickson, E. D.; Taylor, G.; Bertelli, N.; Darrow, D. S.; Gorelenkov, N.; Kramer, G.; Liu, D.; Crocker, N. A.; Kubota, S.; White, R.

    2015-01-01

    In plasmas in the National Spherical Torus Experiment (NSTX) [Ono et al., Nucl. Fusion 40 (2000) 557] heated with neutral beams, the beam ions typically excite Energetic Particle Modes (EPMs or fishbones), and Toroidal, Global or Compressional Alfvén Eigenmodes (TAE, GAE, CAE). These modes can redistribute the energetic beam ions, altering the beam driven current profile and the plasma heating profile, or they may affect electron thermal transport or cause losses of the beam ions. In this paper we present experimental results where these instabilities, driven by the super-thermal beam ions, are suppressed with the application of High Harmonic Fastmore » Wave heating.« less

  20. Beam-driven acceleration in ultra-dense plasma media

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Shin, Young-Min

    2014-09-15

    Accelerating parameters of beam-driven wakefield acceleration in an extremely dense plasma column has been analyzed with the dynamic framed particle-in-cell plasma simulator, and compared with analytic calculations. In the model, a witness beam undergoes a TeV/m scale alternating potential gradient excited by a micro-bunched drive beam in a 1025 m-3 and 1.6 x 1028 m-3 plasma column. The acceleration gradient, energy gain, and transformer ratio have been extensively studied in quasi-linear, linear-, and blowout-regimes. The simulation analysis indicated that in the beam-driven acceleration system a hollow plasma channel offers 20 % higher acceleration gradient by enlarging the channel radius (r)morefrom 0.2 ?p to 0.6 ?p in a blowout regime. This paper suggests a feasibility of TeV/m scale acceleration with a hollow crystalline structure (e.g. nanotubes) of high electron plasma density.less

  1. LIMB-DARKENED RADIATION-DRIVEN WINDS FROM MASSIVE STARS

    SciTech Connect (OSTI)

    Cure, M.; Cidale, L.

    2012-10-01

    We calculated the influence of the limb-darkened finite-disk correction factor in the theory of radiation-driven winds from massive stars. We solved the one-dimensional m-CAK hydrodynamical equation of rotating radiation-driven winds for all three known solutions, i.e., fast, {Omega}-slow, and {delta}-slow. We found that for the fast solution, the mass-loss rate is increased by a factor of {approx}10%, while the terminal velocity is reduced about 10%, when compared with the solution using a finite-disk correction factor from a uniformly bright star. For the other two slow solutions, the changes are almost negligible. Although we found that the limb darkening has no effects on the wind-momentum-luminosity relationship, it would affect the calculation of synthetic line profiles and the derivation of accurate wind parameters.

  2. NREL Demonstrates Light-Driven Process for Enzymatic Ammonia Production -

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    News Releases | NREL Demonstrates Light-Driven Process for Enzymatic Ammonia Production Carbon emissions and energy requirements reduced with new approach April 21, 2016 Image shows tubes of cadmium sulfide nanoparticles dissolved in water. A new process using light to reduce dinitrogen into ammonia, the main ingredient in chemical fertilizers could inspire development of new, more sustainable processes that eliminate the energy-intensive, lengthier processes now commonly in use. According

  3. LIQUID BUTANE FILLED LOAD FOR A LINER DRIVEN PEGASUS EXPERIMENT

    SciTech Connect (OSTI)

    M.A. SALAZAR; W. ANDERSON; ET AL

    2001-06-01

    A hydrogen rich, low density liquid, contained within the internal volume of a cylindrical liner, was requested of the Polymers and Coatings Group (MST-7) of the Los Alamos Materials Science Division for one of the last liner driven experiments conducted on the Los Alamos Pegasus facility. The experiment was a continuation of the Raleigh-Taylor hydrodynamics series of experiments and associated liners that have been described previously [1,2].

  4. Liquid butane filled load for a liner driven Pegasus experiment.

    SciTech Connect (OSTI)

    Salazar, M. A.; Armijo, E. V.; Anderson, W. E.; Atchison, W. L.; Bartos, J. J.; Garcia, F.; Randolph, B.; Sheppard, M. G.; Stokes, J. L.

    2001-01-01

    A hydrogen rich, low density liquid, contained within the internal volume of a cylindrical liner, was requested of the Polymers and Coatings Group (MST-7) of the Los Alamos Materials Science Division for one of the last liner driven experiments conducted on the Los Alamos Pegasus facility. The experiment (Fig.1) was a continuation of the Raleigh-Taylor hydrodynamics series of experiments and associated liners that have been described previously.

  5. Nanoparticle-Driven Assembly of Highly Conducting Hybrid Block Copolymer

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Electrolytes - Joint Center for Energy Storage Research January 13, 2015, Research Highlights Nanoparticle-Driven Assembly of Highly Conducting Hybrid Block Copolymer Electrolytes (Top) The addition of 2 wt% nanoparticles (SEO-LiTFSI-POSS-2) results in an increase in ionic conductivity. STEM images show the bicontinuous morphology of the electrolyte with 2 wt% of nanoparticles. (Bottom) The value of morphology factor, f, for SEO-LiTFSI-POSS-2 is close to unity, the value expected for an

  6. Waste heat driven absorption refrigeration process and system

    DOE Patents [OSTI]

    Wilkinson, William H.

    1982-01-01

    Absorption cycle refrigeration processes and systems are provided which are driven by the sensible waste heat available from industrial processes and other sources. Systems are disclosed which provide a chilled water output which can be used for comfort conditioning or the like which utilize heat from sensible waste heat sources at temperatures of less than 170.degree. F. Countercurrent flow equipment is also provided to increase the efficiency of the systems and increase the utilization of available heat.

  7. Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts Print Catalytic systems based on bimetallic particles with controlled size, composition, and structure dispersed on a high-surface-area support are widely used for catalytic reforming, pollution control, alcohol oxidation, and electrocatalysis in fuel cells. Owing to the nanoscale size of the particles, the modification of the surface structure and composition that may occur when reaction conditions change can have dramatic

  8. Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts Print Catalytic systems based on bimetallic particles with controlled size, composition, and structure dispersed on a high-surface-area support are widely used for catalytic reforming, pollution control, alcohol oxidation, and electrocatalysis in fuel cells. Owing to the nanoscale size of the particles, the modification of the surface structure and composition that may occur when reaction conditions change can have dramatic

  9. Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts Print Catalytic systems based on bimetallic particles with controlled size, composition, and structure dispersed on a high-surface-area support are widely used for catalytic reforming, pollution control, alcohol oxidation, and electrocatalysis in fuel cells. Owing to the nanoscale size of the particles, the modification of the surface structure and composition that may occur when reaction conditions change can have dramatic

  10. Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts Print Catalytic systems based on bimetallic particles with controlled size, composition, and structure dispersed on a high-surface-area support are widely used for catalytic reforming, pollution control, alcohol oxidation, and electrocatalysis in fuel cells. Owing to the nanoscale size of the particles, the modification of the surface structure and composition that may occur when reaction conditions change can have dramatic

  11. Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts Print Catalytic systems based on bimetallic particles with controlled size, composition, and structure dispersed on a high-surface-area support are widely used for catalytic reforming, pollution control, alcohol oxidation, and electrocatalysis in fuel cells. Owing to the nanoscale size of the particles, the modification of the surface structure and composition that may occur when reaction conditions change can have dramatic

  12. Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts Print Catalytic systems based on bimetallic particles with controlled size, composition, and structure dispersed on a high-surface-area support are widely used for catalytic reforming, pollution control, alcohol oxidation, and electrocatalysis in fuel cells. Owing to the nanoscale size of the particles, the modification of the surface structure and composition that may occur when reaction conditions change can have dramatic

  13. Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts Print Catalytic systems based on bimetallic particles with controlled size, composition, and structure dispersed on a high-surface-area support are widely used for catalytic reforming, pollution control, alcohol oxidation, and electrocatalysis in fuel cells. Owing to the nanoscale size of the particles, the modification of the surface structure and composition that may occur when reaction conditions change can have dramatic

  14. Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts Print Catalytic systems based on bimetallic particles with controlled size, composition, and structure dispersed on a high-surface-area support are widely used for catalytic reforming, pollution control, alcohol oxidation, and electrocatalysis in fuel cells. Owing to the nanoscale size of the particles, the modification of the surface structure and composition that may occur when reaction conditions change can have dramatic

  15. Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Reaction-Driven Restructuring of Bimetallic Nanoparticle Catalysts Print Catalytic systems based on bimetallic particles with controlled size, composition, and structure dispersed on a high-surface-area support are widely used for catalytic reforming, pollution control, alcohol oxidation, and electrocatalysis in fuel cells. Owing to the nanoscale size of the particles, the modification of the surface structure and composition that may occur when reaction conditions change can have dramatic

  16. User-Driven Sampling Strategies in Image Exploitation

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Harvey, Neal R.; Porter, Reid B.

    2013-12-23

    Visual analytics and interactive machine learning both try to leverage the complementary strengths of humans and machines to solve complex data exploitation tasks. These fields overlap most significantly when training is involved: the visualization or machine learning tool improves over time by exploiting observations of the human-computer interaction. This paper focuses on one aspect of the human-computer interaction that we call user-driven sampling strategies. Unlike relevance feedback and active learning sampling strategies, where the computer selects which data to label at each iteration, we investigate situations where the user selects which data is to be labeled at each iteration. User-drivenmore » sampling strategies can emerge in many visual analytics applications but they have not been fully developed in machine learning. We discovered that in user-driven sampling strategies suggest new theoretical and practical research questions for both visualization science and machine learning. In this paper we identify and quantify the potential benefits of these strategies in a practical image analysis application. We find user-driven sampling strategies can sometimes provide significant performance gains by steering tools towards local minima that have lower error than tools trained with all of the data. Furthermore, in preliminary experiments we find these performance gains are particularly pronounced when the user is experienced with the tool and application domain.« less

  17. Explosively driven air blast in a conical shock tube

    SciTech Connect (OSTI)

    Stewart, Joel B. Pecora, Collin

    2015-03-15

    Explosively driven shock tubes present challenges in terms of safety concerns and expensive upkeep of test facilities but provide more realistic approximations to the air blast resulting from free-field detonations than those provided by gas-driven shock tubes. Likewise, the geometry of conical shock tubes can naturally approximate a sector cut from a spherically symmetric blast, leading to a better agreement with the blast profiles of free-field detonations when compared to those provided by shock tubes employing constant cross sections. The work presented in this article documents the design, fabrication, and testing of an explosively driven conical shock tube whose goal was to closely replicate the blast profile seen from a larger, free-field detonation. By constraining the blast through a finite area, large blasts (which can add significant damage and safety constraints) can be simulated using smaller explosive charges. The experimental data presented herein show that a close approximation to the free-field air blast profile due to a 1.5 lb charge of C4 at 76 in. can be achieved by using a 0.032 lb charge in a 76-in.-long conical shock tube (which translates to an amplification factor of nearly 50). Modeling and simulation tools were used extensively in designing this shock tube to minimize expensive fabrication costs.

  18. Inertial Fusion Driven by Intense Heavy-Ion Beams

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    INERTIAL FUSION DRIVEN BY INTENSE HEAVY-ION BEAMS * W. M. Sharp # , A. Friedman, D. P. Grote, J. J. Barnard, R. H. Cohen, M. A. Dorf, S. M. Lund, L. J. Perkins, M. R. Terry, LLNL, Livermore, CA, USA B. G. Logan, F. M. Bieniosek, A. Faltens, E. Henestroza, J.-Y. Jung, J. W. Kwan, E. P. Lee, S. M. Lidia, P. A. Ni, L. L. Reginato, P. K. Roy, P. A. Seidl, J. H. Takakuwa, J.-L. Vay, W. L. Waldron, LBNL, Berkeley, CA, USA R. C. Davidson, E. P. Gilson, I. D. Kaganovich, H. Qin, E. Startsev, PPPL,

  19. A measurable force driven by an excitonic condensate

    SciTech Connect (OSTI)

    Hakio?lu, T.; zgn, Ege; Gnay, Mehmet

    2014-04-21

    Free energy signatures related to the measurement of an emergent force (?10{sup ?9}N) due to the exciton condensate (EC) in Double Quantum Wells are predicted and experiments are proposed to measure the effects. The EC-force is attractive and reminiscent of the Casimir force between two perfect metallic plates, but also distinctively different from it by its driving mechanism and dependence on the parameters of the condensate. The proposed experiments are based on a recent experimental work on a driven micromechanical oscillator. Conclusive observations of EC in recent experiments also provide a strong promise for the observation of the EC-force.

  20. Aspect Ratio Effects in the Driven, Flux-Core Spheromak

    SciTech Connect (OSTI)

    Hooper, E B; Romero-Talam?s, C A; LoDestro, L L; Wood, R D; McLean, H S

    2009-03-02

    Resistive magneto-hydrodynamic simulations are used to evaluate the effects of the aspect ratio, A (length to radius ratio) in a spheromak driven by coaxial helicity injection. The simulations are benchmarked against the Sustained Spheromak Physics Experiment (SSPX) [R. D. Wood, et al., Nucl. Nucl. Fusion 45, 1582 (2005)]. Amplification of the bias ('gun') poloidal flux is fit well by a linear dependence (insensitive to A) on the ratio of gun current and bias flux above a threshold dependent on A. For low flux amplifications in the simulations the n = 1 mode is coherent and the mean-field geometry looks like a tilted spheromak. Because the mode has relatively large amplitude the field lines are open everywhere, allowing helicity penetration. Strongly-driven helicity injection at A {le} 1.4 in simulations generates reconnection events which open the magnetic field lines; this state is characteristic of SSPX. Near the spheromak tilt-mode limit, A {approx} 1.67 for a cylindrical flux conserver, the tilt approaches 90{sup o}; reconnection events are not generated up to the strongest drives simulated. The time-sequence of these events suggests that they are representative of a chaotic process. Implications for spheromak experiments are discussed.

  1. OBSERVATION OF MAGNETIC RECONNECTION DRIVEN BY GRANULAR SCALE ADVECTION

    SciTech Connect (OSTI)

    Zeng Zhicheng; Cao Wenda; Ji Haisheng

    2013-06-01

    We report the first evidence of magnetic reconnection driven by advection in a rapidly developing large granule using high spatial resolution observations of a small surge event (base size {approx} 4'' Multiplication-Sign 4'') with the 1.6 m aperture New Solar Telescope at the Big Bear Solar Observatory. The observations were carried out in narrowband (0.5 A) He I 10830 A and broadband (10 A) TiO 7057 A. Since He I 10830 A triplet has a very high excitation level and is optically thin, its filtergrams enable us to investigate the surge from the photosphere through the chromosphere into the lower corona. Simultaneous space data from the Atmospheric Imaging Assembly and Helioseismic and Magnetic Imager on board the Solar Dynamics Observatory were used in the analysis. It is shown that the surge is spatio-temporally associated with magnetic flux emergence in the rapidly developing large granule. During the development of the granule, its advecting flow ({approx}2 km s{sup -1}) squeezed the magnetic flux into an intergranular lane area, where a magnetic flux concentration was formed and the neighboring flux with opposite magnetic polarity was canceled. During the cancellation, the surge was produced as absorption in He I 10830 A filtergrams while simultaneous EUV brightening occurred at its base. The observations clearly indicate evidence of a finest-scale reconnection process driven by the granule's motion.

  2. Atmospheric escape by magnetically driven wind from gaseous planets

    SciTech Connect (OSTI)

    Tanaka, Yuki A.; Suzuki, Takeru K.; Inutsuka, Shu-ichiro

    2014-09-01

    We calculate the mass loss driven by magnetohydrodynamic (MHD) waves from hot Jupiters by using MHD simulations in one-dimensional flux tubes. If a gaseous planet has a magnetic field, MHD waves are excited by turbulence at the surface, dissipate in the upper atmosphere, and drive gas outflows. Our calculation shows that mass-loss rates are comparable to the observed mass-loss rates of hot Jupiters; therefore, it is suggested that gas flow driven by MHD waves can play an important role in the mass loss from gaseous planets. The mass-loss rate varies dramatically with the radius and mass of a planet: a gaseous planet with a small mass but an inflated radius produces a very large mass-loss rate. We also derive an analytical expression for the dependence of mass-loss rate on planet radius and mass that is in good agreement with the numerical calculation. The mass-loss rate also depends on the amplitude of the velocity dispersion at the surface of a planet. Thus, we expect to infer the condition of the surface and the internal structure of a gaseous planet from future observations of mass-loss rate from various exoplanets.

  3. Fluid-driven reciprocating apparatus and valving for controlling same

    DOE Patents [OSTI]

    Whitehead, John C. (Davis, CA); Toews, Hans G. (East Aurora, NY)

    1993-01-01

    A control valve assembly for alternately actuating a pair of fluid-driven free-piston devices by using fluid pressure communication therebetween. Each control valve is switched by a pressure signal depending on the state of its counterpart's piston. The communication logic is arranged to provide overlap of the forward strokes of the pistons, so that at least one of the pair will always be pressurized. Thus, uninterrupted pumping of liquid is made possible from a pair of free-piston pumps. In addition, the speed and frequency of piston stroking is entirely dependent on the mechanical power load applied. In the case of a pair of pumps, this enables liquid delivery at a substantially constant pressure over the full range of flow rates, from zero to maximum flow. One embodiment of the invention utilized two pairs of fluid-driven free-piston devices whereby a bipropellant liquid propulsion system may be operated, so as to provide continuous flow of both fuel and oxidizer liquids when used in rocket applications, for example.

  4. Development of a plasma driven permeation experiment for TPE

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Buchenauer, Dean; Kolasinski, Robert; Shimada, Masa; Donovan, David; Youchison, Dennis; Merrill, Brad

    2014-04-18

    Experiments on retention of hydrogen isotopes (including tritium) at temperatures less than 800 ?C have been carried out in the Tritium Plasma Experiment (TPE) at Idaho National Laboratory [1,2]. To provide a direct measurement of plasma driven permeation in plasma facing materials at temperatures reaching 1000 ?C, a new TPE membrane holder has been built to hold test specimens (=1 mm in thickness) at high temperature while measuring tritium permeating through the membrane from the plasma facing side. This measurement is accomplished by employing a carrier gas that transports the permeating tritium from the backside of the membrane to ionmore » chambers giving a direct measurement of the plasma driven tritium permeation rate. Isolation of the membrane cooling and sweep gases from TPE’s vacuum chamber has been demonstrated by sealing tests performed up to 1000 ?C of a membrane holder design that provides easy change out of membrane specimens between tests. Simulations of the helium carrier gas which transports tritium to the ion chamber indicate a very small pressure drop (~700 Pa) with good flow uniformity (at 1000 sccm). Thermal transport simulations indicate that temperatures up to 1000 ?C are expected at the highest TPE fluxes.« less

  5. Beam-driven acceleration in ultra-dense plasma media

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Shin, Young-Min

    2014-09-15

    Accelerating parameters of beam-driven wakefield acceleration in an extremely dense plasma column has been analyzed with the dynamic framed particle-in-cell plasma simulator, and compared with analytic calculations. In the model, a witness beam undergoes a TeV/m scale alternating potential gradient excited by a micro-bunched drive beam in a 1025 m-3 and 1.6 x 1028 m-3 plasma column. The acceleration gradient, energy gain, and transformer ratio have been extensively studied in quasi-linear, linear-, and blowout-regimes. The simulation analysis indicated that in the beam-driven acceleration system a hollow plasma channel offers 20 % higher acceleration gradient by enlarging the channel radius (r)more » from 0.2 Ap to 0.6 .Ap in a blowout regime. This paper suggests a feasibility of TeV/m scale acceleration with a hollow crystalline structure (e.g. nanotubes) of high electron plasma density.« less

  6. Z-petawatt driven ion beam radiography development.

    SciTech Connect (OSTI)

    Schollmeier, Marius; Geissel, Matthias; Rambo, Patrick K.; Schwarz, Jens; Sefkow, Adam B.

    2013-09-01

    Laser-driven proton radiography provides electromagnetic field mapping with high spatiotemporal resolution, and has been applied to many laser-driven High Energy Density Physics (HEDP) experiments. Our report addresses key questions about the feasibility of ion radiography at the Z-Accelerator (%E2%80%9CZ%E2%80%9D), concerning laser configuration, hardware, and radiation background. Charged particle tracking revealed that radiography at Z requires GeV scale protons, which is out of reach for existing and near-future laser systems. However, it might be possible to perform proton deflectometry to detect magnetic flux compression in the fringe field region of a magnetized liner inertial fusion experiment. Experiments with the Z-Petawatt laser to enhance proton yield and energy showed an unexpected scaling with target thickness. Full-scale, 3D radiation-hydrodynamics simulations, coupled to fully explicit and kinetic 2D particle-in-cell simulations running for over 10 ps, explain the scaling by a complex interplay of laser prepulse, preplasma, and ps-scale temporal rising edge of the laser.

  7. 1st Mile | Open Energy Information

    Open Energy Info (EERE)

    research and screening for venture capitalists. Website: www.1stmile.dk Coordinates: 56.866669, 8.31667 Show Map Loading map... "minzoom":false,"mappingservice":"googlemap...

  8. EMSP Final Report: Electrically Driven Technologies for Radioactive Aerosol Abatement

    SciTech Connect (OSTI)

    DePaoli, D.W.

    2003-01-22

    The purpose of this research project was to develop an improved understanding of how electrically driven processes, including electrocoalescence, acoustic agglomeration, and electric filtration, may be employed to efficiently treat problems caused by the formation of aerosols during DOE waste treatment operations. The production of aerosols during treatment and retrieval operations in radioactive waste tanks and during thermal treatment operations such as calcination presents a significant problem of cost, worker exposure, potential for release, and increased waste volume. There was anecdotal evidence in the literature that acoustic agglomeration and electrical coalescence could be used together to change the size distribution of aerosol particles in such a way as to promote easier filtration and less frequent maintenance of filtration systems. As such, those electrically driven technologies could potentially be used as remote technologies for improved treatment; however, existing theoretical models are not suitable for prediction and design. To investigate the physics of such systems, and also to prototype a system for such processes, a collaborative project was undertaken between Oak Ridge National Laboratory (ORNL) and the University of Texas at Austin (UT). ORNL was responsible for the larger-scale prototyping portion of the project, while UT was primarily responsible for the detailed physics in smaller scale unit reactors. It was found that both electrical coalescence and acoustic agglomeration do in fact increase the rate of aggregation of aerosols. Electrical coalescence requires significantly less input power than acoustic agglomeration, but it is much less effective in its ability to aggregate/coalesce aerosols. The larger-scale prototype showed qualitatively similar results as the unit reactor tests, but presented more difficulty in interpretation of the results because of the complex multi-physics coupling that necessarily occur in all larger-scale system tests. An additional finding from this work is that low-amplitude oscillation may provide an alternative, non-invasive, non-contact means of controlling settling and/or suspension of solids. Further investigation would be necessary to evaluate its utility for radioactive waste treatment applications. This project did not uncover a new technology for radioactive waste treatment. While it may be possible that an efficient electrically driven technology for aerosol treatment could be developed, it appears that other technologies, such as steel and ceramic HEPA filters, can suitably solve this problem. If further studies are to be undertaken, additional fundamental experimentation and modeling is necessary to fully capture the physics; in addition, larger-scale tests are needed to demonstrate the treatment of flowing gas streams through the coupling of acoustic agglomeration with electrocoalescence.

  9. Experimental study on the thorium-loaded accelerator-driven system at the

    Office of Scientific and Technical Information (OSTI)

    Kyoto Univ. critical assembly (Conference) | SciTech Connect Experimental study on the thorium-loaded accelerator-driven system at the Kyoto Univ. critical assembly Citation Details In-Document Search Title: Experimental study on the thorium-loaded accelerator-driven system at the Kyoto Univ. critical assembly The experimental study on the thorium-loaded accelerator-driven system (ADS) is conducted in the Kyoto Univ. Critical Assembly (KUCA). The experiments are carried out in both the

  10. Accelerator driven sub-critical core (Patent) | SciTech Connect

    Office of Scientific and Technical Information (OSTI)

    Patent: Accelerator driven sub-critical core Citation Details In-Document Search Title: Accelerator driven sub-critical core Systems and methods for operating an accelerator driven sub-critical core. In one embodiment, a fission power generator includes a sub-critical core and a plurality of proton beam generators. Each of the proton beam generators is configured to concurrently provide a proton beam into a different area of the sub-critical core. Each proton beam scatters neutrons within the

  11. Accelerator-driven subcritical fission in molten salt core: Closing the

    Office of Scientific and Technical Information (OSTI)

    nuclear fuel cycle for green nuclear energy (Journal Article) | SciTech Connect Accelerator-driven subcritical fission in molten salt core: Closing the nuclear fuel cycle for green nuclear energy Citation Details In-Document Search Title: Accelerator-driven subcritical fission in molten salt core: Closing the nuclear fuel cycle for green nuclear energy A technology for accelerator-driven subcritical fission in a molten salt core (ADSMS) is being developed as a basis for the destruction of

  12. First time nuclear material detection by one short-pulse-laser-driven

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    neutron source Science & Innovation » Technical Articles » First time nuclear material detection by one short-pulse-laser-driven neutron source First time nuclear material detection by one short-pulse-laser-driven neutron source The results obtained are the first experimental demonstration of active interrogation of nuclear material by a short pulse laser driven neutron source. April 3, 2013 TRIDENT pulse The results obtained are the first experimental demonstration of active

  13. Bioenergy Demand in a Market Driven Forest Economy (U.S. South) |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Demand in a Market Driven Forest Economy (U.S. South) Bioenergy Demand in a Market Driven Forest Economy (U.S. South) Breakout Session 1A: Biomass Feedstocks for the Bioeconomy Bioenergy Demand in a Market Driven Forest Economy (U.S. South) Robert C. Abt, Professor of Natural Resource Economics and Management, North Carolina State University PDF icon abt_bioenergy_2015.pdf More Documents & Publications Biomass Program Peer Review Sustainability Platform Biomass as

  14. Spin-driven multiferroics in BaYFeO{sub 4} (Journal Article) | SciTech

    Office of Scientific and Technical Information (OSTI)

    Connect Spin-driven multiferroics in BaYFeO{sub 4} Citation Details In-Document Search Title: Spin-driven multiferroics in BaYFeO{sub 4} We report on the spin-driven multiferroic property and magnetoelectric effect in the lately synthesized compound BaYFeO{sub 4}. Due to its peculiar crystal structure, the system exhibits complex magnetic phases with multiple transitions. The dielectric and pyroelectric measurements evidence a spin-driven multiferroic state raised by the cycloidal spin

  15. Systems Modeling for a Laser-Driven IFE Power Plant using Direct...

    Office of Scientific and Technical Information (OSTI)

    IFE Power Plant using Direct Conversion Citation Details In-Document Search Title: Systems Modeling for a Laser-Driven IFE Power Plant using Direct Conversion You ...

  16. Buoyancy-Driven Ventilation of Hydrogen from Buildings: Laboratory Test and Model Validation

    SciTech Connect (OSTI)

    Barley, C. D.; Gawlik, K.

    2009-05-01

    Passive, buoyancy-driven ventilation is one approach to limiting hydrogen concentration. We explored the relationship between leak rate, ventilation design, and hydrogen concentrations.

  17. Radiation Transport and Energetics of Laser-driven Half-hohlraums...

    Office of Scientific and Technical Information (OSTI)

    Radiation Transport and Energetics of Laser-driven Half-hohlraums at the National Ignition Facility Citation Details In-Document Search Title: Radiation Transport and Energetics of ...

  18. Hawaiis EVolution: Hawaii Powered. Technology Driven. ...

    Broader source: Energy.gov (indexed) [DOE]

    Powered. Technology Driven. Table of Contents Charting the Course Toward a Clean Energy Future 4 Forging a New Path for Island Transportation 5 Embracing New Alternatives 6...

  19. Light and phospholipid driven structural transitions in nematic microdroplets

    SciTech Connect (OSTI)

    Dubtsov, A. V., E-mail: alexanderdubtsov@gmail.com; Pasechnik, S. V.; Shmeliova, D. V. [Moscow State University of Instrument Engineering and Computer Science, Stromynka 20, Moscow 107996 (Russian Federation); Kralj, Samo [Condensed Matter Physics Department, Joef Stefan Institute, Jamova 39, 1000 Ljubljana (Slovenia); FNM, University of Maribor, Koroska 160, 2000 Maribor (Slovenia)

    2014-10-13

    We studied the UV-irradiation and phospholipid driven bipolar-radial structural transitions within azoxybenzene nematic liquid crystal (LC) droplets dispersed in water. It was found that the UV-irradiation induced trans-cis isomerisation of LC molecules could enable structural transitions into radial-type configurations at a critical UV-irradiation time t{sub c}. In particular, we show that under appropriate conditions, a value of t{sub c} could sensitively fingerprint the concentration of phospholipid molecules present in LC-water dispersions. This demonstrated proof-of-principle mechanism could be exploited for development of sensitive detectors for specific nanoparticles (NPs), where value of t{sub c} reveals concentration of NPs.

  20. Laser-driven Sisyphus cooling in an optical dipole trap

    SciTech Connect (OSTI)

    Ivanov, Vladyslav V.; Gupta, Subhadeep

    2011-12-15

    We propose a laser-driven Sisyphus-cooling scheme for atoms confined in a far-off resonance optical dipole trap. Utilizing the differential trap-induced ac Stark shift, two electronic levels of the atom are resonantly coupled by a cooling laser preferentially near the trap bottom. After absorption of a cooling photon, the atom loses energy by climbing the steeper potential, and then spontaneously decays preferentially away from the trap bottom. The proposed method is particularly suited to cooling alkaline-earth-metal-like atoms where two-level systems with narrow electronic transitions are present. Numerical simulations for the cases of {sup 88}Sr and {sup 174}Yb demonstrate the expected recoil and Doppler temperature limits. The method requires a relatively small number of scattered photons and can potentially lead to phase-space densities approaching quantum degeneracy in subsecond time scales.

  1. Electron heating during discharges driven by thermionic emission

    SciTech Connect (OSTI)

    Levko, D.; Krasik, Ya. E.

    2014-11-15

    The heating of plasma electrons during discharges driven by thermionic emission is studied using one-dimensional particle-in-cell Monte Carlo collisions modeling that self-consistently takes the dependence of the thermionic current on the plasma parameters into account. It is found that at a gas pressure of 10{sup 2?}Pa the electron two-stream instability is excited. As a consequence, the electrostatic plasma wave propagates from the cathode to the anode. The trapping of electrons by this wave contributes noticeably to the heating of the plasma. At a larger gas pressure, this instability is not excited. As a consequence, plasma electrons are heated only because of the generation of energetic electrons in ionization events and the scattering of emitted electrons.

  2. Design of Stirling-driven vapor-compression system

    SciTech Connect (OSTI)

    Kagawa, N.

    1998-07-01

    Stirling engines have many unique advantages including higher thermal efficiencies, preferable exhaust gas characteristics, multi-fuel usage, and low noise and vibration. On the other hand, heat pump systems are very attractive for space heating and cooling and industrial usage because of their potential to save energy. Especially, there are many environmental merits of Stirling-driven vapor-compression (SDVC) systems. This paper introduces a design method for the SDVC based on reliable mathematical methods for Stirling and Rankine cycles with reliable thermophysical information for refrigerants. The model treats a kinematic Stirling engine and a scroll compressor coupled by a belt. Some experimental coefficients are used to formulate the SDVC items. The obtained results show the performance behavior of the SDVC in detail. The measured performance of the actual system agrees with the calculated results. Furthermore, the calculated results indicate attractive SDVC performance using alternative refrigerants.

  3. Instability-driven electromagnetic fields in coronal plasmas

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Manuel, M. J.-E.; Li, C. K.; Seguin, F. H.; Sinenian, N.; Frenje, J. A.; Casey, D. T.; Petrasso, R. D.; Hager, J. D.; Betti, R.; Hu, S. X.; et al

    2013-04-15

    Filamentary electromagnetic fields previously observed in the coronae of laser-driven spherical targets [F. H. S#2;eguin et al., Phys. Plasma. 19, 012701 (2012)] have been further investigated in laser irradiated plastic foils. Face-on proton-radiography provides an axial view of these filaments and shows coherent cellular structure regardless of initial foil-surface conditions. The observed cellular fields are shown to have an approximately constant scale size of #2;210 lm throughout the plasma evolution. A discussion of possible field-generation mechanisms is provided and it is demonstrated that the likely source of the cellular field structure is the magnetothermal instability. Using predicted temperature and densitymore » profiles, the fastest growing modes of this instability were found to be slowly varying in time and consistent with the observed cellular size.« less

  4. Dynamically Driven Phase Transformations in Damaged Composite Materials

    SciTech Connect (OSTI)

    Plohr, JeeYeon N.; Clements, Brad E.; Addessio, Frank L

    2006-07-28

    A model developed for composite materials undergoing dynamicaly driven phase transitions in its constituents has been extended to allow for complex material micro-structure and evolution of damage. In this work, damage is described by interfacial debonding and micro-crack growth. We have applied the analysis to silicon carbide-titanium (SiC-Ti) unidirectional metal matrix composites. In these composites, Ti can undergo a low pressure and temperature solid-solid phase transition. With these extensions we have carried out simulations to study the complex interplay between loading rates, micro-structure, damage, and the thermo-mechanical response of the system as it undergoes a solid-solid phase transitions.

  5. Instability-driven electromagnetic fields in coronal plasmas

    SciTech Connect (OSTI)

    Manuel, M. J.-E.; Li, C. K.; Sguin, F. H.; Sinenian, N.; Frenje, J. A.; Casey, D. T.; Petrasso, R. D.; Hager, J. D.; Betti, R.; Hu, S. X.; Delettrez, J.; Meyerhofer, D. D.

    2013-05-15

    Filamentary electromagnetic fields previously observed in the coronae of laser-driven spherical targets [F. H. Sguin et al., Phys. Plasma. 19, 012701 (2012)] have been further investigated in laser-irradiated plastic foils. Face-on proton-radiography provides an axial view of these filaments and shows coherent cellular structure regardless of initial foil-surface conditions. The observed cellular fields are shown to have an approximately constant scale size of ?210 ?m throughout the plasma evolution. A discussion of possible field-generation mechanisms is provided and it is demonstrated that the likely source of the cellular field structure is the magnetothermal instability. Using predicted temperature and density profiles, the fastest growing modes of this instability were found to be slowly varying in time and consistent with the observed cellular size.

  6. Instability-driven electromagnetic fields in coronal plasmas

    SciTech Connect (OSTI)

    Manuel, M. J.-E.; Li, C. K.; Seguin, F. H.; Sinenian, N.; Frenje, J. A.; Casey, D. T.; Petrasso, R. D.; Hager, J. D.; Betti, R.; Hu, S. X.; Delettrez, J.; Meyerhofer, D. D.

    2013-04-15

    Filamentary electromagnetic fields previously observed in the coronae of laser-driven spherical targets [F. H. S#2;eguin et al., Phys. Plasma. 19, 012701 (2012)] have been further investigated in laser irradiated plastic foils. Face-on proton-radiography provides an axial view of these filaments and shows coherent cellular structure regardless of initial foil-surface conditions. The observed cellular fields are shown to have an approximately constant scale size of #2;210 lm throughout the plasma evolution. A discussion of possible field-generation mechanisms is provided and it is demonstrated that the likely source of the cellular field structure is the magnetothermal instability. Using predicted temperature and density profiles, the fastest growing modes of this instability were found to be slowly varying in time and consistent with the observed cellular size.

  7. Heat-driven spin transport in a ferromagnetic metal

    SciTech Connect (OSTI)

    Xu, Yadong; Yang, Bowen; Tang, Chi; Jiang, Zilong; Shi, Jing; Schneider, Michael; Whig, Renu

    2014-12-15

    As a non-magnetic heavy metal is attached to a ferromagnet, a vertically flowing heat-driven spin current is converted to a transverse electric voltage, which is known as the longitudinal spin Seebeck effect (SSE). If the ferromagnet is a metal, this voltage is also accompanied by voltages from two other sources, i.e., the anomalous Nernst effect in both the ferromagnet and the proximity-induced ferromagnetic boundary layer. By properly identifying and carefully separating those different effects, we find that in this pure spin current circuit the additional spin current drawn by the heavy metal generates another significant voltage by the ferromagnetic metal itself which should be present in all relevant experiments.

  8. IEMDC - In-Line Electric Motor Driven Compressor

    SciTech Connect (OSTI)

    Michael J. Crowley

    2004-03-31

    This report covers the fifth quarter (01/01/04 to 03/31/04) of the In-Line Electric Motor Driven Compressor (IEMDC) project. Design efforts on the IEMDC continued with compressor efforts focused on performing aerodynamic analyses. These analyses were conducted using computational fluid dynamics. Compressor efforts also entailed developing mechanical designs of components through the use of solid models and working on project deliverables. Electric motor efforts focused on the design of the magnetic bearing system, motor pressure housing, and the motor-compressor interface. The mechanical evaluation of the main interface from both the perspective of the compressor manufacturer and electric motor manufacturer indicates that an acceptable design has been achieved. All mechanical and aerodynamic design efforts have resulted in considerable progress being made towards the completion of the compressor and electric motor design and towards the successful completion of the IEMDC unit.

  9. Hugoniot and spall data from the laser-driven miniflyer

    SciTech Connect (OSTI)

    Warnes, R.H.; Paisley, D.L.; Tonks, D.L.

    1996-05-01

    The laser-driven miniflyer has been developed as a small-sized complement to the propellant- or gas-driven gun with which to make material property measurements. Flyer velocities typically range from 0.5 to 1.5 km/s, depending on the energy of the launching laser and the flyer dimensions. The 10{endash}50 {mu}m-thick flyers, 1{endash}3 mm in diameter, and comparably small targets require very little material and are easy to recover for post-experiment analysis. To measure and improve the precision of our measurements, we are conducting an extensive series of experiments impacting well-characterized Cu, Al, and Au on several transparent, calibrated, windows (PMMA, LiF, and sapphire). Measurement of the impact and interface velocities with a high-time-resolution velocity interferometer (VISAR) gives us a point on the Hugoniot of the flyer material. These are then compared to published Hugoniot data taken with conventional techniques. In the spall experiments, a flyer strikes a somewhat thicker target of the same material and creates a spall in the target. Measuring the free-surface velocity of the target gives information on the compressive elastic-plastic response of the target to the impact, the tensile spall strength, and the strain rate at which the spall occurred. Volumetric strain rates at spall in these experiments are frequently in the 10{sup 6}{endash}10{sup 8}s{sup {minus}1} range, considerably higher than the 10{sup 3}{endash}10{sup 4}s{sup {minus}1} range obtainable from gas gun experiments. {copyright} {ital 1996 American Institute of Physics.}

  10. Hugoniot and spall data from the laser-driven miniflyer

    SciTech Connect (OSTI)

    Warnes, R.H.; Paisley, D.L.; Tonks, D.L.

    1995-09-01

    The laser-driven miniflyer has been developed as a small-sized complement to the propellant or gas-driven gun with which to make material property measurements. Flyer velocities typically range from 0.5 to 1.5 km/s, depending on the energy of the launching laser and the flyer dimensions. The 10--50 {micro}m-thick flyers, 1--3 mm in diameter, and comparably small targets require very little material and are easy to recover for post-experiment analysis. To measure and improve the precision of the measurements, the authors are conducting an extensive series of experiments impacting well-characterized Cu, Al, and Au on several transparent, calibrated, windows (PMMA, LiF, and sapphire). Measurement of the impact and interface velocities with a high-time-resolution velocity interferometer (VISAR) gives them a point on the Hugoniot of the flyer material. These are then compared to published Hugoniot data taken with conventional techniques. In the spall experiments, a flyer strikes a somewhat thicker target of the same material and creates a spall in the target. Measuring the free-surface velocity of the target gives information on the compressive elastic-plastic response of the target to the impact, the tensile spall strength, and the strain rate at which the spall occurred. Volumetric strain rates at spall in these experiments are frequently in the 10{sup 6}--10{sup 8} s{sup {minus}1} range, considerably higher than the 10{sup 3}--10{sup 4} s{sup {minus}1} range obtainable from gas gun experiments.

  11. Relativistic MHD simulations of poynting flux-driven jets

    SciTech Connect (OSTI)

    Guan, Xiaoyue; Li, Hui; Li, Shengtai

    2014-01-20

    Relativistic, magnetized jets are observed to propagate to very large distances in many active galactic nuclei (AGNs). We use three-dimensional relativistic MHD simulations to study the propagation of Poynting flux-driven jets in AGNs. These jets are already assumed to be being launched from the vicinity (?10{sup 3} gravitational radii) of supermassive black holes. Jet injections are characterized by a model described in Li et al., and we follow the propagation of these jets to ?parsec scales. We find that these current-carrying jets are always collimated and mildly relativistic. When ?, the ratio of toroidal-to-poloidal magnetic flux injection, is large the jet is subject to nonaxisymmetric current-driven instabilities (CDI) which lead to substantial dissipation and reduced jet speed. However, even with the presence of instabilities, the jet is not disrupted and will continue to propagate to large distances. We suggest that the relatively weak impact by the instability is due to the nature of the instability being convective and the fact that the jet magnetic fields are rapidly evolving on Alfvnic time scales. We present the detailed jet properties and show that far from the jet launching region, a substantial amount of magnetic energy has been transformed into kinetic energy and thermal energy, producing a jet magnetization number ? < 1. In addition, we have also studied the effects of a gas pressure supported 'disk' surrounding the injection region, and qualitatively similar global jet behaviors were observed. We stress that jet collimation, CDIs, and the subsequent energy transitions are intrinsic features of current-carrying jets.

  12. Final environmental impact statement for the construction and operation of an independent spent fuel storage installation to store the Three Mile Island Unit 2 spent fuel at the Idaho National Engineering and Environmental Laboratory. Docket Number 72-20

    SciTech Connect (OSTI)

    1998-03-01

    This Final Environmental Impact Statement (FEIS) contains an assessment of the potential environmental impacts of the construction and operation of an Independent Spent Fuel Storage Installation (ISFSI) for the Three Mile Island Unit 2 (TMI-2) fuel debris at the Idaho National Engineering and Environmental laboratory (INEEL). US Department of Energy-Idaho Operations Office (DOE-ID) is proposing to design, construct, and operate at the Idaho Chemical Processing Plant (ICPP). The TMI-2 fuel debris would be removed from wet storage, transported to the ISFSI, and placed in storage modules on a concrete basemat. As part of its overall spent nuclear fuel (SNF) management program, the US DOE has prepared a final programmatic environmental impact statement (EIS) that provides an overview of the spent fuel management proposed for INEEL, including the construction and operation of the TMI-2 ISFSI. In addition, DOE-ID has prepared an environmental assessment (EA) to describe the environmental impacts associated with the stabilization of the storage pool and the construction/operation of the ISFSI at the ICPP. As provided in NRC`s NEPA procedures, a FEIS of another Federal agency may be adopted in whole or in part in accordance with the procedures outlined in 40 CFR 1506.3 of the regulations of the Council on Environmental Quality (CEQ). Under 40 CFR 1506.3(b), if the actions covered by the original EIS and the proposed action are substantially the same, the agency adopting another agency`s statement is not required to recirculate it except as a final statement. The NRC has determined that its proposed action is substantially the same as actions considered in DOE`s environmental documents referenced above and, therefore, has elected to adopt the DOE documents as the NRC FEIS.

  13. Natural Gas Weekly Update, Printer-Friendly Version

    Gasoline and Diesel Fuel Update (EIA)

    *Avg. of NGI's reported avg. prices for: Malin, PG&E citygate, and Southern California Border Avg. Source: NGI's Daily Gas Price Index (http:intelligencepress.com). Storage:...

  14. Experimental Study of Current-Driven Turbulence During Magnetic Reconnection

    SciTech Connect (OSTI)

    Miklos Porkolab; Jan Egedal-Pedersen; William Fox

    2010-08-31

    CMPD Final Report Experimental Study of Current-Driven Turbulence During Magnetic Reconnection Miklos Porkolab, PI, Jan Egedal, co-PI, William Fox, graduate student. This is the final report for Grant DE-FC02-04ER54786, ?¢????MIT Participation in the Center for Multiscale Plasma Dynamics,?¢??? which was active from 8/1/2004 to 7/31/2010. This Grant supported the thesis work of one MIT graduate student, William Fox, The thesis research consisted of an experimental study of the fluctuations arising during magnetic reconnection in plasmas on the Versatile Toroidal Facility (VTF) at MIT Plasma Science and Fusion Center (PSFC). The thesis was submitted and accepted by the MIT physics Department, ?¢????W. Fox, Experimental Study of Current-Driven Turbulence During Magnetic Reconnection, Ph.D. Thesis, MIT (2009)?¢???. In the VTF experiment reconnection and current-sheet formation is driven by quickly changing currents in a specially arranged set of internal conductors. Previous work on this device [Egedal, et al, PRL 98, 015003, (2007)] identified a ?¢????spontaneous?¢??? reconnection regime. In this work fluctuations were studied using impedance-matched, high-bandwidth Langmuir probes. Strong, broadband fluctuations, with frequencies extending from near the lower-hybrid frequency [fLH = (fcefci)1/2] to the electron cyclotron frequency fce were found to arise during the reconnection events. Based on frequency and wavelength measurements, lower-hybrid waves and Trivelpiece-Gould waves were identified. The lower-hybrid waves are easiest to drive with strong perpendicular drifts or gradients which arise due to the reconnection events; an appealing possibility is strong temperature gradients. The Trivelpiece-Gould modes can result from kinetic, bump-on-tail instability of a runaway electron population energized by the reconnection events. We also observed that the turbulence is often spiky, consisting of discrete positive-potential spikes, which were identified as ?¢????electron phase-space holes,?¢??? a class of nonlinear solitary wave known to evolve from a strong beam-on-tail instability. We established that fast electrons were produced by magnetic reconnection. Overall, these instabilities were found to be a consequence of reconnection, specifically the strong energization of electrons, leading to steep gradients in both coordinate- and velocity-space. Estimates (using quasi-linear theory) of the anomalous resistivity due to these modes did not appear large enough to substantially impact the reconnection process. Relevant publications: ?¢???¢ W. Fox, M. Porkolab, et al, Phys. Rev. Lett. 101, 255003 (2008). ?¢???¢ W. Fox, M. Porkolab, et al, Phys. Plasmas 17, 072303, (2010).

  15. Electro-osmotically driven liquid delivery method and apparatus

    DOE Patents [OSTI]

    Rakestraw, David J.; Anex, Deon S.; Yan, Chao; Dadoo, Rajeev; Zare, Richard N.

    1999-01-01

    Method and apparatus for controlling precisely the composition and delivery of liquid at sub-.mu.L/min flow rate. One embodiment of such a delivery system is an electro-osmotically driven gradient flow delivery system that generates dynamic gradient flows with sub-.mu.L/min flow rates by merging a plurality of electro-osmotic flows. These flows are delivered by a plurality of delivery arms attached to a mixing connector, where they mix and then flow into a receiving means, preferably a column. Each inlet of the plurality of delivery arms is placed in a corresponding solution reservoir. A plurality of independent programmable high-voltage power supplies is used to apply a voltage program to each of the plurality of solution reservoirs to regulate the electro-osmotic flow in each delivery arm. The electro-osmotic flow rates in the delivery arms are changed with time according to each voltage program to deliver the required gradient profile to the column.

  16. Electro-osmotically driven liquid delivery method and apparatus

    DOE Patents [OSTI]

    Rakestraw, D.J.; Anex, D.S.; Yan, C.; Dadoo, R.; Zare, R.N.

    1999-08-24

    Method and apparatus are disclosed for controlling precisely the composition and delivery of liquid at sub-{micro}L/min flow rate. One embodiment of such a delivery system is an electro-osmotically driven gradient flow delivery system that generates dynamic gradient flows with sub-{micro}L/min flow rates by merging a plurality of electro-osmotic flows. These flows are delivered by a plurality of delivery arms attached to a mixing connector, where they mix and then flow into a receiving means, preferably a column. Each inlet of the plurality of delivery arms is placed in a corresponding solution reservoir. A plurality of independent programmable high-voltage power supplies is used to apply a voltage program to each of the plurality of solution reservoirs to regulate the electro-osmotic flow in each delivery arm. The electro-osmotic flow rates in the delivery arms are changed with time according to each voltage program to deliver the required gradient profile to the column. 4 figs.

  17. UNIFYING THE ZOO OF JET-DRIVEN STELLAR EXPLOSIONS

    SciTech Connect (OSTI)

    Lazzati, Davide; Blackwell, Christopher H.; Morsony, Brian J.; Begelman, Mitchell C.

    2012-05-01

    We present a set of numerical simulations of stellar explosions induced by relativistic jets emanating from a central engine sitting at the center of compact, dying stars. We explore a wide range of durations of the central engine activity, two candidate stellar progenitors, and two possible values of the total energy release. We find that even if the jets are narrowly collimated, their interaction with the star unbinds the stellar material, producing a stellar explosion. We also find that the outcome of the explosion can be very different depending on the duration of the engine activity. Only the longest-lasting engines result in successful gamma-ray bursts. Engines that power jets only for a short time result in relativistic supernova (SN) explosions, akin to observed engine-driven SNe such as SN2009bb. Engines with intermediate durations produce weak gamma-ray bursts, with properties similar to nearby bursts such as GRB 980425. Finally, we find that the engines with the shortest durations, if they exist in nature, produce stellar explosions that lack sizable amounts of relativistic ejecta and are therefore dynamically indistinguishable from ordinary core-collapse SNe.

  18. Feasibility Study of Accelerator Driven System Proposed by JAEA

    SciTech Connect (OSTI)

    Sugawara, Takanori; Nishihara, Kenji; Tsujimoto, Kazufumi; Iwanaga, Kohei; Kurata, Yuji; Sasa, Toshinobu; Oigawa, Hiroyuki

    2007-07-01

    Accelerator Driven System (ADS) has been studied to transmute minor actinides (MA) discharged from spent fuel of commercial nuclear power plants. In Japan Atomic Energy Agency (JAEA), various R and D for an 800 MWt, lead bismuth eutectic (LBE) cooled ADS have been performed. The feasibility for the ADS is discussed in the present study in terms of the neutronics design, the safety analysis and the design of the beam window. In the neutronics design, the maximum temperature at the surface of the fuel pin was decreased from 578 deg. C to 498 deg. C by the adjustment of the ZrN inert matrix ratio for four zones. In the safety analysis, it was confirmed that there was very little possibility of core disruptive accidents at unprotected accidents in the ADS proposed by JAEA. For the design of the beam window, the parametric survey for the buckling failure was performed to discuss the methods to increase the margin for the buckling pressure. (authors)

  19. Controllable positive exchange bias via redox-driven oxygen migration

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Gilbert, Dustin A.; Olamit, Justin; Dumas, Randy K.; Kirby, B. J.; Grutter, Alexander J.; Maranville, Brian B.; Arenholz, Elke; Borchers, Julie A.; Liu, Kai

    2016-03-21

    We report that ionic transport in metal/oxide heterostructures offers a highly effective means to tailor material properties via modification of the interfacial characteristics. However, direct observation of ionic motion under buried interfaces and demonstration of its correlation with physical properties has been challenging. Using the strong oxygen affinity of gadolinium, we design a model system of GdxFe1-x/NiCoO bilayer films, where the oxygen migration is observed and manifested in a controlled positive exchange bias over a relatively small cooling field range. The exchange bias characteristics are shown to be the result of an interfacial layer of elemental nickel and cobalt, amore » few nanometres in thickness, whose moments are larger than expected from uncompensated NiCoO moments. This interface layer is attributed to a redox-driven oxygen migration from NiCoO to the gadolinium, during growth or soon after. Ultimately, these results demonstrate an effective path to tailoring the interfacial characteristics and interlayer exchange coupling in metal/oxide heterostructures.« less

  20. Valving for controlling a fluid-driven reciprocating apparatus

    DOE Patents [OSTI]

    Whitehead, John C.

    1995-01-01

    A pair of control valve assemblies for alternately actuating a pair of fluid-driven free-piston devices by using fluid pressure communication therebetween. Each control valve assembly is switched by a pressure signal depending on the state of its counterpart's piston. The communication logic is arranged to provide overlap of the forward strokes of the pistons, so that at least one of the pair will always be pressurized. Thus, uninterrupted pumping of liquid is made possible from a pair of free-piston pumps. In addition, the speed and frequency of piston stroking is entirely dependent on the mechanical power load applied. In the case of a pair of pumps, this enables liquid delivery at a substantially constant pressure over the full range of flow rates, from zero to maximum flow. Each of the valve assemblies uses an intake-exhaust valve and a signal valve with the signal valve of one pump being connected to be pressure responsive to the piston of the opposite cylinder or pump.

  1. Valving for controlling a fluid-driven reciprocating apparatus

    DOE Patents [OSTI]

    Whitehead, J.C.

    1995-06-27

    A pair of control valve assemblies is described for alternately actuating a pair of fluid-driven free-piston devices by using fluid pressure communication therebetween. Each control valve assembly is switched by a pressure signal depending on the state of its counterpart`s piston. The communication logic is arranged to provide overlap of the forward strokes of the pistons, so that at least one of the pair will always be pressurized. Thus, uninterrupted pumping of liquid is made possible from a pair of free-piston pumps. In addition, the speed and frequency of piston stroking is entirely dependent on the mechanical power load applied. In the case of a pair of pumps, this enables liquid delivery at a substantially constant pressure over the full range of flow rates, from zero to maximum flow. Each of the valve assemblies uses an intake-exhaust valve and a signal valve with the signal valve of one pump being connected to be pressure responsive to the piston of the opposite cylinder or pump. 15 figs.

  2. An opinion-driven behavioral dynamics model for addictive behaviors

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Moore, Thomas W.; Finley, Patrick D.; Apelberg, Benjamin J.; Ambrose, Bridget K.; Brodsky, Nancy S.; Brown, Theresa J.; Husten, Corinne; Glass, Robert J.

    2015-04-08

    We present a model of behavioral dynamics that combines a social network-based opinion dynamics model with behavioral mapping. The behavioral component is discrete and history-dependent to represent situations in which an individual’s behavior is initially driven by opinion and later constrained by physiological or psychological conditions that serve to maintain the behavior. Additionally, individuals are modeled as nodes in a social network connected by directed edges. Parameter sweeps illustrate model behavior and the effects of individual parameters and parameter interactions on model results. Mapping a continuous opinion variable into a discrete behavioral space induces clustering on directed networks. Clusters providemore » targets of opportunity for influencing the network state; however, the smaller the network the greater the stochasticity and potential variability in outcomes. Furthermore, this has implications both for behaviors that are influenced by close relationships verses those influenced by societal norms and for the effectiveness of strategies for influencing those behaviors.« less

  3. Two-dimensional state in driven magnetohydrodynamic turbulence

    SciTech Connect (OSTI)

    Bigot, Barbara; Galtier, Sebastien

    2011-02-15

    The dynamics of the two-dimensional (2D) state in driven three-dimensional (3D) incompressible magnetohydrodynamic turbulence is investigated through high-resolution direct numerical simulations and in the presence of an external magnetic field at various intensities. For such a flow the 2D state (or slow mode) and the 3D modes correspond, respectively, to spectral fluctuations in the plane k{sub ||}=0 and in the area k{sub ||}>0. It is shown that if initially the 2D state is set to zero it becomes nonnegligible in few turnover times, particularly when the external magnetic field is strong. The maintenance of a large-scale driving leads to a break for the energy spectra of 3D modes; when the driving is stopped, the previous break is removed and a decay phase emerges with Alfvenic fluctuations. For a strong external magnetic field the energy at large perpendicular scales lies mainly in the 2D state, and in all situations a pinning effect is observed at small scales.

  4. Laser-driven ion acceleration with hollow laser beams

    SciTech Connect (OSTI)

    Brabetz, C. Kester, O.; Busold, S.; Bagnoud, V.; Cowan, T.; Deppert, O.; Jahn, D.; Roth, M.; Schumacher, D.

    2015-01-15

    The laser-driven acceleration of protons from thin foils irradiated by hollow high-intensity laser beams in the regime of target normal sheath acceleration (TNSA) is reported for the first time. The use of hollow beams aims at reducing the initial emission solid angle of the TNSA source, due to a flattening of the electron sheath at the target rear side. The experiments were conducted at the PHELIX laser facility at the GSI Helmholtzzentrum für Schwerionenforschung GmbH with laser intensities in the range from 10{sup 18} W cm{sup −2} to 10{sup 20} W cm{sup −2}. We observed an average reduction of the half opening angle by (3.07±0.42)° or (13.2±2.0)% when the targets have a thickness between 12 μm and 14 μm. In addition, the highest proton energies were achieved with the hollow laser beam in comparison to the typical Gaussian focal spot.

  5. Direct match data flow memory for data driven computing

    DOE Patents [OSTI]

    Davidson, G.S.; Grafe, V.G.

    1997-10-07

    A data flow computer and method of computing is disclosed which utilizes a data driven processor node architecture. The apparatus in a preferred embodiment includes a plurality of First-In-First-Out (FIFO) registers, a plurality of related data flow memories, and a processor. The processor makes the necessary calculations and includes a control unit to generate signals to enable the appropriate FIFO register receiving the result. In a particular embodiment, there are three FIFO registers per node: an input FIFO register to receive input information form an outside source and provide it to the data flow memories; an output FIFO register to provide output information from the processor to an outside recipient; and an internal FIFO register to provide information from the processor back to the data flow memories. The data flow memories are comprised of four commonly addressed memories. A parameter memory holds the A and B parameters used in the calculations; an opcode memory holds the instruction; a target memory holds the output address; and a tag memory contains status bits for each parameter. One status bit indicates whether the corresponding parameter is in the parameter memory and one status bit to indicate whether the stored information in the corresponding data parameter is to be reused. The tag memory outputs a ``fire`` signal (signal R VALID) when all of the necessary information has been stored in the data flow memories, and thus when the instruction is ready to be fired to the processor. 11 figs.

  6. Direct match data flow memory for data driven computing

    DOE Patents [OSTI]

    Davidson, George S.; Grafe, Victor Gerald

    1997-01-01

    A data flow computer and method of computing is disclosed which utilizes a data driven processor node architecture. The apparatus in a preferred embodiment includes a plurality of First-In-First-Out (FIFO) registers, a plurality of related data flow memories, and a processor. The processor makes the necessary calculations and includes a control unit to generate signals to enable the appropriate FIFO register receiving the result. In a particular embodiment, there are three FIFO registers per node: an input FIFO register to receive input information form an outside source and provide it to the data flow memories; an output FIFO register to provide output information from the processor to an outside recipient; and an internal FIFO register to provide information from the processor back to the data flow memories. The data flow memories are comprised of four commonly addressed memories. A parameter memory holds the A and B parameters used in the calculations; an opcode memory holds the instruction; a target memory holds the output address; and a tag memory contains status bits for each parameter. One status bit indicates whether the corresponding parameter is in the parameter memory and one status bit to indicate whether the stored information in the corresponding data parameter is to be reused. The tag memory outputs a "fire" signal (signal R VALID) when all of the necessary information has been stored in the data flow memories, and thus when the instruction is ready to be fired to the processor.

  7. Heat-driven acoustic cooling engine having no moving parts

    DOE Patents [OSTI]

    Wheatley, John C.; Swift, Gregory W.; Migliori, Albert; Hofler, Thomas J.

    1989-01-01

    A heat-driven acoustic cooling engine having no moving parts receives heat from a heat source. The acoustic cooling engine comprises an elongated resonant pressure vessel having first and second ends. A compressible fluid having a substantial thermal expansion coefficient and capable of supporting an acoustic standing wave is contained in the resonant pressure vessel. The heat source supplies heat to the first end of the vessel. A first heat exchanger in the vessel is spaced-apart from the first end and receives heat from the first end. A first thermodynamic element is adjacent to the first heat exchanger and converts some of the heat transmitted by the first heat exchanger into acoustic power. A second thermodynamic element has a first end located spaced-apart from the first thermodynamic element and a second end farther away from the first thermodynamic element than is its first end. The first end of the second thermodynamic element heats while its second end cools as a consequence of the acoustic power. A second heat exchanger is adjacent to and between the first and second thermodynamic elements. A heat sink outside of the vessel is thermally coupled to and receives heat from the second heat exchanger. The resonant pressure vessel can include a housing less than one-fourth wavelength in length coupled to a reservoir. The housing can include a reduced diameter portion communicating with the reservoir.

  8. Diversity waves in collapse-driven population dynamics

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Maslov, Sergei; Sneppen, Kim

    2015-09-14

    Populations of species in ecosystems are often constrained by availability of resources within their environment. In effect this means that a growth of one population, needs to be balanced by comparable reduction in populations of others. In neutral models of biodiversity all populations are assumed to change incrementally due to stochastic births and deaths of individuals. Here we propose and model another redistribution mechanism driven by abrupt and severe collapses of the entire population of a single species freeing up resources for the remaining ones. This mechanism may be relevant e.g. for communities of bacteria, with strain-specific collapses caused e.g.more » by invading bacteriophages, or for other ecosystems where infectious diseases play an important role. The emergent dynamics of our system is cyclic ‘‘diversity waves’’ triggered by collapses of globally dominating populations. The population diversity peaks at the beginning of each wave and exponentially decreases afterwards. Species abundances are characterized by a bimodal time-aggregated distribution with the lower peak formed by populations of recently collapsed or newly introduced species while the upper peak - species that has not yet collapsed in the current wave. In most waves both upper and lower peaks are composed of several smaller peaks. This self-organized hierarchical peak structure has a long-term memory transmitted across several waves. It gives rise to a scale-free tail of the time-aggregated population distribution with a universal exponent of 1.7. We show that diversity wave dynamics is robust with respect to variations in the rules of our model such as diffusion between multiple environments, species-specific growth and extinction rates, and bet-hedging strategies.« less

  9. Betatron radiation from a beam driven plasma source

    SciTech Connect (OSTI)

    Litos, M.; Corde, S.

    2012-12-21

    Photons produced by the betatron oscillation of electrons in a beam-driven plasma wake provide a uniquely intense and high-energy source of hard X-rays and gamma rays. This betatron radiation is interesting not only for its high intensity and spectral characteristics, but also because it can be used as a diagnostic for beam matching into the plasma, which is critical for maximizing the energy extraction efficiency of a plasma accelerator stage. At SLAC, gamma ray detection devices have been installed at the dump area of the FACET beamline where the betatron radiation from the plasma source used in the E200 plasma wakefield acceleration experiment may be observed. The ultra-dense, high-energy beam at FACET (2 Multiplication-Sign 10{sup 10} electrons, 20 Multiplication-Sign 20{mu}m{sup 2} spot, 20 - 100{mu}m length, 20GeV energy) when sent into a plasma source with a nominal density of {approx} 1 Multiplication-Sign 10{sup 17} cm{sup -3} will generate synchrotron-like spectra with critical energies well into the tens of MeV. The intensity of the radiation can be increased by introducing a radial offset to the centroid of the witness bunch, which may be achieved at FACET through the use of a transverse deflecting RF cavity. The E200 gamma ray detector has two main components: a 30 Multiplication-Sign 35cm{sup 2} phosphorescent screen for observing the transverse extent of the radiation, and a sampling electromagnetic calorimeter outfitted with photodiodes for measuring the on-axis spectrum. To estimate the spectrum, the observed intensity patterns across the calorimeter are fit with a Gaussian-integrated synchrotron spectrum and compared to simulations. Results and observations from the first FACET user run (April-June 2012) are presented.

  10. Betatron Radiation from a Beam Driven Plasma Source (Conference) | SciTech

    Office of Scientific and Technical Information (OSTI)

    Connect Conference: Betatron Radiation from a Beam Driven Plasma Source Citation Details In-Document Search Title: Betatron Radiation from a Beam Driven Plasma Source Photons produced by the betatron oscillation of electrons in a beam-driven plasma wake provide a uniquely intense and high-energy source of hard X-rays and gamma rays. This betatron radiation is interesting not only for its high intensity and spectral characteristics, but also because it can be used as a diagnostic for beam

  11. 9 GeV energy gain in a beam-driven plasma wakefield accelerator (Journal

    Office of Scientific and Technical Information (OSTI)

    Article) | SciTech Connect 9 GeV energy gain in a beam-driven plasma wakefield accelerator Citation Details In-Document Search Title: 9 GeV energy gain in a beam-driven plasma wakefield accelerator An electron beam has gained a maximum energy of 9 GeV per particle in a 1.3 m-long electron beam-driven plasma wakefield accelerator. The amount of charge accelerated in the spectral peak was 28.3 pC, and the root-mean-square energy spread was 5.0%. The mean accelerated charge and energy gain per

  12. Report on the 1. Techno Rally of small model cars driven by Stirling

    Office of Scientific and Technical Information (OSTI)

    engines (Conference) | SciTech Connect Report on the 1. Techno Rally of small model cars driven by Stirling engines Citation Details In-Document Search Title: Report on the 1. Techno Rally of small model cars driven by Stirling engines The first speed contest of model cars driven by hand made Stirling engines was held in summer of 1997 in Tokyo under the name of The First Stirling Techno Rally sponsored by JSME and others. The body of cars were smaller than 60 cm in length and 30 cm in width

  13. A Beam Driven Plasma-Wakefield Linear Collider: From Higgs Factory...

    Office of Scientific and Technical Information (OSTI)

    A Beam Driven Plasma-Wakefield Linear Collider: From Higgs Factory to Multi-TeV Summarized for CSS2013 E. Adli, J.P.Delahaye, S.J.Gessner, M.J. Hogan, T. Raubenheimer (SLAC) W.An,...

  14. Energy Department Co-Hosts Workshops to Develop an Industry-Driven...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Department Co-Hosts Workshops to Develop an Industry-Driven Vision of the Nation's ... in the Office of Electricity Delivery and Energy Reliability The U.S. electric grid ...

  15. Picture of the Week: Laser-driven neutron source for research...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Laser-driven neutron source for research and global security At Los Alamos's Trident facility, scientists are using an ultra-high intensity laser beam to produce high intensity ...

  16. Sub-100 ps laser-driven dynamic compression of solid deuterium...

    Office of Scientific and Technical Information (OSTI)

    a 40 J laser pulse Citation Details In-Document Search Title: Sub-100 ps laser-driven dynamic compression of solid deuterium with a 40 J laser pulse You are ...

  17. Coulomb-driven organization and enhancement of spin-orbit fields...

    Office of Scientific and Technical Information (OSTI)

    Title: Coulomb-driven organization and enhancement of spin-orbit fields in collective spin excitations Authors: Baboux, F. ; Perez, F. ; Ullrich, C. A. ; D'Amico, I. ; Karczewski, ...

  18. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and ProgramSystem Analyst Vince ...

  19. Ultrasonic Concentration in a Line-Driven Cylindrical Tube

    SciTech Connect (OSTI)

    G.R. Goddard

    2004-12-15

    The fractionation of particles from their suspending fluid or noninvasive micromanipulation of particles in suspension has many applications ranging from the recovery of valuable reagents from process flows to the fabrication of microelectromechanical devices. Techniques based on size, density, solubility, or electromagnetic properties exist for fulfilling these needs, but many particles have traits that preclude their use such as small size, neutral buoyancy, or uniform electromagnetic characteristics. While separation by those techniques may not be possible, often compressibility differences exist between the particle and fluid that would allow fractionation by acoustic forces. The potential of acoustic separation is known, but due to inherent difficulties in achieving and maintaining accurate alignment of the transduction system, it is rarely utilized. The objective of this project is to investigate the use of structural excitation as a potentially efficient concentration/fractionation method for particles in suspension. It is demonstrated that structural excitation of a cylindrically symmetric cavity, such as a tube, allows non-invasive, fast, and low power concentration of particles suspended in a fluid. The inherent symmetry of the system eliminates the need for careful alignment inherent in current acoustic concentration devices. Structural excitation distributes the acoustic field throughout the volume of the cavity, which also significantly reduces temperature gradients and acoustic streaming in the fluid; cavitation is no longer an issue. The lowest-order coupled modes of a long cylindrical glass tube and fluid-filled cavity, driven by a line contact, are tuned, via material properties and aspect ratio, to achieve a coupled dipolar vibration of the system, shown to generate efficient concentration of particles to the central axis of the tube. A two dimensional elastodynamic model of the system was developed and subsequently utilized to optimize particle concentration within the system. The effects of tubing, fluid, and particle material properties, tube geometry, fluid flow, and tube length on the structural excitation and consequently power requirements and concentration quality within the tube were investigated theoretically and experimentally. Limitations of the method are discussed, as well as ways to minimize or compensate for deleterious effects. Finally a preliminary demonstration of the efficacy of acoustic concentration is presented.

  20. IEMDC IN-LINE ELECTRIC MOTOR DRIVEN COMPRESSOR

    SciTech Connect (OSTI)

    Michael J. Crowley; Prem N. Bansal

    2004-10-01

    This report contains the final project summary and deliverables required by the award for the development of an In-line Electric Motor Driven Compressor (IEMDC). Extensive work was undertaken during the course of the project to develop the motor and the compressor section of the IEMDC unit. Multiple design iterations were performed to design an electric motor for operation in a natural gas environment and to successfully integrate the motor with a compressor. During the project execution, many challenges were successfully overcome in order to achieve the project goals and to maintain the system design integrity. Some of the challenges included limiting the magnitude of the compressor aerodynamic loading for appropriate sizing of the magnetic bearings, achieving a compact motor rotor size to meet the rotor dynamic requirements of API standards, devising a motor cooling scheme using high pressure natural gas, minimizing the impact of cooling on system efficiency, and balancing the system thrust loads for the magnetic thrust bearing. Design methods that were used on the project included validated state-of-the-art techniques such as finite element analysis and computational fluid dynamics along with the combined expertise of both Curtiss-Wright Electro-Mechanical Corporation and Dresser-Rand Company. One of the most significant areas of work undertaken on the project was the development of the unit configuration for the system. Determining the configuration of the unit was a significant step in achieving integration of the electric motor into a totally enclosed compression system. Product review of the IEMDC unit configuration was performed during the course of the development process; this led to an alternate design configuration. The alternate configuration is a modular design with the electric motor and compressor section each being primarily contained in its own pressure containing case. This new concept resolved the previous conflict between the aerodynamic flow passage requirements and electric motor requirements for support and utilities by bounding the flowpath within the compressor section. However most importantly, the benefits delivered by the new design remained the same as those proposed by the goals of the project. In addition, this alternate configuration resulted in the achievement of a few additional advantages over the original concept such as easier maintenance, operation, and installation. Interaction and feedback solicited from target clients regarding the unit configuration supports the fact that the design addresses industry issues regarding accessibility, maintainability, preferred operating practice, and increased reliability.

  1. Evidence for a Bubble-Competition Regime in Indirectly Driven Ablative

    Office of Scientific and Technical Information (OSTI)

    Rayleigh-Taylor Instability Experiments on the NIF (Journal Article) | SciTech Connect Journal Article: Evidence for a Bubble-Competition Regime in Indirectly Driven Ablative Rayleigh-Taylor Instability Experiments on the NIF Citation Details In-Document Search This content will become publicly available on May 28, 2016 Title: Evidence for a Bubble-Competition Regime in Indirectly Driven Ablative Rayleigh-Taylor Instability Experiments on the NIF Authors: Martinez, D. A. ; Smalyuk, V. A. ;

  2. I. AN INTRODUCTION TO THE PROPELLANT-DRIVEN MAGNETIC FLUX COMPRESSION GENERATOR

    Office of Scientific and Technical Information (OSTI)

    I. AN INTRODUCTION TO THE PROPELLANT-DRIVEN MAGNETIC FLUX COMPRESSION GENERATOR Pharis E . Williams Abstract An introduction to the concept of a propellant-driven magnetic flux compression generator is presented, together with the theory of its operation. The principles of operation of the propellant flux compression generator combine generator principles, derived from lumped parameter circuit theory, and interior ballistic principles, INTRODUCTION Explosive magnetic flux compression generators

  3. Identification of a jet-driven supernova remnant in the Small Magellanic

    Office of Scientific and Technical Information (OSTI)

    Cloud: Possible evidence for the enhancement of bipolar explosions at low metallicity (Journal Article) | SciTech Connect Identification of a jet-driven supernova remnant in the Small Magellanic Cloud: Possible evidence for the enhancement of bipolar explosions at low metallicity Citation Details In-Document Search Title: Identification of a jet-driven supernova remnant in the Small Magellanic Cloud: Possible evidence for the enhancement of bipolar explosions at low metallicity Recent

  4. Hawai'i's Evolution: Hawai'i Powered. Technology Driven. | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Hawai'i's Evolution: Hawai'i Powered. Technology Driven. Hawai'i's Evolution: Hawai'i Powered. Technology Driven. Outlines Hawaii's energy and transportation goals and the implementation of electric vehicles (EV) and electric vehicle infrastructure since HCEI began in 2008. Includes information about Hawaii's role in leading the nation in available EV charging infrastructure per capita; challenges for continuing to implement EV technology; features on various successful EV users and

  5. United States Industrial Motor-Driven Systems Market Assessment: Charting a

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Roadmap to Energy Savings for Industry | Department of Energy Motor-Driven Systems Market Assessment: Charting a Roadmap to Energy Savings for Industry United States Industrial Motor-Driven Systems Market Assessment: Charting a Roadmap to Energy Savings for Industry This paper is an overview of the results of a market assessment commissioned by the DOE Motor Challenge program in 1995 to better understand the characteristics of the installed population of motor systems in the manufacturing

  6. A hybrid Rayleigh-Taylor-current-driven coupled instability in a

    Office of Scientific and Technical Information (OSTI)

    magnetohydrodynamically collimated cylindrical plasma with lateral gravity (Journal Article) | DOE PAGES A hybrid Rayleigh-Taylor-current-driven coupled instability in a magnetohydrodynamically collimated cylindrical plasma with lateral gravity This content will become publicly available on March 22, 2017 Title: A hybrid Rayleigh-Taylor-current-driven coupled instability in a magnetohydrodynamically collimated cylindrical plasma with lateral gravity Authors: Zhai, Xiang [1] ; Bellan, Paul M.

  7. Are GRACE-era Terrestrial Water Trends Driven by Anthropogenic Climate

    Office of Scientific and Technical Information (OSTI)

    Change? (Journal Article) | SciTech Connect Are GRACE-era Terrestrial Water Trends Driven by Anthropogenic Climate Change? Citation Details In-Document Search Title: Are GRACE-era Terrestrial Water Trends Driven by Anthropogenic Climate Change? To provide context for observed trends in terrestrial water storage (TWS) during GRACE (2003-2014), trends and variability in the CESM1-CAM5 Large Ensemble (LE) are examined. Motivated in part by the anomalous nature of climate variability during

  8. Filamentation instability of current-driven dust ion-acoustic waves in a collisional dusty plasma

    SciTech Connect (OSTI)

    Niknam, A. R. [Laser and Plasma Research Institute, Shahid Beheshti University, G.C., Tehran 19839-63113 (Iran, Islamic Republic of); Haghtalab, T.; Khorashadizadeh, S. M. [Physics Department, Birjand University, Birjand 97179-63384 (Iran, Islamic Republic of)

    2011-11-15

    A theoretical investigation has been made of the dust ion-acoustic filamentation instability in an unmagnetized current-driven dusty plasma by using the Lorentz transformation formulas. The effect of collision between the charged particles with neutrals and their thermal motion on this instability is considered. Developing the filamentation instability of the current-driven dust ion-acoustic wave allows us to determine the period and the establishment time of the filamentation structure and threshold for instability development.

  9. New Homogeneous Chromophore/Catalyst Concepts for the Solar-Driven

    Office of Scientific and Technical Information (OSTI)

    Reduction of Carbon Dioxide (Technical Report) | SciTech Connect New Homogeneous Chromophore/Catalyst Concepts for the Solar-Driven Reduction of Carbon Dioxide Citation Details In-Document Search Title: New Homogeneous Chromophore/Catalyst Concepts for the Solar-Driven Reduction of Carbon Dioxide One of the major scientific and technical challenges of this century is to develop chemical means to store solar energy in the form of fuels. This can be accomplished by developing light-absorbing

  10. Observation of Fine Structures in Laser-Driven Electron Beams Using

    Office of Scientific and Technical Information (OSTI)

    Coherent Transition Radiation (Journal Article) | SciTech Connect SciTech Connect Search Results Journal Article: Observation of Fine Structures in Laser-Driven Electron Beams Using Coherent Transition Radiation Citation Details In-Document Search Title: Observation of Fine Structures in Laser-Driven Electron Beams Using Coherent Transition Radiation We have measured the coherent optical transition radiation emitted by an electron beam from laser-plasma interaction. The measurement of the

  11. Operon Formation is Driven by Co-Regulation and Not by Horizontal Gene

    Office of Scientific and Technical Information (OSTI)

    Transfer (Journal Article) | SciTech Connect Operon Formation is Driven by Co-Regulation and Not by Horizontal Gene Transfer Citation Details In-Document Search Title: Operon Formation is Driven by Co-Regulation and Not by Horizontal Gene Transfer Although operons are often subject to horizontal gene transfer (HGT), non-HGT genes are particularly likely to be in operons. To resolve this apparent discrepancy and to determine whether HGT is involved in operon formation, we examined the

  12. Prospects for Higgs coupling measurements in SUSY with radiatively-driven

    Office of Scientific and Technical Information (OSTI)

    naturalness (Journal Article) | SciTech Connect Prospects for Higgs coupling measurements in SUSY with radiatively-driven naturalness Citation Details In-Document Search This content will become publicly available on August 13, 2016 Title: Prospects for Higgs coupling measurements in SUSY with radiatively-driven naturalness Authors: Bae, Kyu Jung ; Baer, Howard ; Nagata, Natsumi ; Serce, Hasan Publication Date: 2015-08-14 OSTI Identifier: 1210124 Type: Publisher's Accepted Manuscript Journal

  13. Radiation Transport and Energetics of Laser-driven Half-hohlraums at the

    Office of Scientific and Technical Information (OSTI)

    National Ignition Facility (Journal Article) | SciTech Connect Radiation Transport and Energetics of Laser-driven Half-hohlraums at the National Ignition Facility Citation Details In-Document Search Title: Radiation Transport and Energetics of Laser-driven Half-hohlraums at the National Ignition Facility Authors: Moore, A ; Cooper, A ; Schneider, M ; MacLaren, S ; Graham, P ; Lu, K ; Seugling, R ; Satcher, J ; Klingmann, J ; et al. Publication Date: 2014-06-05 OSTI Identifier: 1229309 Report

  14. Large spin-wave bullet in a ferrimagnetic insulator driven by spin Hall

    Office of Scientific and Technical Information (OSTI)

    effect. (Journal Article) | SciTech Connect Large spin-wave bullet in a ferrimagnetic insulator driven by spin Hall effect. Citation Details In-Document Search Title: Large spin-wave bullet in a ferrimagnetic insulator driven by spin Hall effect. Due to its transverse nature, spin Hall effects (SHE) provide the possibility to excite and detect spin currents and magnetization dynamics even in magnetic insulators. Magnetic insulators are outstanding materials for the investigation of nonlinear

  15. Data-Driven Mailing Helps Heat Up Untapped Seattle Market | Department of

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Energy Data-Driven Mailing Helps Heat Up Untapped Seattle Market Data-Driven Mailing Helps Heat Up Untapped Seattle Market Abridged transcript of an interview with Community Power Works Project Manager Ruth Bell and Program/System Analyst Vince Schueler of the Washington State University Energy Program. PDF icon Seattle Focus Series More Documents & Publications The Better Buildings Neighborhood View -- January 2013 howtodesignandmarketenergyefficiencyprogramstospecificneighborhoods.doc

  16. Coulomb-driven organization and enhancement of spin-orbit fields in

    Office of Scientific and Technical Information (OSTI)

    collective spin excitations (Journal Article) | SciTech Connect Coulomb-driven organization and enhancement of spin-orbit fields in collective spin excitations Citation Details In-Document Search Title: Coulomb-driven organization and enhancement of spin-orbit fields in collective spin excitations Authors: Baboux, F. ; Perez, F. ; Ullrich, C. A. ; D'Amico, I. ; Karczewski, G. ; Wojtowicz, T. Publication Date: 2013-03-21 OSTI Identifier: 1103944 Type: Publisher's Accepted Manuscript Journal

  17. Design and optimization of a bi-axial vibration-driven electromagnetic

    Office of Scientific and Technical Information (OSTI)

    generator (Journal Article) | SciTech Connect Design and optimization of a bi-axial vibration-driven electromagnetic generator Citation Details In-Document Search Title: Design and optimization of a bi-axial vibration-driven electromagnetic generator To scavenge energy from ambient vibrations with arbitrary in-plane motion directions and over a wide frequency range, a novel electromagnetic vibration energy harvester is designed and optimized. In the harvester, a circular cross-section

  18. A hybrid Rayleigh-Taylor-current-driven coupled instability in a

    Office of Scientific and Technical Information (OSTI)

    magnetohydrodynamically collimated cylindrical plasma with lateral gravity (Journal Article) | SciTech Connect SciTech Connect Search Results Journal Article: A hybrid Rayleigh-Taylor-current-driven coupled instability in a magnetohydrodynamically collimated cylindrical plasma with lateral gravity Citation Details In-Document Search This content will become publicly available on March 22, 2017 Title: A hybrid Rayleigh-Taylor-current-driven coupled instability in a magnetohydrodynamically

  19. Engine Driven Combined Heat and Power: Arrow Linen Supply, December 2008 |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Department of Energy Engine Driven Combined Heat and Power: Arrow Linen Supply, December 2008 Engine Driven Combined Heat and Power: Arrow Linen Supply, December 2008 This paper describes the Arrow Linen CHP demonstration, including the original installation supported by NYSERDA and the data monitoring and analysis supported by DOE. The team consisted of Oak Ridge National Lab, Energy Solutions Center, and ICF International. PDF icon arrow_linen_hedman.pdf More Documents & Publications

  20. Systems Modeling for a Laser-Driven IFE Power Plant using Direct Conversion

    Office of Scientific and Technical Information (OSTI)

    (Journal Article) | SciTech Connect a Laser-Driven IFE Power Plant using Direct Conversion Citation Details In-Document Search Title: Systems Modeling for a Laser-Driven IFE Power Plant using Direct Conversion A variety of systems analyses have been conducted for laser driver IFE power plants being developed as part of the High Average Power Laser (HAPL) program. A key factor determining the economics attractiveness of the power plant is the net power conversion efficiency which increases

  1. THE DOMINANCE OF NEUTRINO-DRIVEN CONVECTION IN CORE-COLLAPSE SUPERNOVAE

    Office of Scientific and Technical Information (OSTI)

    (Journal Article) | SciTech Connect THE DOMINANCE OF NEUTRINO-DRIVEN CONVECTION IN CORE-COLLAPSE SUPERNOVAE Citation Details In-Document Search Title: THE DOMINANCE OF NEUTRINO-DRIVEN CONVECTION IN CORE-COLLAPSE SUPERNOVAE Multi-dimensional instabilities have become an important ingredient in core-collapse supernova (CCSN) theory. Therefore, it is necessary to understand the driving mechanism of the dominant instability. We compare our parameterized three-dimensional CCSN simulations with

  2. Temperature-driven phase transformation in Y3Co: Neutron scattering and

    Office of Scientific and Technical Information (OSTI)

    first-principles studies (Journal Article) | SciTech Connect Temperature-driven phase transformation in Y3Co: Neutron scattering and first-principles studies Citation Details In-Document Search Title: Temperature-driven phase transformation in Y3Co: Neutron scattering and first-principles studies Authors: Podlesnyak, A. ; Ehlers, G. ; Cao, H. ; Matsuda, M. ; Frontzek, M. ; Zaharko, O. ; Kazantsev, V. A. ; Gubkin, A. F. ; Baranov, N. V. Publication Date: 2013-07-26 OSTI Identifier: 1104316

  3. The ADAPT concept - an accelerator driven system for the rapid and

    Office of Scientific and Technical Information (OSTI)

    efficient disposal of plutonium (Journal Article) | SciTech Connect The ADAPT concept - an accelerator driven system for the rapid and efficient disposal of plutonium Citation Details In-Document Search Title: The ADAPT concept - an accelerator driven system for the rapid and efficient disposal of plutonium A new concept; termed ADAPT; for the rapid and virtually complete burning of plutonium is described. ADAPT employs a high current CW linear accelerator (linac) to generate neutrons in a

  4. Analysis of Buoyancy-Driven Ventilation of Hydrogen from Buildings (Presentation)

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Buoyancy-Driven Ventilation of Hydrogen from Buildings C. Dennis Barley, Keith Gawlik, Jim Ohi, Russell Hewett National Renewable Laboratory U.S. DOE Hydrogen Safety, Codes & Standards Program Presented at 2 nd ICHS, San Sebastián, Spain September 11, 2007 NREL/PR-550-42289 Scope of Work * Safe building design * Vehicle leak in residential garage * Continual slow leak * Passive, buoyancy-driven ventilation (vs. mechanical) * Steady-state concentration of H 2 vs. vent size Prior Work *

  5. Systematic characterization of degas-driven flow for poly(dimethylsiloxane) microfluidic devices

    SciTech Connect (OSTI)

    Liang, David Y. [Univ. of California, Berkeley, CA (United States) Biomolecular Nanotechnology Center, Berkeley Sensor and Actuator Center; Tentori, Augusto M. [Univ. of California, Berkeley, CA (United States) Biomolecular Nanotechnology Center, Berkeley Sensor and Actuator Center; Dimov, Ivan K. [Univ. of California, Berkeley, CA (United States) Biomolecular Nanotechnology Center, Berkeley Sensor and Actuator Center; Univ. de Valapariso, Valapariso (Chile); Lee, Luke P. [Univ. of California, Berkeley, CA (United States) Biomolecular Nanotechnology Center, Berkeley Sensor and Actuator Center

    2011-01-01

    Degas-driven flow is a novel phenomenon used to propel fluids in poly(dimethylsiloxane) (PDMS)-based microfluidic devices without requiring any external power. This method takes advantage of the inherently high porosity and air solubility of PDMS by removing air molecules from the bulk PDMS before initiating the flow. The dynamics of degas-driven flow are dependent on the channel and device geometries and are highly sensitive to temporal parameters. These dependencies have not been fully characterized, hindering broad use of degas-driven flow as a microfluidic pumping mechanism. Here, we characterize, for the first time, the effect of various parameters on the dynamics of degas-driven flow, including channel geometry, PDMS thickness, PDMS exposure area, vacuum degassing time, and idle time at atmospheric pressure before loading. We investigate the effect of these parameters on flow velocity as well as channel fill time for the degas-driven flow process. Using our devices, we achieved reproducible flow with a standard deviation of less than 8% for flow velocity, as well as maximum flow rates of up to 3 nL/s and mean flow rates of approximately 1-1.5 nL/s. Parameters such as channel surface area and PDMS chip exposure area were found to have negligible impact on degas-driven flow dynamics, whereas channel cross-sectional area, degas time, PDMS thickness, and idle time were found to have a larger impact. In addition, we develop a physical model that can predict mean flow velocities within 6% of experimental values and can be used as a tool for future design of PDMS-based microfluidic devices that utilize degas-driven flow.

  6. Systematic characterization of degas-driven flow for poly(dimethylsiloxane) microfluidic devices

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Liang, David Y.; Tentori, Augusto M.; Dimov, Ivan K.; Lee, Luke P.

    2011-01-01

    Degas-driven flow is a novel phenomenon used to propel fluids in poly(dimethylsiloxane) (PDMS)-based microfluidic devices without requiring any external power. This method takes advantage of the inherently high porosity and air solubility of PDMS by removing air molecules from the bulk PDMS before initiating the flow. The dynamics of degas-driven flow are dependent on the channel and device geometries and are highly sensitive to temporal parameters. These dependencies have not been fully characterized, hindering broad use of degas-driven flow as a microfluidic pumping mechanism. Here, we characterize, for the first time, the effect of various parameters on the dynamics ofmore » degas-driven flow, including channel geometry, PDMS thickness, PDMS exposure area, vacuum degassing time, and idle time at atmospheric pressure before loading. We investigate the effect of these parameters on flow velocity as well as channel fill time for the degas-driven flow process. Using our devices, we achieved reproducible flow with a standard deviation of less than 8% for flow velocity, as well as maximum flow rates of up to 3 nL/s and mean flow rates of approximately 1-1.5 nL/s. Parameters such as channel surface area and PDMS chip exposure area were found to have negligible impact on degas-driven flow dynamics, whereas channel cross-sectional area, degas time, PDMS thickness, and idle time were found to have a larger impact. In addition, we develop a physical model that can predict mean flow velocities within 6% of experimental values and can be used as a tool for future design of PDMS-based microfluidic devices that utilize degas-driven flow.« less

  7. Embedding Agile Practices within a Plan-Driven Hierarchical Project Life Cycle

    SciTech Connect (OSTI)

    Millard, W. David; Johnson, Daniel M.; Henderson, John M.; Lombardo, Nicholas J.; Bass, Robert B.; Smith, Jason E.

    2014-07-28

    Organizations use structured, plan-driven approaches to provide continuity, direction, and control to large, multi-year programs. Projects within these programs vary greatly in size, complexity, level of maturity, technical risk, and clarity of the development objectives. Organizations that perform exploratory research, evolutionary development, and other R&D activities can obtain the benefits of Agile practices without losing the benefits of their programs overarching plan-driven structure. This paper describes application of Agile development methods on a large plan-driven sensor integration program. While the client employed plan-driven, requirements flow-down methodologies, tight project schedules and complex interfaces called for frequent end-to-end demonstrations to provide feedback during system development. The development process maintained the many benefits of plan-driven project execution with the rapid prototyping, integration, demonstration, and client feedback possible through Agile development methods. This paper also describes some of the tools and implementing mechanisms used to transition between and take advantage of each methodology, and presents lessons learned from the project management, system engineering, and developers perspectives.

  8. Numerical investigation on target implosions driven by radiation ablation and shock compression in dynamic hohlraums

    SciTech Connect (OSTI)

    Xiao, Delong; Sun, Shunkai; Zhao, Yingkui; Ding, Ning; Wu, Jiming; Dai, Zihuan; Yin, Li; Zhang, Yang; Xue, Chuang

    2015-05-15

    In a dynamic hohlraum driven inertial confinement fusion (ICF) configuration, the target may experience two different kinds of implosions. One is driven by hohlraum radiation ablation, which is approximately symmetric at the equator and poles. The second is caused by the radiating shock produced in Z-pinch dynamic hohlraums, only taking place at the equator. To gain a symmetrical target implosion driven by radiation ablation and avoid asymmetric shock compression is a crucial issue in driving ICF using dynamic hohlraums. It is known that when the target is heated by hohlraum radiation, the ablated plasma will expand outward. The pressure in the shocked converter plasma qualitatively varies linearly with the material temperature. However, the ablation pressure in the ablated plasma varies with 3.5 power of the hohlraum radiation temperature. Therefore, as the hohlraum temperature increases, the ablation pressure will eventually exceed the shock pressure, and the expansion of the ablated plasma will obviously weaken the shock propagation and decrease its velocity after propagating into the ablator plasma. Consequently, longer time duration is provided for the symmetrical target implosion driven by radiation ablation. In this paper these processes are numerically investigated by changing drive currents or varying load parameters. The simulation results show that a critical hohlraum radiation temperature is needed to provide a high enough ablation pressure to decelerate the shock, thus providing long enough time duration for the symmetric fuel compression driven by radiation ablation.

  9. Improved understanding of geologic CO{sub 2} storage processes requires risk-driven field experiments

    SciTech Connect (OSTI)

    Oldenburg, C.M.

    2011-06-01

    The need for risk-driven field experiments for CO{sub 2} geologic storage processes to complement ongoing pilot-scale demonstrations is discussed. These risk-driven field experiments would be aimed at understanding the circumstances under which things can go wrong with a CO{sub 2} capture and storage (CCS) project and cause it to fail, as distinguished from accomplishing this end using demonstration and industrial scale sites. Such risk-driven tests would complement risk-assessment efforts that have already been carried out by providing opportunities to validate risk models. In addition to experimenting with high-risk scenarios, these controlled field experiments could help validate monitoring approaches to improve performance assessment and guide development of mitigation strategies.

  10. Generating a fractal butterfly Floquet spectrum in a class of driven SU(2) systems

    SciTech Connect (OSTI)

    Wang Jiao [Department of Physics and Institute of Theoretical Physics and Astrophysics, Xiamen University, Xiamen 361005 (China); Temasek Laboratories, National University of Singapore, Singapore 117542 (Singapore); Gong Jiangbin [Department of Physics and Center of Computational Science and Engineering, National University of Singapore, Singapore 117542 (Singapore); NUS Graduate School for Integrative Sciences and Engineering, Singapore 117597 (Singapore)

    2010-02-15

    A scheme for generating a fractal butterfly Floquet spectrum, first proposed by Wang and Gong [Phys. Rev. A 77, 031405(R) (2008)], is extended to driven SU(2) systems such as a driven two-mode Bose-Einstein condensate. A class of driven systems without a link with the Harper-model context is shown to have an intriguing butterfly Floquet spectrum. The found butterfly spectrum shows remarkable deviations from the known Hofstadter's butterfly. In addition, the level crossings between Floquet states of the same parity and between Floquet states of different parities are studied and highlighted. The results are relevant to studies of fractal statistics, quantum chaos, and coherent destruction of tunneling, as well as the validity of mean-field descriptions of Bose-Einstein condensates.

  11. A Beam Driven Plasma-Wakefield Linear Collider: From Higgs Factory to

    Office of Scientific and Technical Information (OSTI)

    Multi-TeV (Conference) | SciTech Connect Conference: A Beam Driven Plasma-Wakefield Linear Collider: From Higgs Factory to Multi-TeV Citation Details In-Document Search Title: A Beam Driven Plasma-Wakefield Linear Collider: From Higgs Factory to Multi-TeV Authors: Adli, E ; Delahaye, J.P. ; Gessner, S.J. ; Hogan, M.J. ; Raubenheimer, T. ; /SLAC ; An, W. ; Joshi, C. ; Mori, W. ; /UCLA, Los Angeles Publication Date: 2013-09-30 OSTI Identifier: 1074154 Report Number(s): SLAC-PUB-15426 DOE

  12. Continuous Energy Improvement in Motor Driven Systems - A Guidebook for Industry

    SciTech Connect (OSTI)

    Gilbert A. McCoy and John G. Douglass

    2014-02-01

    This guidebook provides a step-by-step approach to developing a motor system energy-improvement action plan. An action plan includes which motors should be repaired or replaced with higher efficiency models, recommendations on maintaining a spares inventory, and discussion of improvements in maintenance practices. The guidebook is the successor to DOE’s 1997 Energy Management for Motor Driven Systems. It builds on its predecessor publication by including topics such as power transmission systems and matching driven equipment to process requirements in addition to motors.

  13. Extensions to the CYCLUS Ecosystem in Support of Market-Driven Transition

    Office of Scientific and Technical Information (OSTI)

    Capability (Conference) | SciTech Connect Conference: Extensions to the CYCLUS Ecosystem in Support of Market-Driven Transition Capability Citation Details In-Document Search Title: Extensions to the CYCLUS Ecosystem in Support of Market-Driven Transition Capability Authors: Huff, K D ; Fratoni, M ; Greenberg, H R Publication Date: 2014-06-30 OSTI Identifier: 1165805 Report Number(s): LLNL-PROC-656426 DOE Contract Number: DE-AC52-07NA27344 Resource Type: Conference Resource Relation:

  14. X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires Print Wednesday, 26 September 2007 00:00 The quest to increase both computer data-storage density and the speed at which one can read and write the information remains unconsummated. One novel concept is based on the use of a local electric current to push magnetic domain walls along a thin nanowire. A German, Korean, Berkeley Lab team has used the x-ray

  15. Sub-100 ps laser-driven dynamic compression of solid deuterium with a ~ 40

    Office of Scientific and Technical Information (OSTI)

    μ J laser pulse (Journal Article) | SciTech Connect Journal Article: Sub-100 ps laser-driven dynamic compression of solid deuterium with a ~ 40 μ J laser pulse Citation Details In-Document Search Title: Sub-100 ps laser-driven dynamic compression of solid deuterium with a ~ 40 μ J laser pulse Authors: Armstrong, M ; Crowhurst, J ; Bastea, S ; Zaug, J ; Goncharov, A Publication Date: 2014-07-14 OSTI Identifier: 1158883 Report Number(s): LLNL-JRNL-513474 Journal ID: ISSN 0003-6951; APPLAB

  16. Proof of concept of a magnetically coupled Stirling engine-driven heat pump

    SciTech Connect (OSTI)

    Shonder, J.A.; Chen, Gong; McEntee, J.

    1992-08-01

    A prototype magnetically-coupled Stirling engine-driven heat pump module has been designed and fabricated by Sunpower, Inc. under sponsorship of the US Department of Energy and the Oak Ridge National Laboratory (ORNL). Preliminary testing indicates that the magnetic coupling is an effective means for transmitting power from a free-piston Stirling engine to a refrigerant compressor. Compared with other power transmission concepts, the magnetic coupling has relatively low cost, and will help make commercial development of Stirling-driven heat pumps more likely in the future.

  17. Proof of concept of a magnetically coupled Stirling engine-driven heat pump

    SciTech Connect (OSTI)

    Shonder, J.A. ); Chen, Gong; McEntee, J. )

    1992-01-01

    A prototype magnetically-coupled Stirling engine-driven heat pump module has been designed and fabricated by Sunpower, Inc. under sponsorship of the US Department of Energy and the Oak Ridge National Laboratory (ORNL). Preliminary testing indicates that the magnetic coupling is an effective means for transmitting power from a free-piston Stirling engine to a refrigerant compressor. Compared with other power transmission concepts, the magnetic coupling has relatively low cost, and will help make commercial development of Stirling-driven heat pumps more likely in the future.

  18. A Beam Driven Plasma-Wakefield Linear Collider: From Higgs Factory to

    Office of Scientific and Technical Information (OSTI)

    Multi-TeV (Conference) | SciTech Connect A Beam Driven Plasma-Wakefield Linear Collider: From Higgs Factory to Multi-TeV Citation Details In-Document Search Title: A Beam Driven Plasma-Wakefield Linear Collider: From Higgs Factory to Multi-TeV Authors: Adli, E ; Delahaye, J.P. ; Gessner, S.J. ; Hogan, M.J. ; Raubenheimer, T. ; /SLAC ; An, W. ; Joshi, C. ; Mori, W. ; /UCLA, Los Angeles Publication Date: 2013-09-30 OSTI Identifier: 1074154 Report Number(s): SLAC-PUB-15426 DOE Contract Number:

  19. A Simple Radionuclide-Driven Single-Ion Source (Journal Article) | SciTech

    Office of Scientific and Technical Information (OSTI)

    Connect A Simple Radionuclide-Driven Single-Ion Source Citation Details In-Document Search Title: A Simple Radionuclide-Driven Single-Ion Source Authors: Montero Diez, M. ; Twelker, K. ; /Stanford U., Phys. Dept. ; Fairbank, W., Jr. ; /Colorado State U. ; Gratta, G. ; Barbeau, P.S. ; Barry, K. ; DeVoe, R. ; Dolinski, M.J. ; Green, M. ; LePort, F. ; Muller, A.R. ; Neilson, R. ; O'Sullivan, K. ; /Stanford U., Phys. Dept. ; Ackerman, N. ; /SLAC ; Aharmin, B. ; /Laurentian U. more »; Auger, M.

  20. Re-entrant Lithium Local Environments and Defect Driven Electrochemistry of

    Office of Scientific and Technical Information (OSTI)

    Li- and Mn-Rich Li-Ion Battery Cathodes (Journal Article) | SciTech Connect Re-entrant Lithium Local Environments and Defect Driven Electrochemistry of Li- and Mn-Rich Li-Ion Battery Cathodes Citation Details In-Document Search Title: Re-entrant Lithium Local Environments and Defect Driven Electrochemistry of Li- and Mn-Rich Li-Ion Battery Cathodes Authors: Dogan, Fulya ; Long, Brandon R. ; Croy, Jason R. ; Gallagher, Kevin G. ; Iddir, Hakim ; Russell, John T. ; Balasubramanian, Mahalingam ;

  1. Parameter sensitivity of plasma wakefields driven by self-modulating proton beams

    SciTech Connect (OSTI)

    Lotov, K. V.; Minakov, V. A.; Sosedkin, A. P.

    2014-08-15

    The dependence of wakefield amplitude and phase on beam and plasma parameters is studied in the parameter area of interest for self-modulating proton beam-driven plasma wakefield acceleration. The wakefield phase is shown to be extremely sensitive to small variations of the plasma density, while sensitivity to small variations of other parameters is reasonably low. The study of large parameter variations clarifies the effects that limit the achievable accelerating field in different parts of the parameter space: nonlinear elongation of the wakefield period, insufficient charge of the drive beam, emittance-driven beam divergence, and motion of plasma ions.

  2. RF and space-charge effects in laser-driven rf electron guns (Conference) |

    Office of Scientific and Technical Information (OSTI)

    SciTech Connect Conference: RF and space-charge effects in laser-driven rf electron guns Citation Details In-Document Search Title: RF and space-charge effects in laser-driven rf electron guns × You are accessing a document from the Department of Energy's (DOE) SciTech Connect. This site is a product of DOE's Office of Scientific and Technical Information (OSTI) and is provided as a public service. Visit OSTI to utilize additional information resources in energy science and technology. A

  3. Energy Department Co-Hosts Workshops to Develop an Industry-Driven Vision

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of the Nation's Future Electric Grid | Department of Energy Co-Hosts Workshops to Develop an Industry-Driven Vision of the Nation's Future Electric Grid Energy Department Co-Hosts Workshops to Develop an Industry-Driven Vision of the Nation's Future Electric Grid July 11, 2014 - 2:14pm Addthis Eric Lightner Eric Lightner Director of the Federal Smart Grid Task Force in the Office of Electricity Delivery and Energy Reliability The U.S. electric grid provides the foundation for America's

  4. Active Interrogation of Sensitive Nuclear Material Using Laser Driven Neutron Beams

    SciTech Connect (OSTI)

    Favalli, Andrea; Roth, Markus

    2015-05-01

    An investigation of the viability of a laser-driven neutron source for active interrogation is reported. The need is for a fast, movable, operationally safe neutron source which is energy tunable and has high-intensity, directional neutron production. Reasons for the choice of neutrons and lasers are set forth. Results from the interrogation of an enriched U sample are shown.

  5. Technology Solutions Case Study: Field Performance of Inverter-Driven Heat Pumps in Cold Climates

    SciTech Connect (OSTI)

    J. Williamson and R. Aldrich

    2015-09-01

    To better understand and characterize heating performance, the U.S. Department of Energy Building America team, Consortium for Advanced Residential Buildings (CARB), monitored seven inverter-driven ASHPs across the northeast United States during the winter of 2013–2014.

  6. Analysis of Buoyancy-Driven Ventilation of Hydrogen from Buildings: Preprint

    SciTech Connect (OSTI)

    Barley, C. D.; Gawlik, K.; Ohi, J.; Hewett, R.

    2007-08-01

    When hydrogen gas is used or stored within a building, as with a hydrogen-powered vehicle parked in a residential garage, any leakage of unignited H2 will mix with indoor air and may form a flammable mixture. One approach to safety engineering relies on buoyancy-driven, passive ventilation of H2 from the building through vents to the outside.

  7. THE MORPHOLOGY AND DYNAMICS OF JET-DRIVEN SUPERNOVA REMNANTS: THE CASE OF W49B

    SciTech Connect (OSTI)

    Gonzlez-Casanova, Diego F.; De Colle, Fabio; Ramirez-Ruiz, Enrico; Lopez, Laura A.

    2014-02-01

    The circumstellar medium (CSM) of a massive star is modified by its winds before a supernova (SN) explosion occurs, and thus the evolution of the resulting supernova remnant (SNR) is influenced by both the geometry of the explosion as well as the complex structure of the CSM. Motivated by recent work suggesting the SNR W49B was a jet-driven SN expanding in a complex CSM, we explore how the dynamics and the metal distributions in a jet-driven explosion are modified by the interaction with the surrounding environment. In particular, we perform hydrodynamical calculations to study the dynamics and explosive nucleosynthesis of a jet-driven SN triggered by the collapse of a 25 M {sub ?} Wolf-Rayet star and its subsequent interaction with the CSM up to several hundred years following the explosion. We find that although the CSM has small-scale effects on the structure of the SNR, the overall morphology and abundance patterns are reflective of the initial asymmetry of the SN explosion. Thus, we predict that jet-driven SNRs, such as W49B, should be identifiable based on morphology and abundance patterns at ages up to several hundred years, even if they expand into a complex CSM environment.

  8. Investigation of the fracture and fragmentation of explosively driven rings and cylinders

    SciTech Connect (OSTI)

    Goto, D M; Becker, R C; Orzechowski, T J; Springer, H K; Sunwoo, A J; Syn, C K

    2007-04-18

    Cylinders and rings fabricated from AerMet{reg_sign} 100 alloy and AISI 1018 steel have been explosively driven to fragmentation in order to determine the fracture strains for these materials under plane strain and uniaxial stress conditions. The phenomena associated with the dynamic expansion and subsequent break up of the cylinders are monitored with high-speed diagnostics. In addition, complementary experiments are performed in which fragments from the explosively driven cylinders are recovered and analyzed to determine the statistical distribution associated with the fragmentation process as well as to determine failure mechanisms. The data are used to determine relevant coefficients for the Hancock-McKenzie (Johnson-Cook) fracture model. Metallurgical analysis of the fragments provides information on damage and failure mechanisms.

  9. Molten salt considerations for accelerator-driven subcritical fission to close the nuclear fuel cycle

    SciTech Connect (OSTI)

    Sooby, Elizabeth; Baty, Austin; Gerity, James; McIntyre, Peter; Melconian, Karie; Pogue, Nathaniel; Sattarov, Akhdiyor; Adams, Marvin; Tsevkov, Pavel; Phongikaroon, Supathorn; Simpson, Michael; Tripathy, Prabhat

    2013-04-19

    The host salt selection, molecular modeling, physical chemistry, and processing chemistry are presented here for an accelerator-driven subcritical fission in a molten salt core (ADSMS). The core is fueled solely with the transuranics (TRU) and long-lived fission products (LFP) from used nuclear fuel. The neutronics and salt composition are optimized to destroy the transuranics by fission and the long-lived fission products by transmutation. The cores are driven by proton beams from a strong-focusing cyclotron stack. One such ADSMS system can destroy the transuranics in the used nuclear fuel produced by a 1GWe conventional reactor. It uniquely provides a method to close the nuclear fuel cycle for green nuclear energy.

  10. Effects of pulse shape on strongly driven two-level systems

    SciTech Connect (OSTI)

    Conover, C. W. S.

    2011-12-15

    We present an experimental study of the dynamics of a two-level system driven by strong nonresonant electromagnetic pulses as a function of pulse intensity and detuning. We have explored the qualitative and quantitative behavior of the transition probability as a function of pulse area for five different temporal profiles: Lorentzian, Lorentzian squared, hyperbolic secant, hyperbolic secant squared, and Gaussian. The two-level system consists of a fine-structure doublet in sodium Rydberg states coupled by Raman transitions driven through far-off-resonance intermediate states. The pulses are in the microwave regime and have high fidelity and uniform intensity. Experiments show that, despite the similarity in the pulse shapes, the behavior of the population transfer versus intensity depends dramatically on the temporal shape and that the spectral properties and area of the pulse do not adequately describe the response.

  11. On the simulation of shock-driven material mixing in high-Re flows (u)

    SciTech Connect (OSTI)

    Grinstein, Fernando F [Los Alamos National Laboratory

    2009-01-01

    Implicit large eddy simulation proposes to effectively rely on the use of subgrid modeling and filtering provided implicitly by physics capturing numerics. Extensive work has demonstrated that predictive simulations of turbulent velocity fields are possible using a class of high resolution, non-oscillatory finite-volume (NFV) numerical algorithms. Truncation terms associated with NFV methods implicitly provide subgrid models capable of emulating the physical dynamics of the unresolved turbulent velocity fluctuations by themselves. The extension of the approach to the substantially more difficult problem of under-resolved material mixing by an under-resolved velocity field has not yet been investigated numerically, nor are there any theories as to when the methodology may be expected to be successful. Progress in addressing these issues in studies of shock-driven scalar mixing driven by Ritchmyer-Meshkov instabilities will be reported in the context of ongoing simulations of shock-tube laboratory experiments.

  12. Ablation driven by hot electrons generated during the ignitor laser pulse in shock ignition

    SciTech Connect (OSTI)

    Piriz, A. R.; Rodriguez Prieto, G. [E.T.S.I. Industriales, Universidad de Castilla-La Mancha and Instituto de Investigaciones Energeticas, 13071 Ciudad Real (Spain); Tahir, N. A. [GSI Helmholtzzentrum fuer Schwerionenforschung, Planckstrasse 1, 64291 Darmstadt (Germany); Zhang, Y. [School of Physics and Optoelectronic Technology, Dalian University of Technology, 116024 Dalian (China); Liu, S. D.; Zhao, Y. T. [Institute of Modern Physics, Chinese Academy of Science, 730000 Lanzhou (China)

    2012-12-15

    An analytical model for the ablation driven by hot electrons is presented. The hot electrons are assumed to be generated during the high intensity laser spike used to produce the ignitor shock wave in the shock ignition driven inertial fusion concept, and to carry on the absorbed laser energy in its totality. Efficient energy coupling requires to keep the critical surface sufficiently close to the ablation front and this goal can be achieved for high laser intensities provided that the laser wavelength is short enough. Scaling laws for the ablation pressure and the other relevant magnitudes of the ablation cloud are found in terms of the laser and target parameters. The effect of the preformed plasma assembled by the compression pulse, previous to the ignitor, is also discussed. It is found that a minimum ratio between the compression and the ignitor pulses would be necessary for the adequate matching of the corresponding scale lengths.

  13. Confidentiality Concerns Raised by DNA-Based Tests in the Market-Driven Managed Care Setting

    SciTech Connect (OSTI)

    Kotval, Jeroo S.

    2006-07-28

    In a policy climate where incentives to cherry pick are minimized, Managed Care Organizations can implement practices that safeguard medical privacy to the extent that data is protected from falling into the hands of third parties who could misuse it to discriminate. To the extent that these practices have been codified into the regulatory Network of the Health Insurance Portability and Accountability Act (HIPAA) Consumers may be able to rest easy about their genetic data being revealed to third parties who may discriminate. However, there are limitations to the use of policy instruments to prevent the discrimination of an entire genre of clients by market driven managed care organizations. Policy measures, to assure that knowledge of genetic conditions and their future costs would not be used by market driven managed care organizations to implement institutional policies and products that would implicitly discriminate against a genre of clients with genetic conditions, present difficulties.

  14. Three-dimensional microelectromechanical tilting platform operated by gear-driven racks

    DOE Patents [OSTI]

    Klody, Kelly A.; Habbit, Jr., Robert D.

    2005-11-01

    A microelectromechanical (MEM) tiltable-platform apparatus is disclosed which utilizes a light-reflective platform (i.e. a micromirror) which is supported above a substrate by flexures which can be bent upwards to tilt the platform in any direction over an angle of generally .+-.10 degrees using a gear-driven rack attached to each flexure. Each rack is driven by a rotary microengine (i.e. a micromotor); and an optional thermal actuator can be used in combination with each microengine for initially an initial uplifting of the platform away from the substrate. The MEM apparatus has applications for optical switching (e.g. between a pair of optical fibers) or for optical beam scanning.

  15. Temperature Profile of the Solution Vessel of an Accelerator-Driven Subcritical Fissile Solution System

    SciTech Connect (OSTI)

    Klein, Steven Karl; Determan, John C.

    2015-09-14

    Dynamic System Simulation (DSS) models of fissile solution systems have been developed and verified against a variety of historical configurations. DSS techniques have been applied specifically to subcritical accelerator-driven systems using fissile solution fuels of uranium. Initial DSS models were developed in DESIRE, a specialized simulation scripting language. In order to tailor the DSS models to specifically meet needs of system designers they were converted to a Visual Studio implementation, and one of these subsequently to National Instruments LabVIEW for human factors engineering and operator training. Specific operational characteristics of subcritical accelerator-driven systems have been examined using a DSS model tailored to this particular class using fissile fuel.

  16. Measurement of an Explosively Driven Hemispherical Shell Using 96 Points of Optical Velocimetry

    SciTech Connect (OSTI)

    Danielson, J. R.; Daykin, E P; Diaz, A. B.; Doty, D. L.; Frogget, B. C.; Furlanetto, M. R.; Gallegos, C. H.; Gibo, M; Garza, A; Holtkamp, D B; Hutchins, M S; Perez, C; Perez, C; Pena, M; Romero, V T; Shinas, M A; Teel, M G; Tabaka, L J

    2014-04-01

    We report the measurement of the surface motion of a hemispherical copper shell driven by high explosives. This measurement was made using three 32-channel multiplexed photonic Doppler velocimetry (PDV) systems, in combination with a novel compound optical probe. Clearly visible are detailed features of the motion of the shell over time, enhanced by spatial correlation. Significant non-normal motion is apparent, and challenges in measuring such a geometry are discussed.

  17. Study of Plasma Liner Driven Magnetized Target Fusion Via Advanced Simulations

    SciTech Connect (OSTI)

    Samulyak, Roman V.; Parks, Paul

    2013-08-31

    The feasibility of the plasma liner driven Magnetized Target Fusion (MTF) via terascale numerical simulations will be assessed. In the MTF concept, a plasma liner, formed by merging of a number (60 or more) of radial, highly supersonic plasma jets, implodes on the target in the form of two compact plasma toroids, and compresses it to conditions of the fusion ignition. By avoiding major difficulties associated with both the traditional laser driven inertial confinement fusion and solid liner driven MTF, the plasma liner driven MTF potentially provides a low-cost and fast R&D path towards the demonstration of practical fusion energy. High fidelity numerical simulations of full nonlinear models associated with the plasma liner MTF using state-of-art numerical algorithms and terascale computing are necessary in order to resolve uncertainties and provide guidance for future experiments. At Stony Brook University, we have developed unique computational capabilities that ideally suite the MTF problem. The FronTier code, developed in collaboration with BNL and LANL under DOE funding including SciDAC for the simulation of 3D multi-material hydro and MHD flows, has beenbenchmarked and used for fundamental and engineering problems in energy science applications. We have performed 3D simulations of converging supersonic plasma jets, their merger and the formation of the plasma liner, and a study of the corresponding oblique shock problem. We have studied the implosion of the plasma liner on the magnetized plasma target by resolving Rayleigh-Taylor instabilities in 2D and 3D and other relevant physics and estimate thermodynamic conditions of the target at the moment of maximum compression and the hydrodynamic efficiency of the method.

  18. Heterodyne photomixer spectrometer with receiver photomixer driven at different frequency than source photomixer

    DOE Patents [OSTI]

    Wanke, Michael C; Fortier, Kevin; Shaner, Eric A; Barrick, Todd A

    2013-07-09

    A heterodyne photomixer spectrometer comprises a receiver photomixer that is driven at a different frequency than the source photomixer, thereby maintaining the coherent nature of the detection, eliminating etalon effects, and providing not only the amplitude but also the phase of the received signal. The heterodyne technique can be applied where the source and receiver elements are components of a waveguide thereby forming an on-chip heterodyne spectrometer.

  19. Hybrid vehicle powertrain system with power take-off driven vehicle accessory

    DOE Patents [OSTI]

    Beaty, Kevin D.; Bockelmann, Thomas R.; Zou, Zhanijang; Hope, Mark E.; Kang, Xiaosong; Carpenter, Jeffrey L.

    2006-09-12

    A hybrid vehicle powertrain system includes a first prime mover, a first prime mover driven power transmission mechanism having a power take-off adapted to drive a vehicle accessory, and a second prime mover. The second prime mover is operable to drive the power transmission mechanism alone or in combination with the first prime mover to provide power to the power take-off through the power transmission mechanism. The invention further includes methods for operating a hybrid vehicle powertrain system.

  20. Field-driven Polarization and Domain Dynamics of Ferroelectric/Dielectric

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Superlattices | Stanford Synchrotron Radiation Lightsource Field-driven Polarization and Domain Dynamics of Ferroelectric/Dielectric Superlattices Thursday, March 1, 2012 - 10:00am SSRL Conference Room 137-226 Paul G. Evans, Materials Science and Engineering, University of Wisconsin-Madison The atomic-scale periodicity of ferroelectric/dielectric superlattices leads to an exciting variety of structural and dynamic effects in applied electric fields. The richness of these phenomena arises in

  1. Measurement of energetic-particle-driven core magnetic fluctuations and induced fast-ion transport

    SciTech Connect (OSTI)

    Lin, L.; Ding, W. X.; Brower, D. L.; Koliner, J. J.; Eilerman, S.; Reusch, J. A.; Anderson, J. K.; Nornberg, M. D.; Sarff, J. S.; Waksman, J.; Liu, D.

    2013-03-15

    Internal fluctuations arising from energetic-particle-driven instabilities, including both density and radial magnetic field, are measured in a reversed-field-pinch plasma. The fluctuations peak near the core where fast ions reside and shift outward along the major radius as the instability transits from the n = 5 to n = 4 mode. During this transition, strong nonlinear three-wave interaction among multiple modes accompanied by enhanced fast-ion transport is observed.

  2. Physics of Radiation-driven Islands Near the Tokamak Density Limit

    SciTech Connect (OSTI)

    D.A. Gates, L. Delgado-Apricio and R.B. White

    2013-01-10

    In previous work [1], the onset criterion for radiation driven islands [2] in combination with a simple cylindrical model of tokamak current channel behavior was shown to be consistent with the empirical scaling of the tokamak density limit [3]. A number of the unexplained phenomena at the density limit are consistent with this novel physics mechanism. In this work, a more formal theoretical underpinning, consistent with cylindrical tearing mode theory, is developed for the onset criteria of these modes. The appropriate derivation of the radiation-driven addition to the modified Rutherford equation is discussed. Additionally, the ordering of the terms in the MRE is examined in a regime near the density limit. It is hoped that given the apparent success of this simple model in explaining the observed global scalings will lead to a more comprehensive analysis of the possibility that radiation driven islands are the physics mechanism responsible for the density limit. In particular, with modern diagnostic capabilities detailed measurements of current densities, electron densities and impurity concentrations at rational surfaces should be possible, enabling verification of the concepts described above.

  3. Microfluidic pumping through miniaturized channels driven by ultra-high frequency surface acoustic waves

    SciTech Connect (OSTI)

    Shilton, Richie J.; Travagliati, Marco; Beltram, Fabio; Cecchini, Marco

    2014-08-18

    Surface acoustic waves (SAWs) are an effective means to pump fluids through microchannel arrays within fully portable systems. The SAW-driven acoustic counterflow pumping process relies on a cascade phenomenon consisting of SAW transmission through the microchannel, SAW-driven fluid atomization, and subsequent coalescence. Here, we investigate miniaturization of device design, and study both SAW transmission through microchannels and the onset of SAW-driven atomization up to the ultra-high-frequency regime. Within the frequency range from 47.8 MHz to 754 MHz, we show that the acoustic power required to initiate SAW atomization remains constant, while transmission through microchannels is most effective when the channel widths w ≳ 10 λ, where λ is the SAW wavelength. By exploiting the enhanced SAW transmission through narrower channels at ultra-high frequencies, we discuss the relevant frequency-dependent length scales and demonstrate the scaling down of internal flow patterns and discuss their impact on device miniaturization strategies.

  4. A laboratory study of asymmetric magnetic reconnection in strongly-driven plasmas

    SciTech Connect (OSTI)

    Rosenberg, M. J.; Li, C. K.; Fox, W.; Igumenshchev, I.; Seguin, F. H.; Town, R.P. J.; Frenje, J. A.; Stoeckl, C.; Glebov, V.; Petrasso, R. D.

    2015-02-04

    Magnetic reconnection, the annihilation and rearrangement of magnetic fields in a plasma, is a universal phenomenon that frequently occurs when plasmas carrying oppositely-directed field lines collide. In most natural circumstances the collision is asymmetric (the two plasmas having different properties), but laboratory research to date has been limited to symmetric configurations. Additionally, the regime of strongly-driven magnetic reconnection, where the ram pressure of the plasma dominates the magnetic pressure, as in several astrophysical environments, has also received little experimental attention. Thus, we have designed experiments to probe reconnection in asymmetric, strongly-driven, laser-generated plasmas. Here we show that, in this strongly-driven system, the rate of magnetic flux annihilation is dictated by the relative flow velocities of the opposing plasmas and is insensitive to initial asymmetries. Additionally, out-of-plane magnetic fields that arise from asymmetries in the three-dimensional plasma geometry have minimal impact on the reconnection rate, due to the strong flows.

  5. Measurement of pulsed-power-driven magnetic fields via proton deflectometry

    SciTech Connect (OSTI)

    Mariscal, D.; McGuffey, C.; Valenzuela, J.; Beg, F. N.; Wei, M. S.; Chittenden, J. P.; Niasse, N.; Presura, R.; Haque, S.; Wallace, M.; Arias, A.; Covington, A.; Sawada, H.; Wiewior, P.

    2014-12-01

    Measuring magnetic field and current distribution in Z-pinch plasma systems is crucial to the validation of Z-pinch theory. In this letter, the demonstration of proton deflectometry to pulsed-power-driven loads at the mega-amp scale is presented, which is capable of making more detailed field maps in high-density regions of plasmas. In this method, a laser-driven, broad-spectrum, MeV-energy proton beam is directed through a pulsed-power-driven plasma system, and the resulting deflections are measured to examine configuration of magnetic fields and to infer the currents that support them. The technique was first demonstrated on simple short-circuit loads, and the results are in excellent agreement with numerical simulations providing reliable estimates of the field and current configurations. It was then applied to a more complex—radial foil—plasma load. The measurements show unexpected proton deflections that exhibit the complexity of the plasma load and that with further analysis will reveal details about the current and magnetic field topology in this complex configuration.

  6. TP14AppABC.PDF

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    C Day 3 Range and Charge Schedule Page 2 of 2 24 Segment Number % of TP4 Range Distance Required (miles) Segment Speed (mph) Initial SOC Time Start Time End Miles Driven Final SOC ...

  7. ETA-TP014 Appendix A: Day 1 Range and Charge Data Sheet

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    A Day 1 Range and Charge Data Sheet Page 2 of 2 20 Segment Number % of TP4 Range Distance Required (miles) Segment Speed (mph) Initial SOC Time Start Time End Miles Driven Final ...

  8. P-ρ-T measurements of H{sub 2}O up to 260 GPa under laser-driven...

    Office of Scientific and Technical Information (OSTI)

    P--T measurements of Hsub 2O up to 260 GPa under laser-driven shock loading Citation Details In-Document Search Title: P--T measurements of Hsub 2O up to 260 GPa under ...

  9. U.S. Department of Energy's Motor Challenge Program: A National Strategy for Energy Efficient Industrial Motor-Driven Systems

    Broader source: Energy.gov [DOE]

    This brief discusses the opportunities, industry needs, and market drivers associated with improving industrial electric motor-driven systems. The key strategies and tactics being employed by the DOE Motor Challenge program are also described, along with some example products, services, and activities that Motor Challenge partners used to help them accelerate the adoption of efficient motor-driven systems technology and practices within U.S. industry.

  10. Radiation-driven warping of circumbinary disks around eccentric young star binaries

    SciTech Connect (OSTI)

    Hayasaki, Kimitake; Sohn, Bong Won; Jung, Taehyun; Zhao, Guangyao; Okazaki, Atsuo T.; Naito, Tsuguya

    2014-12-10

    We study a warping instability of a geometrically thin, non-self-gravitating, circumbinary disk around young binary stars on an eccentric orbit. Such a disk is subject to both the tidal torques due to a time-dependent binary potential and the radiative torques due to radiation emitted from each star. The tilt angle between the circumbinary disk plane and the binary orbital plane is assumed to be very small. We find that there is a radius within/beyond which the circumbinary disk is unstable to radiation-driven warping, depending on the disk density and temperature gradient indices. This marginally stable warping radius is very sensitive to viscosity parameters, a fiducial disk radius and the temperature measured there, the stellar luminosity, and the disk surface density at a radius where the disk changes from optically thick to thin for the irradiation from the central stars. On the other hand, it is insensitive to the orbital eccentricity and binary irradiation parameter, which is a function of the binary mass ratio and luminosity of each star. Since the tidal torques can suppress the warping in the inner part of the circumbinary disk, the disk starts to be warped in the outer part. While the circumbinary disks are most likely to be subject to the radiation-driven warping on an AU to kilo-AU scale for binaries with young massive stars more luminous than 10{sup 4} L {sub ?}, the radiation-driven warping does not work for those around young binaries with the luminosity comparable to the solar luminosity.

  11. Probability density function method for variable-density pressure-gradient-driven turbulence and mixing

    SciTech Connect (OSTI)

    Bakosi, Jozsef; Ristorcelli, Raymond J

    2010-01-01

    Probability density function (PDF) methods are extended to variable-density pressure-gradient-driven turbulence. We apply the new method to compute the joint PDF of density and velocity in a non-premixed binary mixture of different-density molecularly mixing fluids under gravity. The full time-evolution of the joint PDF is captured in the highly non-equilibrium flow: starting from a quiescent state, transitioning to fully developed turbulence and finally dissipated by molecular diffusion. High-Atwood-number effects (as distinguished from the Boussinesq case) are accounted for: both hydrodynamic turbulence and material mixing are treated at arbitrary density ratios, with the specific volume, mass flux and all their correlations in closed form. An extension of the generalized Langevin model, originally developed for the Lagrangian fluid particle velocity in constant-density shear-driven turbulence, is constructed for variable-density pressure-gradient-driven flows. The persistent small-scale anisotropy, a fundamentally 'non-Kolmogorovian' feature of flows under external acceleration forces, is captured by a tensorial diffusion term based on the external body force. The material mixing model for the fluid density, an active scalar, is developed based on the beta distribution. The beta-PDF is shown to be capable of capturing the mixing asymmetry and that it can accurately represent the density through transition, in fully developed turbulence and in the decay process. The joint model for hydrodynamics and active material mixing yields a time-accurate evolution of the turbulent kinetic energy and Reynolds stress anisotropy without resorting to gradient diffusion hypotheses, and represents the mixing state by the density PDF itself, eliminating the need for dubious mixing measures. Direct numerical simulations of the homogeneous Rayleigh-Taylor instability are used for model validation.

  12. AN INTERPRETATION OF GLE71 CONCURRENT CME-DRIVEN SHOCK WAVE

    SciTech Connect (OSTI)

    Firoz, Kazi A.; Rodrguez-Pacheco, J.; Zhang, Q. M.; Gan, W. Q.; Li, Y. P.; Moon, Y.-J.; Kudela, K.; Park, Y.-D.; Dorman, Lev I. E-mail: firoz.kazi@uah.es

    2014-08-01

    Particle accelerations in solar flares and CME-driven shocks can sometimes result in very high-energy particle events (?1 GeV) that are known as ground level enhancements (GLEs). Recent studies on the first GLE event (GLE71 2012 May 17 01:50 UT) of solar cycle 24 suggested that CME-driven shock played a leading role in causing the event. To verify this claim, we have made an effort to interpret the GLE71 concurrent shock wave. For this, we have deduced the possible speed and height of the shock wave in terms of the frequency (MHz) of the solar radio type II burst and its drift rate (MHz min{sup 1}), and studied the temporal evolution of the particle intensity profiles at different heights of the solar corona. For a better perception of the particle acceleration in the shock, we have studied the solar radio type II burst with concurrent solar radio and electron fluxes. When the particle intensity profiles are necessarily shifted in time at ?1 AU, it is found that the growth phases of the electron and cosmic ray intensity fluxes are strongly correlated (>0.91; ?0.87) with the frequency drift rate of the type II burst, which is also consistent with the intensive particle accelerations at upper coronal heights (??0.80 R {sub S} < 1.10 R {sub S}). Thus, we conclude that the CME-driven shock was possibly capable of producing the high-energy particle event. However, since the peaks of some flare components are found to be strongly associated with the fundamental phase of the type II burst, the preceding flare is supposed to contribute to the shock acceleration process.

  13. Alfvn wave coupled with flow-driven fluid instability in interpenetrating plasmas

    SciTech Connect (OSTI)

    Vranjes, J.

    2015-05-15

    The Alfvn wave is analyzed in case of one quasineutral plasma propagating with some constant speed v{sub 0} through another static quasineutral plasma. A dispersion equation is derived describing the Alfvn wave coupled with the flow driven mode ?=kv{sub 0} and solutions are discussed analytically and numerically. The usual solutions for two oppositely propagating Alfvn waves are substantially modified due to the flowing plasma. More profound is modification of the solution propagating in the negative direction with respect to the magnetic field and the plasma flow. For a large enough flow speed (exceeding the Alfvn speed in the static plasma), this negative solution may become non-propagating, with frequency equal to zero. In this case, it represents a spatial variation of the electromagnetic field. For greater flow speed it becomes a forward mode, and it may merge with the positive one. This merging of the two modes represents the starting point for a flow-driven instability, with two complex-conjugate solutions. The Alfvn wave in interpenetrating plasmas is thus modified and coupled with the flow-driven mode and this coupled mode is shown to be growing when the flow speed is large enough. The energy for the instability is macroscopic kinetic energy of the flowing plasma. The dynamics of plasma particles caused by such a coupled wave still remains similar to the ordinary Alfvn wave. This means that well-known stochastic heating by the Alfvn wave may work, and this should additionally support the potential role of the Alfvn wave in the coronal heating.

  14. X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires Print The quest to increase both computer data-storage density and the speed at which one can read and write the information remains unconsummated. One novel concept is based on the use of a local electric current to push magnetic domain walls along a thin nanowire. A German, Korean, Berkeley Lab team has used the x-ray microscope XM-1 at the ALS to demonstrate that magnetic domain walls in curved permalloy nanowires can be

  15. X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires Print The quest to increase both computer data-storage density and the speed at which one can read and write the information remains unconsummated. One novel concept is based on the use of a local electric current to push magnetic domain walls along a thin nanowire. A German, Korean, Berkeley Lab team has used the x-ray microscope XM-1 at the ALS to demonstrate that magnetic domain walls in curved permalloy nanowires can be

  16. X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires Print The quest to increase both computer data-storage density and the speed at which one can read and write the information remains unconsummated. One novel concept is based on the use of a local electric current to push magnetic domain walls along a thin nanowire. A German, Korean, Berkeley Lab team has used the x-ray microscope XM-1 at the ALS to demonstrate that magnetic domain walls in curved permalloy nanowires can be

  17. X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires Print The quest to increase both computer data-storage density and the speed at which one can read and write the information remains unconsummated. One novel concept is based on the use of a local electric current to push magnetic domain walls along a thin nanowire. A German, Korean, Berkeley Lab team has used the x-ray microscope XM-1 at the ALS to demonstrate that magnetic domain walls in curved permalloy nanowires can be

  18. 9 GeV energy gain in a beam-driven plasma wakefield accelerator

    Office of Scientific and Technical Information (OSTI)

    9 GeV energy gain in a beam-driven plasma wakefield accelerator This content has been downloaded from IOPscience. Please scroll down to see the full text. View the table of contents for this issue, or go to the journal homepage for more Download details: IP Address: 192.107.175.1 This content was downloaded on 27/04/2016 at 15:27 iopscience.iop.org Please note that terms and conditions apply. Plasma Physics and Controlled Fusion OPEN ACCESS IOP Publishing Plasma Phys. Control. Fusion 58 (2016)

  19. Characterization of laser-driven shock waves in solids using a fiber optic pressure probe

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Cranch, Geoffrey A.; Lunsford, Robert; Grun, Jacob; Weaver, James; Compton, Steve; May, Mark; Kostinski, Natalie

    2013-11-08

    Measurement of laser-driven shock wave pressure in solid blocks of polymethyl methacrylate is demonstrated using fiber optic pressure probes. Three probes based on a fiber Fabry–Perot, fiber Bragg grating, and interferometric fiber tip sensor are tested and compared. Shock waves are generated using a high-power laser focused onto a thin foil target placed in close proximity to the test blocks. The fiber Fabry–Perot sensor appears capable of resolving the shock front with a rise time of 91 ns. As a result, the peak pressure is estimated, using a separate shadowgraphy measurement, to be 3.4 GPa.

  20. Thermal engine driven heat pump for recovery of volatile organic compounds

    DOE Patents [OSTI]

    Drake, Richard L.

    1991-01-01

    The present invention relates to a method and apparatus for separating volatile organic compounds from a stream of process gas. An internal combustion engine drives a plurality of refrigeration systems, an electrical generator and an air compressor. The exhaust of the internal combustion engine drives an inert gas subsystem and a heater for the gas. A water jacket captures waste heat from the internal combustion engine and drives a second heater for the gas and possibly an additional refrigeration system for the supply of chilled water. The refrigeration systems mechanically driven by the internal combustion engine effect the precipitation of volatile organic compounds from the stream of gas.

  1. Wake Flow Simulations for a Mid-Sized Rim Driven Wind Turbine

    SciTech Connect (OSTI)

    Rob O. Hovsapian; Various

    2014-06-01

    The onshore land where wind farms with conventional wind turbines can be places is limited by various factors including a requirement for relatively high wind speed for turbines' efficient operations. Where such a requirement cannot be met, mid-and small-sized turbines can be a solution. In the current paper simulations for near and for wakes behind a mid-sized Rim Driven Wind Turbine developed by Keuka Energy LLC is analyzed. The purposes of this study is to better understand the wake structure for more efficient wind farm planning. Simulations are conducted with the commercial CFD software STARCCM+

  2. Neutronics of accelerator-driven subcritical fission for burning transuranics in used nuclear fuel

    SciTech Connect (OSTI)

    Sattarov, A.; Assadi, S.; Badgley, K.; Baty, A.; Comeaux, J.; Gerity, J.; Kellams, J.; Mcintyre, P.; Pogue, N.; Sooby, E.; Tsvetkov, P.; Rosaire, G.; Mann, T.

    2013-04-19

    We report the development of a conceptual design for accelerator-driven subcritical fission in a molten salt core (ADSMS). ADSMS is capable of destroying all of the transuranics at the same rate and proportion as they are produced in a conventional nuclear power plant. The ADSMS core is fueled solely by transuranics extracted from used nuclear fuel and reduces its radiotoxicity by a factor 10,000. ADSMS offers a way to close the nuclear fuel cycle so that the full energy potential in the fertile fuels uranium and thorium can be recovered.

  3. Efficient Feature-Driven Visualization of Large-Scale Scientific Data

    SciTech Connect (OSTI)

    Lu, Aidong

    2012-12-12

    Very large, complex scientific data acquired in many research areas creates critical challenges for scientists to understand, analyze, and organize their data. The objective of this project is to expand the feature extraction and analysis capabilities to develop powerful and accurate visualization tools that can assist domain scientists with their requirements in multiple phases of scientific discovery. We have recently developed several feature-driven visualization methods for extracting different data characteristics of volumetric datasets. Our results verify the hypothesis in the proposal and will be used to develop additional prototype systems.

  4. X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires Print The quest to increase both computer data-storage density and the speed at which one can read and write the information remains unconsummated. One novel concept is based on the use of a local electric current to push magnetic domain walls along a thin nanowire. A German, Korean, Berkeley Lab team has used the x-ray microscope XM-1 at the ALS to demonstrate that magnetic domain walls in curved permalloy nanowires can be

  5. X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires Print The quest to increase both computer data-storage density and the speed at which one can read and write the information remains unconsummated. One novel concept is based on the use of a local electric current to push magnetic domain walls along a thin nanowire. A German, Korean, Berkeley Lab team has used the x-ray microscope XM-1 at the ALS to demonstrate that magnetic domain walls in curved permalloy nanowires can be

  6. X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    X-Ray Imaging Current-Driven Magnetic Domain-Wall Motion in Nanowires Print The quest to increase both computer data-storage density and the speed at which one can read and write the information remains unconsummated. One novel concept is based on the use of a local electric current to push magnetic domain walls along a thin nanowire. A German, Korean, Berkeley Lab team has used the x-ray microscope XM-1 at the ALS to demonstrate that magnetic domain walls in curved permalloy nanowires can be

  7. Plasma size and power scaling of ion temperature gradient driven turbulence

    SciTech Connect (OSTI)

    Idomura, Yasuhiro; Nakata, Motoki

    2014-02-15

    The transport scaling with respect to plasma size and heating power is studied for ion temperature gradient driven turbulence using a fixed-flux full-f gyrokinetic Eulerian code. It is found that when heating power is scaled with plasma size, the ion heat diffusivity increases with plasma size in a local limit regime, where fixed-gradient ?f simulations predict a gyro-Bohm scaling. In the local limit regime, the transport scaling is strongly affected by the stiffness of ion temperature profiles, which is related to the power degradation of confinement.

  8. Software design for a database driven system for accelerator magnet measurements

    SciTech Connect (OSTI)

    Brown, B.C.; Bleadon, M.E.; Glass, H.D.; Glosson, R.; Hanft, R.W.; Harding, D.J.; Mazur, P.O.; Pachnik, J.E.; Sim, J.W.; Trombly-Freytag, K.; Walbridge, D.G.

    1991-05-01

    Measurements of more than 1000 new magnets are needed for the Main Injector Project at Fermilab. In order to achieve efficiency and accuracy in measurements, we chose a database driven design for control of the measurement system. We will use a relational database to describe the measurement subjects and equipment. A logbook system defined in the database will provide for prescription of measurements to be carried out, description of measurements as they are carried out, and a comment database for less structured information. The operator interface will be built on X-windows. This paper will describe our system design. 2 refs.

  9. Interferometry and high speed photography of laser-driven flyer plates

    SciTech Connect (OSTI)

    Paisley, D.L.; Montoya, N.I.; Stahl, D.B.; Garcia, I.A.

    1989-01-01

    Laser-driven thin (2-10-/mu/ thick) plates of aluminum and copper are accelerated to velocities /ge/5 km/s by a 1.06-/mu/ wavelength Nd:YAG 8-10 ns FWHM laser pulse at power densities 0.7-4.0 GW/cm/sup 2/. Accelerations /ge/10/sup 9/ km/s/sup 2/ have been achieved. The acceleration and velocity of these 0.4-1.0-mm-diameter plates are experimentally recorded by velocity interferometry (VISAR) and the planarity of impact by streak photography. 6 refs., 7 figs.

  10. High-intensity laser-driven proton acceleration enhancement from hydrogen containing ultrathin targets

    SciTech Connect (OSTI)

    Dollar, F.; Reed, S. A.; Matsuoka, T.; Bulanov, S. S.; Chvykov, V.; Kalintchenko, G.; McGuffey, C.; Rousseau, P.; Thomas, A. G. R.; Willingale, L.; Yanovsky, V.; Krushelnick, K.; Maksimchuk, A.; Litzenberg, D. W.

    2013-09-30

    Laser driven proton acceleration experiments from micron and submicron thick targets using high intensity (2 10{sup 21} W/cm{sup 2}), high contrast (10{sup ?15}) laser pulses show an enhancement of maximum energy when hydrogen containing targets were used instead of non-hydrogen containing. In our experiments, using thin (<1?m) plastic foil targets resulted in maximum proton energies that were consistently 20%100% higher than when equivalent thickness inorganic targets, including Si{sub 3}N{sub 4} and Al, were used. Proton energies up to 20 MeV were measured with a flux of 10{sup 7} protons/MeV/sr.

  11. International Experiences and Frameworks to Support Country-Driven Low-Emissions Development

    SciTech Connect (OSTI)

    Benioff, R.; Cochran, J.; Cox, S.

    2012-08-01

    Countries can use low-emission development strategies (LEDS) to advance sustainable development, promote private-sector growth, and reduce greenhouse gas emissions. This paper proposes a framework -- or support infrastructure -- to enable the efficient exchange of LEDS-related knowledge and technical assistance. Under the proposed framework, countries share LEDS-related resources via coordinating forums, 'knowledge platforms,' and networks of experts and investors. The virtual 'knowledge platforms' foster learning by allowing countries to communicate with each other and share technical reports, data, and analysis tools in support of LEDS development. Investing in all elements of the framework in an integrated fashion increases the efficacy of support for country-driven LEDS.

  12. Fluctuation of an ion beam extracted from an AC filament driven Bernas-type ion source

    SciTech Connect (OSTI)

    Miyamoto, N. Okajima, Y.; Wada, M.

    2014-02-15

    Argon ion beam fluctuation from an AC filament driven Bernas-type ion source is observed. The ion beam was measured by an 8 measurement elements beam profile monitor. The amplitude of the beam current fluctuation stayed in the same level from 100 Hz to 1 kHz of the filament heating frequency. The beam current fluctuation frequency measured by the beam profile monitor was equal to the frequency of the AC filament operation. The fluctuation amplitudes of the beam current by AC operation were less than 7% and were in the same level of the DC operation.

  13. Analysis of Buoyancy-Driven Ventilation of Hydrogen from Buildings: Preprint

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Analysis of Buoyancy-Driven Ventilation of Hydrogen from Buildings Preprint C.D. Barley, K. Gawlik, J. Ohi, and R. Hewett National Renewable Energy Laboratory To be presented at the 2 nd International Conference on Hydrogen Safety San Sebastian, Spain September 11-13, 2007 Conference Paper NREL/CP-550-41081 August 2007 NREL is operated by Midwest Research Institute ● Battelle Contract No. DE-AC36-99-GO10337 NOTICE The submitted manuscript has been offered by an employee of the Midwest Research

  14. Microsoft Word - 10_Million_Loaded_Miles.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    April 19, 2010 - The U.S. Department of Energy's (DOE) Carlsbad Field Office said drivers, who haul defense-related transuranic (TRU) waste to the Waste Isolation Pilot Plant,...

  15. Operational and Environmental Monitoring Within a Three-Mile...

    Office of Legacy Management (LM)

    ... Counting Error Reporting Limit Units Flag Detected ? BM34-21A Tier II 100608 NG SA 14C1 0.5 0.1 pMC Yes PAD26N Tier I or II 110708 DC SA Ac-228 1.45 0.091 0.2 pCig J Yes ...

  16. Seven Mile Hill I & II Wind Farm | Open Energy Information

    Open Energy Info (EERE)

    Developer PacifiCorp Energy Purchaser PacifiCorp Location Between Hanna and Medicine Bow WY Coordinates 41.939079, -106.372225 Show Map Loading map......

  17. Fact #902: December 7, 2015 Rural versus Urban Vehicle Miles...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    46,996 Louisiana 41.4% 58.6% 47,758 Maine 72.4% 27.6% 14,129 Maryland 18.6% 81.4% 56,688 Massachusetts 4.6% 95.4% 56,311 Michigan 29.5% 70.5% 95,132 Minnesota 40.9% 59.1%...

  18. Vehicle routing for the last mile of power system restoration

    SciTech Connect (OSTI)

    Bent, Russell W; Coffrin, Carleton; Van Hentenryck, Pascal

    2010-11-23

    This paper studied a novel problem in power system restoration: the Power Restoration Vehicle Routing Problem (PRVRP). The goal of PRVRPs is to decide how coordinate repair crews effectively in order to recover from blackouts as fast as possible after a disaster has occurred. PRVRPs are complex problems that combine vehicle routing and power restoration scheduling problems. The paper proposed a multi-stage optimization algorithm based on the idea of constraint injection that meets the aggressive runtime constraints necessary for disaster recovery. The algorithms were validated on benchmarks produced by the Los Alamos National Laboratory, using the infrastructure of the United States. The disaster scenarios were generated by state-of-the-art hurricane simulation tools similar to those used by the National Hurricane Center. Experimental results show that the constraint-injection algorithms can reduce the blackouts by 50% or more over field practices. Moreover, the results show that the constraint-injection algorithm using large neighborhood search over a blackbox simulator provide competitive quality and scales better than using a MIP solver on the subproblems.

  19. Seven Mile Hole Geothermal Area | Open Energy Information

    Open Energy Info (EERE)

    and Environmental Issues Click "Edit With Form" above to add content Exploration History First Discovery Well Completion Date: Well Name: Location: Depth: Initial Flow...

  20. Fact #860 February 16, 2015 Relationship of Vehicle Miles of...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    one year to the next (i.e., February 2001 data were compared with February 2000 data). ... 3-month moving average Month-Year Gas price change from previous year Vehicle travel ...

  1. MHK Projects/Twelve Mile Point Project | Open Energy Information

    Open Energy Info (EERE)

    Province Louisiana Project Country United States Project Resource Click here Current Tidal Coordinates 29.9177, -89.9307 Project Phase Phase 1 Project Installed Capacity...

  2. MHK Projects/Fortyeight Mile Point Project | Open Energy Information

    Open Energy Info (EERE)

    Water Mississippi River Coordinates 30.0447, -90.6659 Project Phase Phase ? PermitLicense Buildout (MW) 59 Device Nameplate Capacity (MW) 40 kW Number of Build Out Units...

  3. Operational and Environmental Monitoring Within a Three-Mile...

    Office of Legacy Management (LM)

    ... produced water, NG natural gas; ST stormwater; SA primary sample; FD field ... produced water, NG natural gas; ST stormwater; SA primary sample; FD field ...

  4. Seven Mile Hole Geothermal Area | Open Energy Information

    Open Energy Info (EERE)

    GEA Development Phase: Resource Estimate Mean Reservoir Temp: Estimated Reservoir Volume: Mean Capacity: USGS Mean Reservoir Temp: USGS Estimated Reservoir Volume: USGS Mean...

  5. Innovative Cell Materials and Designs for 300 Mile Range EVs

    Broader source: Energy.gov [DOE]

    2013 DOE Hydrogen and Fuel Cells Program and Vehicle Technologies Program Annual Merit Review and Peer Evaluation Meeting

  6. Gas breakdown driven by L band short-pulse high-power microwave

    SciTech Connect (OSTI)

    Yang Yiming; Yuan Chengwei; Qian Baoliang

    2012-12-15

    High power microwave (HPM) driven gas breakdown is a major factor in limiting the radiation and transmission of HPM. A method that HPM driven gas breakdown could be obtained by changing the aperture of horn antenna is studied in this paper. Changing the effective aperture of horn antenna can adjust the electric field in near field zone, leading to gas breakdown. With this method, measurements of air and SF{sub 6} breakdowns are carried out on a magnetically insulated transmission-line oscillators, which is capable of generating HPM with pulse duration of 30 ns, and frequency of 1.74 GHz. The typical breakdown waveforms of air and SF{sub 6} are presented. Besides, the breakdown field strengths of the two gases are derived at different pressures. It is found that the effects of air and SF{sub 6} breakdown on the transmission of HPM are different: air breakdown mainly shortens the pulse width of HPM while SF{sub 6} breakdown mainly reduces the peak output power of HPM. The electric field threshold of SF{sub 6} is about 2.4 times larger than that of air. These differences suggest that gas properties have a great effect on the transmission characteristic of HPM in gases.

  7. Simulation and dynamics of entropy-driven, molecular self-assembly processes

    SciTech Connect (OSTI)

    Mayer, B.; Kohler, G.,; Rasmussen, S.,

    1997-04-01

    Molecular self-assembly is frequently found to generate higher-order functional structures in biochemical systems. One such example is the self-assembly of lipids in aqueous solution forming membranes, micelles, and vesicles; another is the dynamic formation and rearrangement of the cytoskeleton. These processes are often driven by local, short-range forces and therefore the dynamics is solely based on local interactions. In this paper, we introduce a cellular automata based simulation, the lattice molecular automaton, in which data structures, representing different molecular entities such as water and hydrophilic and hydrophobic monomers, share locally propagated force information on a hexagonal, two-dimensional lattice. The purpose of this level of description is the simulation of entropic and enthalpic flows in a microcanonical, molecular ensemble to gain insight about entropy-driven processes in molecular many-particle systems. Three applications are shown, i.e., modeling structural features of a polar solvent, cluster formation of hydrophobic monomers in a polar environment, and the self-assembly of polymers. Processes leading to phase separation on a molecular level are discussed. A thorough discussion of the computational details, advantages, and limitations of the lattice molecular automaton approach is given elsewhere [B. Mayer and S. Rasmussen (unpublished)]. {copyright} {ital 1997} {ital The American Physical Society}

  8. THE PROPAGATION OF NEUTRINO-DRIVEN JETS IN WOLF-RAYET STARS

    SciTech Connect (OSTI)

    Nagakura, Hiroki; Advanced Research Institute for Science and Engineering, Waseda University, 3-4-1 Okubo, Shinjuku, Tokyo 169-8555

    2013-02-20

    We numerically investigate the jet propagation through a rotating collapsing Wolf-Rayet star with detailed central engine physics constructed based on the neutrino-driven collapsar model. The collapsing star determines the evolution of the mass accretion rate, black hole mass, and spin, all of which are important ingredients for determining the jet luminosity. We reveal that neutrino-driven jets in rapidly spinning Wolf-Rayet stars are capable of breaking out from the stellar envelope, while those propagating in slower rotating progenitors fail to break out due to insufficient kinetic power. For progenitor models with successful jet breakouts, the kinetic energy accumulated in the cocoon could be as large as {approx}10{sup 51} erg and might significantly contribute to the luminosity of the afterglow emission or to the kinetic energy of the accompanying supernova if nickel production takes place. We further analyze the post-breakout phase using a simple analytical prescription and conclude that the relativistic jet component could produce events with an isotropic luminosity L {sub p(iso)} {approx} 10{sup 52} erg s{sup -1} and isotropic energy E {sub j(iso)} {approx} 10{sup 54} erg. Our findings support the idea of rapidly rotating Wolf-Rayet stars as plausible progenitors of GRBs, while slowly rotational ones could be responsible for low-luminosity or failed GRBs.

  9. An Application of Multivariate Statistical Analysis for Query-Driven Visualization

    SciTech Connect (OSTI)

    Gosink, Luke J.; Garth, Christoph; Anderson, John C.; Bethel, E. Wes; Joy, Kenneth I.

    2010-03-01

    Abstract?Driven by the ability to generate ever-larger, increasingly complex data, there is an urgent need in the scientific community for scalable analysis methods that can rapidly identify salient trends in scientific data. Query-Driven Visualization (QDV) strategies are among the small subset of techniques that can address both large and highly complex datasets. This paper extends the utility of QDV strategies with a statistics-based framework that integrates non-parametric distribution estimation techniques with a new segmentation strategy to visually identify statistically significant trends and features within the solution space of a query. In this framework, query distribution estimates help users to interactively explore their query's solution and visually identify the regions where the combined behavior of constrained variables is most important, statistically, to their inquiry. Our new segmentation strategy extends the distribution estimation analysis by visually conveying the individual importance of each variable to these regions of high statistical significance. We demonstrate the analysis benefits these two strategies provide and show how they may be used to facilitate the refinement of constraints over variables expressed in a user's query. We apply our method to datasets from two different scientific domains to demonstrate its broad applicability.

  10. Microwave Ion Source and Beam Injection for an Accelerator-drivenNeutron Source

    SciTech Connect (OSTI)

    Vainionpaa, J.H.; Gough, R.; Hoff, M.; Kwan, J.W.; Ludewigt,B.A.; Regis, M.J.; Wallig, J.G.; Wells, R.

    2007-02-15

    An over-dense microwave driven ion source capable ofproducing deuterium (or hydrogen) beams at 100-200 mA/cm2 and with atomicfraction>90 percent was designed and tested with an electrostaticlow energy beam transport section (LEBT). This ion source wasincorporatedinto the design of an Accelerator Driven Neutron Source(ADNS). The other key components in the ADNS include a 6 MeV RFQaccelerator, a beam bending and scanning system, and a deuterium gastarget. In this design a 40 mA D+ beam is produced from a 6 mm diameteraperture using a 60 kV extraction voltage. The LEBT section consists of 5electrodes arranged to form 2 Einzel lenses that focus the beam into theRFQ entrance. To create the ECR condition, 2 induction coils are used tocreate ~; 875 Gauss on axis inside the source chamber. To prevent HVbreakdown in the LEBT a magnetic field clamp is necessary to minimize thefield in this region. Matching of the microwave power from the waveguideto the plasma is done by an autotuner. We observed significantimprovement of the beam quality after installing a boron nitride linerinside the ion source. The measured emittance data are compared withPBGUNS simulations.

  11. Role of magnetic fluctuations in mode selection of magnetically driven instabilities

    SciTech Connect (OSTI)

    Dan, Jia-Kun Ren, Xiao-Dong; Huang, Xian-Bin; Ouyang, Kai; Chen, Guang-Hua

    2014-12-15

    The influences of magnetic fluctuations on quasiperiodic structure formation and fundamental wavelength selection of the instability have been studied using two 25-μm-diameter tungsten wires on a 100  ns rise time, 220 kA pulsed power facility. Two different load configurations were adopted to make end surfaces of electrodes approximately satisfy reflecting and absorbing boundary conditions, respectively. The experimental results that the fundamental wavelength in the case of absorbing boundary condition is about one half of that in the case of reflecting boundary condition have demonstrated that magnetic fluctuations appear to play a key role in mode selection of magnetically driven instabilities. The dominant wavelength should be proportional to magnetic field and inversely proportional to square root of mass density, provided that the magnetosonic wave propagating perpendicular to magnetic fields provides a leading candidate for magnetic fluctuations. Therefore, magnetic fluctuation is one of the three key perturbations, along with surface contaminants and surface roughness, that seeds magnetically driven instabilities.

  12. A laboratory study of asymmetric magnetic reconnection in strongly-driven plasmas

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Rosenberg, M. J.; Li, C. K.; Fox, W.; Igumenshchev, I.; Seguin, F. H.; Town, R.P. J.; Frenje, J. A.; Stoeckl, C.; Glebov, V.; Petrasso, R. D.

    2015-02-04

    Magnetic reconnection, the annihilation and rearrangement of magnetic fields in a plasma, is a universal phenomenon that frequently occurs when plasmas carrying oppositely-directed field lines collide. In most natural circumstances the collision is asymmetric (the two plasmas having different properties), but laboratory research to date has been limited to symmetric configurations. Additionally, the regime of strongly-driven magnetic reconnection, where the ram pressure of the plasma dominates the magnetic pressure, as in several astrophysical environments, has also received little experimental attention. Thus, we have designed experiments to probe reconnection in asymmetric, strongly-driven, laser-generated plasmas. Here we show that, in this strongly-drivenmore » system, the rate of magnetic flux annihilation is dictated by the relative flow velocities of the opposing plasmas and is insensitive to initial asymmetries. Additionally, out-of-plane magnetic fields that arise from asymmetries in the three-dimensional plasma geometry have minimal impact on the reconnection rate, due to the strong flows.« less

  13. Data-driven integration of genome-scale regulatory and metabolic network

    SciTech Connect (OSTI)

    Imam, S; Schauble, S; Brooks, AN; Baliga, NS; Price, ND

    2015-05-05

    Microbes are diverse and extremely versatile organisms that play vital roles in all ecological niches. Understanding and harnessing microbial systems will be key to the sustainability of our planet. One approach to improving our knowledge of microbial processes is through data-driven and mechanism-informed computational modeling. Individual models of biological networks (such as metabolism, transcription, and signaling) have played pivotal roles in driving microbial research through the years. These networks, however, are highly interconnected and function in concert a fact that has led to the development of a variety of approaches aimed at simulating the integrated functions of two or more network types. Though the task of integrating these different models is fraught with new challenges, the large amounts of high-throughput data sets being generated, and algorithms being developed, means that the time is at hand for concerted efforts to build integrated regulatory-metabolic networks in a data-driven fashion. In this perspective, we review current approaches for constructing integrated regulatory-metabolic models and outline new strategies for future development of these network models for any microbial system.

  14. Spatial Heterogeneity and Imperfect Mixing in Chemical Reactions: Visualization of Density-Driven Pattern Formation

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Sobel, Sabrina G.; Hastings, Harold M.; Testa, Matthew

    2009-01-01

    Imore » mperfect mixing is a concern in industrial processes, everyday processes (mixing paint, bread machines), and in understanding salt water-fresh water mixing in ecosystems. The effects of imperfect mixing become evident in the unstirred ferroin-catalyzed Belousov-Zhabotinsky reaction, the prototype for chemical pattern formation. Over time, waves of oxidation (high ferriin concentration, blue) propagate into a background of low ferriin concentration (red); their structure reflects in part the history of mixing in the reaction vessel. However, it may be difficult to separate mixing effects from reaction effects. We describe a simpler model system for visualizing density-driven pattern formation in an essentially unmixed chemical system: the reaction of pale yellow Fe 3 + with colorless SCN − to form the blood-red Fe ( SCN ) 2 + complex ion in aqueous solution. Careful addition of one drop of Fe ( NO 3 ) 3 to KSCN yields striped patterns after several minutes. The patterns appear reminiscent of Rayleigh-Taylor instabilities and convection rolls, arguing that pattern formation is caused by density-driven mixing.« less

  15. Cathode fall model and current-voltage characteristics of field emission driven direct current microplasmas

    SciTech Connect (OSTI)

    Venkattraman, Ayyaswamy

    2013-11-15

    The post-breakdown characteristics of field emission driven microplasma are studied theoretically and numerically. A cathode fall model assuming a linearly varying electric field is used to obtain equations governing the operation of steady state field emission driven microplasmas. The results obtained from the model by solving these equations are compared with particle-in-cell with Monte Carlo collisions simulation results for parameters including the plasma potential, cathode fall thickness, ion number density in the cathode fall, and current density vs voltage curves. The model shows good overall agreement with the simulations but results in slightly overpredicted values for the plasma potential and the cathode fall thickness attributed to the assumed electric field profile. The current density vs voltage curves obtained show an arc region characterized by negative slope as well as an abnormal glow discharge characterized by a positive slope in gaps as small as 10 ?m operating at atmospheric pressure. The model also retrieves the traditional macroscale current vs voltage theory in the absence of field emission.

  16. Dynamically balanced, hydraulically driven compressor/pump apparatus for resonant free piston Stirling engines

    DOE Patents [OSTI]

    Corey, John A.

    1984-05-29

    A compressor, pump, or alternator apparatus is designed for use with a resonant free piston Stirling engine so as to isolate apparatus fluid from the periodically pressurized working fluid of the Stirling engine. The apparatus housing has a first side closed by a power coupling flexible diaphragm (the engine working member) and a second side closed by a flexible diaphragm gas spring. A reciprocally movable piston is disposed in a transverse cylinder in the housing and moves substantially at right angles relative to the flexible diaphragms. An incompressible fluid fills the housing which is divided into two separate chambers by suitable ports. One chamber provides fluid coupling between the power diaphragm of the RFPSE and the piston and the second chamber provides fluid coupling between the gas spring diaphragm and the opposite side of the piston. The working members of a gas compressor, pump, or alternator are driven by the piston. Sealing and wearing parts of the apparatus are mounted at the external ends of the transverse cylinder in a double acting arrangement for accessibility. An annular counterweight is mounted externally of the reciprocally movable piston and is driven by incompressible fluid coupling in a direction opposite to the piston so as to damp out transverse vibrations.

  17. Misfit strain driven cation inter-diffusion across an epitaxial multiferroic thin film interface

    SciTech Connect (OSTI)

    Sankara Rama Krishnan, P. S.; Munroe, Paul; Nagarajan, V.; Morozovska, Anna N.; Eliseev, Eugene A.; Ramasse, Quentin M.; Kepaptsoglou, Demie; Liang, Wen-I.; Chu, Ying-Hao

    2014-02-07

    Cation intermixing at functional oxide interfaces remains a highly controversial area directly relevant to interface-driven nanoelectronic device properties. Here, we systematically explore the cation intermixing in epitaxial (001) oriented multiferroic bismuth ferrite (BFO) grown on a (001) lanthanum aluminate (LAO) substrate. Aberration corrected dedicated scanning transmission electron microscopy and electron energy loss spectroscopy reveal that the interface is not chemically sharp, but with an intermixing of ?2?nm. The driving force for this process is identified as misfit-driven elastic strain. Landau-Ginzburg-Devonshire-based phenomenological theory was combined with the Sheldon and Shenoy formula in order to understand the influence of boundary conditions and depolarizing fields arising from misfit strain between the LAO substrate and BFO film. The theory predicts the presence of a strong potential gradient at the interface, which decays on moving into the bulk of the film. This potential gradient is significant enough to drive the cation migration across the interface, thereby mitigating the misfit strain. Our results offer new insights on how chemical roughening at oxide interfaces can be effective in stabilizing the structural integrity of the interface without the need for misfit dislocations. These findings offer a general formalism for understanding cation intermixing at highly strained oxide interfaces that are used in nanoelectronic devices.

  18. Revisiting impacts of nuclear burning for reviving weak shocks in neutrino-driven supernovae

    SciTech Connect (OSTI)

    Nakamura, Ko; Kotake, Kei; Takiwaki, Tomoya; Nishimura, Nobuya

    2014-02-20

    We revisit potential impacts of nuclear burning on the onset of the neutrino-driven explosions of core-collapse supernovae. By changing the neutrino luminosity and its decay time to obtain parametric explosions in one- and two-dimensional (1D and 2D, respectively) models with or without a 13 isotope ? network, we study how the inclusion of nuclear burning could affect the postbounce dynamics for 4 progenitor models; 3 for 15.0 M {sub ?} stars and 1 for an 11.2 M {sub ?} star. We find that the energy supply due to the nuclear burning of infalling material behind the shock can energize the shock expansion, especially for models that produce only marginal explosions in the absence of nuclear burning. These models are energized by nuclear energy deposition when the shock front passes through the silicon-rich layer and/or later as it touches the oxygen-rich layer. Depending on the neutrino luminosity and its decay time, the diagnostic energy of the explosion increases up to a few times 10{sup 50} erg for models with nuclear burning compared to the corresponding models without. We point out that these features are most remarkable for the Limongi-Chieffi progenitor in both 1D and 2D because the progenitor model possesses a massive oxygen layer, with an inner-edge radius that is smallest among the employed progenitors, which means that the shock can touch the rich fuel on a shorter timescale after bounce. The energy difference is generally smaller (?0.1-0.2 10{sup 51} erg) in 2D than in 1D (at most ?0.6 10{sup 51} erg). This is because neutrino-driven convection and the shock instability in 2D models enhance the neutrino heating efficiency, which makes the contribution of nuclear burning relatively smaller compared to 1D models. Considering uncertainties in progenitor models, our results indicate that nuclear burning should remain one of the important ingredients to foster the onset of neutrino-driven explosions.

  19. Plasma turbulence driven by transversely large-scale standing shear Alfven waves

    SciTech Connect (OSTI)

    Singh, Nagendra; Rao, Sathyanarayan

    2012-12-15

    Using two-dimensional particle-in-cell simulations, we study generation of turbulence consisting of transversely small-scale dispersive Alfven and electrostatic waves when plasma is driven by a large-scale standing shear Alfven wave (LS-SAW). The standing wave is set up by reflecting a propagating LS-SAW. The ponderomotive force of the standing wave generates transversely large-scale density modifications consisting of density cavities and enhancements. The drifts of the charged particles driven by the ponderomotive force and those directly caused by the fields of the standing LS-SAW generate non-thermal features in the plasma. Parametric instabilities driven by the inherent plasma nonlinearities associated with the LS-SAW in combination with the non-thermal features generate small-scale electromagnetic and electrostatic waves, yielding a broad frequency spectrum ranging from below the source frequency of the LS-SAW to ion cyclotron and lower hybrid frequencies and beyond. The power spectrum of the turbulence has peaks at distinct perpendicular wave numbers (k{sub Up-Tack }) lying in the range d{sub e}{sup -1}-6d{sub e}{sup -1}, d{sub e} being the electron inertial length, suggesting non-local parametric decay from small to large k{sub Up-Tack }. The turbulence spectrum encompassing both electromagnetic and electrostatic fluctuations is also broadband in parallel wave number (k{sub ||}). In a standing-wave supported density cavity, the ratio of the perpendicular electric to magnetic field amplitude is R(k{sub Up-Tack }) = |E{sub Up-Tack }(k{sub Up-Tack })/|B{sub Up-Tack }(k{sub Up-Tack })| Much-Less-Than V{sub A} for k{sub Up-Tack }d{sub e} < 0.5, where V{sub A} is the Alfven velocity. The characteristic features of the broadband plasma turbulence are compared with those available from satellite observations in space plasmas.

  20. Uniform heating of materials into the warm dense matter regime with laser-driven quasimonoenergetic ion beams

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Bang, W.; Albright, B. J.; Bradley, P. A.; Vold, E. L.; Boettger, J. C.; Fernández, J. C.

    2015-12-01

    In a recent experiment at the Trident laser facility, a laser-driven beam of quasimonoenergetic aluminum ions was used to heat solid gold and diamond foils isochorically to 5.5 and 1.7 eV, respectively. Here theoretical calculations are presented that suggest the gold and diamond were heated uniformly by these laser-driven ion beams. According to calculations and SESAME equation-of-state tables, laser-driven aluminum ion beams achievable at Trident, with a finite energy spread of ΔE/E~20%, are expected to heat the targets more uniformly than a beam of 140-MeV aluminum ions with zero energy spread. As a result, the robustness of the expected heatingmore » uniformity relative to the changes in the incident ion energy spectra is evaluated, and expected plasma temperatures of various target materials achievable with the current experimental platform are presented.« less

  1. Assessment and economic analysis of the MOD III Stirling-engine driven chiller system. Final report, October 1989-July 1990

    SciTech Connect (OSTI)

    Moryl, J.

    1990-07-01

    The Stirling engine is an inherently clean and efficient engine. With the requirements for environmentally benign emissions and high energy efficiency, the Stirling engine is an attractive alternative to both internal combustion (IC) engines and electric motors. The study evaluated a Stirling-engine-driven chiller package. Technically, the Stirling engine is a good selection as a compressor drive, with inherently low vibrations, quiet operation, long life, and low maintenance. Exhaust emissions are below the projected 1995 stringent California standards. Economically, the Stirling-engine-driven chiller is a viable alternative to both IV-engine and electric-driven chillers, trading off slightly higher installed cost against lower total operating expenses. The penetration of a small portion of the projected near-term stationary engine market opportunity will provide the volume production basis to achieve competitively priced engines.

  2. Uniform heating of materials into the warm dense matter regime with laser-driven quasimonoenergetic ion beams

    SciTech Connect (OSTI)

    Bang, W.; Albright, B. J.; Bradley, P. A.; Vold, E. L.; Boettger, J. C.; Fernández, J. C.

    2015-12-01

    In a recent experiment at the Trident laser facility, a laser-driven beam of quasimonoenergetic aluminum ions was used to heat solid gold and diamond foils isochorically to 5.5 and 1.7 eV, respectively. Here theoretical calculations are presented that suggest the gold and diamond were heated uniformly by these laser-driven ion beams. According to calculations and SESAME equation-of-state tables, laser-driven aluminum ion beams achievable at Trident, with a finite energy spread of ΔE/E~20%, are expected to heat the targets more uniformly than a beam of 140-MeV aluminum ions with zero energy spread. As a result, the robustness of the expected heating uniformity relative to the changes in the incident ion energy spectra is evaluated, and expected plasma temperatures of various target materials achievable with the current experimental platform are presented.

  3. Natural Gas Weekly Update, Printer-Friendly Version

    Gasoline and Diesel Fuel Update (EIA)

    *Avg. of NGI's reported avg. prices for: Malin, PG&E citygate, and Southern California Border Avg. Source: NGI's Daily Gas Price Index (http:intelligencepress.com). At the NYMEX,...

  4. Slide 1

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Wtd. Avg. Int. 7.4% Bureau of Reclamation Appropriations 510 Wtd. Avg. Int. 7.1% Power Marketing Transmission Bonds Issued to Treasury 1,854 Wtd. Avg. Int. 7.3% Bureau of...

  5. Slide 1

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    System Supply 6,560 Wtd. Avg. Int. 6.2% Bonds Issued to Treasury 796 Wtd. Avg. Int. 6.8% Bureau of Reclamation Appropriations 565 Wtd. Avg. Int. 7.1% Power Marketing...

  6. Filamentation instability of nonextensive current-driven plasma in the ion acoustic frequency range

    SciTech Connect (OSTI)

    Khorashadizadeh, S. M. Rastbood, E.; Niknam, A. R.

    2014-12-15

    The filamentation and ion acoustic instabilities of nonextensive current-driven plasma in the ion acoustic frequency range have been studied using the Lorentz transformation formulas. Based on the kinetic theory, the possibility of filamentation instability and its growth rate as well as the ion acoustic instability have been investigated. The results of the research show that the possibility and growth rate of these instabilities are significantly dependent on the electron nonextensive parameter and drift velocity. Besides, the increase of electrons nonextensive parameter and drift velocity lead to the increase of the growth rates of both instabilities. In addition, the wavelength region in which the filamentation instability occurs is more stretched in the presence of higher values of drift velocity and nonextensive parameter. Finally, the results of filamentation and ion acoustic instabilities have been compared and the conditions for filamentation instability to be dominant mode of instability have been presented.

  7. Ways to improve the efficiency and reliability of radio frequency driven negative ion sources for fusion

    SciTech Connect (OSTI)

    Kraus, W.; Briefi, S.; Fantz, U.; AG Experimentelle Plasmaphysik, Universitt Augsburg, 86135 Augsburg ; Gutmann, P.; Doerfler, J.

    2014-02-15

    Large RF driven negative hydrogen ion sources are being developed at IPP Garching for the future neutral beam injection system of ITER. The overall power efficiency of these sources is low, because for the RF power supply self-excited generators are utilized and the plasma is generated in small cylindrical sources (drivers) and expands into the source main volume. At IPP experiments to reduce the primary power and the RF power required for the plasma production are performed in two ways: The oscillator generator of the prototype source has been replaced by a transistorized RF transmitter and two alternative driver concepts, a spiral coil, in which the field is concentrated by ferrites, which omits the losses by plasma expansion and a helicon source are being tested.

  8. Critical Phenomena in Driven Granular Matter: Jamming and Glassy Behavior - Final Report

    SciTech Connect (OSTI)

    Teitel, Stephen

    2013-02-20

    Granular materials, such as powders, seeds, grains, sand, rocks, etc., are ubiquitous both in nature and in industrial processes. At the scale of individual grains, granular systems are particularly simple: particles interact only when they touch. But when viewed in the aggregate, granular systems can display complex behavior. In particular, as the volume packing fraction of the grains increases, the system undergoes a jamming transition from a flowing liquid to a disordered but rigid solid. We study the critical behavior of such systems near the jamming transition using numerical simulations of a simple model of soft-core, bidisperse, frictionless disks in two dimensions. We seek to understand the structural and transport properties of such systems under a variety of physical perturbations such as steady state shear driven flow, and finite thermal fluctuations.

  9. Efficient quasi-monoenergetic ion beams from laser-driven relativistic plasmas

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Palaniyappan, Sasi; Huang, Chengkun; Gautier, Donald C.; Hamilton, Christopher E.; Santiago, Miguel A.; Kreuzer, Christian; Sefkow, Adam B.; Shah, Rahul C.; Fernández, Juan C.

    2015-12-11

    Table-top laser–plasma ion accelerators have many exciting applications, many of which require ion beams with simultaneous narrow energy spread and high conversion efficiency. However, achieving these requirements has been elusive. We report the experimental demonstration of laser-driven ion beams with narrow energy spread and energies up to 18 MeV per nucleon and ~5% conversion efficiency (that is 4 J out of 80-J laser). Using computer simulations we identify a self-organizing scheme that reduces the ion energy spread after the laser exits the plasma through persisting self-generated plasma electric (~1012 V m-1) and magnetic (~104 T) fields. Furthermore, these results contributemore » to the development of next generation compact accelerators suitable for many applications such as isochoric heating for ion-fast ignition and producing warm dense matter for basic science.« less

  10. Accelerating the Customer-Driven Microgrid Through Real-Time Digital Simulation

    SciTech Connect (OSTI)

    I. Leonard; T. Baldwin; M. Sloderbeck

    2009-07-01

    Comprehensive design and testing of realistic customer-driven microgrids requires a high performance simulation platform capable of incorporating power system and control models with external hardware systems. Traditional non real-time simulation is unable to fully capture the level of detail necessary to expose real-world implementation issues. With a real-time digital simulator as its foundation, a high-fidelity simulation environment that includes a robust electrical power system model, advanced control architecture, and a highly adaptable communication network is introduced. Hardware-in-the-loop implementation approaches for the hardware-based control and communication systems are included. An overview of the existing power system model and its suitability for investigation of autonomous island formation within the microgrid is additionally presented. Further test plans are also documented.

  11. Report on the 1. Techno Rally of small model cars driven by Stirling engines

    SciTech Connect (OSTI)

    Isshiki, N.; Hirata, M.; Fujii, I.; Masuno, M.

    1998-07-01

    The first speed contest of model cars driven by hand made Stirling engines was held in summer of 1997 in Tokyo under the name of The First Stirling Techno Rally sponsored by JSME and others. The body of cars were smaller than 60 cm in length and 30 cm in width to fit the test course and Stirling engines were non-pressurized hot air engine fueled by gas or solid fuel. On the race day, 103 cars were gathered from high schools, universities and companies, and the contest was successful1 in both technical and educational purposes. The top speed record was 4.25 second for 13 m run. In this paper the details of this contest are reported. The second techno rally will be held in November, 1998 at Honda's sub car test course.

  12. A magnetically coupled Stirling engine driven heat pump: Design optimization and operating cost analysis

    SciTech Connect (OSTI)

    Vincent, R.J.; Waldron, W.D.

    1990-01-01

    A preliminary design for a 2nd generation, gas-fired free-piston Stirling engine driven heat pump has been developed which incorporates a linear magnetic coupling to drive the refrigerant compressor piston. The Mark 2 machine is intended for the residential heat pump market and has 3 Ton cooling capacity. The new heat pump is an evolutionary design based on the Mark 1 free-piston machine which was successfully developed and independently tested by a major heat pump/air conditioning manufacturer. This paper briefly describes test results that were obtained with the Mark 1 machine and then presents the design and operating cost analysis for the Mark 2 heat pump. Operating costs by month are given for both Chicago and Atlanta. A summary of the manufacturing cost estimates obtained from Pioneer Engineering and Manufacturing Company (PEM) are also given. 9 figs., 3 tabs.

  13. Merits of Stirling-driven vapor-compression systems and their advanced technologies

    SciTech Connect (OSTI)

    Kagawa, Noboru

    1997-12-31

    Stirling engines have unique advantages including a high thermal efficiency, preferable exhaust gas characteristics, multi-fuel usage, and low noise and vibration. On the other hand, heat pump systems are very attractive because of their potential to save energy and to get applicability for space heating and industrial usage. This paper introduced the recognized merits of efficient and environmental-friendly Stirling-driven vapor-compression (SDVC) systems. The differences between SDVC systems and conventional systems were discussed from the aspects of the performance and operating cost. The results show SDVC systems have many advantages. This paper also mentioned about the future R and D which will be required to realize more attractive SDVC system including the initial cost issues and several advance technologies for SDVC. The Lorenz cycle and flash gas removal technologies for heat pump cycle were introduced as the advanced SDVC technologies.

  14. Efficient quasi-monoenergetic ion beams from laser-driven relativistic plasmas

    SciTech Connect (OSTI)

    Palaniyappan, Sasi; Huang, Chengkun; Gautier, Donald C.; Hamilton, Christopher E.; Santiago, Miguel A.; Kreuzer, Christian; Sefkow, Adam B.; Shah, Rahul C.; Fernández, Juan C.

    2015-12-11

    Table-top laser–plasma ion accelerators have many exciting applications, many of which require ion beams with simultaneous narrow energy spread and high conversion efficiency. However, achieving these requirements has been elusive. We report the experimental demonstration of laser-driven ion beams with narrow energy spread and energies up to 18 MeV per nucleon and ~5% conversion efficiency (that is 4 J out of 80-J laser). Using computer simulations we identify a self-organizing scheme that reduces the ion energy spread after the laser exits the plasma through persisting self-generated plasma electric (~1012 V m-1) and magnetic (~104 T) fields. Furthermore, these results contribute to the development of next generation compact accelerators suitable for many applications such as isochoric heating for ion-fast ignition and producing warm dense matter for basic science.

  15. Demonstartion of density dependence of x-ray flux in a laser-driven hohlraum

    SciTech Connect (OSTI)

    Young, P E; Rosen, M D; Hammer, J H; Hsing, W S; Glendinning, S G; Turner, R E; Kirkwood, R; Schein, J; Sorce, C; Satcher, J; Hamza, A; Reibold, R A; Hibbard, R; Landen, O; Reighard, A; McAlpin, S; Stevenson, M; Thomas, B

    2008-02-11

    Experiments have been conducted using laser-driven cylindrical hohlraums whose walls are machined from Ta{sub 2}O{sub 5} foams of 100 mg/cc and 4 g/cc densities. Measurements of the radiation temperature demonstrate that the lower density walls produce higher radiation temperatures than the high density walls. This is the first experimental demonstration of the prediction that this would occur [M. D. Rosen and J. H. Hammer, Phys. Rev. E 72, 056403 (2005)]. For high density walls, the radiation front propagates subsonically, and part of the absorbed energy is wasted by the flow kinetic energy. For the lower wall density, the front velocity is supersonic and can devote almost all of the absorbed energy to heating the wall.

  16. Finite ballooning angle effects on ion temperature gradient driven mode in gyrokinetic flux tube simulations

    SciTech Connect (OSTI)

    Singh, Rameswar, E-mail: rameswar.singh@lpp.polytechnique.fr [Institute for Plasma Research, Bhat Gandhinagar, Gujarat 2382 428 (India) [Institute for Plasma Research, Bhat Gandhinagar, Gujarat 2382 428 (India); Laboratoire de Physique des Plasmas, Ecole Polytechnique, Route de Saclay, 91128 Palaiseau Cedex (France); Brunner, S. [CRPP, Ecole Polytechnique Federale de Lausanne, CH-1015 Lausanne (Switzerland)] [CRPP, Ecole Polytechnique Federale de Lausanne, CH-1015 Lausanne (Switzerland); Ganesh, R. [Institute for Plasma Research, Bhat Gandhinagar, Gujarat 2382 428 (India)] [Institute for Plasma Research, Bhat Gandhinagar, Gujarat 2382 428 (India); Jenko, F. [Max-Planck-Institut fur Plasmaphysik, EURATOM Association, D-85748 Garching (Germany)] [Max-Planck-Institut fur Plasmaphysik, EURATOM Association, D-85748 Garching (Germany)

    2014-03-15

    This paper presents effects of finite ballooning angles on linear ion temperature gradient (ITG) driven mode and associated heat and momentum flux in Gyrokinetic flux tube simulation GENE. It is found that zero ballooning angle is not always the one at which the linear growth rate is maximum. The ITG mode acquires a short wavelength (SW) branch (k{sub ?}?{sub i}?>?1) when growth rates maximized over all ballooning angles are considered. However, the SW branch disappears on reducing temperature gradient showing characteristics of zero ballooning angle SWITG in case of extremely high temperature gradient. Associated heat flux is even with respect to ballooning angle and maximizes at nonzero ballooning angle while the parallel momentum flux is odd with respect to the ballooning angle.

  17. Ion Thermal Decoupling and Species Separation in Shock-Driven Implosions

    SciTech Connect (OSTI)

    Rinderknecht, Hans G.; Rosenberg, M. J.; Li, C. K.; Hoffman, N. M.; Kagan, G.; Zylstra, A. B.; Sio, H.; Johnson, M. Gatu; Seguin, F. H.; Petrasso, R. D.; Amendt, P.; Bellei, C.; Wilks, S.; Delettrez, J.; Glebov, V. Yu.; Stoeckl, C.; Sangster, T. C.; Meyerhofer, D. D.; Nikroo, A.

    2015-01-14

    Anomalous reduction of the fusion yields by 50% and anomalous scaling of the burn-averaged ion temperatures with the ion-species fraction has been observed for the first time in DHe3-filled shock-driven inertial confinement fusion implosions. Two ion kinetic mechanisms are used to explain the anomalous observations: thermal decoupling of the D and He3 populations and diffusive species separation. The observed insensitivity of ion temperature to a varying deuterium fraction is shown to be a signature of ion thermal decoupling in shock-heated plasmas. The burn-averaged deuterium fraction calculated from the experimental data demonstrates a reduction in the average core deuterium density, as predicted by simulations that use a diffusion model. Accounting for each of these effects in simulations reproduces the observed yield trends.

  18. Proximity-driven enhanced magnetic order at ferromagnetic-insulator-magnetic-topological-insulator interface

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Li, Mingda; Zhu, Yimei; Chang, Cui -Zu; Kirby, B. J.; Jamer, Michelle E.; Cui, Wenping; Wu, Lijun; Wei, Peng; Heiman, Don; Li, Ju; et al

    2015-08-17

    Magnetic exchange driven proximity effect at a magnetic-insulator–topological-insulator (MI-TI) interface provides a rich playground for novel phenomena as well as a way to realize low energy dissipation quantum devices. In this study, we report a dramatic enhancement of proximity exchange coupling in the MI/magnetic-TI EuS/Sb2–xVxTe3 hybrid heterostructure, where V doping is used to drive the TI (Sb2Te3) magnetic. We observe an artificial antiferromagneticlike structure near the MI-TI interface, which may account for the enhanced proximity coupling. The interplay between the proximity effect and doping in a hybrid heterostructure provides insights into the engineering of magnetic ordering.

  19. Device and method to relieve cordelle action in a chain driven pump

    DOE Patents [OSTI]

    Dysarz, Edward D.

    1994-01-01

    A cordelle action relief apparatus or device for use in sucker rod pumps in a petroleum or water well. The device is incorporated in a chain driven pump to prevent the chain from forming a bow or archlike configuration as the chain rolls off of the sprocket and down into the well. When the chain is allowed to form this bow or arch it could damage the well and well casing. The device includes a first rod on the side of the chain and a second rod on the second side of the chain that will allow the rollers of the chain to roll on the rod and further prevent the chain from bowing or arching and will further allow the rollers on the chain to roll on the rods which will further prevent damage to the well casing, the well, and the chain.

  20. Ion Thermal Decoupling and Species Separation in Shock-Driven Implosions

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Rinderknecht, Hans G.; Rosenberg, M. J.; Li, C. K.; Hoffman, N. M.; Kagan, G.; Zylstra, A. B.; Sio, H.; Johnson, M. Gatu; Seguin, F. H.; Petrasso, R. D.; et al

    2015-01-14

    Anomalous reduction of the fusion yields by 50% and anomalous scaling of the burn-averaged ion temperatures with the ion-species fraction has been observed for the first time in DHe3-filled shock-driven inertial confinement fusion implosions. Two ion kinetic mechanisms are used to explain the anomalous observations: thermal decoupling of the D and He3 populations and diffusive species separation. The observed insensitivity of ion temperature to a varying deuterium fraction is shown to be a signature of ion thermal decoupling in shock-heated plasmas. The burn-averaged deuterium fraction calculated from the experimental data demonstrates a reduction in the average core deuterium density, asmore » predicted by simulations that use a diffusion model. Accounting for each of these effects in simulations reproduces the observed yield trends.« less

  1. Precision vector control of a superconducting RF cavity driven by an injection locked magnetron

    SciTech Connect (OSTI)

    Chase, Brian; Pasquinelli, Ralph; Cullerton, Ed; Varghese, Philip

    2015-03-01

    The technique presented in this paper enables the regulation of both radio frequency amplitude and phase in narrow band devices such as a Superconducting RF (SRF) cavity driven by constant power output devices i.e. magnetrons [1]. The ability to use low cost high efficiency magnetrons for accelerator RF power systems, with tight vector regulation, presents a substantial cost savings in both construction and operating costs - compared to current RF power system technology. An operating CW system at 2.45 GHz has been experimentally developed. Vector control of an injection locked magnetron has been extensively tested and characterized with a SRF cavity as the load. Amplitude dynamic range of 30 dB, amplitude stability of 0.3% r.m.s, and phase stability of 0.26 degrees r.m.s. has been demonstrated.

  2. Quantum interference and sub-Poissonian statistics for time-modulated driven dissipative nonlinear oscillators

    SciTech Connect (OSTI)

    Gevorgyan, T. V. [Institute for Physical Research, National Academy of Sciences, Ashtarak-2, 0203 Ashtarak (Armenia); Shahinyan, A. R. [Yerevan State University, A. Manoogian 1, 0025 Yerevan (Armenia); Kryuchkyan, G. Yu. [Institute for Physical Research, National Academy of Sciences, Ashtarak-2, 0203 Ashtarak (Armenia); Yerevan State University, A. Manoogian 1, 0025 Yerevan (Armenia)

    2009-05-15

    We show that quantum-interference phenomena can be realized for the dissipative nonlinear systems exhibiting hysteresis-cycle behavior and quantum chaos. Such results are obtained for a driven dissipative nonlinear oscillator with time-dependent parameters and take place for the regimes of long time intervals exceeding dissipation time and for macroscopic levels of oscillatory excitation numbers. Two schemas of time modulation, (i) periodic variation in the strength of the {chi}(3) nonlinearity; (ii) periodic modulation of the amplitude of the driving force, are considered. These effects are obtained within the framework of phase-space quantum distributions. It is demonstrated that the Wigner functions of oscillatory mode in both bistable and chaotic regimes acquire negative values and interference patterns in parts of phase-space due to appropriately time modulation of the oscillatory nonlinear dynamics. It is also shown that the time modulation of the oscillatory parameters essentially improves the degree of sub-Poissonian statistics of excitation numbers.

  3. Enhanced Component Performance Study: Turbine-Driven Pumps 1998–2012

    SciTech Connect (OSTI)

    T. E. Wierman

    2013-10-01

    This report presents an enhanced performance evaluation of turbine-driven pumps (TDPs) at U.S. commercial nuclear power plants. The data used in this study are based on the operating experience failure reports from fiscal year 1998 through 2012 for the component reliability as reported in the Equipment Performance and Information Exchange (EPIX). The TDP failure modes considered are failure to start, failure to run less than or equal to 1 hour, failure to run more than 1 hour, and (for normally running systems) failure to run. The component reliability estimates and the reliability data are trended for the most recent 10-year period while yearly estimates for reliability are provided for the entire active period. No statistically significant increasing trends were identified in the TDP results. Statistically significant decreasing trends were identified for TDP run hours per reactor critical year and start demands.

  4. Nonlinear dynamics of three-magnon process driven by ferromagnetic resonance in yttrium iron garnet

    SciTech Connect (OSTI)

    Cunha, R. O.; Holanda, J.; Azevedo, A.; Rezende, S. M.; Vilela-Leo, L. H.; Rodrguez-Surez, R. L.

    2015-05-11

    We report an investigation of the dynamics of the three-magnon splitting process associated with the ferromagnetic resonance (FMR) in films of the insulating ferrimagnet yttrium iron garnet (YIG). The experiments are performed with a 6??m thick YIG film close to a microstrip line fed by a microwave generator operating in the 26?GHz range. The magnetization precession is driven by the microwave rf magnetic field perpendicular to the static magnetic field, and its dynamics is observed by monitoring the amplitude of the FMR absorption peak. The time evolution of the amplitude reveals that if the frequency is lowered below a critical value of 3.3?GHz, the FMR mode pumps two magnons with opposite wave vectors that react back on the FMR, resulting in a nonlinear dynamics of the magnetization. The results are explained by a model with coupled nonlinear equations describing the time evolution of the magnon modes.

  5. Development of a gas engine-driven chiller. Annual report, January 1988-November 1988

    SciTech Connect (OSTI)

    Koplow, M.; Morgan, J.

    1989-10-01

    The report covers the third and final year of activity in a program to develop a natural gas engine-driven chiller with a nominal capacity of 150 tons. During the period covered by the report the field testing of six chillers continued, and a seventh and the final field test chiller was installed and started (April 1988). Field test hours for the period totalled 17,299, bringing the total field test hours to 24,247. The reliability and serviceability of the chiller have met expectations and have proven to be within the bounds of acceptability for this type of equipment. A ton-hour weighted coefficient of performance of 1.26 was obtained for the year.

  6. Full counting statistics of energy fluctuations in a driven quantum resonator

    SciTech Connect (OSTI)

    Clerk, A. A.

    2011-10-15

    We consider the statistics of time-integrated energy fluctuations of a driven bosonic single-mode resonator, as measured by a quantum nondemolition (QND) detector, using the standard Keldysh prescription to define higher moments. We find that, due to an effective cascading of fluctuations, these statistics are surprisingly nonclassical: the low-temperature, quantum probability distribution is not equivalent to the high-temperature classical distribution evaluated at some effective temperature. Moreover, for a sufficiently large drive detuning and low temperatures, the Keldysh-ordered quasiprobability distribution characterizing these fluctuations fails to be positive-definite; this is similar to the full counting statistics of charge in superconducting systems. We argue that this indicates a kind of nonclassical behavior akin to that tested by Leggett-Garg inequalities.

  7. Attosecond Thomson-scattering x-ray source driven by laser-based electron acceleration

    SciTech Connect (OSTI)

    Luo, W.; College of Science, National University of Defense Technology, Changsha 410073 ; Zhuo, H. B.; Yu, T. P.; Ma, Y. Y.; Applied Ion Beam Physics Laboratory, Institute of Modern Physics, Fudan University, Shanghai 200433 ; Song, Y. M.; Zhu, Z. C.; Yu, M. Y.; Theoretical Physics I, Ruhr University, D-44801 Bochum

    2013-10-21

    The possibility of producing attosecond x-rays through Thomson scattering of laser light off laser-driven relativistic electron beams is investigated. For a ≤200-as, tens-MeV electron bunch produced with laser ponderomotive-force acceleration in a plasma wire, exceeding 10{sup 6} photons/s in the form of ∼160 as pulses in the range of 3–300 keV are predicted, with a peak brightness of ≥5 × 10{sup 20} photons/(s mm{sup 2} mrad{sup 2} 0.1% bandwidth). Our study suggests that the physical scheme discussed in this work can be used for an ultrafast (attosecond) x-ray source, which is the most beneficial for time-resolved atomic physics, dubbed “attosecond physics.”.

  8. DOE High Performance Computing Operational Review (HPCOR): Enabling Data-Driven Scientific Discovery at HPC Facilities

    SciTech Connect (OSTI)

    Gerber, Richard; Allcock, William; Beggio, Chris; Campbell, Stuart; Cherry, Andrew; Cholia, Shreyas; Dart, Eli; England, Clay; Fahey, Tim; Foertter, Fernanda; Goldstone, Robin; Hick, Jason; Karelitz, David; Kelly, Kaki; Monroe, Laura; Prabhat,; Skinner, David; White, Julia

    2014-10-17

    U.S. Department of Energy (DOE) High Performance Computing (HPC) facilities are on the verge of a paradigm shift in the way they deliver systems and services to science and engineering teams. Research projects are producing a wide variety of data at unprecedented scale and level of complexity, with community-specific services that are part of the data collection and analysis workflow. On June 18-19, 2014 representatives from six DOE HPC centers met in Oakland, CA at the DOE High Performance Operational Review (HPCOR) to discuss how they can best provide facilities and services to enable large-scale data-driven scientific discovery at the DOE national laboratories. The report contains findings from that review.

  9. Negative hydrogen ion beam extraction from an AC heated cathode driven Bernas-type ion source

    SciTech Connect (OSTI)

    Okano, Y.; Miyamoto, N.; Kasuya, T.; Wada, M.

    2015-04-08

    A plasma grid structure was installed to a Bernas-type ion source used for ion implantation equipment. A negative hydrogen (H{sup −}) ion beam was extracted by an AC driven ion source by adjusting the bias to the plasma grid. The extracted electron current was reduced by positively biasing the plasma grid, while an optimum plasma grid bias voltage for negative ion beam extraction was found to be positive 3 V with respect to the arc chamber. Source operations with AC cathode heating show extraction characteristics almost identical to that with DC cathode heating, except a minute increase in H{sup −} current at higher frequency of cathode heating current.

  10. Science-Driven Candidate Search for New Scintillator Materials FY 2013 Annual Report

    SciTech Connect (OSTI)

    Gao, Fei; Kerisit, Sebastien N.; Xie, YuLong; Wu, Dangxin; Prange, Micah P.; Van Ginhoven, Renee M.; Campbell, Luke W.; Wang, Zhiguo

    2013-10-01

    This annual report presents work carried out during Fiscal Year (FY) 2013 at Pacific Northwest National Laboratory (PNNL) under the project entitled “Science-Driven Candidate Search for New Scintillator Materials” (Project number: PL13-SciDriScintMat-PD05) and led by Dr. Fei Gao. This project is divided into three tasks, namely (1) Ab initio calculations of electronic properties, electronic response functions and secondary particle spectra; (2) Intrinsic response properties, theoretical light yield, and microscopic description of ionization tracks; and (3) Kinetics and efficiency of scintillation: nonlinearity, intrinsic energy resolution, and pulse shape discrimination. Detailed information on the findings and insights obtained in each of these three tasks are provided in this report. Additionally, papers published this fiscal year or currently in review are included in Appendix together with presentations given this fiscal year.

  11. Ion Thermal Decoupling and Species Separation in Shock-Driven Implosions

    SciTech Connect (OSTI)

    Rinderknecht, Hans G.; Rosenberg, M. J.; Li, C. K.; Hoffman, N. M.; Kagan, G.; Zylstra, A. B.; Sio, H.; Frenje, J. A,; Gatu Johnson, M.; Seguin, F. H.; Petrasso, R. D.; Amendt, P.; Bellei, C.; Wilks, S.; Delettrez, J.; Glebov, V. Yu.; Stoeckl, C.; Sangster, T. C.; Meyerhofer, D. D.; Nikroo, A.

    2015-01-01

    Anomalous reduction of the fusion yields by 50% and anomalous scaling of the burn-averaged ion temperatures with the ion-species fraction has been observed for the first time in DHe3-filled shock-driven inertial confinement fusion implosions. Two ion kinetic mechanisms are used to explain the anomalous observations: thermal decoupling of the D and He3 populations and diffusive species separation. The observed insensitivity of ion temperature to a varying deuterium fraction is shown to be a signature of ion thermal decoupling in shock-heated plasmas. The burn-averaged deuterium fraction calculated from the experimental data demonstrates a reduction in the average core deuterium density, as predicted by simulations that use a diffusion model. Accounting for each of these effects in simulations reproduces the observed yield trends.

  12. Proximity-driven enhanced magnetic order at ferromagnetic-insulator-magnetic-topological-insulator interface

    SciTech Connect (OSTI)

    Li, Mingda; Zhu, Yimei; Chang, Cui -Zu; Kirby, B. J.; Jamer, Michelle E.; Cui, Wenping; Wu, Lijun; Wei, Peng; Heiman, Don; Li, Ju; Moodera, Jagadeesh S.; Katmis, Ferhat

    2015-08-17

    Magnetic exchange driven proximity effect at a magnetic-insulator–topological-insulator (MI-TI) interface provides a rich playground for novel phenomena as well as a way to realize low energy dissipation quantum devices. In this study, we report a dramatic enhancement of proximity exchange coupling in the MI/magnetic-TI EuS/Sb2–xVxTe3 hybrid heterostructure, where V doping is used to drive the TI (Sb2Te3) magnetic. We observe an artificial antiferromagneticlike structure near the MI-TI interface, which may account for the enhanced proximity coupling. The interplay between the proximity effect and doping in a hybrid heterostructure provides insights into the engineering of magnetic ordering.

  13. Feasibility of an XUV FEL Oscillator Driven by a SCRF Linear Accelerator

    SciTech Connect (OSTI)

    Lumpkin, A. H.; Freund, H. P.; Reinsch, M.

    2014-01-01

    The Advanced Superconducting Test Accelerator (ASTA) facility is currently under construction at Fermi National Accelerator Laboratory. Using a1-ms-long macropulse composed of up to 3000 micropulses, and with beam energies projected from 45 to 800 MeV, the possibility for an extreme ultraviolet (XUV) free-electron laser oscillator (FELO) with the higher energy is evaluated. We have used both GINGER with an oscillator module and the MEDUSA/OPC code to assess FELO saturation prospects at 120 nm, 40 nm, and 13.4 nm. The results support saturation at all of these wavelengths which are also shorter than the demonstrated shortest wavelength record of 176 nm from a storage-ring-based FELO. This indicates linac-driven FELOs can be extended into this XUV wavelength regime previously only reached with single-pass FEL configurations.

  14. Precision vector control of a superconducting RF cavity driven by an injection locked magnetron

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Chase, Brian; Pasquinelli, Ralph; Cullerton, Ed; Varghese, Philip

    2015-03-01

    The technique presented in this paper enables the regulation of both radio frequency amplitude and phase in narrow band devices such as a Superconducting RF (SRF) cavity driven by constant power output devices i.e. magnetrons [1]. The ability to use low cost high efficiency magnetrons for accelerator RF power systems, with tight vector regulation, presents a substantial cost savings in both construction and operating costs - compared to current RF power system technology. An operating CW system at 2.45 GHz has been experimentally developed. Vector control of an injection locked magnetron has been extensively tested and characterized with a SRFmore » cavity as the load. Amplitude dynamic range of 30 dB, amplitude stability of 0.3% r.m.s, and phase stability of 0.26 degrees r.m.s. has been demonstrated.« less

  15. Current-driven domain wall motion enhanced by the microwave field

    SciTech Connect (OSTI)

    Wang, Xi-guang; Guo, Guang-hua Nie, Yao-zhuang; Wang, Dao-wei; Li, Zhi-xiong; Tang, Wei; Zeng, Zhong-ming

    2014-07-14

    The magnetic domain wall (DW) motion driven by a spin-polarized current opens a new concept for memory and logic devices. However, the critical current density required to overcome the intrinsic and/or extrinsic pinning of DW remains too large for practical applications. Here, we show, by using micromagnetic simulations and analytical approaches, that the application of a microwave field offers an effective solution to this problem. When a transverse microwave field is applied, the adiabatic spin-transfer torque (STT) alone can sustain a steady-state DW motion without the sign of Walker breakdown, meaning that the intrinsic pinning disappears. The extrinsic pinning can also be effectively reduced. Moreover, the DW velocity is increased greatly for the microwave-assisted DW motion. This provides a new way to manipulate the DW motion at low current densities.

  16. Analytical solutions for radiation-driven winds in massive stars. I. The fast regime

    SciTech Connect (OSTI)

    Araya, I.; Cur, M.; Cidale, L. S.

    2014-11-01

    Accurate mass-loss rate estimates are crucial keys in the study of wind properties of massive stars and for testing different evolutionary scenarios. From a theoretical point of view, this implies solving a complex set of differential equations in which the radiation field and the hydrodynamics are strongly coupled. The use of an analytical expression to represent the radiation force and the solution of the equation of motion has many advantages over numerical integrations. Therefore, in this work, we present an analytical expression as a solution of the equation of motion for radiation-driven winds in terms of the force multiplier parameters. This analytical expression is obtained by employing the line acceleration expression given by Villata and the methodology proposed by Mller and Vink. On the other hand, we find useful relationships to determine the parameters for the line acceleration given by Mller and Vink in terms of the force multiplier parameters.

  17. Laser heating of solid matter by light pressure-driven shocks

    SciTech Connect (OSTI)

    Akli, K; Hansen, S B; Kemp, A J; Freeman, R R; Beg, F N; Clark, D; Chen, S; Hey, D; Highbarger, K; Giraldez, E; Green, J; Gregori, G; Lancaster, K; Ma, T; MacKinnon, A J; Norreys, P A; Patel, N; Patel, P; Shearer, C; Stephens, R B; Stoeckl, C; Storm, M; Theobald, W; Van Woerkom, L; Weber, R; Key, M H

    2007-05-04

    Heating by irradiation of a solid surface in vacuum with 5 x 10{sup 20} W cm{sup -2}, 0.8 ps, 1.05 {micro}m wavelength laser light is studied by x-ray spectroscopy of the K-shell emission from thin layers of Ni, Mo and V. A surface layer is heated to {approx} 5 keV with an axial temperature gradient of 0.6 {micro}m scale length. Images of Ni Ly{sub {alpha}} show the hot region has a {approx} 25 {micro}m diameter, much smaller than {approx} 70 {micro}m region of K{sub {alpha}} emission. 2D particle-in-cell (PIC) simulations suggest that the surface heating is due to a light pressure driven shock.

  18. Electron self-injection in the proton-driven-plasma-wakefield acceleration

    SciTech Connect (OSTI)

    Hu, Zhang-Hu; Wang, You-Nian

    2013-12-15

    The self-injection process of plasma electrons in the proton-driven-plasma-wakefield acceleration scheme is investigated using a two-dimensional, electromagnetic particle-in-cell method. Plasma electrons are self-injected into the back of the first acceleration bucket during the initial bubble formation period, where the wake phase velocity is low enough to trap sufficient electrons. Most of the self-injected electrons are initially located within a distance of the skin depth c/?{sub pe} to the beam axis. A decrease (or increase) in the beam radius (or length) leads to a significant reduction in the total charges of self-injected electron bunch. Compared to the uniform plasma, the energy spread, emittance and total charges of the self-injected bunch are reduced in the plasma channel case, due to a reduced injection of plasma electrons that initially located further away from the beam axis.

  19. Seating Arrangement, Group Composition and Competition-driven Interaction: Effects on Students' Performance in Physics

    SciTech Connect (OSTI)

    Roxas, R. M.; Monterola, C.; Carreon-Monterola, S. L.

    2010-07-28

    We probe the effect of seating arrangement, group composition and group-based competition on students' performance in Physics using a teaching technique adopted from Mazur's peer instruction method. Ninety eight lectures, involving 2339 students, were conducted across nine learning institutions from February 2006 to June 2009. All the lectures were interspersed with student interaction opportunities (SIO), in which students work in groups to discuss and answer concept tests. Two individual assessments were administered before and after the SIO. The ratio of the post-assessment score to the pre-assessment score and the Hake factor were calculated to establish the improvement in student performance. Using actual assessment results and neural network (NN) modeling, an optimal seating arrangement for a class was determined based on student seating location. The NN model also provided a quantifiable method for sectioning students. Lastly, the study revealed that competition-driven interactions increase within-group cooperation and lead to higher improvement on the students' performance.

  20. Temperature requirements and corrosion rates in combustion driven hydrogen fluoride supersonic diffusion lasers

    SciTech Connect (OSTI)

    Nordine, P.C.

    1983-08-01

    A maximum F-atom yield from F2 occurs in a combustion driven hydrogen fluoride supersonic diffusion laser (HFSDL) because the amount of fluorine reacted with hydrogen (or deuterium) continues to increase with temperature after most of the unreacted fluorine has been thermally dissociated. A small decease from the maximum combustor F-atom yield allows a significant decease in the required temperature and in the corrosion rates that uncooled laser nozzles would display. The temperatures that give F-atom yields equal to 95 percent of the maximum values were calculated for typical HFSDL combustor pressures and F-atom mole fractions and the corrosion rates of uncooled nozzles were evaluated at these temperatures. The corrosion rates of materials resistant to fluorine attack at the highest temperatures would allow HFSDL applications or test experiments up to several hours duration.

  1. Accelerator-driven subcritical fission in molten salt core: Closing the nuclear fuel cycle for green nuclear energy

    SciTech Connect (OSTI)

    McIntyre, Peter; Assadi, Saeed; Badgley, Karie; Baker, William; Comeaux, Justin; Gerity, James; Kellams, Joshua; McInturff, Al; Pogue, Nathaniel; Sattarov, Akhdiyor; Sooby, Elizabeth; Tsvetkov, Pavel; Phongikaroon, Supathorn; Simpson, Michael

    2013-04-19

    A technology for accelerator-driven subcritical fission in a molten salt core (ADSMS) is being developed as a basis for the destruction of the transuranics in used nuclear fuel. The molten salt fuel is a eutectic mixture of NaCl and the chlorides of the transuranics and fission products. The core is driven by proton beams from a strong-focusing cyclotron stack. This approach uniquely provides an intrinsically safe means to drive a core fueled only with transuranics, thereby eliminating competing breeding terms.

  2. Transport driven plasma flows in the scrape-off layer of ADITYA Tokamak in different orientations of magnetic field

    SciTech Connect (OSTI)

    Sangwan, Deepak; Jha, Ratneshwar; Brotankova, Jana; Gopalkrishna, M. V. [Institute for Plasma Research, Gandhinagar 382428 (India)

    2014-06-15

    Parallel plasma flows in the scrape-off layer of ADITYA tokamak are measured in two orientations of total magnetic field. In each orientation, experiments are carried out by reversing the direction of the toroidal magnetic field and the plasma current. The transport-driven component is determined by averaging flow Mach numbers, measured in two directions of the toroidal magnetic field and the plasma current for the same orientation. It is observed that there is a significant transport-driven component in the measured flow and the component depends on the field orientation.

  3. Compact disposal of high-energy electron beams using passive or laser-driven plasma decelerating stage

    SciTech Connect (OSTI)

    Bonatto, A.; Schroeder, C.B.; Vay, J.-L.; Geddes, C.R.; Benedetti, C.; Esarey and, E.; Leemans, W.P.

    2014-07-13

    A plasma decelerating stage is investigated as a compact alternative for the disposal of high-energy beams (beam dumps). This could benefit the design of laser-driven plasma accelerator (LPA) applications that require transportability and or high-repetition-rate operation regimes. Passive and laser-driven (active) plasma-based beam dumps are studied analytically and with particle-in-cell (PIC) simulations in a 1D geometry. Analytical estimates for the beam energy loss are compared to and extended by the PIC simulations, showing that with the proposed schemes a beam can be efficiently decelerated in a centimeter-scale distance.

  4. WIND-DRIVEN ACCRETION IN PROTOPLANETARY DISKS. II. RADIAL DEPENDENCE AND GLOBAL PICTURE

    SciTech Connect (OSTI)

    Bai Xuening, E-mail: xbai@cfa.harvard.edu [Institute for Theory and Computation, Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, MS-51, Cambridge, MA 02138 (United States)

    2013-08-01

    Non-ideal magnetohydrodynamical effects play a crucial role in determining the mechanism and efficiency of angular momentum transport as well as the level of turbulence in protoplanetary disks (PPDs), which are the key to understanding PPD evolution and planet formation. It was shown in our previous work that at 1 AU, the magnetorotational instability (MRI) is completely suppressed when both ohmic resistivity and ambipolar diffusion (AD) are taken into account, resulting in a laminar flow with accretion driven by magnetocentrifugal wind. In this work, we study the radial dependence of the laminar wind solution using local shearing-box simulations. The scaling relation on the angular momentum transport for the laminar wind is obtained, and we find that the wind-driven accretion rate can be approximated as M-dot approx. 0.91 x 10{sup -8}R{sub AU}{sup 1.21}(B{sub p}/10 mG){sup 0.93} M{sub Sun} yr{sup -1}, where B{sub p} is the strength of the large-scale poloidal magnetic field threading the disk. The result is independent of disk surface density. Four criteria are outlined for the existence of the laminar wind solution: (1) ohmic resistivity dominated the midplane region, (2) the AD-dominated disk upper layer, (3) the presence of a (not too weak) net vertical magnetic flux, and (4) sufficiently well-ionized gas beyond the disk surface. All these criteria are likely to be met in the inner region of the disk from {approx}0.3 AU to about 5-10 AU for typical PPD accretion rates. Beyond this radius, the angular momentum transport is likely to proceed due to a combination of the MRI and disk wind, and eventually completely dominated by the MRI (in the presence of strong AD) in the outer disk. Our simulation results provide key ingredients for a new paradigm on the accretion processes in PPDs.

  5. CO2-driven Enhanced Oil Recovery as a Stepping Stone to What?

    SciTech Connect (OSTI)

    Dooley, James J.; Dahowski, Robert T.; Davidson, Casie L.

    2010-07-14

    This paper draws heavily on the authors’ previously published research to explore the extent to which near term carbon dioxide-driven enhanced oil recovery (CO2-EOR) can be “a stepping stone to a long term sequestration program of a scale to be material in climate change risk mitigation.” The paper examines the historical evolution of CO2-EOR in the United States and concludes that estimates of the cost of CO2-EOR production or the extent of CO2 pipeline networks based upon this energy security-driven promotion of CO2-EOR do not provide a robust platform for spurring the commercial deployment of carbon dioxide capture and storage technologies (CCS) as a means of reducing greenhouse gas emissions. The paper notes that the evolving regulatory framework for CCS makes a clear distinction between CO2-EOR and CCS and the authors examine arguments in the technical literature about the ability for CO2-EOR to generate offsetting revenue to accelerate the commercial deployment of CCS systems in the electric power and industrial sectors of the economy. The authors conclude that the past 35 years of CO2-EOR in the U.S. have been important for boosting domestic oil production and delivering proven system components for future CCS systems. However, though there is no reason to suggest that CO2-EOR will cease to deliver these benefits, there is also little to suggest that CO2-EOR is a necessary or significantly beneficial step towards the commercial deployment of CCS as a means of addressing climate change.

  6. Adsorbate-driven morphological changes on Cu(111) nano-pits

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Mudiyanselage, K.; Xu, F.; Hoffmann, F. M.; Hrbek, J.; Waluyo, I.; Boscoboinik, J. A.; Stacchiola, D. J.

    2014-12-09

    Adsorbate-driven morphological changes of pitted-Cu(111) surfaces have been investigated following the adsorption and desorption of CO and H. The morphology of the pitted-Cu(111) surfaces, prepared by Ar+ sputtering, exposed a few atomic layers deep nested hexagonal pits of diameters from 8 to 38 nm with steep step bundles. The roughness of pitted-Cu(111) surfaces can be healed by heating to 450-500 K in vacuum. Adsorption of CO on the pitted-Cu(111) surface leads to two infrared peaks at 2089-2090 and 2101-2105 cm-1 for CO adsorbed on under-coordinated sites in addition to the peak at 2071 cm-1 for CO adsorbed on atop sitesmore » of the close-packed Cu(111) surface. CO adsorbed on under-coordinated sites is thermally more stable than that of atop Cu(111) sites. Annealing of the CO-covered surface from 100 to 300 K leads to minor changes of the surface morphology. In contrast, annealing of a H covered surface to 300 K creates a smooth Cu(111) surface as deduced from infrared data of adsorbed CO and scanning tunnelling microscopy (STM) imaging. The observation of significant adsorbate-driven morphological changes with H is attributed to its stronger modification of the Cu(111) surface by the formation of a sub-surface hydride with a hexagonal structure, which relaxes into the healed Cu(111) surface upon hydrogen desorption. These morphological changes occur ~150 K below the temperature required for healing of the pitted-Cu(111) surface by annealing in vacuum. In contrast, the adsorption of CO, which only interacts with the top-most Cu layer and desorbs by 160 K, does not significantly change the morphology of the pitted-Cu(111) surface.« less

  7. Adsorbate-driven morphological changes on Cu(111) nano-pits

    SciTech Connect (OSTI)

    Mudiyanselage, K.; Xu, F.; Hoffmann, F. M.; Hrbek, J.; Waluyo, I.; Boscoboinik, J. A.; Stacchiola, D. J.

    2014-12-09

    Adsorbate-driven morphological changes of pitted-Cu(111) surfaces have been investigated following the adsorption and desorption of CO and H. The morphology of the pitted-Cu(111) surfaces, prepared by Ar+ sputtering, exposed a few atomic layers deep nested hexagonal pits of diameters from 8 to 38 nm with steep step bundles. The roughness of pitted-Cu(111) surfaces can be healed by heating to 450-500 K in vacuum. Adsorption of CO on the pitted-Cu(111) surface leads to two infrared peaks at 2089-2090 and 2101-2105 cm-1 for CO adsorbed on under-coordinated sites in addition to the peak at 2071 cm-1 for CO adsorbed on atop sites of the close-packed Cu(111) surface. CO adsorbed on under-coordinated sites is thermally more stable than that of atop Cu(111) sites. Annealing of the CO-covered surface from 100 to 300 K leads to minor changes of the surface morphology. In contrast, annealing of a H covered surface to 300 K creates a smooth Cu(111) surface as deduced from infrared data of adsorbed CO and scanning tunnelling microscopy (STM) imaging. The observation of significant adsorbate-driven morphological changes with H is attributed to its stronger modification of the Cu(111) surface by the formation of a sub-surface hydride with a hexagonal structure, which relaxes into the healed Cu(111) surface upon hydrogen desorption. These morphological changes occur ~150 K below the temperature required for healing of the pitted-Cu(111) surface by annealing in vacuum. In contrast, the adsorption of CO, which only interacts with the top-most Cu layer and desorbs by 160 K, does not significantly change the morphology of the pitted-Cu(111) surface.

  8. Adsorbate-driven morphological changes on Cu(111) nano-pits

    SciTech Connect (OSTI)

    Mudiyanselage, K.; Xu, F.; Hoffmann, F. M.; Hrbek, J.; Waluyo, I.; Boscoboinik, J. A.; Stacchiola, D. J.

    2015-01-01

    Adsorbate-driven morphological changes of pitted-Cu(111) surfaces have been investigated following the adsorption and desorption of CO and H. The morphology of the pitted-Cu(111) surfaces, prepared by Ar+ sputtering, exposed a few atomic layers deep nested hexagonal pits of diameters from 8 to 38 nm with steep step bundles. The roughness of pitted-Cu(111) surfaces can be healed by heating to 450-500 K in vacuum. Adsorption of CO on the pitted-Cu(111) surface leads to two infrared peaks at 2089-2090 and 2101-2105 cm-1 for CO adsorbed on under-coordinated sites in addition to the peak at 2071 cm-1 for CO adsorbed on atop sites of the close-packed Cu(111) surface. CO adsorbed on under-coordinated sites is thermally more stable than that of atop Cu(111) sites. Annealing of the CO-covered surface from 100 to 300 K leads to minor changes of the surface morphology. In contrast, annealing of a H covered surface to 300 K creates a smooth Cu(111) surface as deduced from infrared data of adsorbed CO and scanning tunnelling microscopy (STM) imaging. The observation of significant adsorbate-driven morphological changes with H is attributed to its stronger modification of the Cu(111) surface by the formation of a sub-surface hydride with a hexagonal structure, which relaxes into the healed Cu(111) surface upon hydrogen desorption. These morphological changes occur ~150 K below the temperature required for healing of the pitted-Cu(111) surface by annealing in vacuum. In contrast, the adsorption of CO, which only interacts with the top-most Cu layer and desorbs by 160 K, does not significantly change the morphology of the pitted-Cu(111) surface.

  9. Heat release and flame structure measurements of self-excited acoustically-driven premixed methane flames

    SciTech Connect (OSTI)

    Kopp-Vaughan, Kristin M.; Tuttle, Steven G.; Renfro, Michael W.; King, Galen B.

    2009-10-15

    An open-open organ pipe burner (Rijke tube) with a bluff-body ring was used to create a self-excited, acoustically-driven, premixed methane-air conical flame, with equivalence ratios ranging from 0.85 to 1.05. The feed tube velocities corresponded to Re = 1780-4450. Coupled oscillations in pressure, velocity, and heat release from the flame are naturally encouraged at resonant frequencies in the Rijke tube combustor. This coupling creates sustainable self-excited oscillations in flame front area and shape. The period of the oscillations occur at the resonant frequency of the combustion chamber when the flame is placed {proportional_to}1/4 of the distance from the bottom of the tube. In this investigation, the shape of these acoustically-driven flames is measured by employing both OH planar laser-induced fluorescence (PLIF) and chemiluminescence imaging and the images are correlated to simultaneously measured pressure in the combustor. Past research on acoustically perturbed flames has focused on qualitative flame area and heat release relationships under imposed velocity perturbations at imposed frequencies. This study reports quantitative empirical fits with respect to pressure or phase angle in a self-generated pressure oscillation. The OH-PLIF images were single temporal shots and the chemiluminescence images were phase averaged on chip, such that 15 exposures were used to create one image. Thus, both measurements were time resolved during the flame oscillation. Phase-resolved area and heat release variations throughout the pressure oscillation were computed. A relation between flame area and the phase angle before the pressure maximum was derived for all flames in order to quantitatively show that the Rayleigh criterion was satisfied in the combustor. Qualitative trends in oscillating flame area were found with respect to feed tube flow rates. A logarithmic relation was found between the RMS pressure and both the normalized average area and heat release rate for all flames. (author)

  10. Vehicle Technologies Office: 2015 Vehicle Systems Annual Progress...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to advancing light-, medium-, and heavy-duty vehicle systems to help maximize the number of electric miles driven and increase the energy efficiency of transportation vehicles. ...

  11. Vehicle Technologies Office: 2014 Vehicle and Systems Simulation...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to advancing light-, medium-, and heavy-duty vehicle systems to help maximize the number of electric miles driven and increase the energy efficiency of transportation vehicles. ...

  12. FY2015 Vehicle Systems Annual Progress Report (Technical Report...

    Office of Scientific and Technical Information (OSTI)

    to advancing light-, medium-, and heavy-duty vehicle systems to help maximize the number of electric miles driven and increase the energy efficiency of transportation vehicles. ...

  13. Driven and decaying turbulence simulations of low–mass star formation: From clumps to cores to protostars

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Offner, Stella S. R.; Klein, Richard I.; McKee, Christopher F.

    2008-10-20

    Molecular clouds are observed to be turbulent, but the origin of this turbulence is not well understood. As a result, there are two different approaches to simulating molecular clouds, one in which the turbulence is allowed to decay after it is initialized, and one in which it is driven. We use the adaptive mesh refinement (AMR) code, Orion, to perform high-resolution simulations of molecular cloud cores and protostars in environments with both driven and decaying turbulence. We include self-gravity, use a barotropic equation of state, and represent regions exceeding the maximum grid resolution with sink particles. We analyze the propertiesmore » of bound cores such as size, shape, line width, and rotational energy, and we find reasonable agreement with observation. At high resolution the different rates of core accretion in the two cases have a significant effect on protostellar system development. Clumps forming in a decaying turbulence environment produce high-multiplicity protostellar systems with Toomre Q unstable disks that exhibit characteristics of the competitive accretion model for star formation. In contrast, cores forming in the context of continuously driven turbulence and virial equilibrium form smaller protostellar systems with fewer low-mass members. Furthermore, our simulations of driven and decaying turbulence show some statistically significant differences, particularly in the production of brown dwarfs and core rotation, but the uncertainties are large enough that we are not able to conclude whether observations favor one or the other.« less

  14. Proposed Laser-driven, Dielectric Microstructure Few-cm Long Undulator for Attosecond Coherent X-rays

    SciTech Connect (OSTI)

    Plettner, T; Byer, R.L.; /Stanford U., Ginzton Lab.

    2011-09-16

    This article presents the concept of an all-dielectric laser-driven undulator for the generation of coherent X-rays. The proposed laser-driven undulator is expected to produce internal deflection forces equivalent to a several-Tesla magnetic field acting on a speed-of-light particle. The key idea for this laser-driven undulator is its ability to provide phase synchronicity between the deflection force and the electron beam for a distance that is much greater than the laser wavelength. The potential advantage of this undulator is illustrated with a possible design example that assumes a small laser accelerator which delivers a 2 GeV, 1 pC, 1 kHz electron bunch train to a 10 cm long, 1/2 mm period laser-driven undulator. Such an undulator could produce coherent X-ray pulses with {approx}10{sup 9} photons of 64 keV energy. The numerical modeling for the expected X-ray pulse shape was performed with GENESIS, which predicts X-ray pulse durations in the few-attosecond range. Possible applications for nonlinear electromagnetic effects from these X-ray pulses are briefly discussed.

  15. Maibarara Geothermal Power Plant | Open Energy Information

    Open Energy Info (EERE)

    1 Avg. Annual Gross Operating Capacity(MW) Summer Peak Net Capacity (MW) Winter Peak Net Capacity (MW) Avg. Annual GenerationConsumption Gross Generation (MWh) 60 1...

  16. Differences in carbon cycle and temperature projections from emission- and concentration-driven earth system model simulations

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Shao, P.; Zeng, X.; Zeng, X.

    2014-08-29

    The influence of prognostic and prescribed atmospheric CO2 concentrations ([CO2]) on the carbon uptake and temperature is investigated using all eight Earth System Models (ESMs) with relevant output variables from the Coupled Model Intercomparison Project Phase 5 (CMIP5). Under the RCP8.5 scenario, the projected [CO2] differences in 2100 vary from -19.7 to +207.3 ppm in emission-driven ESMs. Incorporation of the interactive concentrations also increases the range of global warming, computed as the 20 year average difference between 20812100 and 18501869/18611880, by 49% from 2.36 K (i.e. ranging from 3.11 to 5.47 K) in the concentration-driven simulations to 3.51 K inmorethe emission-driven simulations. The observed seasonal amplitude of global [CO2] from 19802011 is about 1.25.3 times as large as those from the eight emission-driven ESMs, while the [CO2] seasonality is simply neglected in concentration-driven ESMs, suggesting the urgent need of ESM improvements in this area. The temperature-concentration feedback parameter ? is more sensitive to [CO2] (e.g. during 19802005 versus 20752100) than how [CO2] is handled (i.e. prognostic versus prescribed). This sensitivity can be substantially reduced by using a more appropriate parameter ?' computed from the linear regression of temperature change versus that of the logarithm of [CO2]. However, the inter-model relative variations of both ? and ?' remain large, suggesting the need of more detailed studies to understand and hopefully reduce these discrepancies.less

  17. A non-linear dimension reduction methodology for generating data-driven stochastic input models

    SciTech Connect (OSTI)

    Ganapathysubramanian, Baskar; Zabaras, Nicholas

    2008-06-20

    Stochastic analysis of random heterogeneous media (polycrystalline materials, porous media, functionally graded materials) provides information of significance only if realistic input models of the topology and property variations are used. This paper proposes a framework to construct such input stochastic models for the topology and thermal diffusivity variations in heterogeneous media using a data-driven strategy. Given a set of microstructure realizations (input samples) generated from given statistical information about the medium topology, the framework constructs a reduced-order stochastic representation of the thermal diffusivity. This problem of constructing a low-dimensional stochastic representation of property variations is analogous to the problem of manifold learning and parametric fitting of hyper-surfaces encountered in image processing and psychology. Denote by M the set of microstructures that satisfy the given experimental statistics. A non-linear dimension reduction strategy is utilized to map M to a low-dimensional region, A. We first show that M is a compact manifold embedded in a high-dimensional input space R{sup n}. An isometric mapping F from M to a low-dimensional, compact, connected set A is contained in R{sup d}(d<driven representation of the property variations. The reduced-order model of the material topology and thermal diffusivity variations is subsequently used as an input in the solution of stochastic partial differential equations that describe the evolution of dependant variables. A sparse grid collocation strategy (Smolyak algorithm) is utilized to solve these stochastic equations efficiently. We showcase the methodology by constructing low-dimensional input stochastic models to represent thermal diffusivity in two-phase microstructures. This model is used in analyzing the effect of topological variations of two-phase microstructures on the evolution of temperature in heat conduction processes.

  18. Geophysical monitoring and reactive transport modeling of ureolytically-driven calcium carbonate precipitation

    SciTech Connect (OSTI)

    Wu, Y.; Ajo-Franklin, J.B.; Spycher, N.; Hubbard, S.S.; Zhang, G.; Williams, K.H.; Taylor, J.; Fujita, Y.; Smith, R.

    2011-07-15

    Ureolytically-driven calcium carbonate precipitation is the basis for a promising in-situ remediation method for sequestration of divalent radionuclide and trace metal ions. It has also been proposed for use in geotechnical engineering for soil strengthening applications. Monitoring the occurrence, spatial distribution, and temporal evolution of calcium carbonate precipitation in the subsurface is critical for evaluating the performance of this technology and for developing the predictive models needed for engineering application. In this study, we conducted laboratory column experiments using natural sediment and groundwater to evaluate the utility of geophysical (complex resistivity and seismic) sensing methods, dynamic synchrotron x-ray computed tomography (micro-CT), and reactive transport modeling for tracking ureolytically-driven calcium carbonate precipitation processes under site relevant conditions. Reactive transport modeling with TOUGHREACT successfully simulated the changes of the major chemical components during urea hydrolysis. Even at the relatively low level of urea hydrolysis observed in the experiments, the simulations predicted an enhanced calcium carbonate precipitation rate that was 3-4 times greater than the baseline level. Reactive transport modeling results, geophysical monitoring data and micro-CT imaging correlated well with reaction processes validated by geochemical data. In particular, increases in ionic strength of the pore fluid during urea hydrolysis predicted by geochemical modeling were successfully captured by electrical conductivity measurements and confirmed by geochemical data. The low level of urea hydrolysis and calcium carbonate precipitation suggested by the model and geochemical data was corroborated by minor changes in seismic P-wave velocity measurements and micro-CT imaging; the latter provided direct evidence of sparsely distributed calcium carbonate precipitation. Ion exchange processes promoted through NH{sub 4}{sup +} production during urea hydrolysis were incorporated in the model and captured critical changes in the major metal species. The electrical phase increases were potentially due to ion exchange processes that modified charge structure at mineral/water interfaces. Our study revealed the potential of geophysical monitoring for geochemical changes during urea hydrolysis and the advantages of combining multiple approaches to understand complex biogeochemical processes in the subsurface.

  19. Geophysical Monitoring and Reactive Transport Modeling of Ureolytically-Driven Calcium Carbonate Precipitation

    SciTech Connect (OSTI)

    Yuxin Wu; Jonathan B. Ajo-Franklin; Nicolas Spycher; Susan S. Hubbard; Guoxiang Zhang; Kenneth H. Williams; Joanna Taylor; Yoshiko Fujita; Robert Smith

    2011-09-01

    Ureolytically-driven calcium carbonate precipitation is the basis for a promising in-situ remediation method for sequestration of divalent radionuclide and trace metal ions. It has also been proposed for use in geotechnical engineering for soil strengthening applications. Monitoring the occurrence, spatial distribution, and temporal evolution of calcium carbonate precipitation in the subsurface is critical for evaluating the performance of this technology and for developing the predictive models needed for engineering application. In this study, we conducted laboratory column experiments using natural sediment and groundwater to evaluate the utility of geophysical (complex resistivity and seismic) sensing methods, dynamic synchrotron x-ray computed tomography (micro-CT), and reactive transport modeling for tracking ureolytically-driven calcium carbonate precipitation processes under site relevant conditions. Reactive transport modeling with TOUGHREACT successfully simulated the changes of the major chemical components during urea hydrolysis. Even at the relatively low level of urea hydrolysis observed in the experiments, the simulations predicted an enhanced calcium carbonate precipitation rate that was 3-4 times greater than the baseline level. Reactive transport modeling results, geophysical monitoring data and micro-CT imaging correlated well with reaction processes validated by geochemical data. In particular, increases in ionic strength of the pore fluid during urea hydrolysis predicted by geochemical modeling were successfully captured by electrical conductivity measurements and confirmed by geochemical data. The low level of urea hydrolysis and calcium carbonate precipitation suggested by the model and geochemical data was corroborated by minor changes in seismic P-wave velocity measurements and micro-CT imaging; the latter provided direct evidence of sparsely distributed calcium carbonate precipitation. Ion exchange processes promoted through NH4+ production during urea hydrolysis were incorporated in the model and captured critical changes in the major metal species. The electrical phase increases were potentially due to ion exchange processes that modified charge structure at mineral/water interfaces. Our study revealed the potential of geophysical monitoring for geochemical changes during urea hydrolysis and the advantages of combining multiple approaches to understand complex biogeochemical processes in the subsurface.

  20. Rac1 and Cdc42 GTPases regulate shear stress-driven ?-catenin signaling in osteoblasts

    SciTech Connect (OSTI)

    Wan, Qiaoqiao; Cho, Eunhye; Yokota, Hiroki; Department of Anatomy and Cell Biology, Indiana University School of Medicine, Indianapolis, IN 46202 ; Na, Sungsoo

    2013-04-19

    Highlights: Shear stress increased TCF/LEF activity and stimulated ?-catenin nuclear localization. Rac1, Cdc42, and RhoA displayed distinct dynamic activity patterns under flow. Rac1 and Cdc42, but not RhoA, regulate shear stress-driven TCF/LEF activation. Cytoskeleton did not significantly affect shear stress-induced TCF/LEF activation. -- Abstract: Beta-catenin-dependent TCF/LEF (T-cell factor/lymphocyte enhancing factor) is known to be mechanosensitive and an important regulator for promoting bone formation. However, the functional connection between TCF/LEF activity and Rho family GTPases is not well understood in osteoblasts. Herein we investigated the molecular mechanisms underlying oscillatory shear stress-induced TCF/LEF activity in MC3T3-E1 osteoblast cells using live cell imaging. We employed fluorescence resonance energy transfer (FRET)-based and green fluorescent protein (GFP)-based biosensors, which allowed us to monitor signal transduction in living cells in real time. Oscillatory (1 Hz) shear stress (10 dynes/cm{sup 2}) increased TCF/LEF activity and stimulated translocation of ?-catenin to the nucleus with the distinct activity patterns of Rac1 and Cdc42. The shear stress-induced TCF/LEF activity was blocked by the inhibition of Rac1 and Cdc42 with their dominant negative mutants or selective drugs, but not by a dominant negative mutant of RhoA. In contrast, constitutively active Rac1 and Cdc42 mutants caused a significant enhancement of TCF/LEF activity. Moreover, activation of Rac1 and Cdc42 increased the basal level of TCF/LEF activity, while their inhibition decreased the basal level. Interestingly, disruption of cytoskeletal structures or inhibition of myosin activity did not significantly affect shear stress-induced TCF/LEF activity. Although Rac1 is reported to be involved in ?-catenin in cancer cells, the involvement of Cdc42 in ?-catenin signaling in osteoblasts has not been identified. Our findings in this study demonstrate that both Rac1 and Cdc42 GTPases are critical regulators in shear stress-driven ?-catenin signaling in osteoblasts.

  1. Science-Driven Candidate Search for New Scintillator Materials: FY 2014 Annual Report

    SciTech Connect (OSTI)

    Kerisit, Sebastien N.; Gao, Fei; Xie, YuLong; Campbell, Luke W.; Wu, Dangxin; Prange, Micah P.

    2014-10-01

    This annual reports presents work carried out during Fiscal Year (FY) 2014 at Pacific Northwest National Laboratory (PNNL) under the project entitled “Science-Driven Candidate Search for New Scintillator Materials” (Project number: PL13-SciDriScintMat-PD05) and led by Drs. Fei Gao and Sebastien N. Kerisit. This project is divided into three tasks: 1) Ab initio calculations of electronic properties, electronic response functions and secondary particle spectra; 2) Intrinsic response properties, theoretical light yield, and microscopic description of ionization tracks; and 3) Kinetics and efficiency of scintillation: nonproportionality, intrinsic energy resolution, and pulse shape discrimination. Detailed information on the results obtained in each of the three tasks is provided in this Annual Report. Furthermore, peer-reviewed articles published this FY or currently under review and presentations given this FY are included in Appendix. This work was supported by the National Nuclear Security Administration, Office of Nuclear Nonproliferation Research and Development (DNN R&D/NA-22), of the U.S. Department of Energy (DOE).

  2. Development of a broadband reflectivity diagnostic for laser driven shock compression experiments

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Ali, S. J.; Bolme, C. A.; Collins, G. W.; Jeanloz, R.

    2015-04-01

    A normal - incidence visible and near - infrared Shock Wave Optical Reflectivity Diagnostic (SWORD) was constructed to investigate changes in the optical properties of materials under dynamic laser compression . Documenting wavelength - and time - dependent changes in the optical properties of laser - shock compressed samples has been difficult, primarily due to the small sample sizes and short time scales involved , but we succeeded in doing so by broadening a series of time delayed 800 - nm pulses from an ultra fast Ti: sapphire laser to generate high - intensity broadband light at nanosecond time scalesmore » . This diagnostic was demonstrated over the wavelength range 450 to 1150 nm with up to 16 time displaced spectra during a single shock experiment. Simultaneous off - normal incidence velocity interferometry (VISAR) characterize d the sample under laser - compression , and also provide d a n independent reflectivity measurement at 532 nm wavelength . Lastly, the shock - driven semiconductor - to - metallic transition in germanium was documented by way of reflectivity measurements with 0.5 ns time resolution and a wavelength resolution of 10 nm .« less

  3. Conjugated ionomers for photovoltaic applications: electric field driven charge separation in organic photovoltaics. Final Technical report

    SciTech Connect (OSTI)

    Lonergan, Mark

    2015-05-29

    Final technical report for Conjugated ionomers for photovoltaic applications, electric field driven charge separation in organic photovoltaics. The central goal of the work we completed was been to understand the photochemical and photovoltaic properties of ionically functionalized conjugated polymers (conjugated ionomers or polyelectrolytes) and energy conversion systems based on them. We primarily studied two classes of conjugated polymer interfaces that we developed based either upon undoped conjugated polymers with an asymmetry in ionic composition (the ionic junction) or doped conjugated polymers with an asymmetry in doping type (the p-n junction). The materials used for these studies have primarily been the polyacetylene ionomers. We completed a detailed study of p-n junctions with systematically varying dopant density, photochemical creation of doped junctions, and experimental and theoretical work on charge transport and injection in polyacetylene ionomers. We have also completed related work on the use of conjugated ionomers as interlayers that improve the efficiency or organic photovoltaic systems and studied several important aspects of the chemistry of ionically functionalized semiconductors, including mechanisms of so-called "anion-doping", the formation of charge transfer complexes with oxygen, and the synthesis of new polyfluorene polyelectrolytes. We also worked worked with the Haley group at the University of Oregon on new indenofluorene-based organic acceptors.

  4. Geometric phase of a qubit driven by a phase noise laser under non-Markovian dynamics

    SciTech Connect (OSTI)

    Berrada, K.

    2014-01-15

    Robustness of the geometric phase (GP) with respect to the environmental effects is a basic condition for an effective quantum computation. Here, we study quantitatively the GP of a two-level atom system driven by a phase noise laser under non-Markovian dynamics in terms of different parameters involved in the whole system. We find that with the change of the damping coupling, the GP is very sensitive to its properties exhibiting long collapse and revival phenomena, which play a significant role in enhancing the stabilization and control of the system dynamics. Moreover, we show that the GP can be considered as a tool for testing and characterizing the nature of the qubitenvironment coupling. Due to the significance of how a system is quantum correlated with its environment in the construction of a scalable quantum computer, the entanglement dynamics between the qubit with its environment under external classical noise is evaluated and investigated during the time evolution. -- Highlights: Geometric phase under noise phase laser. Dynamics of the geometric phase under non-Markovian dynamics in the presence of classical noise. Solution of master equation of the system in terms atomic inversion. Nonlocal correlation between the system and its environment under non-Markovianity.

  5. A novel data-driven learning method for radar target detection in nonstationary environments

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Akcakaya, Murat; Nehorai, Arye; Sen, Satyabrata

    2016-04-12

    Most existing radar algorithms are developed under the assumption that the environment (clutter) is stationary. However, in practice, the characteristics of the clutter can vary enormously depending on the radar-operational scenarios. If unaccounted for, these nonstationary variabilities may drastically hinder the radar performance. Therefore, to overcome such shortcomings, we develop a data-driven method for target detection in nonstationary environments. In this method, the radar dynamically detects changes in the environment and adapts to these changes by learning the new statistical characteristics of the environment and by intelligibly updating its statistical detection algorithm. Specifically, we employ drift detection algorithms to detectmore » changes in the environment; incremental learning, particularly learning under concept drift algorithms, to learn the new statistical characteristics of the environment from the new radar data that become available in batches over a period of time. The newly learned environment characteristics are then integrated in the detection algorithm. Furthermore, we use Monte Carlo simulations to demonstrate that the developed method provides a significant improvement in the detection performance compared with detection techniques that are not aware of the environmental changes.« less

  6. A study of self organized criticality in ion temperature gradient mode driven gyrokinetic turbulence

    SciTech Connect (OSTI)

    Mavridis, M.; Isliker, H.; Vlahos, L.; Grler, T.; Jenko, F.; Told, D.

    2014-10-15

    An investigation on the characteristics of self organized criticality (Soc) in ITG mode driven turbulence is made, with the use of various statistical tools (histograms, power spectra, Hurst exponents estimated with the rescaled range analysis, and the structure function method). For this purpose, local non-linear gyrokinetic simulations of the cyclone base case scenario are performed with the GENE software package. Although most authors concentrate on global simulations, which seem to be a better choice for such an investigation, we use local simulations in an attempt to study the locally underlying mechanisms of Soc. We also study the structural properties of radially extended structures, with several tools (fractal dimension estimate, cluster analysis, and two dimensional autocorrelation function), in order to explore whether they can be characterized as avalanches. We find that, for large enough driving temperature gradients, the local simulations exhibit most of the features of Soc, with the exception of the probability distribution of observables, which show a tail, yet they are not of power-law form. The radial structures have the same radial extent at all temperature gradients examined; radial motion (transport) though appears only at large temperature gradients, in which case the radial structures can be interpreted as avalanches.

  7. Field Performance of Inverter-Driven Heat Pumps in Cold Climates

    SciTech Connect (OSTI)

    Williamson, James; Aldrich, Robb

    2015-08-19

    Traditionally, air-source heat pumps (ASHPs) have been used more often in warmer climates; however, some new ASHPs are gaining ground in colder areas. These systems operate at subzero (Fahrenheit) temperatures and many do not include backup electric resistance elements. There are still uncertainties, however, about capacity and efficiency in cold weather. Also, questions such as “how cold is too cold?” do not have clear answers. These uncertainties could lead to skepticism among homeowners; poor energy savings estimates; suboptimal system selection by heating, ventilating, and air-conditioning contractors; and inconsistent energy modeling. In an effort to better understand and characterize the heating performance of these units in cold climates, the U.S. Department of Energy Building America team, Consortium for Advanced Residential Buildings (CARB), monitored seven inverter-driven, ductless ASHPs across the Northeast. Operating data were collected for three Mitsubishi FE18 units, three Mitsubishi FE12 units, and one Fujitsu 15RLS2 unit. The intent of this research was to assess heat output, electricity consumption, and coefficients of performance (COPs) at various temperatures and load conditions. This assessment was accomplished with long- and short-term tests that measured power consumption; supply, return, and outdoor air temperatures; and airflow through the indoor fan coil.

  8. Hydrogen-bond driven loop-closure kinetics in unfolded polypeptide chains

    SciTech Connect (OSTI)

    Daidone, Isabella [University of Heidelberg; Neuweiler, H [University of Heidelberg; Doose, S [University of Heidelberg; Sauer, M [University of Heidelberg; Smith, Jeremy C [ORNL

    2010-12-01

    Characterization of the length dependence of end-to-end loop-closure kinetics in unfolded polypeptide chains provides an understanding of early steps in protein folding. Here, loop-closure in poly-glycine-serine peptides is investigated by combining single-molecule fluorescence spectroscopy with molecular dynamics simulation. For chains containing more than 10 peptide bonds loop-closing rate constants on the 20-100 nanosecond time range exhibit a power-law length dependence. However, this scaling breaks down for shorter peptides, which exhibit slower kinetics arising from a perturbation induced by the dye reporter system used in the experimental setup. The loop-closure kinetics in the longer peptides is found to be determined by the formation of intra-peptide hydrogen bonds and transient beta-sheet structure, that accelerate the search for contacts among residues distant in sequence relative to the case of a polypeptide chain in which hydrogen bonds cannot form. Hydrogen-bond-driven polypeptide-chain collapse in unfolded peptides under physiological conditions found here is not only consistent with hierarchical models of protein folding, that highlights the importance of secondary structure formation early in the folding process, but is also shown to speed up the search for productive folding events.

  9. Time-Periodic Solutions of Driven-Damped Trimer Granular Crystals

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Charalampidis, E. G.; Li, F.; Chong, C.; Yang, J.; Kevrekidis, P. G.

    2015-01-01

    We consider time-periodic structures of granular crystals consisting of alternate chrome steel (S) and tungsten carbide (W) spherical particles where each unit cell follows the pattern of a 2 : 1 trimer: S-W-S. The configuration at the left boundary is driven by a harmonic in-time actuation with given amplitude and frequency while the right one is a fixed wall. Similar to the case of a dimer chain, the combination of dissipation, driving of the boundary, and intrinsic nonlinearity leads to complex dynamics. For fixed driving frequencies in each of the spectral gaps, we find that the nonlinear surface modes and the statesmore » dictated by the linear drive collide in a saddle-node bifurcation as the driving amplitude is increased, beyond which the dynamics of the system becomes chaotic. While the bifurcation structure is similar for solutions within the first and second gap, those in the first gap appear to be less robust. We also conduct a continuation in driving frequency, where it is apparent that the nonlinearity of the system results in a complex bifurcation diagram, involving an intricate set of loops of branches, especially within the spectral gap. The theoretical findings are qualitatively corroborated by the experimental full-field visualization of the time-periodic structures.« less

  10. The effect of diamagnetic flows on turbulent driven ion toroidal rotation

    SciTech Connect (OSTI)

    Lee, J. P.; Barnes, M.; Parra, F. I.; Belli, E. A.; Candy, J.

    2014-05-15

    Turbulent momentum redistribution determines the radial profile of rotation in a tokamak. The momentum transport driven by diamagnetic flow effects is an important piece of the radial momentum transport for sub-sonic rotation, which is often observed in experiments. In a non-rotating state, the diamagnetic flow and the E B flow must cancel. The diamagnetic flow and the E B flow have different effects on the turbulent momentum flux, and this difference in behavior induces intrinsic rotation. The momentum flux is evaluated using gyrokinetic equations that are corrected to higher order in the ratio of the poloidal Larmor radius to the minor radius, which requires evaluation of the diamagnetic corrections to Maxwellian equilibria. To study the momentum transport due to diamagnetic flow effects, three experimental observations of ion rotation are examined. First, a strong pressure gradient at the plasma edge is shown to result in a significant inward momentum transport due to the diamagnetic effect, which may explain the observed peaking of rotation in a high confinement mode. Second, the direction of momentum transport is shown to change as collisionality increases, which is qualitatively consistent with the observed reversal of intrinsic rotation by varying plasma density and current. Last, the dependence of the intrinsic momentum flux on the magnetic shear is found, and it may explain the observed rotation changes in the presence of lower hybrid current drive.

  11. Kinetic mix mechanisms in shock-driven inertial confinement fusion implosions

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Rinderknecht, H. G.; Sio, H.; Li, C. K.; Hoffman, N.; Zylstra, A. B.; Rosenberg, M. J.; Frenje, J. A.; Gatu Johnson, M.; Seguin, F. H.; Petrasso, R. D.; et al

    2014-05-19

    Shock-driven implosions of thin-shell capsules, or ''exploding pushers,'' generate low-density, high-temperature plasmas in which hydrodynamic instability growth is negligible and kinetic effects can play an important role. Data from implosions of thin deuterated-plastic shells with hydroequivalent D3He gas fills ranging from pure deuterium to pure 3He [H. G. Rinderknecht et al., Phys. Rev. Lett. 112, 135001 (2014)] were obtained to evaluate non-hydrodynamic fuel-shell mix mechanisms. Simulations of the experiments including reduced ion kinetic models support ion diffusion as an explanation for these data. Several additional kinetic mechanisms are investigated and compared to the data to determine which are important inmore » the experiments. Shock acceleration of shell deuterons is estimated to introduce mix less than or comparable to the amount required to explain the data. Beam-target mechanisms are found to produce yields at most an order of magnitude less than the observations« less

  12. A data-driven approach for retrieving temperatures and abundances in brown dwarf atmospheres

    SciTech Connect (OSTI)

    Line, Michael R.; Fortney, Jonathan J.; Marley, Mark S.; Sorahana, Satoko

    2014-09-20

    Brown dwarf spectra contain a wealth of information about their molecular abundances, temperature structure, and gravity. We present a new data driven retrieval approach, previously used in planetary atmosphere studies, to extract the molecular abundances and temperature structure from brown dwarf spectra. The approach makes few a priori physical assumptions about the state of the atmosphere. The feasibility of the approach is first demonstrated on a synthetic brown dwarf spectrum. Given typical spectral resolutions, wavelength coverage, and noise, property precisions of tens of percent can be obtained for the molecular abundances and tens to hundreds of K on the temperature profile. The technique is then applied to the well-studied brown dwarf, Gl 570D. From this spectral retrieval, the spectroscopic radius is constrained to be 0.75-0.83 R {sub J}, log (g) to be 5.13-5.46, and T {sub eff} to be between 804 and 849 K. Estimates for the range of abundances and allowed temperature profiles are also derived. The results from our retrieval approach are in agreement with the self-consistent grid modeling results of Saumon et al. This new approach will allow us to address issues of compositional differences between brown dwarfs and possibly their formation environments, disequilibrium chemistry, and missing physics in current grid modeling approaches as well as a many other issues.

  13. 9 GeV energy gain in a beam-driven plasma wakefield accelerator

    DOE Public Access Gateway for Energy & Science Beta (PAGES Beta)

    Litos, M.; Adli, E.; Allen, J. M.; An, W.; Clarke, C. I.; Corde, S.; Clayton, C. E.; Frederico, J.; Gessner, S. J.; Green, S. Z.; et al

    2016-02-15

    An electron beam has gained a maximum energy of 9 GeV per particle in a 1.3 m-long electron beam-driven plasma wakefield accelerator. The amount of charge accelerated in the spectral peak was 28.3 pC, and the root-mean-square energy spread was 5.0%. The mean accelerated charge and energy gain per particle of the 215 shot data set was 115 pC and 5.3 GeV, respectively, corresponding to an acceleration gradient of 4.0 GeV m-1 at the spectral peak. Moreover, the mean energy spread of the data set was 5.1%. Our results are consistent with the extrapolation of the previously reported energy gainmore » results using a shorter, 36 cm-long plasma source to within 10%, evincing a non-evolving wake structure that can propagate distances of over a meter in length. Wake-loading effects were evident in the data through strong dependencies observed between various spectral properties and the amount of accelerated charge.« less

  14. Enhanced Component Performance Study: Motor-Driven Pumps 1998–2012

    SciTech Connect (OSTI)

    T. E. Wierman

    2013-10-01

    This report presents an enhanced performance evaluation of motor-driven valves (MDPs) at U.S. commercial nuclear power plants. The data used in this study are based on the operating experience failure reports from fiscal year 1998 through 2012 for the component reliability as reported in the Equipment Performance and Information Exchange (EPIX). The MDP failure modes considered for standby systems are failure to start, failure to run less than or equal to 1 hour, and failure to run more than 1 hour; for normally running systems, the failure modes considered are failure to start and failure to run. An 8 hr unreliability estimate is also calculated and trended. The component reliability estimates and the reliability data are trended for the most recent 10-year period while yearly estimates for reliability are provided for the entire active period. One statistically significant increasing trend was identified in the MDP results for standby MDP run hours per reactor critical year. Statistically significant decreasing trends were identified for unreliability (for standby and normally running systems) frequency of failure-to-start events for standby systems and failure probability for standby systems.

  15. Kinetic mix mechanisms in shock-driven inertial confinement fusion implosions

    SciTech Connect (OSTI)

    Rinderknecht, H. G.; Sio, H.; Li, C. K.; Hoffman, N.; Zylstra, A. B.; Rosenberg, M. J.; Frenje, J. A.; Gatu Johnson, M.; Seguin, F. H.; Petrasso, R. D.; Betti, R.; Yu Glebov, V.; Meyerhofer, D. D.; Sangster, T. C.; Seka, W.; Stoeckl, C.; Kagan, G.; Molvig, K.; Bellei, C.; Amendt, P.; Landen, O.; Rygg, J. R.; Smalyuk, V. A.; Wilks, S.; Greenwood, A.; Nikroo, A.

    2014-05-19

    Shock-driven implosions of thin-shell capsules, or ''exploding pushers,'' generate low-density, high-temperature plasmas in which hydrodynamic instability growth is negligible and kinetic effects can play an important role. Data from implosions of thin deuterated-plastic shells with hydroequivalent D3He gas fills ranging from pure deuterium to pure 3He [H. G. Rinderknecht et al., Phys. Rev. Lett. 112, 135001 (2014)] were obtained to evaluate non-hydrodynamic fuel-shell mix mechanisms. Simulations of the experiments including reduced ion kinetic models support ion diffusion as an explanation for these data. Several additional kinetic mechanisms are investigated and compared to the data to determine which are important in the experiments. Shock acceleration of shell deuterons is estimated to introduce mix less than or comparable to the amount required to explain the data. Beam-target mechanisms are found to produce yields at most an order of magnitude less than the observations

  16. Evaluation of lightning accommodation systems for wind-driven turbine rotors

    SciTech Connect (OSTI)

    Bankaitis, H

    1982-03-01

    Several concepts of lightning accommodation systems for wind-driven turbine rotor blades were evaluated by submitting them to simulated lightning tests. Test samples representative of epoxy-fiberglass and wood-epoxy composite structural materials were submitted to a series of high-voltage and high-current damage tests. The high-voltage tests were designed to determine the strike points and current paths through the sample and the need for, and the most proper type of, lightning accommodation. The high-current damage tests were designed to determine the capability of the potential lightning accommodation system to sustain the 200-kA lightning current without causing damage to the composite structure. The observations and data obtained in the series of tests of lightning accommodation systems clearly led to the conclusions that composite-structural-material rotor blades require a lightning accommodation system; that the concepts tested prevent internal streamering; and that keeping discharge currents on the blade surface precludes structure penetration. Induced voltage effects or any secondary effects on the integral components of the total system could not be addressed. Further studies should be carried out to encompass effects on the total system design.

  17. Direct match data flow machine apparatus and process for data driven computing

    DOE Patents [OSTI]

    Davidson, George S.; Grafe, Victor Gerald

    1997-01-01

    A data flow computer and method of computing is disclosed which utilizes a data driven processor node architecture. The apparatus in a preferred embodiment includes a plurality of First-In-First-Out (FIFO) registers, a plurality of related data flow memories, and a processor. The processor makes the necessary calculations and includes a control unit to generate signals to enable the appropriate FIFO register receiving the result. In a particular embodiment, there are three FIFO registers per node: an input FIFO register to receive input information form an outside source and provide it to the data flow memories; an output FIFO register to provide output information from the processor to an outside recipient; and an internal FIFO register to provide information from the processor back to the data flow memories. The data flow memories are comprised of four commonly addressed memories. A parameter memory holds the A and B parameters used in the calculations; an opcode memory holds the instruction; a target memory holds the output address; and a tag memory contains status bits for each parameter. One status bit indicates whether the corresponding parameter is in the parameter memory and one status but to indicate whether the stored information in the corresponding data parameter is to be reused. The tag memory outputs a "fire" signal (signal R VALID) when all of the necessary information has been stored in the data flow memories, and thus when the instruction is ready to be fired to the processor.

  18. Effect of resistivity gradient on laser-driven electron transport and ion acceleration

    SciTech Connect (OSTI)

    Zhuo, H. B.; Yang, X. H.; Ma, Y. Y.; Li, X. H.; Zhou, C. T.; Institute of Applied Physics and Computational Mathematics, Beijing 100094 ; Yu, M. Y.; Institute for Theoretical Physics I, Ruhr University, Bochum D-44780

    2013-09-15

    The effect of resistivity gradient on laser-driven electron transport and ion acceleration is investigated using collisional particle-in-cell simulation. The study is motivated by recent proton acceleration experiments [Gizzi et al., Phys. Rev. ST Accel. Beams 14, 011301 (2011)], which showed significant effect of the resistivity gradient in layered targets on the proton angular spread. This effect is reproduced in the present simulations. It is found that resistivity-gradient generation of magnetic fields and inhibition of electron transport is significantly enhanced when the feedback interaction between the magnetic field and the fast-electron current is included. Filamentation of the laser-generated hot electron jets inside the target, considered as the origin of the nonuniform proton patterns observed in the experiments, is clearly suppressed by the resistive magnetic field. As a result, the electrostatic sheath field at the target back surface acquires a relatively smooth profile, which contributes to the superior quality of the proton beams accelerated off layered targets in the experiments.

  19. Performance of a double-effect absorption chiller driven by ICPC solar collectors

    SciTech Connect (OSTI)

    Bergquam, J.B.; Duff, W.S.; Brezner, J.M.; Henkel, E.T.; Winston, R.; O'Gallagher, J.; Sethi, P.

    1999-07-01

    This paper presents experimental data and analytical results describing the performance of a 70 kW (20 ton), water-fired, double-effect absorption chiller. The chiller is driven by a 106 m{sup 2} array of integrated compound parabolic concentrator (ICPC) solar collectors. For this project, an existing gas-fired chiller was modified to operate on hot water. The water was heated by an array of 336 evacuated ICPC tubes. Each tube has an effective area of 0.317 m{sup 2}. The chiller and collector array are part of a complete solar HVAC system that provides air conditioning and space heating for a 743 m{sup 2} (8,000 ft{sup 2}) commercial building in Sacramento, CA. The other components of the HVAC system are a high temperature storage tank, a cooling tower, a gas-fired back-up boiler and five 14 kW (4 ton) cooling/heating fan coil units. The experimental data are used to determine; (1) the efficiency of the collectors; (2) the coefficient of performance of the chiller; and (3) the overall energy balance on the system. Computer models have also been developed to predict the performance and to optimize the design and operating characteristics of the HVAC system.

  20. Drainage capture and discharge variations driven by glaciation in the Southern Alps, New Zealand

    SciTech Connect (OSTI)

    Ann V. Rowan; Mitchell A. Plummer; Simon H. Brocklehurst; Merren A. Jones; David M. Schultz

    2013-02-01

    Sediment flux in proglacial fluvial settings is primarily controlled by discharge, which usually varies predictably over a glacial–interglacial cycle. However, glaciers can flow against the topographic gradient to cross drainage divides, reshaping fluvial drainage networks and dramatically altering discharge. In turn, these variations in discharge will be recorded by proglacial stratigraphy. Glacial-drainage capture often occurs in alpine environments where ice caps straddle range divides, and more subtly where shallow drainage divides cross valley floors. We investigate discharge variations resulting from glacial-drainage capture over the past 40 k.y. for the adjacent Ashburton, Rangitata, and Rakaia basins in the Southern Alps, New Zealand. Although glacial-drainage capture has previously been inferred in the range, our numerical glacier model provides the first quantitative demonstration that this process drives larger variations in discharge for a longer duration than those that occur due to climate change alone. During the Last Glacial Maximum, the effective drainage area of the Ashburton catchment increased to 160% of the interglacial value with drainage capture, driving an increase in discharge exceeding that resulting from glacier recession. Glacial-drainage capture is distinct from traditional (base level–driven) drainage capture and is often unrecognized in proglacial deposits, complicating interpretation of the sedimentary record of climate change.