Powered by Deep Web Technologies
Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


1

12. J. A. Hoch, Curr. Opin. Microbiol. 3, 165 (2000). 13. J. M. Boyd, Mol. Microbiol. 36, 153 (2000).  

E-Print Network [OSTI]

). 14. R. B. Jensen, S. C. Wang, L. Shapiro, Nature Rev. Mol. Cell. Biol. 3, 167 (2002). 15. P. Viollier, 177 (2000). 19. C. Jacobs, D. Hung, L. Shapiro, Proc. Natl. Acad. Sci. U.S.A. 98, 4095 (2001). 20. M. T. Laub, H. H. McAdams, T. Feldblyum, C. M. Fraser, L. Shapiro, Science 290, 2144 (2000). 21. I. J

Seydoux, Geraldine

2

J. Mol. Biol. (1988) 201, 751-754 Aromatic Rings Act as Hydrogen  

E-Print Network [OSTI]

J. Mol. Biol. (1988) 201, 751-754 Aromatic Rings Act as Hydrogen Bond Acceptors Michael Levitt that there is a significant interaction between a hydrogen bond donor (like the > NH group) and the centre of a benzene ring, which acts as a hydrogen bond acceptor. This interaction, hvdrogen bond, which is about half as strong

Levitt, Michael

3

J. Mol. Biol. (1996) 264, 11641179 How to Derive a Protein Folding Potential? A New  

E-Print Network [OSTI]

J. Mol. Biol. (1996) 264, 1164­1179 How to Derive a Protein Folding Potential? A New Approach of deriving a pairwise potentialHarvard University Department of Chemistry for protein folding. The potential of accuracy. 7 1996 Academic Press Limited *Corresponding author Keywords: protein folding; protein folding

Mirny, Leonid

4

J. Mol. Biol. (1975) 91, 101-120 A Neutron Scattering Study of the Distribution of Protein  

E-Print Network [OSTI]

J. Mol. Biol. (1975) 91, 101-120 A Neutron Scattering Study of the Distribution of Protein and RNA coli have been measured by neutron scattering experiments on the intact subunit. In addition the radius, 1972; Lutter et al., 1972), and neutron scattering (Engelman & Moore, 1972; Moore et al., 1974

5

Simultaneous cell growth and ethanol production from cellulose by an engineered yeast consortium displaying a functional mini-cellulosome  

E-Print Network [OSTI]

Cellulase, clostridia, and ethanol. Microbiol Mol Biol RevNext- generation cellulosic ethanol technologies and theirProduction of cellulosic ethanol in Saccharomyces cerevisiae

Goyal, Garima; Tsai, Shen-Long; Madan, Bhawna; DaSilva, Nancy A; Chen, Wilfred

2011-01-01T23:59:59.000Z

6

Appl Microbiol Biotechnol (2003) 62:291296 DOI 10.1007/s00253-003-1297-4  

E-Print Network [OSTI]

Appl Microbiol Biotechnol (2003) 62:291­296 DOI 10.1007/s00253-003-1297-4 O R I G I N A L P A P E R

Daugulis, Andrew J.

7

J. Mol. Biol. (1995) 252, 672708 Acid and Thermal Denaturation of Barnase  

E-Print Network [OSTI]

.g. on tyrosine and tryptophan sidechains. The hydrogen-bonding propensity of the water molecules tends structural elements, where water molecules compete with the interstrand and intrahelical hydrogen bonds state to a partially unfoldedDepartment of Chemistry conformation has been studied by molecular dynamics

Caflisch, Amedeo

8

J. Mol. Biol. (1995) 254, 856868 Modelling Viral Evolution in Vitro Using exo-  

E-Print Network [OSTI]

-helix Present address: c/o Professor John M. Burke, Department of Microbiology and Molecular Genetics viruses and small (Gilbert & Dressler, 1968), the crucial 0022

Walter, Nils G.

9

J. Mol. Biol. (1984) 177, 201-206 Some X-ray Diffraction Patterns from  

E-Print Network [OSTI]

awaits a molecular model. In vivo and in vitro produced two-dimensional sheets and helices have been methanol (type M) or a mixture of methanol and ethylene glycol (type ME). Sharp, resolvable patterns% (v v methanol at pH 8.7, using a modified version of' the/ ) crystallization method described

Yonath, Ada E.

10

J. Mol. Biol. (1996) 259, 970987 Solution Structure of the Granular Starch Binding  

E-Print Network [OSTI]

, 1991; PDB, accession code, 1cgt); 1D, one-dimensional; 2D, two-dimensional; 3D, three-dimensional; bCD (Lawson et al. 1994; PDB accession code, 1cdg); 1CGT, crystal structure of free CGTase (Klein & Schulz

Williamson, Mike P.

11

Crit Rev Biochem Mol Biol . Author manuscript AMPK inhibition in health and disease  

E-Print Network [OSTI]

that repeatedly reassess the status of amassed energy, in order to adapt energy supply to demand. The AMP Pathology4 Mayo Clinic , 200 First Street SW Rochester, MN 55905,US * Correspondence should be adressed to-activated protein kinase (AMPK) heterotrimer has emerged as an important integrator of signals managing energy

Boyer, Edmond

12

J. Mol. Biol. (1996) 259, 988994 Local Interactions Dominate Folding in a Simple  

E-Print Network [OSTI]

Unger1,2 * and John Moult2 Recent computational studies of simple models of protein folding have1 Press Limited Keywords: protein folding; lattice models; local interactions*Corresponding author Introduction What are the dominant contributions guiding the process of protein folding? The short life

Unger, Ron

13

6. T. D. Brock and J. Gustafson, Appl. Environ. Micro-biol. 32, 567 (1976); D. R. Boone et al., Int. J. Syst.  

E-Print Network [OSTI]

. Bjornstad et al., Ground Water Moni- toring Remediation 14, 140 (1994). 12. R. G. Arnold, T. J. Di

Goodrich, Lisa V.

14

JMB--MS 422 Cust. Ref. No. CAM 502/94 [SGML] J. Mol. Biol. (1995) 247, 536540  

E-Print Network [OSTI]

(Chothia, 1984; Finkelstein & Ptitsyn, 1987) and provide the basis for the classification of protein folds (1993). An extensive bibliography of papers on the classification and the determinants of protein folds

15

J. Mol. Biol. (1990) 213, 215-218 X-ray Crystal Structure of a Recombinant Human Myoglobin  

E-Print Network [OSTI]

at 2-8 A Resolution Stevan R. Hubbard, Wayne A. Hendrickson Howard Hughes Medical Institute Department been collected on film at the National Synchrotron Light Source (Brookhaven) and will be used for high

Boxer, Steven G.

16

Yeast Polysome Profiles Adapted from Baim et al., 1985, Mol. Cell. Biol. 5(8):1839-46.  

E-Print Network [OSTI]

of yeast, swirl, and pour into precooled 50 ml tube in ice water. Rapid cooling is essential. Hold in ice vigorously eight times for 15 sec each with 30 sec cooling on ice between each burst. It is essential to get yeast, make sure all solutions are at 4°C. Have stock of 5 mg/ml cyclohexamide thawed and on ice. Have

Aris, John P.

17

J. Mol. Biol. (1981) 153, 739-760 Positions of Proteins S6, Sl 1 and S15 in the  

E-Print Network [OSTI]

on neutron scattering, is presented and discussed. Estimates for the radii of gyration of these proteins in the neutron scattering pattern of the overall particle when the two are present in deuterated form. This alteration is measured as the difference between the neutron scattering profile of an equimolar mixture

18

J. Mol. Biol. (1977) 112, 199-234 Triangulation of Proteins in the 30 S Ribosomal Subunit of  

E-Print Network [OSTI]

, and in revised form 21 January 1977) Thermal neutron radiation has been used for solution scattering experiments are elongated. 1. Introduction Thermal neutron scattering is a powerful method to use in the study of the quater al., 1975a,b) demonstrated that the inter- ference ripple which results when neutrons are scattered

19

J. Mol. Biol. (1979) 134, 595-620 Positions of Proteins SlO, Sll and S12 in the  

E-Print Network [OSTI]

between proteins in the 30 S subunit of Esch.&chia coli by neutron scattering was demonstratjed several). The neutron scattering profiles for solutions of both mixtures are measured and then differenced point. Y. 11973, U.S.A. (Received 9 April 1979) The results of 17 new neutron distance measurements

20

Rev. Brasil. Biol., 60(4): 683-687 Deladenus siricidicola PARASITISM EVALUATION ADULT Sirex noctilio 683  

E-Print Network [OSTI]

Rev. Brasil. Biol., 60(4): 683-687 Deladenus siricidicola PARASITISM EVALUATION ADULT Sirex, parasitismo, controle biológico. #12;Rev. Brasil. Biol., 60(4): 683-687 684 FENILI, R. et al. INTRODUCTION

Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


21

BIOLOGY (BIOL) PROFESSORS HURD, I'ANSON, KNOX, SIMURDA,  

E-Print Network [OSTI]

137Biology BIOLOGY (BIOL) PROFESSORS HURD, I'ANSON, KNOX, SIMURDA, WIELGUS ASSOCIATE PROFESSORS, register for Mathematics 101 and a laboratory science course in the biology or chemistry departments. The biology major leading to a Bachelor of Science degree consists of 50 credits in science and mathemat- ics

Dresden, Gregory

22

BIOL 303, Ecology Study guide for Exam1, Spring 2011  

E-Print Network [OSTI]

BIOL 303, Ecology Study guide for Exam1, Spring 2011 1. The sun is so far from the earth this produce the observed global distribution of wet and dry climates along the NorthSouth axis? 3. Given global temperature responds to the addition of CO2. Understand this figure thoroughly, because

Creel, Scott

23

Biol 2605 Marine Life of Nova Scotia -Syllabus Instructor: Dave Keith: email -keithdm@dal.ca. Office: Biol 4050  

E-Print Network [OSTI]

Biol 2605 Marine Life of Nova Scotia - Syllabus Instructor: Dave Keith: email - keithdm Centre ­ Students should wear sneakers or (preferably) hiking/waterproof boots on field trips (water Textbooks: 1. Marine Biology 8th Edition (Castro and Huber) - Recommended & available from in- structor 2

Iverson, Sara

24

Mol. Biol. Evol. 17(12):17761788. 2000 2000 by the Society for Molecular Biology and Evolution. ISSN: 0737-4038  

E-Print Network [OSTI]

and Evolution. ISSN: 0737-4038 A Case for Evolutionary Genomics and the Comprehensive Examination of Sequence; Department of Biological Sciences, Louisiana State University at Baton Rouge; Institute for Genomic Research, Gaithersburg, Maryland; §Genomics Group, Bioscience Division, Los Alamos National Laboratory, Los Alamos, New

Pollock, David

25

COMPETENT CELLS (based on Hanahan 1983 J Mol Biol 166, 557580) STREAK a fresh plate the day before inoculation from parent stock (NOT previous  

E-Print Network [OSTI]

mM KCl 10 mM CaCl2 15% w/v glycerol Mix well, pH to 5.8 with 0.2 M acetic acid Tfb2: filterM KCl 75 mM CaCl2 15% w/v glycerol #12;

Cross, George

26

J. Mol. Biol. (1984) 174, 265284 Positions of Proteins S14, S18 and S20 in the 30 S Ribosomal  

E-Print Network [OSTI]

scattering. Since then, a large number of pairwise distances have been estimated by the neutron method measuringinterprotein distancesby neutron scattering in the ribosome have been described at both the theoretical alld on the fact that, the substitution of `H for `H in a biopolymer substantially alters its neutron scattering

27

Mol. Biol. Evol. 18(4):627638. 2001 2001 by the Society for Molecular Biology and Evolution. ISSN: 0737-4038  

E-Print Network [OSTI]

to morphological evolution. For ex- ample, naturally occurring alleles of the MADS box transcription factor within the Andropogoneae. The phylogeny suggests that the tribe underwent a rapid radiation during its

Doebley, John

28

J Biol Phys DOI 10.1007/s10867-011-9240-x  

E-Print Network [OSTI]

J Biol Phys DOI 10.1007/s10867-011-9240-x ORIGINAL PAPER Disentangling signaling gradients and Physics of Complex Systems, Weizmann Institute of Science, Rehovot 76100, Israel e-mail: naama

Barkai, Naama

29

744 Mol. BioSyst., 2012, 8, 744752 This journal is c The Royal Society of Chemistry 2012 Cite this: Mol. BioSyst., 2012, 8, 744752  

E-Print Network [OSTI]

: Mol. BioSyst., 2012, 8, 744­752 Dissecting ensemble networks in ES cell populations reveals micro in pluripotency in eighty-three ES cells to create Gene Regulatory Networks (GRNs) at the single cell level. We is associated with a collection of active sub-networks, with differing degrees of connectivity between

Babu, M. Madan

30

This journal is c The Royal Society of Chemistry 2012 Mol. BioSyst., 2012, 8, 4757 47 Cite this: Mol. BioSyst., 2012, 8, 4757  

E-Print Network [OSTI]

: Mol. BioSyst., 2012, 8, 47­57 Intrinsically disordered regions as affinity tuners in protein-binding proteins and play a crucial role by increasing the affinity and specificity of DNA binding. Disordered disordered linkers in multidomain proteins that mediate the cross-talks between the constituent domains

Martin, Jan M.L.

31

E-Print Network 3.0 - accords conclus par Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Biology and Medicine 3 12. J. A. Hoch, Curr. Opin. Microbiol. 3, 165 (2000). 13. J. M. Boyd, Mol. Microbiol. 36, 153 (2000). Summary: of PAR-1 function may facilitate the...

32

INTEGR. COMP. BIOL., 45:377385 (2005) Biodiversity, molecular ecology and phylogeography of marine sponges: patterns,  

E-Print Network [OSTI]

microevolutionary processes and molecular ecology. INTRODUCTION Molecular studies in marine biodiversity and ecol377 INTEGR. COMP. BIOL., 45:377­385 (2005) Biodiversity, molecular ecology and phylogeography of marine sponges: patterns, implications and outlooks1 GERT WO¨ RHEIDE,2, * ANTONIO M. SOLE´-CAVA, AND JOHN

Solé-Cava, Antonio M.

33

Reference: Biol. Bull. 196: 257-264. (June 1999) Physiological Functioning of Carbonic Anhydrase in  

E-Print Network [OSTI]

, high levels of carbonic anhydrase. Introduction The giant hydrothermal vent tubeworm Riftia pachyptilaReference: Biol. Bull. 196: 257-264. (June 1999) Physiological Functioning of Carbonic Anhydrase in the Hydrothermal Vent Tubeworm Riftia Pachyptila SHANA K. GOFFREDI", PETER R. GIRGUIS, JAMES J. CHILDRESS

Girguis, Peter R.

34

This journal is c The Royal Society of Chemistry 2010 Integr. Biol. Microfluidics for bacterial chemotaxisw  

E-Print Network [OSTI]

This journal is c The Royal Society of Chemistry 2010 Integr. Biol. Microfluidics for bacterial 2010 DOI: 10.1039/c0ib00049c Microfluidics is revolutionizing the way we study the motile behavior system to understand how cells and organisms sense and respond to gradients. Using microfluidics to study

Shimizu, Tom

35

SEABED: Small molEcule activity scanner weB servicE baseD  

Science Journals Connector (OSTI)

......SEABED: Small molEcule activity scanner weB servicE baseD Carlos Fenollosa 1 2 Marcel...Alfonso Valencia Motivation: The SEABED web server integrates a variety of docking and...SEABED goes beyond the basic docking and QSAR web tools and implements extended functionalities......

Carlos Fenollosa; Marcel Otn; Pau Andrio; Jorge Corts; Modesto Orozco; J. Ramon Goi

2014-11-01T23:59:59.000Z

36

J. Mol. Riol. (1991) 222, 1085-1108 Complementary Recognition in Condensed DNA: Accelerated  

E-Print Network [OSTI]

J. Mol. Riol. (1991) 222, 1085-1108 Complementary Recognition in Condensed DNA: Accelerated DNA) Condensation of denatured DNA greatly accelerates the kinetics of DNA renaturation. We propose a unifying explanation for the effects of several accelerating solvents studied here including polymers, di

Church, George M.

37

TaylorbtFranci s INT . J . RADIAT . BIOL 2002, voL. 78, NO . 9, 765--772  

E-Print Network [OSTI]

TaylorbtFranci s INT . J . RADIAT . BIOL 2002, voL. 78, NO . 9, 765--772 healthsciences Higher-mail: ghoffmann@holycross.edu tDepartment of Biology, College of the Holy Cross, Worcester , MA 01610, USA

38

May 13, 1998 Gas Frac. Mol.Wt. Density Speci c Ht. Boil. Pt.  

E-Print Network [OSTI]

. Automatic switch from empty to full bottles DataLink ethernet 4 #12;Gas Mixing Station Four independent gas.Rate Normal Rate Station of Gas SCCM SCCM SCCM Barrel HFC-134a 0.32 10,000 3,200 1,240 Inner Ar 1.37 5,000 6K.Abe Gas System May 13, 1998 RPC Gas Gas Frac. Mol.Wt. Density Speci c Ht. Boil. Pt. g=l cal=g c c

Llope, William J.

39

Laboratory Hydro-mechanical Characterisation of Boom Clay at Essen and Mol Y. F. Deng1, 2  

E-Print Network [OSTI]

of 220 - 260 m and from HADES that is the underground rock laboratory at Mol in Belgium, at 223-m depth facility called HADES (High-Activity Disposal Experimental Site) excavated at 223-m depth close to the city

Paris-Sud XI, Université de

40

Enhancing the Promiscuous Phosphotriesterase Activity of a Thermostable Lactonase (GkaP) for the Efficient Degradation of Organophosphate Pesticides  

Science Journals Connector (OSTI)

...sp. Appl. Environ. Microbiol. 57 :812-819. 47. Tehei, M , D Madern, B Franzetti and G Zaccai. 2005. Neutron scattering reveals the dynamic basis of protein adaptation to extreme temperature. J. Biol. Chem. 280 :40974-40979...

Yu Zhang; Jiao An; Wei Ye; Guangyu Yang; Zhi-Gang Qian; Hai-Feng Chen; Li Cui; Yan Feng

2012-07-13T23:59:59.000Z

Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


41

REPORT: RHRDUN02_E1 REGISTERED STUDENTS BY COLLEGE AND MAJOR PAGE 1 DATE: 10-23-2014  

E-Print Network [OSTI]

St-Anth Int-5yrPS Dept Total HIST History Dept Total HDP Pr-HumnDev Human Dev Dept Total GLBH Global Hlt Dept/Chem Dept Total CGS CritGendSt Dept Total CENG Chem Engin Dept Total BIOL PhyslNeuro Molec Biol Microbiol Human Bio Genl Biol Ec/Beh/Evo BiolBioinf Bioc/CellB Dept Total BENG Bioengin BioengBiot Bioeng

Talley, Lynne D.

42

11388 Biochemistry 1991, 30, 1 1388-1 1402 Patel, D. J., & Shapiro, L. (1986) J. Biol. Chem. 261,  

E-Print Network [OSTI]

11388 Biochemistry 1991, 30, 1 1388-1 1402 Patel, D. J., & Shapiro, L. (1986) J. Biol. Chem. 261- Stevens, E. S.,Sugawara, N., Bonora, G. M., & Toniolo, C. Stokke, T., & Steen, H. B. (1985) J Magnetic Resonance Spectroscopy, Academic Press, London and New York. Teng, M.-K., Usman, N., Frederick, C

Williams, Loren

43

Hexabromo- and hexaiododisilane: small and simple molecules showing completely different crystal structures  

Science Journals Connector (OSTI)

Si2Br6 and Si2I6 were prepared through dephenylation of hexaphenyldisilane with acetyl bromide or acetyl iodide in the presence of the corresponding aluminium halide. It is interesting to note that Si2Br6 and Si2I6 do not form isomorphous structures. Moreover, an orthorhombic polymorph of the present structure of Si2I6 is already known. Although the title compounds feature such small and simple molecules they show completely different crystal structures.

Berger, M.

2014-10-24T23:59:59.000Z

44

2004;2:692-701. Published online January 5, 2005.Mol Cancer Res Mauro Bordin, Fabio D'Atri, Laurent Guillemot, et al.  

E-Print Network [OSTI]

2004;2:692-701. Published online January 5, 2005.Mol Cancer Res Mauro Bordin, Fabio D'Atri, Laurent.aacrjournals.orgDownloaded from #12;Histone Deacetylase Inhibitors Up-Regulate the Expression of Tight Junction Proteins Mauro

Halazonetis, Thanos

45

J. Phys. B: At. Mol. Phys. 16 (1983) 1595-1603. Printed in Great Britain Atomic orbital expansion study of electron capture in  

E-Print Network [OSTI]

J. Phys. B: At. Mol. Phys. 16 (1983) 1595-1603. Printed in Great Britain Atomic orbital expansion of H+ and Hez+ ions with Li atoms. The calculated total and partial transfer cross sections constitute.1-2.0keVamu-' for HeZ++Li collisions. Total capture cross sections are found to agree well

Lin, Chii-Dong

46

J. Phys. B: At. Mol. Opt. Phys. 29 (1996) 47714786. Printed in the UK Angular distributions of high-order harmonics generated  

E-Print Network [OSTI]

distributions of high-order harmonics generated with a femtosecond Cr:LiSrAlF6 laser. We investigate-atom response. The far-field distributions of the harmonics (11 to 41) generated in heavy rare gases are foundJ. Phys. B: At. Mol. Opt. Phys. 29 (1996) 4771­4786. Printed in the UK Angular distributions

Ditmire, Todd

47

Tanikawa C et al. Mol Cancer Res 8: 855-863, 2010. Tanikawa C et al. Cancer Res 69: 8761-9, 2009.  

E-Print Network [OSTI]

p53 p53 30000 p53 Tanikawa C et al. Mol Cancer Res 8: 855-863, 2010. Tanikawa C et al. Cancer Res 69: 8761-9, 2009. Tanikawa C et al.Oncogene 28: 3081-92, 2009. Morioka K et al. Cancer Science 100: 1227-1233, 2009. Kidokoro T et al. Oncogene 27: 1562-1571, 2008

Katsumoto, Shingo

48

int. j. radiat. biol 2002, vol. 78, no. 7, 593 604 Do low dose-rate bystander eVects in uence domestic radon risks?  

E-Print Network [OSTI]

int. j. radiat. biol 2002, vol. 78, no. 7, 593± 604 Do low dose-rate bystander eVects in uence that bystander radon risk estimation. eVects can be induced by high-LET radiation even Conclusions : Bystander e of inverse dose-rate eVects by high- exposed to low doses of low-LET radiation (SawantLET radiation

Brenner, David Jonathan

49

E-Print Network 3.0 - alternative neisseria spp Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

in symbiotic populations of Vibrio spp... adherence of Neisseria gonorrhoeae pilC double knock-out mutants. Mol Microbiol 17, 1057-1071. Rudel, T Source: McFall-Ngai,...

50

Rickettsia Sca2 is a bacterial formin-like mediator of actin-based motility  

E-Print Network [OSTI]

J Cell Biol. 154:785-97. Marchand, J.B. , P. Moreau, A.J Mol Biol. 369:1258-69. Marchand, J.B. , P. Moreau, A.of vesicle rocketing (Marchand et al. , 1995; Merrifield et

Haglund, Cathleen Margaret

2011-01-01T23:59:59.000Z

51

Biological safety cabinetry.  

Science Journals Connector (OSTI)

...Class II cabinets are used. The operator wears a ventilated suit that is supplied with...Meet. Biol. Safety Conf. 168. Rake, B. W. 1978. Influence of cross drafts on the...Microbiol. 36: 278-283. 169. Rake, B. W. 1980. Laboratory: effectiveness of a...

R H Kruse; W H Puckett; J H Richardson

1991-04-01T23:59:59.000Z

52

COSTBI-882; NO. OF PAGES 9 Please cite this article in press as: Babu MM, et al. Intrinsically disordered proteins: regulation and disease, Curr Opin Struct Biol (2011), doi:10.1016/j.sbi.2011.03.011  

E-Print Network [OSTI]

disordered proteins: regulation and disease, Curr Opin Struct Biol (2011), doi:10.1016/j.sbi.2011.03.011 Available online at www.sciencedirect.com Intrinsically disordered proteins: regulation and disease M Madan proteins (IDPs) are enriched in signaling and regulatory functions because disordered segments permit

Babu, M. Madan

53

Combining frequency and time domain approaches to systems with multiple spike train input and output  

E-Print Network [OSTI]

between neuronal spike trains. Prog Biophys Mol Biol Vapnikto systems with multiple spike train input and output D. R.Keywords Multiple spike trains Neural coding Maximum

Brillinger, D. R.; Lindsay, K. A.; Rosenberg, J. R.

2009-01-01T23:59:59.000Z

54

E-Print Network 3.0 - atp hydrolysis mechanism Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Physics ; Materials Science 12 Biochemistry 1988, 27, 1205-1212 1205 Ogata, R. T., & Gilbert, W. (1979) J. Mol. Biol. 132, 709. Summary: of ATP hydrolysis is greatly...

55

BPA COMMODITY LISTING July 2014 OM/FSS -O= Open Market/F= Federal Supply Bus. Sz. -S= Small Business/O= Other than Small MOL= Maximum Order Limit  

E-Print Network [OSTI]

BPA COMMODITY LISTING July 2014 OM/FSS - O= Open Market/F= Federal Supply Bus. Sz. - S= Small Business/O= Other than Small MOL= Maximum Order Limit B.P.A. # Vendor Name ATTN: Phone # City State/30/2014 O S $25,000.00 #12;BPA COMMODITY LISTING July 2014 B.P.A. # Vendor Name ATTN: Phone # City State

Rau, Don C.

56

BPA COMMODITY LISTING February 2014 OM/FSS -O= Open Market/F= Federal Supply Bus. Sz. -S= Small Business/O= Other than Small MOL= Maximum Order Limit  

E-Print Network [OSTI]

BPA COMMODITY LISTING February 2014 OM/FSS - O= Open Market/F= Federal Supply Bus. Sz. - S= Small Business/O= Other than Small MOL= Maximum Order Limit B.P.A. # Vendor Name ATTN: Phone # City State,000.00 #12;BPA COMMODITY LISTING February 2014 B.P.A. # Vendor Name ATTN: Phone # City State Expiration O

Rau, Don C.

57

BPA COMMODITY LISTING August 2014 OM/FSS -O= Open Market/F= Federal Supply Bus. Sz. -S= Small Business/O= Other than Small MOL= Maximum Order Limit  

E-Print Network [OSTI]

BPA COMMODITY LISTING August 2014 OM/FSS - O= Open Market/F= Federal Supply Bus. Sz. - S= Small Business/O= Other than Small MOL= Maximum Order Limit B.P.A. # Vendor Name ATTN: Phone # City State/30/2014 O S $25,000.00 #12;BPA COMMODITY LISTING August 2014 B.P.A. # Vendor Name ATTN: Phone # City State

Rau, Don C.

58

E-Print Network 3.0 - acetyltransferase positive cells Sample...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Hbo1. Mol. Cell. Biol. 26, 1098-1108. Iizuka, M... ). Nucleosomes positioned by ORC facilitate the initiation of DNA replication. Mol. Cell 7, 21-30. Lucas, I... Molecular...

59

How many metals does it take to fix N2? A mechanistic overview of biological nitrogen fixation  

Science Journals Connector (OSTI)

...Mol Biol 280 : 669 685 . 13 Mayer SM Lawson DM Gormal CA Roe SM Smith BE ( 1999 ) J Mol Biol 292 : 871 891 . 14 Jang SB...A Treatise on Dinitrogen Fixation , eds Hardy RWF Bottomley F Burns RC ( Wiley , New York ), pp 569 604 . 74 Kraulis PJ ( 1991...

James B. Howard; Douglas C. Rees

2006-01-01T23:59:59.000Z

60

A mutant RNA polymerase that forms unusual open promoter?complexes  

Science Journals Connector (OSTI)

...Biochemistry 24 : 2712 2723 , 3896304 . 4 Roe J-H Record M T Jr ( 1985 ) Biochemistry 24 : 4721 4726 , 2934084 . 5 Roe J-H Burgess R R Record M T Jr ( 1985 ) J Mol Biol 184...Mol Biol 267 : 47 59 , 9096206 . 19 Burns H Minchin S ( 1994 ) Nucleic Acids Res...

Konstantin Severinov; Seth A. Darst

1997-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


61

Synthetic fluid inclusions: XIII. Experimental determination of PVT properties in the system H{sub 2}O + 40 wt% NaCl + 5 mol% CO{sub 2} at elevated temperature and pressure  

SciTech Connect (OSTI)

The location of the liquid + vapor {yields} liquid phase boundary and the P-T slopes of iso-Th lines were determined for a constant composition of 40 {+-} 0.1 wt% NaCl 5 {+-} 0.15 mol% CO{sub 2} (both relative) to H{sub 2}O at high density. Synthetic fluid inclusions with this composition were formed in cold-seal pressure vessels at pressures of 2 and 4 kbar and temperatures between 350{degrees}C and 700{degrees}C. The inclusions were analyzed on a gas-flow heating/cooling stage to determine the temperatures of halite dissolution [Tm{sub (H+L+V{yields}L+V)}] and total homogenization [Th{sub (L+V{yields}L)}]. Addition to 40 wt% NaCl to an aqueous solution containing 5 mol% CO{sub 2} causes a significant shift of the liquid + vapor {yields} liquid boundary towards higher pressures. The slopes of the iso-Th lines decrease from 29.5 bars/{degrees}C for Th{sub (L+V{yields}L)} of 400{degrees}C, to 6.4 bars/{degrees}C for Th{sub (L+V{yields})} = 600{degrees}C. Addition of 5 mol% CO{sub 2} to an aqueous solution containing 40 wt% NaCl results in halite dissolution temperatures that are slightly higher (Tm{sub (H+L+V{yields}L+V)} {approx} 332{degrees}C) than the literature value of 323{degrees}C for the vapor-saturated liquidus of an H{sub 2}O-40 wt% NaCl mixture. Calculated molar volumes for 40 wt% NaCl + 5 mol% CO{sub 2} solutions at 2 and 4 kbar show trends that are similar to those of other compositions in the ternary system H{sub 2}O-CO{sub 2}-NaCl at the same pressures and temperatures. In the P-T range of this study, all excess volumes are negative and lie between the values for the compositions H{sub 2}O-5 mol% CO{sub 2} and H{sub 2}O-40 wt% NaCl. 30 refs., 6 figs., 2 tabs.

Schmidt, C.; Rosso, K.M.; Bodnar, R.J. [Virginia Polytechnic Institute and State Univ., Blackburg, VA (United States)] [Virginia Polytechnic Institute and State Univ., Blackburg, VA (United States)

1995-10-01T23:59:59.000Z

62

Ternary mutual diffusion coefficients of NaCl-SrCl/sub 2/-H/sub 2/O at 25/degrees/C. 2. Total concentrations of 2. 0 and 3. 0 mol/times/dm/sup /minus/3/  

SciTech Connect (OSTI)

Mutual diffusion coefficients were measured for aqueous NaCl-SrCl/sub 2/ mixtures at 25/degrees/C by using free-diffusion Rayleigh interferometry. These mixtures were total molarities of 2.0 and 3.0 mol/times/dm/sup /minus/3/ with molarity fractions of 2/3, 1/2, and 1/3, the results complement the authors earlier data at 0.5 and 1.0 mol/times/dm/sup /minus/3/. At a constant molarity ratio, the NaCl main-term coefficient decreases regularly by 19-36% with increasing concentration, in contrast, the SrCl/sub 2/ main-term coefficient is relatively constant, with 18% or less variation with concentration. The SrCl/sub 2/ cross-term coefficient is 7-23% of its corresponding main-term coefficient, whereas the NaCl cross-term coefficient varies from 8% to 73% of its corresponding main-term coefficient. Clearly, coupled diffusion is very important for these systems. Various estimation procedures were considered, including variations using the Nernst-Hartley equations and estimates from the corresponding binary solutions. None of these methods, for which sufficient auxiliary data are available, gave reliable estimates of diffusion coefficients for mixtures. At a total molarity of 3.0 mol/times/dm/sup /minus/3/ and molarity fractions of 1/2 and 1/3 NaCl, experiments with the SrCl/sub 2/ ..delta..c approx. 0 are convectively unstable with regard to fingering at the center of the boundary. Density data were also measured for the above systems.

Rard, J.A.; Miller, D.G.

1988-10-20T23:59:59.000Z

63

Author manuscript, published in "Information and Software Technology (2011)" DOI: 10.1016/j.infsof.2011.09.006 API2MoL: Automating the building of bridges between APIs and Model- Driven Engineering  

E-Print Network [OSTI]

Context. A software artefact typically makes its functionality available through a specialized Application Programming Interface (API) describing the set of services offered to client applications. In fact, building any software system usually involves managing a plethora of APIs, which complicates the development process. In Model-Driven Engineering (MDE), where models are the key elements of any software engineering activity, this API management should take place at the model level. Therefore, tools that facilitate the integration of APIs and MDE are clearly needed. Objective. Our goal is to automate the implementation of API-MDE bridges for supporting both the creation of models from API objects and the generation of such API objects from models. In this sense, this paper presents the API2MoL approach, which provides a declarative rule-based language to easily write mapping definitions to link API specifications and the metamodel that represents them. These definitions are then executed to convert API objects into model elements or vice versa. The approach also allows both the metamodel and the mapping to be automatically obtained from the API specification (bootstrap process). Method. After implementing the API2MoL engine, its correctness was validated using several APIs.

Javier Luis; Cnovas Izquierdo; Frdric Jouault; Jordi Cabot; Jess Garca Molina

2011-01-01T23:59:59.000Z

64

Agrobacterium tumefaciens VirC2 enhances T-DNA transfer and virulence through its C-terminal ribbonhelixhelix DNA-binding fold  

Science Journals Connector (OSTI)

...extending DNA strand separation to the nick site at the origin of transfer . Mol Microbiol...Z-score of 11.3 and a mean figure of merit of 0.37. Maximum likelihood density...phases, yielding an overall figure of merit of phasing of 0.66. Automatic building...

Jun Lu; Amke den Dulk-Ras; Paul J. J. Hooykaas; J. N. Mark Glover

2009-01-01T23:59:59.000Z

65

Department and function: Head of Division of Cell Biology and Immunology, HZI  

E-Print Network [OSTI]

, Karst U, Fischer E, Wehland J, Jansch L. Nucleic Acids Res. 2006; 34(Database issue):D402-6. Jenzora A, Gerstel B, Loessner M, Wehland J, Jansch L. J Bacteriol. 2007;189(2):313-24. Thedieck K, Hain T, Mohamed W, Tindall BJ, Nimtz M, Chakraborty T, Wehland J, Jansch L. Mol Microbiol. 2006;62(5):1325-39. Wissing J

Manstein, Dietmar J.

66

A Horizontally Acquired Transcription Factor Coordinates Salmonella Adaptations to Host Microenvironments  

Science Journals Connector (OSTI)

...Proteomic data set generation and analysis pipeline. Two parallel experiments were performed...specialized epithelial M cells of the Peyers patches. J. Exp. Med. 180 :15-23. doi...for ferritin B in iron-sulphur cluster repair and virulence. Mol. Microbiol. 63...

Nat F. Brown; Lindsay D. Rogers; Kristy L. Sanderson; Joost W. Gouw; Elizabeth L. Hartland; Leonard J. Foster

2014-10-01T23:59:59.000Z

67

Appl Microbiol Biotechnol (2005) 68: 567579 DOI 10.1007/s00253-005-0081-z  

E-Print Network [OSTI]

to manipulate organ- ism-wide metabolic networks to create recombinant micro- organisms able to effectively. However, these strategies often failed because the complex metabolic networks of microorganisms tend- wide metabolic networks to modify the metabolic path- ways toward efficient production of target

68

28. T. Dalsgaard, F. Bak, Appl. Environ. Microbiol. 60, 291 (1994).  

E-Print Network [OSTI]

Pacific Ocean to Solar Forcing During the Early Holocene Thomas M. Marchitto,1 * Raimund Muscheler,2, Mexico, a region where interannual SST variability is dominated today by the influence of the El Niño that correlate with cosmogenic nuclide proxies of solar variability, with inferred solar minima corresponding

van Geen, Alexander

69

Appl Microbiol Biotechnol (2005) 66: 696701 DOI 10.1007/s00253-004-1685-4  

E-Print Network [OSTI]

toward toluene, trichloro- ethylene (TCE), tetrachloroethylene (PCE), cis-1,2-di- chloroethylene (cis. stutzeri OX1 and P. putida F1 were chemotactic toward toluene, PCE, TCE, all DCEs, and VC. B. cepacia G4 was chemotactic toward toluene, PCE, TCE, cis-DCE, 1,1-DCE, and VC. Chemotaxis of P. stutzeri OX1 grown on o

Wood, Thomas K.

70

Arch Microbiol (2009) 191:221232 DOI 10.1007/s00203-008-0445-8  

E-Print Network [OSTI]

· Methanotrophs Introduction Trichloroethylene (TCE) and tetrachloroethylene (PCE) are primarily volatile organic concentrations, increases in chloride concentration and increases in methanotroph viable counts, provide multiple cor- rection Xuid. Exposure to TCE and PCE over extended periods has been known to cause impaired

Hazen, Terry

71

J. Eukaryot. Microbiol., 51(5), 2004 pp. 529535 2004 by the Society of Protozoologists  

E-Print Network [OSTI]

to direct the secretion of the protein. Key Words. Secondary endosymbiosis, signal peptide, transit peptide-containing organisms account for a significant fraction of present-day algal diversity: secondary algae are abundant algal endosymbionts, as well as the euglenids and chlorarachniophytes, which contain green al- gal

Archibald, John

72

Appl Microbiol Biotechnol (2004) 64: 289299 DOI 10.1007/s00253-003-1515-0  

E-Print Network [OSTI]

. Recently, nanotechnology has greatly impacted biotech- nological research with its potential applications state-of-the-art of micro- systems for use in biotechnological research, medicine and diagnostics. Introduction Recent developments in nanotechnology have opened up possibilities for new, revolutionary

73

J Ind Microbiol Biotechnol DOI 10.1007/s10295-014-1548-7  

E-Print Network [OSTI]

Introduction Methane is not only an important modulator of global cli- mate as a potent greenhouse gas [33, 71/BIOFUELS/BIOCHEMICALS Methane oxidation by anaerobic archaea for conversion to liquid fuels Thomas J. Mueller · Matthew J] but also by far the largest constituent of natural gas deposits. Global proven natural gas resources have

Wood, Thomas K.

74

Corpet 1993 Author's Version Vet.Microbiol. 35 -199 Veterinary Microbiology, 35 (1993) 199-212  

E-Print Network [OSTI]

-212 An evaluation of methods to assess the effect of antimicrobial residues on the human gut flora Denis E. Corpet bacterial populations such as drug resistant E. coli. 2. Anaerobes vs. aerobes. Aerobe counts are more isolated models in which the effect of any antimicrobial on the human gut flora can be tested. This in vivo

Boyer, Edmond

75

Appl Microbiol Biotechnol (2005) 69: 326334 DOI 10.1007/s00253-005-1988-0  

E-Print Network [OSTI]

) has been extensively produced for the generation of explosives, dyestuffs, and photo- graphic chemicals (Sax and Lewis 1987). It has caused severe contamination of soil and water, and is mutagenic and potentially carcinogenic (Dodard et al. 2003; Honeycutt et al. 1996). Thus, remediation of TNT

Wood, Thomas K.

76

Appl Microbiol Biotechnol (1995) 44:259--264 Springer-Verlag 1995 ORIGINAL PAPER  

E-Print Network [OSTI]

-ion- specific electrode. By substituting chloride salts with phosphates and nitrates, a chloride-free minimal). In addition, indole-containing, minim- al-medium agar plates were developed to indicate the presence the presence of P. cepacia G4 PR1 and expression of its TCE-degrading enzyme TOM, indole agar plates were

Wood, Thomas K.

77

Appl Microbiol Biotechnol (1996) 45:248--256 Springer-Verlag 1996 ORIGINAL PAPER  

E-Print Network [OSTI]

HCl is one of the most frequently detected pollutants in hazardous waste sites and in ground water), and concentrations of copper in excess of 0.25 M have been found in pol- luted ground water (Phelps et al. 1992-suited for environmental remediation. With growth on phenol or toluene as a sole carbon source (Ensley and Kurisko 1994

Wood, Thomas K.

78

doi:10.1128/AEM.02928-05. Microbiol. 72(8):5421-5427.  

E-Print Network [OSTI]

MICROBIOLOGY, Aug. 2006, p. 5421­5427 Vol. 72, No. 8 0099-2240/06/$08.00 0 doi:10.1128/AEM.02928-05 Copyright © 2006, American Society for Microbiology. All Rights Reserved. Peptidoglycan from Bacillus cereus Microbiology Doctoral Training Program,2 and Department of Bacteriology,3 University of Wisconsin

Handelsman, Jo

79

Impact of Biochar Application to Soil on the Root-Associated Bacterial Community Structure of Fully Developed Greenhouse Pepper Plants  

Science Journals Connector (OSTI)

...strains in plant root environments, which in some cases...plant resistance in the literature included Hydrogenophaga...are found in soil environments, where they can oxidize...tropics with charcoal-a review. Biol. Fertil. Soils...gene diversity in any environment. Methods Mol. Biol...

Max Kolton; Yael Meller Harel; Zohar Pasternak; Ellen R. Graber; Yigal Elad; Eddie Cytryn

2011-05-27T23:59:59.000Z

80

Repeated DNA: Molecular Genetics of Higher Organisms  

Science Journals Connector (OSTI)

...77, 1 (1973). 2. C. Thomas et al., Cold Spring Harbor Symp. Quart. Biol., in press. 3. J. Bonner and J.-R. Wti, Proc. Nat. Acad. Sci. U.S.A. 70, 535 (1973). 4. J.-R. Wu, J. Htirn, J. Bonner, J. Mol. Biol. 64...

Gina Bari Kolata

1973-12-07T23:59:59.000Z

Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


81

Basement membrane remodeling is essential for Drosophila disc eversion and tumor invasion  

Science Journals Connector (OSTI)

...Montell DJ ( 2003 ) Nat Rev Mol Cell Biol 4 : 13 24 . 11 Santos AC Lehmann R ( 2004 ) Curr Biol 14 : R578 R589 . 12 Pagliarini RA Xu T ( 2003 ) Science 302 : 1227...Nat Rev Cancer 2 : 442 454 . 36 Cano A Perez-Moreno MA Rodrigo I Locascio A Blanco MJ del Barrio MG Portillo F Nieto MA...

Ajay Srivastava; Jose Carlos Pastor-Pareja; Tatsushi Igaki; Raymond Pagliarini; Tian Xu

2007-01-01T23:59:59.000Z

82

A Map of the Interactome Network of the Metazoan C. elegans  

Science Journals Connector (OSTI)

...2003 ). 25 S. Wawersik , R. L. Maas, Hum. Mol...3303 ( 1999 ). 27 K. S. Pappu et al., Development 130...Niklaus, G. Cassata, T. R. Burglin, Dev. Biol...3303 (1999). 27 K. S. Pappu et al., Development 130...Niklaus, G. Cassata, T. R. Burglin, Dev. Biol...

Siming Li; Christopher M. Armstrong; Nicolas Bertin; Hui Ge; Stuart Milstein; Mike Boxem; Pierre-Olivier Vidalain; Jing-Dong J. Han; Alban Chesneau; Tong Hao; Debra S. Goldberg; Ning Li; Monica Martinez; Jean-Franois Rual; Philippe Lamesch; Lai Xu; Muneesh Tewari; Sharyl L. Wong; Lan V. Zhang; Gabriel F. Berriz; Laurent Jacotot; Philippe Vaglio; Jrme Reboul; Tomoko Hirozane-Kishikawa; Qianru Li; Harrison W. Gabel; Ahmed Elewa; Bridget Baumgartner; Debra J. Rose; Haiyuan Yu; Stephanie Bosak; Reynaldo Sequerra; Andrew Fraser; Susan E. Mango; William M. Saxton; Susan Strome; Sander van den Heuvel; Fabio Piano; Jean Vandenhaute; Claude Sardet; Mark Gerstein; Lynn Doucette-Stamm; Kristin C. Gunsalus; J. Wade Harper; Michael E. Cusick; Frederick P. Roth; David E. Hill; Marc Vidal

83

A systematic study of low-resolution recognition in proteinprotein complexes  

Science Journals Connector (OSTI)

...226 230 , 2417241 . 5 Laskowski R A Luscombe N M Swindells M B Thornton J M...213 , 8609611 . 7 Ho C M W Marshall G R ( 1990 ) J Comput Aided Mol Des 4 : 337...Biol 282 : 703 711 , 9743619 . 11 Pappu R V Marshall G R Ponder J W ( 1999 ) Nat Struct Biol...

Ilya A. Vakser; Omar G. Matar; Chan F. Lam

1999-01-01T23:59:59.000Z

84

Ternary mutual diffusion coefficients of NaCl-SrCl/sub 2/-H/sub 2/O at 25/sup 0/C. 1. Total concentrations of 0. 5 and 1. 0 mol. dm/sup -3/  

SciTech Connect (OSTI)

Mutual diffusion coefficients have been measured for aqueous NaCl-SrCl/sub 2/ mixtures at 25/sup 0/C by using free-diffusion Rayleigh interferometry. These diffusion experiments were done at total molarities of 0.5 and 1.0 mol x dm/sup -3/ and with molarity fractions of 1/3, 1/2, and 2/3. Main-term diffusion coefficients for NaCl and SrCl/sub 2/ show a 10-15% variation with concentration and composition. Coupled diffusion is important for these systems, with cross-term diffusion coefficients being 6.5-36% as large as their corresponding main terms. At a constant molarity ratio, doubling the concentration causes cross-term diffusion coefficients to increase. Attempts to estimate the ternary solution diffusion coefficients from those of their corresponding binary solutions or from the ternary solution analogues of the Nernst-Hartley equation do not yield particularly accurate results.

Rard, J.A.; Miller, D.G.

1987-08-13T23:59:59.000Z

85

Rerouting Carbon Flux To Enhance Photosynthetic Productivity  

Science Journals Connector (OSTI)

...discussions and the critical review of the manuscript. We acknowledge...membrane transport proteins (review). Mol. Membr. Biol. 21...Biofuels from microalgae-a review of technologies for production...Souza. 2010. Sugarcane for bioenergy production: an assessment...

Daniel C. Ducat; J. Abraham Avelar-Rivas; Jeffrey C. Way; Pamela A. Silver

2012-02-03T23:59:59.000Z

86

Annotation and comparative analysis of the glycoside hydrolase genes in Brachypodium distachyon  

E-Print Network [OSTI]

functional annotations of alpha-amylase-related proteins.N: The structure of barley alpha-amylase isozyme 1 reveals astructure of barley alpha-amylase. J Mol Biol 1994, 239(1):

Tyler, Ludmila; Bragg, Jennifer N; Wu, Jiajie; Yang, Xiaohan; Tuskan, Gerald A; Vogel, John P

2010-01-01T23:59:59.000Z

87

Molecular Mechanisms of Anthrax Toxin Assembly and Transport  

E-Print Network [OSTI]

Dominant forces in protein folding. Biochemistry 29: 7133-1993) Cooperativity in protein-folding kinetics. Proc. Natl.barrier mechanism in protein folding. J Mol Biol 324: 359-

Feld, Geoffrey Keith

2012-01-01T23:59:59.000Z

88

Optimized Null Model for Protein Structure Networks  

E-Print Network [OSTI]

play a key role in protein folding. Phys Rev E Stat Nonlinstages in non-two-state protein folding. J Mol Biol 357(5):determinants of protein folding. PNAS 12. Soyer A, Chomilier

Milenkovic, Tijana; Filippis, Ioannis; Lappe, Michael; Przulj, Natasa

2009-01-01T23:59:59.000Z

89

E-Print Network 3.0 - archaeon halobacterium sp Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

R64. Summary: in the archaeon Halobacterium salinarium. J. Mol. Biol. 258:548-554. 184. Samuelson, J. C. 2000. YidC mediates... proteins in Halobacterium halobium. EMBO J....

90

Isolation and characterization of Bacillus stearothermophilus 30S and 50S ribosomal protein mutations.  

Science Journals Connector (OSTI)

...B to differentiate them from Bacillus subtilis proteins, which are designated...E. R. 1982. Selection in Bacillus subtilis giving rise to strains with...translational discrimina- tion in Bacillus subtilis. J. Mol. Biol. 86:855-863...

J Schnier; H S Gewitz; S E Behrens; A Lee; C Ginther; T Leighton

1990-12-01T23:59:59.000Z

91

Evolution of MDA-5/RIG-I-dependent innate immunity: Independent evolution by domain grafting  

Science Journals Connector (OSTI)

...proteins. Abbreviations: csp, caspase; cdf...Abbreviations: cdf, CARDif; csp, caspase. Solid black...mechanism that existed before plants and animals diverged . Mol Biol...Activation of the interferon system by short-interfering...RNA Helicases chemistry classification genetics Evolution...

Devanand Sarkar; Rob DeSalle; Paul B. Fisher

2008-01-01T23:59:59.000Z

92

(E)-β-Ocimene and Myrcene Synthase Genes of Floral Scent Biosynthesis in Snapdragon: Function and Expression of Three Terpene Synthase Genes of a New Terpene Synthase Subfamily  

Science Journals Connector (OSTI)

...Methyl jasmonate-induced terpene synthase gene expression, and cDNA cloning and functional characterization of (+)-3-carene synthase. Plant Mol. Biol. 51, 119-133. Gang, D.R., Lavid, N., Zubieta, C., Chen, F., Beuerle, T., Lewinsohn...

Natalia Dudareva; Diane Martin; Christine M. Kish; Natalia Kolosova; Nina Gorenstein; Jenny Fäldt; Barbara Miller; Jörg Bohlmann

2003-04-11T23:59:59.000Z

93

E-Print Network 3.0 - analogue calcipotriol enhances Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

as: Y.-R. Lou, et al., 25-Hydroxyvitamin D3 is an agonistic vitamin D receptor ligand, J. Steroid Biochem. Mol. Biol. (2009), doi:10.1016j.jsbmb.2009.11.011 Summary: at higher...

94

The basic keratin 10-binding domain of the virulence-associated pneumococcal serine-rich protein PsrP adopts a novel MSCRAMM fold  

Science Journals Connector (OSTI)

...figure S1). The ensemble of 18 monomer models...different sites of the two proteins (see electronic supplementary...binding to intrinsically disordered protein regions [24] such...the interactions of disordered proteins. J. Mol. Biol...

2014-01-01T23:59:59.000Z

95

E-Print Network 3.0 - amp-epac-rap1 signal-activated endothelial...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

AMP-Epac-Rap1 signal-activated endothelial cells. Mol Biol Cell 2010, 21: 584-596. 64. Jansen SR... -427. 40. Enserink JM, Price LS, Methi T, Mahic M, Sonnenberg A, Bos JL, Tasken...

96

Lipid Transfer Proteins Enhance Cell Wall Extension in Tobacco  

Science Journals Connector (OSTI)

...hypothesize that LTP slightly reduces the energy barriers for rearrangements in the cellulose/xyloglucan network toward lower energy configurations, thereby facilitating...protein gene, during embryo development in Norway spruce (Picea abies). Plant Mol. Biol...

Jeroen Nieuwland; Richard Feron; Bastiaan A.H. Huisman; Annalisa Fasolino; Cornelis W. Hilbers; Jan Derksen; Celestina Mariani

2005-06-03T23:59:59.000Z

97

The Last Step of Syringyl Monolignol Biosynthesis in Angiosperms Is Regulated by a Novel Gene Encoding Sinapyl Alcohol Dehydrogenase  

Science Journals Connector (OSTI)

...article. This work was supported by the Energy Biosciences Program, United States Department of Energy, and a Michigan Technological University...accumulation of cinnamyl alcohol dehydrogenase from Norway spruce (Picea abies). Plant Mol. Biol...

Laigeng Li; Xiao Fei Cheng; Jacqueline Leshkevich; Toshiaki Umezawa; Scott A. Harding; Vincent L. Chiang

98

E-Print Network 3.0 - adenosine triphosphate atp Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Collection: Biology and Medicine 53 Biochemistry 1988, 27, 1205-1212 1205 Ogata, R. T., & Gilbert, W. (1979) J. Mol. Biol. 132, 709. Summary: triphosphates that are not hydrolyzed...

99

E-Print Network 3.0 - angiostatin binds atp Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Sciences and Ecology 30 Biochemistry 1988, 27, 1205-1212 1205 Ogata, R. T., & Gilbert, W. (1979) J. Mol. Biol. 132, 709. Summary: . The effect of ATP binding to recA...

100

E-Print Network 3.0 - adenine nucleotide hydrolysis Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Collection: Biology and Medicine 8 Biochemistry 1988, 27, 1205-1212 1205 Ogata, R. T., & Gilbert, W. (1979) J. Mol. Biol. 132, 709. Summary: that prevent hydrolysis but not...

Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


101

E-Print Network 3.0 - acyclic nucleoside analogues Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Collection: Biology and Medicine 67 Biochemistry 1988, 27, 1205-1212 1205 Ogata, R. T., & Gilbert, W. (1979) J. Mol. Biol. 132, 709. Summary: of the nucleoside triphosphates that...

102

E-Print Network 3.0 - atp steady state Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Physics ; Biology and Medicine 24 Biochemistry 1988, 27, 1205-1212 1205 Ogata, R. T., & Gilbert, W. (1979) J. Mol. Biol. 132, 709. Summary: DNA binding affinity state similar to...

103

E-Print Network 3.0 - affinity purified protein Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Collection: Biology and Medicine 56 Biochemistry 1988, 27, 1205-1212 1205 Ogata, R. T., & Gilbert, W. (1979) J. Mol. Biol. 132, 709. Summary: of the nucleoside triphosphates that...

104

E-Print Network 3.0 - acids preliminary nucleotide Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Collection: Biology and Medicine 33 Biochemistry 1988, 27, 1205-1212 1205 Ogata, R. T., & Gilbert, W. (1979) J. Mol. Biol. 132, 709. Summary: Lett. Schmitz, A,, & Galas, D. (1979)...

105

E-Print Network 3.0 - arsr repressor mediates Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

in mediating the effects of repressor and Cro. J. Mol. Biol. 139, 147-161. Maxam, A., and Gilbert, W. (1980... 3: their roles in mediating the effects of repressor and cro. J....

106

E-Print Network 3.0 - atp binding site Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Physics ; Biology and Medicine 27 Biochemistry 1988, 27, 1205-1212 1205 Ogata, R. T., & Gilbert, W. (1979) J. Mol. Biol. 132, 709. Summary: . The effect of ATP binding to recA...

107

E-Print Network 3.0 - abcc9-encoded nucleotide binding Sample...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Chemistry ; Biology and Medicine 37 Biochemistry 1988, 27, 1205-1212 1205 Ogata, R. T., & Gilbert, W. (1979) J. Mol. Biol. 132, 709. Summary: DNA binding affinity by nucleotide...

108

E-Print Network 3.0 - atp biosynthesis induces Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Sciences and Ecology 91 Biochemistry 1988, 27, 1205-1212 1205 Ogata, R. T., & Gilbert, W. (1979) J. Mol. Biol. 132, 709. Summary: DNA binding affinity state similar to...

109

E-Print Network 3.0 - atp binding protein Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Collection: Biology and Medicine 5 Biochemistry 1988, 27, 1205-1212 1205 Ogata, R. T., & Gilbert, W. (1979) J. Mol. Biol. 132, 709. Summary: . The effect of ATP binding to recA...

110

E-Print Network 3.0 - affinity binding studies Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

and Information Sciences 26 Biochemistry 1988, 27, 1205-1212 1205 Ogata, R. T., & Gilbert, W. (1979) J. Mol. Biol. 132, 709. Summary: . U.S.A.82, 2565-2569. Properties of...

111

E-Print Network 3.0 - affinity cell-capture mass Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

5 > >> Page: << < 1 2 3 4 5 > >> 21 Biochemistry 1988, 27, 1205-1212 1205 Ogata, R. T., & Gilbert, W. (1979) J. Mol. Biol. 132, 709. Summary: . Sakonju, S.,& Brown, D. (1982) Cell...

112

E-Print Network 3.0 - atp hydrolysis potential Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Physics ; Biology and Medicine 7 Biochemistry 1988, 27, 1205-1212 1205 Ogata, R. T., & Gilbert, W. (1979) J. Mol. Biol. 132, 709. Summary: of ATP hydrolysis is greatly...

113

E-Print Network 3.0 - adeonsine triphosphate based Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Collection: Biology and Medicine 73 Biochemistry 1988, 27, 1205-1212 1205 Ogata, R. T., & Gilbert, W. (1979) J. Mol. Biol. 132, 709. Summary: of the nucleoside triphosphates that...

114

On the Migration of the Scientific Code Dyana from SMPs to Clusters of PCs and on to the Grid  

E-Print Network [OSTI]

Michela Taufer1, Thomas Stricker1, G´erard Roos 1, Peter G¨untert 2 1 Department of Computer Science 2-8092 Zurich, Switzerland stricker,taufer@inf.ethz.ch guentert@mol.biol.ethz.ch Abstract Dyana

Taufer, Michela

115

FtsZ dynamics and the regulation of division site selection by the MinCD division inhibitor in Bacillus subtilis  

E-Print Network [OSTI]

Anderson et al, 2004; Stricker et al, 2002). This suggestsa non-localized pool (Stricker et al, 2002). It is thereforeJ Mol Biol 369(1): 210-221 Stricker J, Maddox P, Salmon ED,

Gregory, James Alan

2009-01-01T23:59:59.000Z

116

An Arabidopsis Glutathione Peroxidase Functions as Both a Redox Transducer and a Scavenger in Abscisic Acid and Drought Stress Responses  

Science Journals Connector (OSTI)

...S., and Lee, Y. (1999). Oligogalacturonic acid and chitosan reduce stomatal aperture by inducing the evolution of reactive...receptor-associated factor 2 requires prior dissociation of the ASK1 inhibitor thioredoxin. Mol. Cell. Biol. 20, 2198-2208. Liu...

Yuchen Miao; Dong Lv; Pengcheng Wang; Xue-Chen Wang; Jia Chen; Chen Miao; Chun-Peng Song

2006-09-22T23:59:59.000Z

117

Optimization of the In-Silico-Designed Kemp Eliminase KE70 by Computational Design and Directed Evolution  

E-Print Network [OSTI]

of designed enzymes are still orders of magnitude lower than those of naturally occurring ones. Nonetheless; ESRF, European Synchrotron Radiation Facility. doi:10.1016/j.jmb.2011.01.041 J. Mol. Biol. (2011) 407

Baker, David

118

Improved efficiency of protein structure calculations from NMR data using the program DIANA with redundant dihedral angle constraints  

Science Journals Connector (OSTI)

A new strategy for NMR structure calculations of proteins with the variable target function method (Braun, W. and Go, N. (1985)J. Mol. Biol.,186..., 611) is described, which makes use of redundant dihedral angle ...

Peter Gntert; Kurt Wthrich

1991-11-01T23:59:59.000Z

119

Freeze-Thaw Tolerance and Clues to the Winter Survival of a Soil Community  

Science Journals Connector (OSTI)

...Myers, and D. J. Lipmann. 1990. Basic local alignment search tool. J. Mol. Biol...alternate freezing and thawing caused by Foehn or Chinook winds have been largely overlooked. We designed...Ecosystem Freezing Seasons Soil Microbiology Wind

Virginia K. Walker; Gerald R. Palmer; Gerrit Voordouw

2006-03-01T23:59:59.000Z

120

Genetic Engineering of Algae for Enhanced Biofuel Production  

Science Journals Connector (OSTI)

...Samuels. 2004. Plant cuticular lipid export requires an ABC transporter. Science...japonica (Laminariales, Phaeophyta) in China. Hydrobiologia 398 :469-472...and unveils the pathway of carbon export from rhodoplasts. Plant Mol. Biol...

Randor Radakovits; Robert E. Jinkerson; Al Darzins; Matthew C. Posewitz

2010-02-05T23:59:59.000Z

Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


121

Exploring Flory's isolated-pair hypothesis: Statistical mechanics of helixcoil transitions in polyalanine and the C-peptide from RNase A  

Science Journals Connector (OSTI)

...153 164. 12368107 7 Zaman, M. H., Shen, M. Y., Berry, R. S., Freed, K. F. & Sosnick, T. R. ( 2003 ) J. Mol. Biol. 331, 693 711. 12899838 8 Pappu, R. V., Srinivasan, R. & Rose, G. D. ( 2000 ) Proc. Natl. Acad...

Y. Zenmei Ohkubo; Charles L. Brooks III

2003-01-01T23:59:59.000Z

122

Septin Self-Assembly: Plasticity and Protein Scaffolding  

E-Print Network [OSTI]

Y. Arnaiz-Pita, H. Tachikawa, F. del Rey, A.M. Neiman, andMol Biol Cell. 19:4675-4686. Tachikawa, H. , A. Bloecher, K.specific protein, Gip1 (Tachikawa et al. , 2001) colocalize

Garcia, III, Galo

2012-01-01T23:59:59.000Z

123

Colletotrichum orbiculare Secretes Virulence Effectors to a Biotrophic Interface at the Primary Hyphal Neck via Exocytosis Coupled with SEC22-Mediated Traffic  

Science Journals Connector (OSTI)

...R. and Scheller, R.H. (2006). SNAREs-Engines for membrane fusion. Nat. Rev. Mol. Cell Biol...Cloning: A Laboratory Manual, 2nd ed. (Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press). Siriputthaiwan, P...

Hiroki Irieda; Hitomi Maeda; Kaoru Akiyama; Asuka Hagiwara; Hiromasa Saitoh; Aiko Uemura; Ryohei Terauchi; Yoshitaka Takano

2014-05-21T23:59:59.000Z

124

Structure of Human Argonaute2: A Programmable Ribonuclease |...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

RNAi Enzyme Complex", Nat. Struct. Mol. Biol. 11, 599 (2004) E. Huntzinger, and E. Izaurralde, "Gene Silencing by MicroRNAs: Contributions of Translational Repression and mRNA...

125

Effects of organic carbon supply rates on mobility of previously bioreduced uranium in a contaminated sediment  

E-Print Network [OSTI]

contaminated subsurface sediments. Environ. Microbiol. 2002,in previously bioreduced sediment by dissolved oxygen andcontaminated aquifer sediments. Appl Environ Microbiol 2002,

Wan, J.

2008-01-01T23:59:59.000Z

126

J. Microbiol. Biotechnol. (2006), 16(2), 232239 Bacterial Community Structure in Activated Sludge Reactors Treating Free  

E-Print Network [OSTI]

the formation of complexes with metal ions, which function as enzyme cofactors [2]. Because of the high toxicity from wastewater effluent before discharge [3]. Cyanide in these wastewater creates heavy-metal Reactors Treating Free or Metal-Complexed Cyanides QUAN, ZHE-XUE1,2,3 , SUNG-KEUN RHEE2,4 , JIN-WOO BAE2

Bae, Jin-Woo

127

J Ind Microbiol Biotechnol (2011) 38:873890 DOI 10.1007/s10295-011-0970-3  

E-Print Network [OSTI]

Microbiology 2011 Abstract Microorganisms have become an increasingly important platform for the production of drugs, chemicals, and biofuels from renewable resources. Advances in pro- tein engineering, metabolic, polyketides, non-ribo- somal peptides, biofuels, and chemicals. Related topics on lignocellulose degradation

Zhao, Huimin

128

19 May 1987 PROC. BIOL. SOC. WASH.  

E-Print Network [OSTI]

.-Palau, Peleliu Island, Airport Well, 26 Feb 1985, leg. Thomas M. Iliffe, Jeff Bozanic, and Dennis Williams, holo- type (USNM 232000) and 16 paratypes (USNM 232001); 2 Apr 1985, leg. Dennis Williams and Jeff Bozanic

Iliffe, Thomas M.

129

Biol. Cybern. 76, 8396 (1997) Cybernetics  

E-Print Network [OSTI]

and Computing Science, University of Groningen, P.O. Box 800, 9700 AV Groningen, The Netherlands Received: 4

Petkov, Nicolai

130

LABORATORY #5 --BIOL 111 Photosynthesis and Respiration  

E-Print Network [OSTI]

!) Photosynthesis can be defined as the transfer and storage of solar energy to a chemical form called glucose (a the world of life go `round: photosynthesis and respiration. One is about converting solar energy the standpoint of chemistry, photosynthesis is written like this: solar energy 6CO2 + 6H2O C6H12O6 + 6O2 Carbon

131

Nucleic Acid Standards - Program List  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

List of Programs and References List of Programs and References CEHS M. A. El Hassan & C. R. Calladine (1995). ``The Assessment of the Geometry of Dinucleotide Steps in Double-Helical DNA: A New Local Calculation Scheme.'' J. Mol. Biol. 251, 648-664. X. J. Lu, M. A. El Hassan & C. A. Hunter (1997). ``Structure and Conformation of Helical Nucleic Acids: Analysis Program (SCHNAaP).''J. Mol. Biol. 273, 668-680. CompDNA (Please refer to Dr. Andrey A. Gorin: agor@sbnmr1.ski.mskcc.org OR Dr. Victor B. Zhurkin: zhurkin@lmmb.nci.nih.gov) A. A. Gorin, V. B. Zhurkin & W. K. Olson (1995). ``B-DNA Twisting Correlates with Base-pair Morphology.'' J. Mol. Biol. 247, 34-48. K. M. Kosikov, A. A. Gorin, V. B. Zhurkin & W. K. Olson (1999). ``DNA Stretching and Compression: Large-scale Simulations of Double Helical

132

Unstructured Adaptive Mesh MOL Solvers for Atmospheric Reacting  

E-Print Network [OSTI]

. Achieving high resolution in air pollution models is a difficult challenge because of the large number for the next generation of air pollution models in order to "capture important smaller scale atmospheric in understanding the complex processes which lead to the formation of pollutants such as greenhouse gases, acid

Utah, University of

133

CafeMol (www.cafemol.org) Features are;  

E-Print Network [OSTI]

$ pjqstat display job status(-A:all user) $ pjdel [JOBID] cancel job $ pjsub --interact interactive job e directory of native info files >>>> job_cntl i_run_mode = 2 2:constat T, 6:REMD i_simulate_type = 1 1(essential block 2) energy_function LOCAL(1) L_GO local energy L_GO, L_AICG2_PLUS, L_BDNA NLOCAL(1/1) GO EXV

Fukai, Tomoki

134

90, 41 (1992); K. Nakai and H. Sakamoto, Gene 141, 171 (1994).  

E-Print Network [OSTI]

Res. 19, 3795 (1991). 5. S. L. Hall and R. A. Padgett, J. Mol. Biol. 139, 357 (1994). 6. I. Kiss et al., Cancer Commun. 2, 63 (1990); A. I. Mc- Clatchey et al., Hum. Mol. Genet. 1, 521 (1992); A. L. George Jr splicing was 60% (v/v) nuclear extract [giving final concentrations of 12% (v/v) glycerol, 12 mM Hepes

Bonhoeffer, Sebastian

135

Tle4 Regulates Epigenetic Silencing of Gamma Interferon Expression during Effector T Helper Cell Tolerance  

Science Journals Connector (OSTI)

...of histone deacetylase. Mol. Cell. Biol. 20 :2592-2603. doi: 10.1128/MCB.20.7.2592-2603.2000 . 37. Overwijk, WW , MR Theoret, SE Finkelstein, DR Surman, LA de Jong, FA Vyth-Dreese, TA Dellemijn, PA Antony, PJ Spiess, DC...

Sanmay Bandyopadhyay; Rut Valdor; Fernando Macian

2013-11-04T23:59:59.000Z

136

Discovery of a selective inhibitor of oncogenic B-Raf kinase with potent antimelanoma activity  

Science Journals Connector (OSTI)

...with TUNEL to indicate areas of high apoptosis...resulted in increasing plasma levels (up to 600 {mu...hypermutations in diffuse large cell lymphoma . J Mol Biol 348 : 183...1); 1 H-NMR (300 MHz, DMSO-d 6...60 ml), under an atmosphere of nitrogen and cooled...

James Tsai; John T. Lee; Weiru Wang; Jiazhong Zhang; Hanna Cho; Shumeye Mamo; Ryan Bremer; Sam Gillette; Jun Kong; Nikolas K. Haass; Katrin Sproesser; Ling Li; Keiran S. M. Smalley; Daniel Fong; Yong-Liang Zhu; Adhirai Marimuthu; Hoa Nguyen; Billy Lam; Jennifer Liu; Ivana Cheung; Julie Rice; Yoshihisa Suzuki; Catherine Luu; Calvin Settachatgul; Rafe Shellooe; John Cantwell; Sung-Hou Kim; Joseph Schlessinger; Kam Y. J. Zhang; Brian L. West; Ben Powell; Gaston Habets; Chao Zhang; Prabha N. Ibrahim; Peter Hirth; Dean R. Artis; Meenhard Herlyn; Gideon Bollag

2008-01-01T23:59:59.000Z

137

The Chromatin Assembly Factor Subunit FASCIATA1 Is Involved in Homologous Recombination in Plants  

Science Journals Connector (OSTI)

...significantly to the control of HR. In future work, it will be interesting to analyze...described by the manufacturer (Ambion Quantum kit) after adjustment of the PCR to the...Chromatin assembly by DNA-translocating motors. Nat. Rev. Mol. Cell Biol. 4, 613-620...

Angela Kirik; Ales Pecinka; Edelgard Wendeler; Bernd Reiss

2006-09-15T23:59:59.000Z

138

LINE-1 Retrotransposable Element DNA Accumulates in HIV-1-Infected Cells  

Science Journals Connector (OSTI)

...this article. Type 1 long-interspersed nuclear elements (L1s) are autonomous retrotransposable...L1-ORF1 (E), and Alu (F). In each graph, DNA quantifications for NL4-3-infected...J. Mol. Biol. 304 :11-20. 18. Cost, GJ , Q Feng, A Jacquier, and JD Boeke...

R. Brad Jones; Haihan Song; Yang Xu; Keith E. Garrison; Anton A. Buzdin; Naveed Anwar; Diana V. Hunter; Shariq Mujib; Vesna Mihajlovic; Eric Martin; Erika Lee; Monika Kuciak; Rui Andr Saraiva Raposo; Ardalan Bozorgzad; Duncan A. Meiklejohn; Lishomwa C. Ndhlovu; Douglas F. Nixon; Mario A. Ostrowski

2013-10-02T23:59:59.000Z

139

Changes in protein conformational mobility upon activation of extracellular regulated protein kinase-2 as detected by hydrogen exchange  

Science Journals Connector (OSTI)

...Kraulis P J ( 1991 ) J Appl Crystallogr 24 : 946 950 . 25 Merritt E A Murphy M E P ( 1994 ) Acta Crystallogr D 50 : 869 873 , 15299354 . 26 Narayana...Mol Biol 286 : 1547 1565 , 10064715 . We are indebted to Nick Tolwinski for assistance with data analysis. Special thanks...

Andrew N. Hoofnagle; Katheryn A. Resing; Elizabeth J. Goldsmith; Natalie G. Ahn

2001-01-01T23:59:59.000Z

140

A Structural Basis for the pH-Dependent Xanthophyll Cycle in Arabidopsis thaliana  

Science Journals Connector (OSTI)

...members of the lipocalin family, the first identified...2004). Coot: Model-building tools for molecular graphics...the lipocalin protein family. Mol. Biol. Evol...2006). Lipocalins - A family portrait. J. Plant...2000). An approach to multi-copy search in molecular...

Pascal Arnoux; Tomas Morosinotto; Giorgia Saga; Roberto Bassi; David Pignol

2009-07-28T23:59:59.000Z

Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


141

A Structural Basis for the pH-Dependent Xanthophyll Cycle in Arabidopsis thaliana  

Science Journals Connector (OSTI)

...of the lipocalin family, the first identified...Coot: Model-building tools for molecular...lipocalin protein family. Mol. Biol. Evol...Lipocalins - A family portrait. J. Plant...An approach to multi-copy search in...absorbed energy as heat and the scavenging...

Pascal Arnoux; Tomas Morosinotto; Giorgia Saga; Roberto Bassi; David Pignol

2009-07-28T23:59:59.000Z

142

Delivery of 5-Aza-2?-Deoxycytidine to Cells Using Oligodeoxynucleotides  

Science Journals Connector (OSTI)

...47 Beavo JA, Brunton LL. Cyclic nucleotide research: still expanding after half a century. Nat Rev Mol Cell Biol 2002;3:710-8. 48 Williams C. cAMP detection methods in HTS: selecting the best from the rest. Nat Rev Drug Discov 2004...

Christine B. Yoo; Shinwu Jeong; Gerda Egger; Gangning Liang; Pasit Phiasivongsa; Chunlin Tang; Sanjeev Redkar; and Peter A. Jones

2007-07-01T23:59:59.000Z

143

In Plant and Animal Cells, Detergent-Resistant Membranes Do Not Define Functional Membrane Rafts  

Science Journals Connector (OSTI)

...working with mammalian cells. Critical voices from the plant camp remain rare and timid. Among them, the most pronounced one...533-544. Edidin, M. (2003). Lipids on the frontier: a century of cell-membrane bilayers. Nat. Rev. Mol. Cell Biol...

Widmar Tanner; Jan Malinsky; Miroslava Opekarová

2011-04-29T23:59:59.000Z

144

Chemoresistant KM12C Colon Cancer Cells Are Addicted to Low Cyclic AMP Levels in a Phosphodiesterase 4Regulated Compartment via Effects on Phosphoinositide 3-Kinase  

Science Journals Connector (OSTI)

...with the specific cyclic AMP (cAMP) phosphodiesterase-4 (PDE4...cells, those controlled by cAMP and PIP3, which are critical...research-still expanding after half a century. Nat Rev Mol Cell Biol 2002...259-69. 5 Bos JL. Epac: a new cAMP target and new avenues in cAMP...

David G. McEwan; Valerie G. Brunton; George S. Baillie; Nicholas R. Leslie; Miles D. Houslay; and Margaret C. Frame

2007-06-01T23:59:59.000Z

145

Transcript-Based Cloning of RRP46, a Regulator of rRNA Processing and R Gene??Independent Cell Death in Barley??Powdery Mildew Interactions  

Science Journals Connector (OSTI)

...Oliver, R.P., and Gurr, S.J. (1999). Involvement of cAMP and protein kinase A in conidial differentiation by Erysiphe...Mol. Cell. Biol. 28: 3038-3044. Li, X., Song, Y., Century, K., Straight, S., Ronald, P., Dong, X., Lassner...

Liu Xi; Matthew J. Moscou; Yan Meng; Weihui Xu; Rico A. Caldo; Miranda Shaver; Dan Nettleton; Roger P. Wise

2009-10-27T23:59:59.000Z

146

PROTEIN S-ACYL TRANSFERASE10 Is Critical for Development and Salt Tolerance in Arabidopsis  

Science Journals Connector (OSTI)

...protoplasts was performed according to standard protocols (Yoo et al., 2007). Three...confocal microscope (LSM780; Zeiss) with a Plan-Neofluar 40/1.3 oil differential...cycles and regulation of protein function (Review). Mol. Membr. Biol. 26 : 42-54...

Liang-Zi Zhou; Sha Li; Qiang-Nan Feng; Yu-Ling Zhang; Xinying Zhao; Yong-lun Zeng; Hao Wang; Liwen Jiang; Yan Zhang

2013-03-12T23:59:59.000Z

147

PROTEIN S-ACYL TRANSFERASE10 Is Critical for Development and Salt Tolerance in Arabidopsis  

Science Journals Connector (OSTI)

...sections were stained with acetate uranium and lead citrate. The specimens...was performed according to standard protocols (Yoo et al., 2007...microscope (LSM780; Zeiss) with a Plan-Neofluar 40/1.3 oil differential...regulation of protein function (Review). Mol. Membr. Biol. 26...

Liang-Zi Zhou; Sha Li; Qiang-Nan Feng; Yu-Ling Zhang; Xinying Zhao; Yong-lun Zeng; Hao Wang; Liwen Jiang; Yan Zhang

2013-03-12T23:59:59.000Z

148

PROTEIN S-ACYL TRANSFERASE10 Is Critical for Development and Salt Tolerance in Arabidopsis  

Science Journals Connector (OSTI)

...vacuole function. Indeed, a similar regulatory paradigm occurred early during evolution...confocal microscope (LSM780; Zeiss) with a Plan-Neofluar 40/1.3 oil differential...cycles and regulation of protein function (Review). Mol. Membr. Biol. 26 : 42-54...

Liang-Zi Zhou; Sha Li; Qiang-Nan Feng; Yu-Ling Zhang; Xinying Zhao; Yong-lun Zeng; Hao Wang; Liwen Jiang; Yan Zhang

2013-03-12T23:59:59.000Z

149

Species-specific responses of Late Quaternary megafauna to climate and humans  

E-Print Network [OSTI]

Pleistocene musk ox (Ovibos moschatus) population dynamics. P Nat Acad Sci. 2010; 107:5675 5680. 11. Stiller M, et al. Withering away25,000 years of genetic decline preceded cave bear extinction. Mol Biol Evol. 2010; 27:975978. [PubMed: 20335279] 12. Barnes...

Lorenzen, Eline D.; Nogué s-Bravo, David; Orlando, Ludovic; Weinstock, Jaco; Binladen, Jonas; Marske, Katharine A.; Ugan, Andrew; Borregaard, Michael K.; Gilbert, M. Thomas P.; Nielsen, Rasmus; Ho, Simon Y. W.; Goegel, Ted; Graf, Kelly E.; Byers, David; Stenderup, Jesper T.; Rasmussen, Morten; Campos, Paula F.; Leonard, Jennifer A.; Koepfli, Klaus-Peter; Froese, Duane; Zazula, Grant; Stafford, Thomas W. Jr.; Aaris-Sø rensen, Kim; Batra, Persaram; Haywood, Alan M.; Singarayer, Joy S.; Valdes, Paul J.; Boeskorov, Gennady; Burns, James A.; Davydov, Sergey P.; Haile, James; Jenkins, Dennis L.; Kosintsev, Pavel; Kuznetsova, Tatyana; Lai, Xulong; Martin, Larry D.; McDonald, H. Gregory; Mol, Dick; Meldgaard, Morten; Munch, Kasper; Stephan, Elisabeth; Sablin, Mikhail; Sommer, Robert S.; Sipko, Taras; Scott, Eric; Suchard, Marc A.; Tikhonov, Alexei; Willerslev, Rane; Wayne, Robert K.; Cooper, Alan; Hofreiter, Michael; Sher, Andrei; Shapiro, Beth; Rahbek, Carsten; Willerslev, Eske

2014-11-17T23:59:59.000Z

150

Characterization of a DNA exit gate in the human cohesin ring  

Science Journals Connector (OSTI)

...Mol. Syst. Biol. 7 , 539 ( 2011 ). 10.1038/msb.2011.75 21988835 36 Chou K. C. Lin W. Z. Xiao X. , Wenxiang: A web-server for drawing wenxiang diagrams . Nat. Sci. 3 , 862 865 ( 2011 ). 10.4236/ns.2011.310111 37 Soding J...

Pim J. Huis in t Veld; Franz Herzog; Rene Ladurner; Iain F. Davidson; Sabina Piric; Emanuel Kreidl; Venugopal Bhaskara; Ruedi Aebersold; Jan-Michael Peters

2014-11-21T23:59:59.000Z

151

DOI: 10.1126/science.1211600 , 104 (2012);335Science  

E-Print Network [OSTI]

, 13831 (2002). 24. R. B. Jensen, S. C. Wang, L. Shapiro, Nat. Rev. Mol. Cell Biol. 3, 167 (2002). 25. P. Shapiro, H. H. McAdams, R. Losick, Science 298, 1942 (2002). 16. Y. E. Chen et al., Proc. Natl. Acad. Sci). 21. D. Huh, J. Paulsson, Nat. Genet. 43, 95 (2011). 22. C. G. Tsokos, B. S. Perchuk, M. T. Laub, Dev

152

In contrast, the autocorrelation of the intrinsic noise (16) decays rapidly: tintrinsic G  

E-Print Network [OSTI]

Press and Blackwell Science, Cambridge, MA, ed. 2, 1992). 3. H. H. McAdams, L. Shapiro, Science 269, 650. B. Elowitz, S. Leibler, Nature 403, 335 (2000). 8. T. S. Gardner, C. R. Cantor, J. J. Collins, M. B. Elowitz, U. Alon, J. Mol. Biol. 323, 785 (2002). 11. F. J. Isaacs, J. Hasty, C. R. Cantor, J

van Oudenaarden, Alexander

153

Handedness and situs inversus in primary ciliary dyskinesia  

Science Journals Connector (OSTI)

...for a short period during development (Brueckner 2002), which is then followed by a...et al. 2000; Mercola & Levin 2001; Brueckner 2002; Essner et al. 2002), and situs...Respir. Cell Mol. Biol. 23, 4551. Brueckner, M. 2002 Cilia propel the embryo in...

2004-01-01T23:59:59.000Z

154

The Transcription Factor RFX3 Directs Nodal Cilium Development and Left-Right Asymmetry Specification  

Science Journals Connector (OSTI)

...Cell. Mol. Biol. 23: 45-51. 4 Brueckner, M. 2001. Cilia propel the embryo...J. Tabin, H. J. Yost, and M. Brueckner. 2002. Conserved function for embryonic...5043-5048. 26 McGrath, J., and M. Brueckner. 2003. Cilia are at the heart of vertebrate...

E. Bonnafe; M. Touka; A. AitLounis; D. Baas; E. Barras; C. Ucla; A. Moreau; F. Flamant; R. Dubruille; P. Couble; J. Collignon; B. Durand; W. Reith

2004-05-01T23:59:59.000Z

155

Mapping of the SecA Signal Peptide Binding Site and Dimeric Interface by Using the Substituted Cysteine Accessibility Method  

Science Journals Connector (OSTI)

...binding induces changes in the oligomeric state and conformation of Sec A in a lipid environment: a small-angle neutron-scattering study. J. Mol. Biol. 332 :23-30. 13. Or E , A Navon, and T Rapoport. 2002. Dissociation of the dimeric...

Meera K. Bhanu; Ping Zhao; Debra A. Kendall

2013-08-09T23:59:59.000Z

156

Defining the Escherichia coli SecA Dimer Interface Residues through In Vivo Site-Specific Photo-Cross-Linking  

Science Journals Connector (OSTI)

...binding induces changes in the oligomeric state and conformation of Sec A in a lipid environment: a small-angle neutron-scattering study. J. Mol. Biol. 332 :23-30. 12. Shin JY , M Kim, and T Ahn. 2006. Effects of signal peptide and...

Dongmei Yu; Andy J. Wowor; James L. Cole; Debra A. Kendall

2013-04-12T23:59:59.000Z

157

Copper Induces Cytoplasmic Retention of Fission Yeast Transcription Factor Cuf1  

Science Journals Connector (OSTI)

...copper-dependent manner by two-hybrid assay. (A) Schematic diagram...grant MOP-36450 to S.L. Infrastructure equipment that was essential...helix-loop-helix proteins with a two-hybrid system. Mol. Cell. Biol...interacting proteins with the two-hybrid system II, p. 29-42. In...

Jude Beaudoin; Simon Labb

2006-02-01T23:59:59.000Z

158

Kaposi's Sarcoma-Associated Herpesvirus K3 and K5 Ubiquitin E3 Ligases Have Stage-Specific Immune Evasion Roles during Lytic Replication  

Science Journals Connector (OSTI)

...passant mutagenesis: a two step markerless red recombination system. Methods Mol. Biol...and N Osterrieder. 2006. Two-step red-mediated recombination for versatile high-efficiency...Kumar, W Lu, Y Li, Y Zhou, Q Li, and C Wood. 2014. Humanized-BLT mouse model of...

Kevin Brulois; Zsolt Toth; Lai-Yee Wong; Pinghui Feng; Shou-Jiang Gao; Armin Ensser; Jae U. Jung

2014-06-04T23:59:59.000Z

159

Identification of Neuronal Enhancers of the Proopiomelanocortin Gene by Transgenic Mouse Analysis and Phylogenetic Footprinting  

Science Journals Connector (OSTI)

...overnight at 4C, and sectioned (50 mum) with Vibratome 1000 (Ted Pella, Redding, Calif.). Brain slices were treated with...of transcription. Mol. Cell. Biol. 17: 5952-5959. 44 Poulin, G., B. Turgeon, and J. Drouin. 1997. NeuroD1/beta2...

Flvio S. J. de Souza; Andrea M. Santangelo; Viviana Bumaschny; Mara Elena Avale; James L. Smart; Malcolm J. Low; Marcelo Rubinstein

2005-04-01T23:59:59.000Z

160

WaterDNA interactions as studied by Xray and neutron fibre diffraction  

Science Journals Connector (OSTI)

...over the A form by the pres- ence of excess ions in the fibre. This effect is most...Langridge, R. 1965 Fourier synthesis of lithium DNA part III: Hoogsteen models. J...diffraction study of a crystalline form of the lithium salt. J. Mol. Biol. 2, 1937. Langridge...

2004-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


161

Discrimination of outer membrane proteins using support vector machines  

Science Journals Connector (OSTI)

......discriminated with an accuracy of 94% from the pool of 1087 sequences, while correctly excluding...orthologous transporters by sequence/structure conservation. J. Mol. Biol., 332, 9991014. Chou...of amino acid preference at membrane-water interfaces. Bioinformatics, 18, 608616......

Keun-Joon Park; M. Michael Gromiha; Paul Horton; Makiko Suwa

2005-01-01T23:59:59.000Z

162

The degree of agreement between simulation and experiment with respect to temperature dependent displacements and spectra is really remarkable. However one point remains obscure: It is  

E-Print Network [OSTI]

of dynamic neutron scattering to biology was to test MD simulations and related force fields on a ps time Dependence of hydrated myoglobin, comparison of force field calculations with neutron scattering data by R. Loncharich and B. Brooks, J. Mol. Biol. (1990) 215, 439 This figures show simulated neutron scattering

Doster, Wolfgang

163

Cyanobacterial Lactate Oxidases Serve as Essential Partners in N2 Fixation and Evolved into Photorespiratory Glycolate Oxidases in Plants  

Science Journals Connector (OSTI)

...2001). After 2 h of incubation under the growth conditions, ethylene was measured in the head space of the vial using gas chromatography...Mol. Biol. Evol. 26 : 1533-1548. Badger, M.R. , Price, G.D., Long, B.M., and Woodger, F.J. (2006...

Claudia Hackenberg; Ramona Kern; Jan Hüge; Lucas J. Stal; Yoshinori Tsuji; Joachim Kopka; Yoshihiro Shiraiwa; Hermann Bauwe; Martin Hagemann

2011-08-09T23:59:59.000Z

164

Crystal Structure of Vigna radiata Cytokinin-Specific Binding Protein in Complex with Zeatin  

Science Journals Connector (OSTI)

...The data were fitted to a sigmoidal dose-response equation to determine the...0 to 1.20 (1.22 to 1.20) a Radiation source BW7B beamline, EMBL/DESY Temperature...interpretation of protein structures: Estimation of static accessibility. J. Mol. Biol...

Oliwia Pasternak; Grzegorz D. Bujacz; Yasuyuki Fujimoto; Yuichi Hashimoto; Filip Jelen; Jacek Otlewski; Michal M. Sikorski; Mariusz Jaskolski

2006-09-22T23:59:59.000Z

165

Antioxidant Action via p53-mediated Apoptosis  

Science Journals Connector (OSTI)

...cells. Mol. Cell. Biol., 4: 1689 "1694,1984. 37. Price, B. D., and Calderwood, S. K. Increased sequence-specific...Cardioscience, 1: 191 "198,1990. 44. Packer, L., Wits,E. H., and Tritschler, H. J. a-Lipoic acid as a biological...

Ming Liu; Jill C. Pelling; Jingfang Ju; Edward Chu; and Douglas E. Brash

1998-04-15T23:59:59.000Z

166

Protein active sites, interaction  

E-Print Network [OSTI]

for active site identification ! Manual MSA and structure analysis ! Catalytic Site Atlas (homology-based) ! Evolutionary Trace (MSA subfamily- and family-wide conservation; phylogenetic tree and structure analysis) ! 3D", Bartlett et al. J Mol Biol. 2002 Nov 15;324(1):105-21. · "An evolutionary trace method defines binding

Sjölander, Kimmen

167

Caenorhabditis elegans SMG-2 Selectively Marks mRNAs Containing Premature Translation Termination Codons  

Science Journals Connector (OSTI)

...G. Caponigro, T. E. LaGrandeur, L. Hatfield, D. M. Fortner, and R. Parker. 1996. An essential component of the decapping...Struct. Mol. Biol. 12: 482-488. 22 Fukuhara, N., J. Ebert, L. Unterholzner, D. Lindner, E. Izaurralde, and E...

Lisa Johns; Andrew Grimson; Sherry L. Kuchma; Carrie Loushin Newman; Philip Anderson

2007-06-11T23:59:59.000Z

168

Conditional requirement for the Flk-1 receptor in the in vitro generation of early hematopoietic cells  

Science Journals Connector (OSTI)

...Papayannopoulou T Wiles M V ( 1993 ) Mol Cell Biol 13 : 473 486 , 8417345 . 15 Bautch V L Stanford W L Rapoport R Russell S Byrum R S Futch T A ( 1996 ) Dev Dyn 205 : 1 12 , 8770547 . 16 Eichmann A Corbel C Nataf V Vaigot P Breant C Le Douarin N M ( 1997 ) Proc...

Michihiro Hidaka; William L. Stanford; Alan Bernstein

1999-01-01T23:59:59.000Z

169

Cancer Cell Metabolism: One Hallmark, Many Faces  

Science Journals Connector (OSTI)

...2011;144:646-74. 9. Warburg O , Wind F, Negelein E.The metabolism of tumors...kinases: conserved guardians of cellular energy.Nat Rev Mol Cell Biol 2007;8:774-85...Zhu T, Guan KL.TSC2 mediates cellular energy response to control cell growth and survival...

Jason R. Cantor and David M. Sabatini

2012-10-01T23:59:59.000Z

170

New Strategies in Prostate Cancer: Targeting Lipogenic Pathways and the Energy Sensor AMPK  

Science Journals Connector (OSTI)

...cancer: the HUNT 2 cohort, Norway. Cancer Causes Control 2009...conserved guardians of cellular energy. Nat Rev Mol Cell Biol 2007...targeting lipogenic pathways and the energy sensor AMPK. | Although the...represents a link between energy homeostasis and cancer. Thus...

Giorgia Zadra; Carmen Priolo; Akash Patnaik; and Massimo Loda

2010-07-01T23:59:59.000Z

171

Ganglioside rafts as MAG receptors that mediate blockade of axon growth  

Science Journals Connector (OSTI)

...2002 ) Mol Cell Neurosci 19 : 18 31 , 11817895 . 28 Dergham, P., Ellezam, B. Essagian, C., Avedissian, H., Lubell, W. D. & McKerracher, L. (2002) J. Neurosci., in press. 29 Yamashita T H Higuchi H Tohyama M ( 2002 ) J Cell Biol...

Lisa McKerracher

2002-01-01T23:59:59.000Z

172

A Genomic Map of Viroid RNA Motifs Critical for Replication and Systemic Trafficking  

Science Journals Connector (OSTI)

...life based on the RNA World scenario (Gilbert, 1986; Joyce, 2002) but also impacts...J. Mol. Biol. 262: 652-670. Gilbert, W. (1986). The RNA world. Nature...replication. In Cuurent Protocols in Microbiology, R. Coico, T. Kowalik, J.M. Quarles...

Xuehua Zhong; Anthony J. Archual; Amy A. Amin; Biao Ding

2008-01-04T23:59:59.000Z

173

Human Metapneumovirus Establishes Persistent Infection in the Lungs of Mice and Is Reactivated by Glucocorticoid Treatment  

Science Journals Connector (OSTI)

...points out to day 98 p.i. (data not shown). In general, the lung virus titers (Fig. 1) followed a similar...susceptibility to RSV infection by exposure to inhaled diesel engine emissions. Am. J. Respir. Cell Mol. Biol. 28...

Yuru Liu; Debra L. Haas; Spencer Poore; Sanjin Isakovic; Michelle Gahan; Suresh Mahalingam; Zhen F. Fu; Ralph A. Tripp

2009-04-08T23:59:59.000Z

174

High-resolution timing of cell cycle-regulated gene expression  

Science Journals Connector (OSTI)

...CLN2, CLB1, and PCL9); a Cdc28p inhibitor (SWE1); a positive regulator of...regu-lates expression of the cyclin kinase inhibitor p40SIC1. Mol Cell Biol, 16:5701 ZZQQhy7...synthesis of chitin in cell walls and chitosan in spore walls. Yeast, 8:1089 ZZQQhy99...

Maga Rowicka; Andrzej Kudlicki; Benjamin P. Tu; Zbyszek Otwinowski

2007-01-01T23:59:59.000Z

175

Genetic Variation in the Nucleotide Excision Repair Pathway and Colorectal Cancer Risk  

Science Journals Connector (OSTI)

...complex formation and stimulation of XPC repair activity. Mol Cell Biol 1997;17:6924-31. 35 van der Spek PJ, Eker A, Rademakers S, et al. XPC and human homologs of RAD23: intracellular localization and relationship to other nucleotide excision repair...

Sonja I. Berndt; Elizabeth A. Platz; M. Daniele Fallin; Lucy W. Thuita; Sandra C. Hoffman; Kathy J. Helzlsouer

2006-11-01T23:59:59.000Z

176

Quantification of Excision Repair Cross-Complementing Group 1 and Survival in p16-Negative Squamous Cell Head and Neck Cancers  

Science Journals Connector (OSTI)

...fluorescence-based in-situ assessment of protein expression.Methods Mol Biol 2009;520:163-75. 23. Houtsmuller AB , Rademakers S, Nigg AL, Hoogstraten D, Hoeijmakers JH Vermeulen W.Action of DNA repair endonuclease ERCC1/XPF in living cells...

Ranee Mehra; Fang Zhu; Dong-Hua Yang; Kathy Q. Cai; JoEllen Weaver; Mahendra K. Singh; Anna S. Nikonova; Erica A. Golemis; Douglas B. Flieder; Harry S. Cooper; Miriam Lango; John A. Ridge; Barbara Burtness

2013-12-01T23:59:59.000Z

177

Patterns and Evolution of Nucleotide Landscapes in Seed Plants  

Science Journals Connector (OSTI)

...retrieved from GenBank with the EST analysis pipeline EST2uni (Forment et al., 2008). After...processed through the EST protein translation pipeline prot4EST version 2.2 (Wasmuth and Blaxter...Mechanisms of transcription-coupled DNA repair. Nat. Rev. Mol. Cell Biol. 3 : 21-29...

Laurana Serres-Giardi; Khalid Belkhir; Jacques David; Sylvain Glémin

2012-04-06T23:59:59.000Z

178

Object-oriented biological system integration: a SARS coronavirus example  

Science Journals Connector (OSTI)

......were obtained through an auto-mated pipeline, GeneAtlas, implemented by Accelrys, Inc. (Kitson et al., 2002). This pipeline can efficiently identify the function...the mammalian cell cycle control and DNA repair systems. Mol. Biol. Cell, 10, 27032734......

Daniel Shegogue; W. Jim Zheng

2005-05-01T23:59:59.000Z

179

Methanogens and the diversity of archaebacteria.  

Science Journals Connector (OSTI)

...genes by restriction endonuclease map- ping (478). In the methanogens and halobacteria...Mol. Biol. Evol. 2:92-108. 202. Jin, S.-L. C., D. K. Blanchard, and...484-490. 376. Rivard, C. J., and P. XI. Smith. 1982. Isolation and character...

W J Jones; D P Nagle Jr; W B Whitman

1987-03-01T23:59:59.000Z

180

Terminally differentiated muscle cells are defective in base excision DNA repair and hypersensitive to oxygen injury  

Science Journals Connector (OSTI)

...1562 1570 . 4 Nouspikel TP Hyka-Nouspikel N Hanawalt PC ( 2006 ) Mol Cell Biol 26 : 8722 8730 . 5 El-Khamisy SF Saifi GM Weinfeld M Johansson F Helleday T Lupski JR Caldecott KW ( 2005 ) Nature 434 : 108 113 . 6 Ahel I Rass U El-Khamisy...

Laura Narciso; Paola Fortini; Deborah Pajalunga; Annapaola Franchitto; Pingfang Liu; Paolo Degan; Mathilde Frechet; Bruce Demple; Marco Crescenzi; Eugenia Dogliotti

2007-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


181

A protective monoclonal antibody recognizes a linear epitope in the precursor to the major merozoite antigens of Plasmodium chabaudi adami  

Science Journals Connector (OSTI)

...overlap with the P. yoelii PMMSA clone of Burns et al. (20), the epitope of mAb 5C10...Barrell, B. G., Smith, A. J. H. & Roe, B. A. (1980) J. Mol. Biol. 143...Acad. Sci. USA 83, 2989-2993. 20. Burns, J. M., Daly, T. M., Vaidya, A...

A M Lew; C J Langford; R F Anders; D J Kemp; A Saul; C Fardoulys; M Geysen; M Sheppard

1989-01-01T23:59:59.000Z

182

Selective cleavage in the avian retroviral long terminal repeat sequence by the endonuclease associated with the alpha beta form of avian reverse transcriptase  

Science Journals Connector (OSTI)

...Research Center, Nutley, NJ 07110 Communicated by John J. Burns, July 20, 1983 ABSTRACT M13 recombinant DNA clones containing...Goulson, A. R., Barrell, B. G., Smith, A. S. E. & Roe, B. A. (1980)J. Mol. Biol. 143, 161-172. 10. Ehrlich...

G Duyk; J Leis; M Longiaru; A M Skalka

1983-01-01T23:59:59.000Z

183

Transduction of nondividing cells using pseudotyped defective high-titer HIV type?1?particles  

Science Journals Connector (OSTI)

...Miller A D ( 1990 ) Mol Cell Biol 10 : 4239 4242 , 2370865 . 4 Roe T Reynolds T C Yu G Brown P O ( 1993 ) EMBO J 12 : 2099 2108 , 8491198 . 5 Lewis P F Emerman M ( 1994 ) J Virol 68...J Acquired Immune Defic Syndr 3 : 215 219 , 2154577 . 41 Burns J C Friedmann T Driever W Burrascano M Yee J-K ( 1993 ) Proc...

Jakob Reiser; George Harmison; Stephanie Kluepfel-Stahl; Roscoe?O. Brady; Stefan Karlsson; Manfred Schubert

1996-01-01T23:59:59.000Z

184

Gaucher disease gene GBA functions in immune regulation  

Science Journals Connector (OSTI)

...Nagauker-Shriker O Yermiyahu T Levy R ( 1994 ) Monocyte dysfunction in patients with Gaucher...Exp Med 173 : 539 547 . 26 Le Panse R ( 2008 ) Regulatory and pathogenic mechanisms in human autoimmune...Rev Mol Cell Biol 9 : 139 150 . 42 Pappu R ( 2007 ) Promotion of lymphocyte egress...

Jun Liu; Stephanie Halene; Mei Yang; Jameel Iqbal; Ruhua Yang; Wajahat Z. Mehal; Wei-Lien Chuang; Dhanpat Jain; Tony Yuen; Li Sun; Mone Zaidi; Pramod K. Mistry

2012-01-01T23:59:59.000Z

185

Protein folding from a highly disordered denatured state: The folding pathway of chymotrypsin inhibitor 2 at atomic resolution  

Science Journals Connector (OSTI)

...theoretical study of polyalanine peptides by Pappu et al. (31) suggests that the Flory...F J Otzen D E Ladurner A G Fersht A R ( 1995 ) J Mol Biol 254 : 968 979...10.1073/ pnas.090104997) . 31 Pappu R V Srinivasan R Rose G D ( 2000 ) Proc...

Steven L. Kazmirski; Kam-Bo Wong; Stefan M. V. Freund; Yee-Joo Tan; Alan R. Fersht; Valerie Daggett

2001-01-01T23:59:59.000Z

186

A method for evaluating the structural quality of protein models by using higher-order ?? pairs scoring  

Science Journals Connector (OSTI)

...fragment length, k, the coarser the bin. 1 Lakowski R. A. MacArthur M. W. Moss D. S. Thornton J. M. ( 1993...1963 ) J. Mol. Biol 7 : 95 99 , 13990617 . 10 Pappu R. V. Srinivasan R. Rose G. D. ( 2005 ) Proc. Natl. Acad. Sci. USA...

Gregory E. Sims; Sung-Hou Kim

2006-01-01T23:59:59.000Z

187

Assessing the solvent-dependent surface area of unfolded proteins using an ensemble model  

Science Journals Connector (OSTI)

...J Mol Biol 353 : 873 887 . 25 Pappu RV Srinivasan R Rose GD ( 2000 ) The Flory isolated-pair...Crick SL Jayaraman M Frieden C Wetzel R Pappu RV ( 2006 ) Fluorescence correlation...1749 . 49 Schweitzer-Stenner R Measey TJ ( 2007 ) The alanine-rich XAO...

Haipeng Gong; George D. Rose

2008-01-01T23:59:59.000Z

188

End-to-end distance distributions and intrachain diffusion constants in unfolded polypeptide chains indicate intramolecular hydrogen bond formation  

Science Journals Connector (OSTI)

...the chromophores and on the distance, r, separating them according to (25...fluorescence lifetime of the donor, and R 0 is the characteristic Forster distance...Mol. Biol. 327 : 867 884 . 16 Pappu R. V. Srinivasan R. Rose G. D. ( 2000 ) Proc. Natl...

Andreas Mglich; Karin Joder; Thomas Kiefhaber

2006-01-01T23:59:59.000Z

189

Fluorescence correlation spectroscopy shows that monomeric polyglutamine molecules form collapsed structures in aqueous solutions  

Science Journals Connector (OSTI)

...Chen S Berthelier V Yang W Wetzel R ( 2001 ) J Mol Biol 311 : 173...16 Chen S Ferrone FA Wetzel R ( 2002 ) Proc Natl Acad Sci USA 99...Bhattacharya A Thakur A Wetzel R ( 2005 ) Proc Natl Acad Sci USA...Wang X Vitalis A Wyczalkowski MA Pappu RV ( 2006 ) Proteins Struct Funct Bioinf...

Scott L. Crick; Murali Jayaraman; Carl Frieden; Ronald Wetzel; Rohit V. Pappu

2006-01-01T23:59:59.000Z

190

HSP70 homolog functions in cell-to-cell movement of a plant virus  

Science Journals Connector (OSTI)

...Karasev A V Koonin E V Dolja V V ( 1991 ) J Mol Biol 217 : 603 610 , 2005613 . 14 Pappu H R Karasev A V Anderson E J Pappu S S Hilf M E Febres V J Eckloff R M G McCaffery M Boyko V Govda S ( 1994 ) Virology 199 : 35 46 , 8116253 . 15 Klaassen...

Valery V. Peremyslov; Yuka Hagiwara; Valerian V. Dolja

1999-01-01T23:59:59.000Z

191

Dissection of Double-Stranded RNA Binding Protein B2 from Betanodavirus  

Science Journals Connector (OSTI)

...ahead of print on 21 March 2007. Beau J. Fenner Winnie Goh Jimmy Kwang Corresponding author...Mol. Biol. 279: 1085-1099. 10 Fenner, B. J., Q. Du, W. Goh, R. Thiagarajan...ELISA. J. Fish Dis. 29: 423-432. 11 Fenner, B. J., W. Goh, and J. Kwang...

Beau J. Fenner; Winnie Goh; Jimmy Kwang

2007-03-21T23:59:59.000Z

192

Appl Microbiol Biotechnol (1995) 43:850-855 Springer-Verlag 1995 N. Padukone K. W. Evans J. D. McMillan  

E-Print Network [OSTI]

cellulose and xylose to ethanol Received: 25 July 1994/Received revision: 2 December 1994/Accepted: 16 (pLOI 297) in the production of ethanol from cellulose and xylose. We have examined the fermentation and fermentation of cellulose with recom- binant E. coli and exogenous cellulose showed a high ethanol yield (84

California at Riverside, University of

193

Morphological and Functional Stasis in Mycorrhizal Root Nodules as Exhibited by a Triassic Conifer  

E-Print Network [OSTI]

Telemachus: Evidence from the Triassic of Antarctica. Int J Plant Sci 171:560573. 22. Bergersen FJ, Costin B (1964) Root nodules of Podocarpus lawrencei and their eco- logical significance. Aust J Biol Sci 17:4448. Schwendemann et al. PNAS | August 16, 2011... evolution: analysis of nuclear 18S rRNA sequences. Mol Biol Evol 14:5668. 33. Chaw S-M, Parkinson CL, Cheng Y, Vincent TM, Palmer JD (2000) Seed plant phy- logeny inferred from all three plant genomes: Monophyly of extant gymnosperms and origin of Gnetales...

Schwendemann, Andrew Benjamin; Decombeix, Anne-Laure; Taylor, Thomas N.; Taylor, Edith L.; Krings, Michael

2011-01-01T23:59:59.000Z

194

J59 Chem Biol Biohydrog 2011draft ($$$).pdf  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Biohydrogenation from Biomass Sugar Mediated by Biohydrogenation from Biomass Sugar Mediated by in vitro 1 Synthetic Enzymatic Pathways 2 3 Running title: Biohydrogenation by Enzyme Cocktail 4 5 6 Yiran Wang 1,4 , Weidong Huang 1 , Noppadon Sathitsuksanoh 1,2 , Zhiguang Zhu 1 , 7 Y.-H. Percival Zhang 1,2,3, * 8 1 Biological Systems Engineering Department, 210-A Seitz Hall, Virginia Polytechnic Institute 9 and State University, Blacksburg, Virginia, USA 10 2 Institute for Critical Technology and Applied Science, Virginia Polytechnic Institute and State 11 University, Blacksburg, Virginia, USA 12 3 DOE Bioenergy Science Center, Oak Ridge, Tennessee, USA 13 4 Shanghai Advanced Research Institute, Chinese Academy of Sciences, No. 115, Lane 572, 14 Bibo Road, Shanghai 201203, China 15 16 * Correspondence should be addressed to Y.P.Z. (ypzhang@vt.edu) 17

195

Biol. Lett. doi:10.1098/rsbl.2005.0437  

E-Print Network [OSTI]

-biased dispersal in a solitary carnivore: Yellowstone cougars Roman Biek1,*, Naomi Akamine2 , Michael K. Schwartz3-wise comparisons. In contrast, female residents pre- sent at the same time and females separated by few generations

196

Biol. Lett. doi:10.1098/rsbl.2005.0332  

E-Print Network [OSTI]

. Pads (Premium cosmetic pads, Boots, www.boots.co.uk) were 100% cotton, elliptical in shape, approximately 9!7 cm at their longest axis and held in place using MicroporeTM surgical tape (Boots

Flegr, Jaroslav

197

Biol. Lett. doi:10.1098/rsbl.2007.0136  

E-Print Network [OSTI]

of abnormalities in barn swallows from Chernobyl A. P. Møller1,*, T. A. Mousseau2 , F. de Lope3 and N. Saino4 1 for correspondence (amoller@snv.jussieu.fr). Ever since the Chernobyl accident in 1986, that contaminated vast areas in populations around Chernobyl, but much less frequently in an uncontaminated Ukrainian con- trol population

Mousseau, Timothy A.

198

Biol. Lett. doi:10.1098/rsbl.2007.0528  

E-Print Network [OSTI]

research in Chernobyl Although Chernobyl is perhaps the largest environmental disaster ever, there has been on the status of Chernobyl did not use exhaustive quantitative assess- ment of available evidence (Chernobyl Forum 2005; EGE 2005). The conclusion that Chernobyl is a thriving ecosystem was widely cited

Mousseau, Timothy A.

199

Biol. Lett. doi:10.1098/rsbl.2008.0174  

E-Print Network [OSTI]

drive the nucleotide composition of non-coding sequences in Drosophila Penelope R. Haddrill* and Brian of base pairs that are GC versus AT. This is highly variable among different parts of eukaryotic genomes in the frequency of GC versus AT variants at a site similar to that caused by selection (Gutz & Leslie 1976

200

exp. Biol. (1976), 65, 483-506 With 14 figures  

E-Print Network [OSTI]

OF SPIDER'S SILK AND THEIR ROLE IN THE DESIGN OF ORB-WEBS BY MARK DENNY* Department of Zoology, Duke physical properties of the viscid and frame silks of the orb-webs built by the spider Araneus sericatus (Cl; and allow the orb-web to function as an aerial filter with a minimum expen- diture of material and energy

Denny, Mark

Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


201

Biol. Lett. doi:10.1098/rsbl.2007.0218  

E-Print Network [OSTI]

components of prey capture are architecturally constrained in spider orb webs Todd A. Blackledge1,* and Chad context. Orb webs first intercept and then retain insects long enough to be attacked by spiders. Improving either function increases prey capture and they are largely determined by different aspects of web

Blackledge, Todd

202

Biol. Lett. doi:10.1098/rsbl.2005.0388  

E-Print Network [OSTI]

mass-specific metabolic demands. Keywords: hummingbird; digestion; glucose absorption; paracellular the question of whether sugar absorption could occur without any energy expen- diture (by passive, non that is not metabolized or trans- ported by mediated pathways in birds (Chang et al. 2004). Their findings led them

Mladenoff, David

203

Biol.Cybem.40, i-8 (1981) Biological Cybernetics  

E-Print Network [OSTI]

become dis- pensible. A second feature consists in the creation of a semi-quantitative scale which may be used to invert observed behaviour into relative genetic values. In general, non trivial quantitative special case is the elementary hypercycle (aq = aj6~,j +1) introduced by Eigen and Schuster (1979

Hofbauer, Josef

204

This journal is c The Royal Society of Chemistry 2012 Mol. BioSyst., 2012, 8, 21 21 Cite this: Mol. BioSyst., 2012, 8, 21  

E-Print Network [OSTI]

. BioSyst., 2012, 8, 21 Intrinsically disordered proteins M. Madan Babu DOI: 10.1039/c1mb90045e Our of protein function. Such segments, usually referred to as intrinsically disordered regions (IDRs), may understanding of protein function has been predominated by the view that proteins need to adopt a defined three

Babu, M. Madan

205

Every organism contains, within its regu-latory system, self-sustaining pacemaker cir-  

E-Print Network [OSTI]

. References and Notes 1. M. T. Laub, H. H. McAdams, T. Feldblyum, C. M. Fraser, L. Shapiro, Science 290, 2144, S. C. Wang, L. Shapiro, Nature Rev. Mol. Cell Biol. 3, 167 (2002). 6. M. T. Laub, S. L. Chen, L. Shapiro, H. H. McAdams, Proc. Natl. Acad. Sci. U.S.A. 99, 4632 (2002). 7. K. C. Quon, G. T. Marczynski, L

206

Mol. Cryst. Liq. Cryst., Vol. 575: pp. 5763, 2013 Copyright Taylor & Francis Group, LLC  

E-Print Network [OSTI]

, AND V. V. SLYUSAR Institute of Physics, National Academy of Sciences of Ukraine, Kiev, Ukraine We report. Kasyanyuk, Institute of Physics, National Academy of Sci- ences of Ukraine, Prospect Nauki 46, Kiev (03680), Ukraine. E-mail: deniskasyanyuk@hotmail.com 57 Downloadedby[DenisKasyanyuk]at23:4222April2013 #12;

Reznikov, Yuri

207

J. Mol. Riol. (1987) 198, 655-676 Refolding of Bacteriorhodopsin in Lipid Bilayers  

E-Print Network [OSTI]

provide further evidence that the native folded structure of bact,eriorhodopsin lies at' a free energy studied by absorption spectroscopy. Upon vesicle fusion, the refolded fragments first reassociate

208

Int. J. Mol. Sci. 2008, 9, 679-697 International Journal of  

E-Print Network [OSTI]

used by different organisms, even within the same organism the nuclear and mitochondrial genes may on genes subject to mutations, and have estimated how these genes "survive" over generations. We have used ­ Crick [1] had postulated the coevolution and frozen accident hypotheses, where similar amino acids would

Kurnaz, Levent

209

J Mol Model (2006) 12: 611619 DOI 10.1007/s00894-005-0068-9  

E-Print Network [OSTI]

­Cr­Mn and of Ni­Co­Mo­Mn (10% spacing) have been measured for the oxidation of propene to acroleine. The data have Selective oxidation . Acroleine materials modeling . Kriging . Heterogeneous catalysts . Composition

Hamprecht, Fred A.

210

Cell. Mol. Life Sci. 62 (2005) 31063116 1420-682X/05/243106-11  

E-Print Network [OSTI]

towards sper- mine. Despite the reduced uptake, the resistant strains ac- cumulated significant levels of polyamines and displayed increased ornithine decarboxylase activity, suggesting re- duced polyamine sensing stimulate proliferation and metastasis of cancer cells they have become a target for therapeutic efforts [3

Kahana, Chaim

211

J. Mol. Model. 2000, 6, 498 516 Springer-Verlag 2000FULL PAPER  

E-Print Network [OSTI]

constraints of the target protein, LigBuilder builds up ligands step by step using a library of organicBuilder is able to generate chemical structures similar to the known ligands. Keywords Structure-based drug design as de novo design. In this case, ligand molecules are built up within the constraints of the binding

Luhua, Lai

212

Hydrogen Separations and Purification  

E-Print Network [OSTI]

/mol 100 Water mol/mol 5 Total hydrocarbons mol/mol 2 Oxygen mol/mol 5 Helium, Nitrogen, Argon mol/mol 100

213

Proper Sanitization of Sewage Sludge: a Critical Issue for a Sustainable Society  

Science Journals Connector (OSTI)

...Martin. 2003. A review of the literature on the occurrence...in extraanimal environments, p. 57-66...selective research reviews. Klampenbourg...in the natural environment. Microbiol...L. 2003. A review of survival of...

Veronica Arthurson

2008-07-07T23:59:59.000Z

214

Characterization of C1-Metabolizing Prokaryotic Communities in Methane Seep Habitats at the Kuroshima Knoll, Southern Ryukyu Arc, by Analyzing pmoA, mmoX, mxaF, mcrA, and 16S rRNA Genes  

Science Journals Connector (OSTI)

...other bacteria in sediments above gas hydrate (Cascadia Margin, Oregon...associated with Gulf of Mexico gas hydrates. Appl. Environ. Microbiol...reduction in sediment from a marine gas hydrate area. Environ. Microbiol. 4...

Fumio Inagaki; Urumu Tsunogai; Masae Suzuki; Ayako Kosaka; Hideaki Machiyama; Ken Takai; Takuro Nunoura; Kenneth H. Nealson; Koki Horikoshi

2004-12-01T23:59:59.000Z

215

Statistical Assessment of Variability of Terminal Restriction Fragment Length Polymorphism Analysis Applied to Complex Microbial Communities  

Science Journals Connector (OSTI)

...communities. The statistical analysis was carried out at successive...batch bubble column reactor inoculated with activated...length polymorphism data analysis. Appl. Environ. Microbiol...length polymorphism analysis. Environ. Microbiol...F. Widmer. 2008. Reliability for detecting composition...

Pierre Rossi; Franois Gillet; Emmanuelle Rohrbach; Nouhou Diaby; Christof Holliger

2009-09-11T23:59:59.000Z

216

Genotypic Diversity and Virulence Characteristics of Clinical and Environmental Vibrio vulnificus Isolates from the Baltic Sea Region  

Science Journals Connector (OSTI)

...whole Baltic Sea region (8). Health authorities in the state of Mecklenburg-Vorpommern...Vibrio vulnificus strains of human health relevance. Food Microbiol. 30...vulnificus strains potentially dangerous to public health. Appl. Environ. Microbiol...

Nadja Bier; Silke Bechlars; Susanne Diescher; Florian Klein; Gerhard Hauk; Oliver Duty; Eckhard Strauch; Ralf Dieckmann

2013-03-29T23:59:59.000Z

217

Separation of Human Leucocytes from Blood  

Science Journals Connector (OSTI)

... Int. Congr. Microbiol., 1958, 178 (Almquist and Wiksells, Uppsala, 1958).Riis, P., Acta Hmatol., 14, 302 (1955).

PETER WILDY; MARK RIDLEY

1958-12-27T23:59:59.000Z

218

Microarray and Functional Gene Analyses of Sulfate-Reducing Prokaryotes in Low-Sulfate, Acidic Fens Reveal Cooccurrence of Recognized Genera and Novel Lineages  

Science Journals Connector (OSTI)

...sulfate-reducing bacteria in groundwater at a uranium mill tailings site. Appl. Environ. Microbiol...Microbiol. Lett. 123: 249-254. 76 Wind, T., and R. Conrad. 1995. Sulfur...Microbiol. Ecol. 18: 257-266. 77 Wind, T., S. Stubner, and R. Conrad...

Alexander Loy; Kirsten Ksel; Angelika Lehner; Harold L. Drake; Michael Wagner

2004-12-01T23:59:59.000Z

219

Prevalence of Yersinia enterocolitica in waters of the lower Chippewa River Basin, Wisconsin.  

Science Journals Connector (OSTI)

...Y-M agar (T. N. Saari and G. P. Jansen, Contrib. Microbiol. Immunol. 5...Y-M agar (T. N. Saari and G. P. Jansen, Contrib. Microbiol. Immunol. 5...Y-M agar (T. N. Saari and G. P. Jansen, Contrib. Microbiol. Immunol. 5...

C A Meadows; B H Snudden

1982-04-01T23:59:59.000Z

220

192 | Integr. Biol., 2014, 6, 192--202 This journal is The Royal Society of Chemistry 2014 Cite this: Integr. Biol., 2014,  

E-Print Network [OSTI]

cell migration Reza Riahi,a Min Long,bc Yongliang Yang,a Zachary Dean,d Donna D. Zhang,be Marvin J is sufficient to trigger the migratory behavior, cell injury additionally induces reactive oxygen species, Nrf2, in a spatiotemporal manner. Furthermore, we show that Nrf2 has an inhibitory role in injury-induced epithelial

Wong, Pak Kin

Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


221

1521-0111/85/5/671681$25.00 http://dx.doi.org/10.1124/mol.113.091199 MOLECULAR PHARMACOLOGY Mol Pharmacol 85:671681, May 2014  

E-Print Network [OSTI]

-yl)-[2-(1H-tetrazol-5-yl)-phenyl]- amine] enhance the activity of TREK1 currents, and we show that BL

Tucker, Stephen J.

222

Microsoft PowerPoint - MolWireH2-jM_JW_BNLworkshop.ppt [Read-Only]  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Fast Pulse Experiments on Fast Pulse Experiments on Molecular Processes in Organic Ions hν phase boundary e - 2-200 nm molecular wire Catalytic nanoparticle Energy Capture and Storage Using Nano Objects 10 8 6 4 2 0 x10 -3 3000nm 2500 2000 1500 1000 500 λ (nm) 0.14 0.12 0.10 0.08 0.06 0.04 0.02 0.00 Absorbance R R R R * n n=20 PolyFluorene 20 anion in THF LEAF (300ns) Na reduction 606 nm 2520 nm 80 60 40 20 0 ε (M -1 cm -1 ) x10 -3 2000 1800 1600 1400 1200 1000 800 600 λ (nm) T3-PPE-T3 and PPE Cations in DCE/Toluene T3PPET3 Cation PPE Cation < 10 ns S R S S R R OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR S R S S R R OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR OR * The spectrum of the T 3 end-capped polymer is red- shifted relative to that of the parent * The PPE cation radical is trapped by the T 3 end- groups in <10 ns !

223

Mol Genet Genomics (2008) 280:249261 DOI 10.1007/s00438-008-0360-3  

E-Print Network [OSTI]

activity is essential for the process of self-incompatibility in several plant families (reviewed in Mc are not involved in self-incompatibility, but seem to have impor- tant functions throughout the plant kingdomCubbin and Kao 2000). Enzymes related to, but dis- tinct from, S-RNases are also present in self

Green, Pamela

224

Mol Gen Genet (1996) 250:180-488 Springer-Verlag 1996 Joaquin Royo Norbert Nass Daniel P. Matron  

E-Print Network [OSTI]

clone for the N. alata S6-ribonuclease (S6-RNase), a gene required for self- incompatibility. alata styles (self-incompatibility genotype S6S6)hybridized to Tnal and accumulated in the style a population of N. alata plants segregating for alleles of the self-incom- patibility locus and is closely

225

Threshold Photoelectron Photoion Coincidence (TPEPICO) Studies: The Road to ? 0.1 kJ/mol Thermochemistry  

SciTech Connect (OSTI)

The threshold photoelectron photoion coincidence (TPEPICO) technique is utilized to investigate the dissociation dynamics and thermochemistry of energy selected medium to large organic molecular ions. The reactions include parallel and consecutive steps that are modeled with the statistical theory in order to extract dissociation onsets for multiple dissociation paths. These studies are carried out with the aid of molecular orbital calculations of both ions and the transition states connecting the ion structure to their products. The results of these investigations yield accurate heats of formation of ions, free radicals, and stable molecules. In addition, they provide information about the potential energy surface that governs the dissociation process. Isomerization reactions prior to dissociation are readily inferred from the TPEPICO data.

Baer, Tomas [University of North Carolina

2013-10-14T23:59:59.000Z

226

ExoMol molecular line lists V: the ro-vibrational spectra of NaCl and KCl  

Science Journals Connector (OSTI)

......London WC1E 6BT, UK 2 Department of Chemistry and Biochemistry, Old Dominion University...importance as they are products of coal and straw combustion. Their presence in coal increases the rate of corrosion in coal-fired power plants (Yang et-al......

Emma J. Barton; Christopher Chiu; Shirin Golpayegani; Sergei N. Yurchenko; Jonathan Tennyson; Daniel J. Frohman; Peter F. Bernath

2014-01-01T23:59:59.000Z

227

Int. J. Mol. Sci. 2013, 14, 4372-4374; doi:10.3390/ijms14024372 International Journal of  

E-Print Network [OSTI]

Bhatnagar and Keshav C. Das Biomass Production Potential of a Wastewater Alga Chlorella vulgaris ARC 1 under

Millar, Andrew J.

228

Stability assessment of gas mixtures containing terpenes at nominal 5nmol/mol contained in treated aluminum gas cylinders  

Science Journals Connector (OSTI)

Studies of climate change increasingly recognize the diverse influences exerted by terpenes in the atmosphere, including roles in particulates, ozone formation, and their oxidizing potential. Measurements of k...

George C. Rhoderick

2010-10-01T23:59:59.000Z

229

Int. J. Mol. Sci. 2012, 13, 8740-8751; doi:10.3390/ijms13078740 International Journal of  

E-Print Network [OSTI]

.: +86-871-5223505 (L.-M.G.); +86-871-5223503 (D.-Z.L.); Fax: +86-871-5217791 (D.-Z.L.). Received: 8

Provan, Jim

230

Int. J. Mol. Sci. 2012, 13, 5138-5162; doi:10.3390/ijms13045138 International Journal of  

E-Print Network [OSTI]

-dong, Jinju, 660-701, Korea; E-Mails: suguna@bio.gnu.ac.kr (S.S.); megac@bio.gnu.ac.kr (C.M.); ysohn@bio obesity. Cortisol is an important regulator of fuel metabolism during the starvation and stress which

Lee, Keun Woo

231

JOl/mol of Food Pmftclian. Vv/. 64. No. J. 200/. P/1ges 401-41)4 Research Note  

E-Print Network [OSTI]

. Two A. jlavus isolates, AFI2 with low virulence and lacking pectinase P2C and AF13 with high virulence. flavus with low virulence lack the ability to produce the predominant polygalacturonase, pectinase P2C (6 of polygalacturonase P2C (11). tn a molecular genetic study that provided direct evi- dence that polygalacturonase P2C

Cotty, Peter J.

232

Eur J Nucl Med Mol Imaging. Author manuscript Assessment of insulin resistance in fructose-fed rats with 125  

E-Print Network [OSTI]

in fructose-fed rats with 125 I-6-deoxy-6-iodo-D-glucose, a new tracer of glucose transport Perret Pascale 1 was to assess variations in glucose transport in rats with I-6-Deoxy-6-Iodo-D-glucose (6DIG), a new tracer protocol, in awake control and insulin-resistant fructose-fed rats. The tracer was injected at steady state

Paris-Sud XI, Université de

233

ExoMol line lists VII: The rotation-vibration spectrum of phosphine up to 1500 K  

E-Print Network [OSTI]

A comprehensive hot line list is calculated for $^{31}$PH$_3$ in its ground electronic state. This line list, called SAlTY, contains almost 16.8 billion transitions between 7.5 million energy levels and it is suitable for simulating spectra up to temperatures of 1500~K. It covers wavelengths longer than 1~$\\mu$m and includes all transitions to upper states with energies below $hc \\cdot 18\\,000$~cm$^{-1}$ and rotational excitation up to $J=46$. The line list is computed by variational solution of the Schr\\"odinger equation for the rotation-vibration motion employing the nuclear-motion program TROVE. A previously reported {\\it ab initio} dipole moment surface is used as well as an updated `spectroscopic' potential energy surface (PES), obtained by refining an existing \\textit{ab initio} surface through least-squares fitting to the experimentally derived energies. Detailed comparisons with other available sources of phosphine transitions confirms SAlTY's accuracy and illustrates the incompleteness of previous ex...

Sousa-Silva, Clara; Tennyson, Jonathan; Yurchenko, Sergei N

2014-01-01T23:59:59.000Z

234

Observation of the Early Structural Changes Leading to the Formation of Protein Superstructures  

E-Print Network [OSTI]

with this idea, a number of hydrophobic residues are present in the exterior of the ?-domains.5 Specifically, Val 112, 2 and 99 (D-helix/loop interface) together with Leu 120, 124 and 129 (A-helix) are candidate for the formation of such hydrophobic... Lysozyme. J. Mol. Biol. 1997, 268, 903-921. (7) Tsuge, H.; Ago, H.; Noma, M.; Nitta, K.; Sugai, S.; Miyano M. Crystallographic Studies of a Calcium Binding Lysozyme From Equine Milk at 2.5 A resolution. J. Biochem. 1992, 111, 141- 143. 16 (8) Blanch, E...

Foder, Vito; Vetri, Valeria; Wind, Thea S.; Noppe, Wim; Cornett, Claus; Donald, Athene M.; Morozova-Roche, Ludmilla A.; Vestergaard, Bente

2014-09-03T23:59:59.000Z

235

Reference: Biol. Bull. 192: 243-252. (April, 1997) Morphology and Development of Odostomia  

E-Print Network [OSTI]

, Washington 98195; and 2Houston Museum of Natural Science, I Herman Circle Drive, Houston, Texas 77030 to that de-. scribed for other pyramidellids: cleavage is unequal, gas- trulation is partially, the duration of a planktonic larval stage may be a key factor influencing pyramidellid distribution

Collin, Rachel

236

J. Math. Biol. DOI 10.1007/s00285-010-0349-5 Mathematical Biology  

E-Print Network [OSTI]

; Abrams et al. 1998; Bjornstad and Grenfell 2001; Kuang and Chesson 2008, 2009). For example, competition

Benaïm, Michel

237

J. theor. Biol. (1983) 105, 273-286 Lake Geometry: Implications for Production and  

E-Print Network [OSTI]

on the geochemistry of the watershed; and morphometric factors, which are determined by the shape of the lake's basin distinguishes between the size and shape components of lake morphometry. Implications of shape for nutrient is borne out by a significant netative correlation between productivity and depth ratio. The theoretical

Notre Dame, University of

238

Original articleWildl. Biol. 17: 431-440 (2011) DOI: 10.2981/10-062  

E-Print Network [OSTI]

of animals are commonly used to estimate deer abundance. Forward-looking infrared (FLIR) technology to compare fixed-wing FLIR and visual, helicopter-based counts in terms of relative bias, influence of snow contained by a high fence in Michigan. We surveyed plots using both fixed-wing FLIR and helicopters, both

Mladenoff, David

239

57. S. A. Bastin-Shanower, S. J. Brill, J. Biol. Chem. 276, 36446 (2001).  

E-Print Network [OSTI]

Mac- Chess, of the National Synchrotron Light Source X9A and X4A beamlines, and of the Argonne. This work was supported by the NIH, the Howard Hughes Medical Institute, the Dewitt Wallace Foundation

Morel, François M. M.

240

Syst. Biol. 47(4):702710,1998 Taxon Sampling and the Accuracy of Large Phylogenies  

E-Print Network [OSTI]

by computer simulation, based on the estimated phylogeny and a model of nucleotide substitution, after which Biology, University of California, Berkeley, California 94720-3140, USA With the advent of automated methods for rapid sequencing of DNA, and the avail- ability of powerful microcomputers, many more attempts

Yang, Ziheng

Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


241

Short communicationWildl. Biol. 18: 215-224 (2012) DOI: 10.2981/10-105  

E-Print Network [OSTI]

.80-0.99 when surveys were conducted on an 838 km2 grid with 10 km of search effort per cell. Snow-track surveys: John R. Squires Received 1 October 2010, accepted 2 October 2011 Associate Editor: Aure´lien Besnard

242

/. mar. biol. Ass. U.K. (1994), 74, 367-382 367 Printed in Great Britain  

E-Print Network [OSTI]

North Sea by selected Scottish fishing boats during 1985-1992, large numbers of the normally rare short, such as incursions of high salinity sea-water, has been suggested to be a factor in these occurrences (Rae & Lamont briefly discussed. MATERIALS AND METHODS By-catches of squid taken in the northern North Sea were obtained

Pierce, Graham

243

doi: 10.1098/rsbl.2011.0603 published online 31 August 2011Biol. Lett.  

E-Print Network [OSTI]

, Quito, Ecuador 9 United States Agency for International Development, San Salvador, El Salvador 10 de El Salvador, San Salvador, El Salvador 11 Flora and Fauna International, Managua, Nicaragua 12

Lewison, Rebecca

244

Int. J. Biol. Sci. 2010, 6 http://www.biolsci.org  

E-Print Network [OSTI]

.02.03; Published: 2010.02.06 Abstract In order to efficiently utilize natural cellulose materials to produce syringae pv. glycinea were constructed. The target gene was respectively controlled by different promoters, ethylene is an important plant hormone, which plays a significant role in the regulation of many

Qin, Wensheng

245

Mar Biol (2010) 157:6980 DOI 10.1007/s00227-009-1296-9  

E-Print Network [OSTI]

Barroso · Michelle Klautau · Antonio M. Solé-Cava · Paulo C. Paiva Received: 19 January 2009 / Accepted users. R. Barroso · P. C. Paiva (&) Instituto de Biologia, Departamento de Zoologia, Laboratório de

Solé-Cava, Antonio M.

246

Syllabus Human Anatomy and Human Anatomy Laboratory -Biol 350 Fall 2014 page 1 of 10  

E-Print Network [OSTI]

. The one adopted for the class is a good one for the cost, and it is available from the University in quality and flexibility. A good one all around is "Essential Anatomy" by 3D4medical.com. Try biodigital.com for a free but lesser muscle module. Internet access to "myaandp.com" and PAL3.0 are included with new copies

Houde, Peter

247

Conf Proc IEEE Eng Med Biol Soc. Author manuscript Multimodal MRI segmentation of ischemic stroke lesions  

E-Print Network [OSTI]

of ischemic stroke lesions Kabir Yacine 1 , Dojat Michel 1 * , Scherrer Beno tî 1 , Forbes Florence 2 , Garbay in this paper is the automatic segmentation of stroke lesions on MR multi-sequences. Lesions enhance differently constructed an Atlas of blood supply territories to help clinicians in the determination of stroke subtypes

Paris-Sud XI, Université de

248

Biol. Lett. (2007) 3, 509512 doi:10.1098/rsbl.2007.0307  

E-Print Network [OSTI]

for the documentation of biodiversity (Hebert et al. 2003; Moritz & Cicero 2004; Meyer & Paulay 2005). A persistent. We also reanalysed data from recent studies of butterflies (Hebert et al. 2004) and marine snails biodiversity. We produced 95% parsi- mony networks from these mtDNA sequence alignments in TCS v. 1.21. We

249

Mar Biol (2009) 156:16911702 DOI 10.1007/s00227-009-1204-3  

E-Print Network [OSTI]

along a northeast-to-southwest salinity gradient. Salinity treatments were based on histori- cal salinity records for these basins. Photophysiology of the endosymbiont Symbiodinium spp. (maximum quantum were assigned four salinity treatments [The Practical Salinity Scale (PSS) was used to determine

Durako, Michael J.

250

Reference: Biol. Brr//. 191: 92-100. (August, 1996) The Economy of Winter: Phenotypic Plasticity in  

E-Print Network [OSTI]

in response to the changing demands of the environment. Introduction To everything there is a season in response to changing environments, not static ones. When interac- tions between the environment of Massachusetts, Amherst, from 6 to 8 October 1995. in a variety of phenotypes, this is called `phenotypic plas

Jacobs, Lucia

251

Syst. Biol. 53(5):781792, 2004 Copyright c Society of Systematic Biologists  

E-Print Network [OSTI]

- gration of methods designed to detect signal at vari- ous positions of the continuum of genetic variation / 1076-836X online DOI: 10.1080/10635150490522296 Testing Nested Phylogenetic and Phylogeographic dispersal or vicariance. Here, we test these hypotheses in the disjunct salamander complex Plethodon

Sullivan, Jack

252

J. Math. Biol. (1999) 39: 493}517 Lyapunov functions for Lotka+Volterra  

E-Print Network [OSTI]

mobile. We show that in the studied examples, optimal foraging behavior changes the neutral stability on the construction and use of appropriate Lyapunov functions for models described by discontinuous di are perfect opti- mizers maximizing a quantity (e.g., the rate of energy intake) which is directly related

Krivan, Vlastimil

253

J. theor. Biol. (1972) 36,427-446 JCinetic Models of Oxygen Evolution in Photosydhesis~  

E-Print Network [OSTI]

reaction center, but in it, each oxygen evolving site has two bound reaction centers II. This alternate that involve the accumulation of two or four positive charges before oxygen is evolved. In order to explain models have been proposed here that equally well explain the data. In the 6rst one, oxygen can be evolved

Govindjee

254

Reference: Biol. Bull. 196: 1-17. (February, 1999) Dynamics of Gastrovascular Circulation in the  

E-Print Network [OSTI]

(Bevan et al., 1995). Murray (1926) pro- posed that tree-like vascular designs minimize the total energy 87131-1091; `Departments qf Ecology and Evolutionary Biology, 4Electrical Engineering, `Geology

Wagner, Andreas

255

J. Mar. Biol. Ass. U.K. (2007), 87, 327338 Printed in the United Kingdom  

E-Print Network [OSTI]

that include by-catch in fishing operations (Berggren, 1994; Kinze et al., 1997; Vinther, 1999; Kaschner, 2003), pollution (Aguilar & Borrell, 1995), over-fishing of prey species (Evans, 1990; Jackson et al., 2001), and disturbance from sound sources such as shipping, seismic surveys, sonar and acoustic deterrents (Evans, 1996

Pierce, Graham

256

Biol. Chem. Hoppe-Seyler Vol. 374, pp. 377-383, June 1993  

E-Print Network [OSTI]

are obtained from the Gram-nega- tive Thermus thermophilus. This organism was iso- lated in 1974 were prepared as described in ref.(2 -3] . The total 30S subunit protein (TP-30) from T. thermophilus% aceticacid containing lOmM 2-mercaptoethanol, then lyophilized. TP-30 proteins from T. aquaticus EP002276

Yonath, Ada E.

257

Revisin: The butterflies of genus Forsterinaria Rev. peru. biol. 12(1): 5-48 (2005)  

E-Print Network [OSTI]

., and F. rustica glendita ssp. n. Euptychia stelligera Butler, and E. fabiana Butler are sunk as synonyms are sunk as synonyms (syn. n.) of F. inornata (C. Felder & R. Felder), and F. necys (Godart), respectively

Wahlberg, Niklas

258

INTEGR. COMP. BIOL., 45:231233 (2005) The Academic Genealogy of George A. Bartholomew1  

E-Print Network [OSTI]

, Irvine, CA 92697 FIG. 1. The Ph.D. students of George A. Bartholomew and their Ph.D. descendants in 1987 supervised the training of 39 Ph.D. stu- dents, 5 postdoctoral researchers, and one Master's stu- 1 From and their subsequent doctoral students in a pictorial descendant tree (Fig. 1). This tree included about 200

Bennett, Albert F.

259

Int. J. Biol. Sci. 2009, 5 http://www.biolsci.org  

E-Print Network [OSTI]

. Based on World Energy Council (WEC) calculations, the world-wide primary energy consumption is ap worldwide and leading to global climate changes [1,3,4]. Rising energy consumption, depletion of fossil.09.04 Abstract The development of alternative energy technology is critically important because of the ris- ing

Qin, Wensheng

260

EXTRAFLORAL NECTAR FEEDING BY STRYMON JACQUELINE Rev. peru. biol. 13(1): 125 -128 (octubre 2006)  

E-Print Network [OSTI]

°09'35" W). This second site consisted of a long, narrow valley adjacent to the road where the vegetation Regions and the Río Marañón Valley(northwesternPeru,Cajamarca)atelevationsbetween460- 1300 m. The type-Jequetepeque river valley, from Pacasmayo to Cajamarca, kilometre 95, 550 m (07°13'46"S, 79°03'15"W). The site

Eastwood, Rod

Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


261

, 20130530, published 2 October 201392013Biol. Lett. Toms Albrecht and Jan T. Lifjeld  

E-Print Network [OSTI]

-off between sperm length and integrity Patterns of sperm damage in Chernobyl passerine birds Supplementary JT. 2013 Patterns of sperm damage in Chernobyl passerine birds suggest a trade-off between sperm://rsbl.royalsocietypublishing.org. Evolutionary biology Patterns of sperm damage in Chernobyl passerine birds suggest a trade-off between sperm

Mousseau, Timothy A.

262

doi: 10.1098/rsbl.2008.0778 published online 18 March 2009Biol. Lett.  

E-Print Network [OSTI]

and Timothy A Mousseau at Chernobyl 20 years after the accident Reduced abundance of insects and spiders abundance of insects and spiders linked to radiation at Chernobyl 20 years after the accident Anders Pape at forest sites around Chernobyl differing in background radiation by over four orders of magnitude

Mousseau, Timothy A.

263

University of Northern British Columbia POPULATION AND COMMUNITY ECOLOGY (BIOL 410) FALL 2012  

E-Print Network [OSTI]

the interrelated disciplines of population and community ecology. Successful completion of this course will provide communities. Thus, we will examine increasingly more complex ecological processes and successful completion the major processes that influence the distribution or abundance of a `sample' population; and · 5 problem

Johnson, Chris

264

University of Northern British Columbia POPULATION AND COMMUNITY ECOLOGY (BIOL 410) FALL 2011  

E-Print Network [OSTI]

the interrelated disciplines of population and community ecology. Successful completion of this course will provide communities. Thus, we will examine increasingly more complex ecological processes; successful completion%; this model represents a species of your choice and should capture the major processes that influence

Johnson, Chris

265

Bull Math Biol DOI 10.1007/s11538-014-9957-3  

E-Print Network [OSTI]

hydraulics and allows us to gain a mechanistic understanding as to how flow patterns affect population widely recognized that variations in the water flow are critically important for the ecosystem integrity­biological model. The water depth and current are derived from a hydrodynamic equation for variable stream bed

Lewis, Mark

266

J. Mar. Biol. Ass. U.K. (2007), 87, 14 Printed in the United Kingdom  

E-Print Network [OSTI]

of `Marine mammals and man in coastal ecosystems: can they co-exist?' Many of the papers contained range of pressures--habitat modification, pollution, disturbance, and conflicts with fisheries through--either stranded specimens or a by- product of the whaling industry, a range of techniques has now been developed

Pierce, Graham

267

Mar Biol (2012) 159:481488 DOI 10.1007/s00227-011-1825-1  

E-Print Network [OSTI]

advected by strong Xows (wind/ocean currents) is equivocal. We added geomagnetic directional swimming positional and navigational cues since magnetic inclination angle and Weld intensity are particularly in magnetic inclination angle and Weld intensity have been shown for hatchling sea turtles (Lohmann et al

Hays, Graeme

268

ol.Biol.Evol. Adaptations to Climate-Mediated Selective Pressures in  

E-Print Network [OSTI]

and Environmental Engineering Kijas, James ; CSIRO, Joost, Stephane; School of Architecture, Civil and Environmental Systems (LASIG), School of Architecture, Civil and11 Environmental Engineering (ENAC), Ecole Polytechnique Zootecnica Stucki, Sylvie; Laboratory of Geographic Information Systems, School of Architecture, Civil

Thévenaz, Jacques

269

Mar Biol (2014) 161:275283 DOI 10.1007/s00227-013-2333-2  

E-Print Network [OSTI]

, Midoricho, Tachikawa, Tokyo 190-0014, Japan Y. Watanuki Graduate School of Fisheries Sciences, Hokkaido

270

Use of bromodeoxyuridine immunocapture to identify psychrotolerant phenanthrene-degrading bacteria in phenanthrene-enriched polluted Baltic Sea sediments  

E-Print Network [OSTI]

from ancient permafrost sediments. Extremophiles 4: 165173.and log CFU ( ) in sediment extract medium spiked with 10 mghighly polluted Baltic Sea sediments. Appl Environ Microbiol

Edlund, A.

2009-01-01T23:59:59.000Z

271

Active bacterial community structure along vertical redox gradients in Baltic Sea sediment  

E-Print Network [OSTI]

Pacific Northwest Marine sediments by Terminal Restrictionin three continental margin sediments. Mar Geol 113: 27-in polluted Baltic Sea sediments. Environ Microbiol 8: 223-

Edlund, Anna

2008-01-01T23:59:59.000Z

272

Flushing associated with scombroid fish poisoning  

E-Print Network [OSTI]

Taylor SL. Histamine food poisoning: toxicology and clinicalan unusual cause of food poisoning! Emerg Med (Fremantle).J. Histamine fish poisoning revisited. Int J Food Microbiol.

Ferran, Marta; Ybenes, Mireia

2006-01-01T23:59:59.000Z

273

Linearly concatenated cyclobutane lipids form a dense bacterial membrane  

Science Journals Connector (OSTI)

... K. et al. Enrichment and characterization of an anammox bacterium from a rotating biological contactor treating ammonium-rich leachate. Arch. Microbiol. 175, 198207 (2001)

Jaap S. Sinninghe Damst; Marc Strous; W. Irene C. Rijpstra; Ellen C. Hopmans; Jan A. J. Geenevasen; Adri C. T. van Duin; Laura A. van Niftrik; Mike S. M. Jetten

2002-10-17T23:59:59.000Z

274

E-Print Network 3.0 - anopheles culicifacies complex Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

J Gen Microbiol 129:2605-2619. Bisht GS, Joshi C, ... Source: Williams, Charles F. "Rick" - Department of Biological Sciences, Idaho State University Collection:...

275

Highly Active Yeast MnSOD has a Novel Mechanism Involving Six-coordinate Mn(3+) Species  

E-Print Network [OSTI]

J Biol Chem 279, 12769-12776 Zhao, Y. , Xue, Y. , Oberley,J Biol Chem 279, 12769-12776 Yikilmaz, E. , Porta, J. ,J Biol Chem 279, 12769-12776 Chapter 3 Comparison of Two

Sheng, Yuewei

2012-01-01T23:59:59.000Z

276

Composition and Function of Sulfate-Reducing Prokaryotes in Eutrophic and Pristine Areas of the Florida Everglades  

Science Journals Connector (OSTI)

...sulfate-reducing bacteria in groundwater at a uranium mill tailings site. Appl. Environ. Microbiol...Williams Wilkins, Baltimore, Md. 46 Wind, T., and R. Conrad. 1995. Sulfur...Microbiol. Ecol. 18: 257-266. 47 Wind, T., S. Stubner, and R. Conrad...

Hector Castro; K. R. Reddy; Andrew Ogram

2002-12-01T23:59:59.000Z

277

Microbial Biogeography of Six Salt Lakes in Inner Mongolia, China, and a Salt Lake in Argentina  

Science Journals Connector (OSTI)

...salinity gradient of a coastal solar saltern. Environ. Microbiol...fingerprinting methods in a multipond solar saltern. Environ. Microbiol...Junfeng, L. 1997. Renewable energy development in China: resource...mitigation potential. Appl. Energy 56: 381-394. 38 Kulp, T...

Eulyn Pagaling; Huanzhi Wang; Madeleine Venables; Andrew Wallace; William D. Grant; Don A. Cowan; Brian E. Jones; Yanhe Ma; Antonio Ventosa; Shaun Heaphy

2009-07-31T23:59:59.000Z

278

From Metagenomics to Pure Culture: Isolation and Characterization of the Moderately Halophilic Bacterium Spiribacter salinus gen. nov., sp. nov.  

Science Journals Connector (OSTI)

...throughout the salinity gradient of a coastal solar saltern. Environ. Microbiol. 4 :349-360...fingerprinting methods in a multipond solar saltern. Environ. Microbiol. 4 :338-348...sulfur-reducing bacterium isolated from a sulfide chimney in Suiyo Seamount. Int. J. Syst. Evol...

Mara Jos Len; Ana B. Fernndez; Rohit Ghai; Cristina Snchez-Porro; Francisco Rodriguez-Valera; Antonio Ventosa

2014-04-18T23:59:59.000Z

279

Global patterns in bacterial diversity  

Science Journals Connector (OSTI)

...Helmke E (2003) Appl Environ Microbiol 69:6610-6619. 62. Burns BP, Goh F, Allen M, Neilan BA (2004) Environ Microbiol...117-130. 96. Elshahed MS, Senko JM, Najar FZ, Kenton SM, Roe BA, Dewers TA, Spear JR, Krumholz LR (2003) Appl Environ...

Catherine A. Lozupone; Rob Knight

2007-01-01T23:59:59.000Z

280

Chlorination of lignin by ubiquitous fungi has a likely role in global organochlorine production  

Science Journals Connector (OSTI)

...2091 2104 . 40 Pellinen J Joyce TW Chang H-M ( 1988 ) Tappi J 71 : 191 194 . 41 Fetzner S Lingens F ( 1994 ) Microbiol Rev...685 . 42 Huynh VB Chang H-M Joyce TW Kirk TK ( 1985 ) Tappi J 68 : 98 102 . 43 Mohn WW Tiedje JM ( 1992 ) Microbiol...

Patricia Ortiz-Bermdez; Kolby C. Hirth; Ewald Srebotnik; Kenneth E. Hammel

2007-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


281

147Rev. Biol.Trop. (Int. J.Trop. Biol. ISSN-0034-7744)Vol. 53 (Suppl. 3): 147-170, December 2005 Echinoids of the Pacific Waters of Panama  

E-Print Network [OSTI]

Echinoids of the Pacific Waters of Panama: Status of knowledge and new records H.A. Lessios Smithsonian Tropical Research Institute, Apartado 0843-03092, Balboa, Panama; Fax: 507-212-8790; Lessiosh are available in the Bay of Panama and in the Gulf of Chiriqui, how to recognize them, and what has been

Bermingham, Eldredge

282

Biochimie {1998) 80, 37 !-377 O Soci6t6 fi'an~;aisede biochimie et bi~lo,,ie molOcukfiret Elsevier, Paris  

E-Print Network [OSTI]

11~1. The relation of cells with their environment implies also various types of membrane fusion is an fluportant aspect of cell biology which implies shuttle vesicles and multiple binding/fusion event,;. In spite ot' rapid progress at the biochemical level, the mechanism of fusion is still not understood

283

mol10x6.0mV10x1.0mC10x2.6 1-231-930 EU rotationdipole  

E-Print Network [OSTI]

. Results I - Pore Formation and Ion Transport A potential over the membrane is generated by placing different numbers of Na (black spheres) and Cl (pink spheres) ions on each side of the membrane (lipid tails the hydrophilic pore. When the potential from the ion imbalance dissipates, the pore subsides and the membrane

Southern California, University of

284

Eur J Nucl Med Mol Imaging . Author manuscript Baseline F-FDG PET image-derived parameters for therapy response18  

E-Print Network [OSTI]

and response was investigated using Kruskal-Wallis tests= ? and receiver operating characteristic methodology

Paris-Sud XI, Université de

285

JOURNAL DE PHYSIQUE Colloque C 3, supplment au no 4, Tome 29, Avril 1968, page C 3 -3 A. -PROCESSUS ATOMIQUES ET MOL~CULAIRES.  

E-Print Network [OSTI]

such as the nature and pressure of the gas, the characteristics of the laser (pulse duration and optical system paramètres tels que la nature et la pression du gaz, les caractéristiquesdu laser (durée de l'impulsion et système optique) et les dimensionsde la tache focale lorsquedifférentes théories du type cascade, pour le

Boyer, Edmond

286

./. Mol. Riol. (1988) 200, 65-87 Positions of S2, S13, S16, S17, S19 and S21 in the  

E-Print Network [OSTI]

2 June 1987, and in revised form 28 September 1987) Neutron scat,tering distance data are presented the mapping of its proteins by neutron scattering. Comparisons with other data suggest that, the neutron map can be measured by neutron t Present address: Biology Department. Brookhaven Xational Laboratory

287

J. Phys. B AL Mol. Opt Phys. 26 (1993) 1569-1578. Printed in the UK Pure and mixed state calculationsof the laser-induced  

E-Print Network [OSTI]

, altemative methods for separating the elements of uranium are being studied, notably the use of lasers of the isotopes of uranium has major commercial importance in the nuclear fuel industry. As is well known to induce preferential ionization of 23sU(see Greenland 1991 for a review). Laser isotope separation relies

Ford, Ian

288

Biochem. Cell Biol. 83: 696702 (2005) doi: 10.1139/O05-161 2005 NRC Canada MINIREVIEW / MINISYNTHSE  

E-Print Network [OSTI]

» les centromères nouvellement répliqués. Durant l'anaphase, CFB3 est transporté à l'extrémité positive sous-unité Ndc10p de CFB3 présentent des défauts dans la stabilité du fuseau lors de l'anaphase. De explorons le rôle du transport de CFB3 à l'extrémité positive des microtubules au milieu du fuseau. Mots

289

J Biol Phys (2009) 35:57 DOI 10.1007/s10867-009-9132-5  

E-Print Network [OSTI]

into an amorphous film on the cold window. Prof Gratton was looking at the emerging infrared spectrum as the film Gratton had instructed me to machine a brass piece to replace a window in the cryostat. I finished a calcium fluoride window, taking care not to obstruct the infrared beam from the interferometer. I loaded

290

IOP PUBLISHING PHYSICAL BIOLOGY Phys. Biol. 9 (2012) 056003 (9pp) doi:10.1088/1478-3975/9/5/056003  

E-Print Network [OSTI]

.1088/1478-3975/9/5/056003 Stuttering Min oscillations within E. coli bacteria: a stochastic polymerization model Supratim Sengupta1 oscillation stuttering. Stuttering was affected by the rate of immediate rebinding of MinE released from and fragmentation of MinD filaments due to MinE. Processivity, protection and fragmentation each reduce stuttering

Rutenberg, Andrew

291

10. L. M. Futey, Q. G. Medley, G. P. Cote, T. T. Egelhoff, J. Biol. Chem. 270, 523 (1995).  

E-Print Network [OSTI]

M NaCl, 5 mM ATP, 1 mM MgCl2, 10 mM EGTA, 4.1 mM CaCl2, and 10 mM Hepes, with pH adjusted to 7.8 mM KCl, 2 mM CaCl2, 1 mM MgCl2, 10 mM Hepes, and 10 mM glucose, with pH adjusted to 7.4 with Na

McMahon, Harvey

292

179J. exp. Biol. 185, 179193 (1993) Printed in Great Britain The Company of Biologists Limited 1993  

E-Print Network [OSTI]

develop hydromechanical models based on oscillating plates or hydrofoils (Parry, 1949; Lighthill, 1970; Wu by dorsoventral oscillations of the posterior body and flukes. The maximum angle of attack of the flukes showed, 1936; Hui, 1987). However, a dolphin does not swim as a rigid body, but oscillates its tail and flukes

Fish, Frank

293

INTEGR. COMP. BIOL., 42:10441049 (2002) Flexible Wings and Fins: Bending by Inertial or Fluid-Dynamic Forces?1  

E-Print Network [OSTI]

arise, in part, from the passive mechanics of oscillating a flexible air- or hydrofoil. At the same time elasticity can affect thrust for a given level of energy input in the form of an inertial oscillation

Daniel, Tom

294

J. Membrane Biol. 4,179-192 (1971) 9 by Springer-Verlag New York Inc. 1971  

E-Print Network [OSTI]

antibiotics increase the ion permeability of biological membranes have been carried out on artificial model the possibility that they may serve as model systems for active transport across biological membranes. Moore and Pressman (1964) discovered the influence of valinomycin on the ion transport across the mitochondrial

Junge, Wolfgang

295

J. Math. Biol. (2008) 56:129144 DOI 10.1007/s00285-007-0107-5 Mathematical Biology  

E-Print Network [OSTI]

they form the units of the standard additive energy model. Energy parameters that depend on sequence, length programming algorithms solve many standard problems of RNA bioinformatics in polynomial time. In this contribution we discuss a series of varia- tions on these standard methods that implement refined biophysical

Will, Sebastian

296

1926 Biochemistry 1984, 23, 1926-1934 Morris, C. R., & Gale, G. R. (1973) Chem.-Biol.Interact.  

E-Print Network [OSTI]

-1 71, Prentice-Hall, New York. Towbin, H., Staehelin, T., & Gordon, J. (1979) Proc. Natl. Acad. Sci. U? Elizabeth F. McCord, Kathleen M. Morden, Arthur Pardi, Ignacio Tinoco, Jr., and Steven G. Boxer* ABSTRACT- istry and Laboratoryof Chemical Biodynamics,Universityof California, Berkeley, California 94720 (K.M.M

Boxer, Steven G.

297

doi: 10.1098/rsbl.2009.1081 , 458-461 first published online 17 February 201062010Biol. Lett.  

E-Print Network [OSTI]

(Spermophilus beecheyi) in areas with loud wind turbines exhibited higher rates of vigilance after hearing hypothesis Anthropogenic noise affects risk assessment and attention: References http.royalsocietypublishing.orgDownloaded from #12;Animal behaviour Anthropogenic noise affects risk assessment and attention: the distracted

Grether, Gregory

298

BIOL 5131 Sample Test 3 1. Which of the following are pathways of vesicle trafficking through the cytoplasm that  

E-Print Network [OSTI]

to study eukaryotic gene mutations affecting secretion and other cytomembrane processes? a. They have. Fluorescently labeled proteins can be seen to diffuse between the types of ER. b. Fluorescently labeled lipids

Cutler, Chris

299

604 Integr. Biol., 2010, 2, 604629 This journal is c The Royal Society of Chemistry 2010 Microfluidics for bacterial chemotaxisw  

E-Print Network [OSTI]

Microfluidics for bacterial chemotaxisw Tanvir Ahmed,a Thomas S. Shimizub and Roman Stocker*a Received 1st June 2010, Accepted 11th August 2010 DOI: 10.1039/c0ib00049c Microfluidics is revolutionizing the way we to gradients. Using microfluidics to study chemotaxis of free-swimming bacteria presents experimental

Entekhabi, Dara

300

DOI 10.1515/hsz-2013-0258Biol. Chem. 2013; x(x): xxxxxx Mini review  

E-Print Network [OSTI]

soluble by a GDP dissocia- tion inhibitor (GDI), which interacts with the C-terminal prenyl anchor, the GDI has to be released. This process may require a GDI displacement factor (GDF), although its general be sufficient to displace both GDI and promote nucleotide exchange (Itzen and Goody, 2011). In the GTP

Ungermann, Christian

Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


301

INTEG. AND COMP. BIOL., 42:352359 (2002) Host Specificity in Ectomycorrhizal Communities: What Do the Exceptions Tell Us?1  

E-Print Network [OSTI]

Do the Exceptions Tell Us?1 THOMAS D. BRUNS,2 MARTIN I. BIDARTONDO, AND D. LEE TAYLOR Department we examine two exceptional cases of specificity to see what they tell us about the advantages of specificity, how it is initiated, and the potential role that it plays in complex ecosystems. The first case

California at Berkeley, University of

302

Biol. Rev. (2012), 87, pp. 563582. 563 doi: 10.1111/j.1469-185X.2011.00209.x  

E-Print Network [OSTI]

interactions in terrestrial dryland ecosystems under altered water availability and climate change Kevin E. Mc-third of the Earth's land mass, are greatly affected by changes in water availability, and are predicted of Life Sciences, Arizona State University, Tempe, AZ 85287, USA 2 US Geological Survey, Southwest

303

J Biol Phys (2009) 35:91101 DOI 10.1007/s10867-009-9130-7  

E-Print Network [OSTI]

) Department of Physics, Princeton University, Princeton, NJ, USA e-mail: austin@princeton.edu A. Xie, Princeton University, Princeton, NJ, USA W. W. Warren Department of Chemistry, Duke University, Durham, NC, USA B. Redlich · L. van der Meer FOM Institute for Plasma Physics, Nieuwegein, The Netherlands #12

304

97J. exp. Biol. 194, 97115 (1994) Printed in Great Britain The Company of Biologists Limited 1994  

E-Print Network [OSTI]

1994 EXTREME DRAG FORCES AND THE SURVIVAL OF WIND- AND WATER-SWEPT ORGANISMS MARK W. DENNY Department. This is particularly true when extreme drag forces are relevant; for instance, when predicting the survival of benthic and cylinders. The distribution of extremes in drag is used to predict the likelihood that an organism

Denny, Mark

305

Biol. Rev. (2012), 87, pp. 661685. 661 doi: 10.1111/j.1469-185X.2011.00216.x  

E-Print Network [OSTI]

, Cairns, Queensland 4870, Australia 19 Fenner School of Environment and Society, The Australian National

306

Inter-college program between Colleges of Life Sciences & Agriculture and Engineering & Physical Sciences  

E-Print Network [OSTI]

OR _____________ NR 527 Forest Ecology (fall) OR BIOL 541 General Ecology (fall/spring, WI 17. NR 501 Studio Soils. Geology course (ESCI 401, 402 or 409) _____________ 8. Statistics course (MATH 644 or BIOL 528 _____________ BIOL 411 Principles of Biology I BIOL 412 Principles of Biology II PBIO 412 Introductory Botany ZOOL

Pringle, James "Jamie"

307

Purification and properties of Escherichia coli dimethyl sulfoxide reductase, an iron-sulfur molybdoenzyme with broad substrate specificity.  

Science Journals Connector (OSTI)

...Microbiol. 1987, K122, p. 150) and tetrahydrothiophene oxide (25) have recently been...physiological roles. The sulfoxide tetrahydrothiophene oxide (tetramethylene sulfoxide...and J. Schrementi. 1987. Tetrahydrothiophene 1-oxide as an electron acceptor...

J H Weiner; D P MacIsaac; R E Bishop; P T Bilous

1988-04-01T23:59:59.000Z

308

The antigenic evolution of influenza: drift or thrift?  

Science Journals Connector (OSTI)

...we use a theoretical model to suggest the existence...the antigenic thrift model would predict that this method would...against the 1976 swine flu have enhanced neutralization...S. 2009 Influenza outbreaks. J. Cell. Microbiol...

2013-01-01T23:59:59.000Z

309

Atmospheric Movement of Microorganisms in Clouds of Desert Dust and Implications for Human Health  

Science Journals Connector (OSTI)

...A. Centeno. 2005. Health effects of natural dust-role of trace elements and compounds...enumeration of heterotrophic bacteria in natural mineral water. World J. Microbiol...coccidioidomycosis following a severe natural dust storm. An outbreak at the Naval...

Dale W. Griffin

2007-07-01T23:59:59.000Z

310

Extensive sampling of basidiomycete genomes demonstrates inadequacy of the white-rot/brown-rot paradigm for wood decay fungi  

Science Journals Connector (OSTI)

...GL ( 1996 ) Basidiomycosis: A review of the literature . Rev Inst Med Trop Sao Paulo 38 ( 5 ): 379 390 . 10...functional and phylogenetic review . J Basic Microbiol 50 ( 1...supported by the DOE Great Lakes Bioenergy Research Center (DOE Office of...

Robert Riley; Asaf A. Salamov; Daren W. Brown; Laszlo G. Nagy; Dimitrios Floudas; Benjamin W. Held; Anthony Levasseur; Vincent Lombard; Emmanuelle Morin; Robert Otillar; Erika A. Lindquist; Hui Sun; Kurt M. LaButti; Jeremy Schmutz; Dina Jabbour; Hong Luo; Scott E. Baker; Antonio G. Pisabarro; Jonathan D. Walton; Robert A. Blanchette; Bernard Henrissat; Francis Martin; Dan Cullen; David S. Hibbett; Igor V. Grigoriev

2014-01-01T23:59:59.000Z

311

Distinct domains of antizyme required for binding and proteolysis of ornithine decarboxylase.  

Science Journals Connector (OSTI)

...now to determine the partners with which it interacts and the ambit and conse- quences of those interactions. ACKNOWLEDGMENTS...and M. R. Maurizi. 1992. Regulation by prote- olysis: energy-dependent proteases and their targets. Microbiol. Rev...

X Li; P Coffino

1994-01-01T23:59:59.000Z

312

In vivo lipidomics using single-cell Raman spectroscopy  

Science Journals Connector (OSTI)

...costs and benefits of biodiesel and ethanol biofuels...2 Chisti Y ( 2007 ) Biodiesel from microalgae . Biotechnol...bioproductivity from algae . Appl Microbiol Biotechnol...Aquatic Species Program: Biodiesel from Algae ( National Renewable...

Huawen Wu; Joanne V. Volponi; Ann E. Oliver; Atul N. Parikh; Blake A. Simmons; Seema Singh

2011-01-01T23:59:59.000Z

313

Identification of Medically Important Molds by an Oligonucleotide Array  

Science Journals Connector (OSTI)

...phialides slender (arising from submerged or slightly fasiculate aerial hyphae), conidia grouped in slimy heads (cylindrical or...analysis. J. Syst. Evol. Microbiol. 50: 1351-1371. 17 Fukushima, M., K. Kakinuma, H. Hayashi, H. Nagai, K. Ito...

Chen Ren Hsiao; Liyin Huang; Jean-Philippe Bouchara; Richard Barton; Hsin Chieh Li; Tsung Chain Chang

2005-08-01T23:59:59.000Z

314

Use of Chemical Oxygen Demand Values of Bacterial Cells in Waste-Water Purification  

Science Journals Connector (OSTI)

...Bacterial Cells in Waste-Water Purification A. F. Gaudy Jr. M. N...Bacterial Cells in Waste-Water Purification A. F. GAUDY, JR., M...bacterial cells in waste-water purification. Appl. Microbiol. 12:254-260...

A. F. Gaudy Jr.; M. N. Bhatla; E. T. Gaudy

1964-05-01T23:59:59.000Z

315

The role of technology in achieving water security  

Science Journals Connector (OSTI)

...footprint associated with current water purification and distribution systems...Science and technology for water purification in the coming decades. Nature...nanofibers and nanobiocides in water purification. Crit. Rev. Microbiol...

2013-01-01T23:59:59.000Z

316

Inter- and Intralaboratory Comparison of JC Polyomavirus Antibody Testing Using Two Different Virus-Like Particle-Based Assays  

Science Journals Connector (OSTI)

...PML), a debilitating, often fatal brain disease in immunocompromised patients...PML), a demyelinating disease of the brain, with typically fatal outcome (5, 6...virus-induced demyelinating disease of the human brain. Clin. Microbiol. Rev. 25 :471-506...

Piotr Kardas; Mohammadreza Sadeghi; Fabian H. Weissbach; Tingting Chen; Lea Hedman; Eeva Auvinen; Klaus Hedman; Hans H. Hirsch

2014-09-24T23:59:59.000Z

317

Microorganisms with Novel Dissimilatory (Bi)Sulfite Reductase Genes Are Widespread and Part of the Core Microbiota in Low-Sulfate Peatlands  

Science Journals Connector (OSTI)

...accession numbers) qPCR performance Mean efficiency () SD Linearity R 2 Dynamic range (no...cyanobacterial mats of Solar Lake (Sinai, Egypt). Appl. Environ. Microbiol. 64...sulfite, or some organosulfonates for energy conservation but can also be present in...

Doris Steger; Cecilia Wentrup; Christina Braunegger; Pinsurang Deevong; Manuel Hofer; Andreas Richter; Christian Baranyi; Michael Pester; Michael Wagner; Alexander Loy

2010-12-17T23:59:59.000Z

318

Clostridium difficile Extracytoplasmic Function ? Factor ?V Regulates Lysozyme Resistance and Is Necessary for Pathogenesis in the Hamster Model of Infection  

Science Journals Connector (OSTI)

...extracytoplasmic function (ECF) sigma factors. Adv. Microb. Physiol. 46 :47-110. doi: 10.1016/S0065-2911(02)46002-X . 30. Ho TD , and CD Ellermeier. 2012. Extracytoplasmic function sigma factor activation. Curr. Opin. Microbiol...

Theresa D. Ho; Kyle B. Williams; Yan Chen; Richard F. Helm; David L. Popham; Craig D. Ellermeier

2014-03-24T23:59:59.000Z

319

Identification and Characterization of Potential Performance-Related Gut Microbiotas in Broiler Chickens across Various Feeding Trials  

Science Journals Connector (OSTI)

...non-treatment-related microbiota), this high-resolution analysis is not always warranted...intestinal bacterial communities of the maturing boiler chicken. Appl. Environ. Microbiol...performance-related phylotypes showed high sequence identity with classified bacteria...

Valeria A. Torok; Robert J. Hughes; Lene L. Mikkelsen; Rider Perez-Maldonado; Katherine Balding; Ron MacAlpine; Nigel J. Percy; Kathy Ophel-Keller

2011-07-08T23:59:59.000Z

320

Bacteriological quality of crops irrigated with wastewater in the Xochimilco plots, Mexico City, Mexico.  

Science Journals Connector (OSTI)

...MICROBIOL. BACTERIOLOGICAL QUALITY OF WASTEWATER-IRRIGATED CROPS...L. 1976. Bacteriological quality assessment offresh marketed...wastewater. U.S. Army Corps of Engineers, CRREL, Hanover, N.H...Administration. 1968. Water Quality Criteria Report of the National...

I Rosas; A Bez; M Coutio

1984-05-01T23:59:59.000Z

Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


321

Monitoring gp43 Antigenemia in Paracoccidioidomycosis Patients during Therapy  

Science Journals Connector (OSTI)

...Intergroup comparisons were performed by using the Kruskal-Wallis test. RESULTS Table 1 shows the characteristics of...Microbiol. 29: 1610-1615. 29 Restrepo, A. 1966. La prueba de inmunodifusion en el diagnostico de la paracoccidioidomicosis...

Silvia Helena Marques da Silva; Flvio Queiroz-Telles; Arnaldo Lopes Colombo; Maria Heloisa Souza Lima Blotta; Jos Daniel Lopes; Zoilo Pires de Camargo

2004-06-01T23:59:59.000Z

322

Subsampling technique for measuring growth of bacterial cultures under high hydrostatic pressure.  

Science Journals Connector (OSTI)

...APPL. ENVIRON. MICROBIOL. sation oil used with the electric motor, Bray 3M-626- 2 (Bray Oil Co., Los Angeles, Calif.); electric motor, 26 SR 601 B 12 (Portescap U.S., New York, N...

C D Taylor; H W Jannasch

1976-09-01T23:59:59.000Z

323

Synthesis of three advanced biofuels from ionic liquid-pretreated switchgrass using engineered Escherichia coli  

Science Journals Connector (OSTI)

...existing internal combustion engines. Based in part on previous work (9), we constructed a...Microbial cellulose utilization: Fundamentals and biotechnology . Microbiol...precursors suitable for gasoline, diesel, and jet engines directly from ionic liquid-treated...

Gregory Bokinsky; Pamela P. Peralta-Yahya; Anthe George; Bradley M. Holmes; Eric J. Steen; Jeffrey Dietrich; Taek Soon Lee; Danielle Tullman-Ercek; Christopher A. Voigt; Blake A. Simmons; Jay D. Keasling

2011-01-01T23:59:59.000Z

324

Strongyloides stercoralis in the Immunocompromised Population  

Science Journals Connector (OSTI)

...may include farming (69, 98) and coal mining (127, 128) depending on local...endemic decades ago, i.e., rural Appalachia (5), should prompt screening...stercoralis in an immunocompromised retired coal miner. Eur. J. Clin. Microbiol...

Paul B. Keiser; Thomas B. Nutman

2004-01-01T23:59:59.000Z

325

Xylanase and Acetyl Xylan Esterase Activities of XynA, a Key Subunit of the Clostridium cellulovorans Cellulosome for Xylan Degradation  

Science Journals Connector (OSTI)

...ENGINEERING Xylanase and Acetyl Xylan Esterase Activities of XynA...cellulovorans Cellulosome for Xylan Degradation Akihiko Kosugi Koichiro...and R. H. Doi. 1999. Three surface layer homology domains at the...1993. Molecular biology of xylan degradation. FEMS Microbiol...

Akihiko Kosugi; Koichiro Murashima; Roy H. Doi

2002-12-01T23:59:59.000Z

326

Synthetic Biology Moving into the Clinic  

Science Journals Connector (OSTI)

...secrete key molecules for potential disease treatment, including insulinotropic...murine interleukin-2 in response to xylan . J. Appl. Microbiol. 98 , 1191...of synthetic biology therapies for the treatment of infectious diseases and cancer, as...

Warren C. Ruder; Ting Lu; James J. Collins

2011-09-02T23:59:59.000Z

327

Serratia Infections: from Military Experiments to Current Practice  

Science Journals Connector (OSTI)

...pathogen, especially among individuals who wear contact lenses. As shown here, S. marcescens...screening quorum sensing inhibitors from marine microbes. J. Gen. Appl. Microbiol...and H. C. Upham. 1944. A list of marine bacteria, including descriptions of sixty...

Steven D. Mahlen

2011-10-01T23:59:59.000Z

328

Microbial Community Diversity Associated with Carbon and Nitrogen Cycling in Permeable Shelf Sediments  

Science Journals Connector (OSTI)

...with surface-breaching gas hydrate mounds in the Gulf of Mexico...transport in permeable shelf sands. Cont. Shelf Res. 24...batch cultures, using gas-chromatography and N-15...Middle Atlantic Bight shelf sands. FEMS Microbiol. Ecol...

Evan M. Hunter; Heath J. Mills; Joel E. Kostka

2006-09-01T23:59:59.000Z

329

Acetone and Butanol Production by Clostridium acetobutylicum in a Synthetic Medium  

Science Journals Connector (OSTI)

...1974. Acetone-butanol fermen- tation in Egypt. IV. Millet as raw material. Egypt. J. Microbiol. 9:45-56. 15. Miller...1973. Acetone-butanol fermen- tation in Egypt. II. Use ofvarious raw materials. Egypt. J...

Frdric Monot; Jean-Ren Martin; Henri Petitdemange; Robert Gay

1982-12-01T23:59:59.000Z

330

Next Science Wound Gel Technology, a Novel Agent That Inhibits Biofilm Development by Gram-Positive and Gram-Negative Wound Pathogens  

Science Journals Connector (OSTI)

...microbiology and associated approaches to wound management. Clin. Microbiol...persistent infections. Science 284 :1318-1322. doi: 10.1126/science.284.5418.1318...current therapeutic approaches in burns. Shock 5...

Kyle G. Miller; Phat L. Tran; Cecily L. Haley; Cassandra Kruzek; Jane A. Colmer-Hamood; Matt Myntti; Abdul N. Hamood

2014-03-17T23:59:59.000Z

331

A Decade of Burkholderia cenocepacia Virulence Determinant Research  

Science Journals Connector (OSTI)

...novel Burkholderia strain with broad-spectrum antimicrobial activity. Appl. Environ. Microbiol. 66: 4139-4141. 27 Caraher, E., G. Reynolds, P. Murphy, S. McClean, and M. Callaghan. 2007. Comparison of antibiotic susceptibility of Burkholderia...

Slade A. Loutet; Miguel A. Valvano

2010-07-19T23:59:59.000Z

332

Clinical and Microbiological Features of a Cystic Fibrosis Patient Chronically Colonized with Pandoraea sputorum Identified by Combining 16S rRNA Sequencing and Matrix-Assisted Laser Desorption IonizationTime of Flight Mass Spectrometry  

Science Journals Connector (OSTI)

...instruments for identification of isolates of the Burkholderia cepacia complex. J. Clin. Microbiol. 40 :1743-1748. 4. Caraher E , et al . 2008. Evaluation of in vitro virulence characteristics of the genus Pandoraea in lung epithelial cells. J. Med...

A. Fernndez-Olmos; M. I. Morosini; A. Lamas; M. Garca-Castillo; L. Garca-Garca; R. Cantn; L. Miz

2011-12-14T23:59:59.000Z

333

Geraniol and Geranial Dehydrogenases Induced in Anaerobic Monoterpene Degradation by Castellaniella defragrans  

Science Journals Connector (OSTI)

...defragrans sp. nov., description of four strains isolated on alkenoic monoterpenes ((+)-menthene, alpha-pinene, 2-carene, and alpha-phellandrene) and nitrate. Syst. Appl. Microbiol. 21 : 237-244. 18. Gillooly, DJ , AGS Robertson and...

Frauke Lddeke; Annika Wlfing; Markus Timke; Frauke Germer; Johanna Weber; Aytac Dikfidan; Tobias Rahnfeld; Dietmar Linder; Anke Meyerdierks; Jens Harder

2012-01-27T23:59:59.000Z

334

Functional Assembly of Minicellulosomes on the Saccharomyces cerevisiae Cell Surface for Cellulose Hydrolysis and Ethanol Production  

Science Journals Connector (OSTI)

...inexpensive feedstock for sustainable bioethanol production...S. Kang. 1999. -Integration of endo/exo-glucanase...from lignocellulose: a challenge for metabolic engineering and process integration. Appl. Microbiol. Biotechnol...

Shen-Long Tsai; Jeongseok Oh; Shailendra Singh; Ruizhen Chen; Wilfred Chen

2009-08-14T23:59:59.000Z

335

Synergistic Saccharification, and Direct Fermentation to Ethanol, of Amorphous Cellulose by Use of an Engineered Yeast Strain Codisplaying Three Types of Cellulolytic Enzyme  

Science Journals Connector (OSTI)

...fuel sources and most sustainable energy resource and is reproduced...also financed by the New Energy and Industrial Technology...from lignocellulose: a challenge for metabolic engineering and process integration. Appl. Microbiol...

Yasuya Fujita; Junji Ito; Mitsuyoshi Ueda; Hideki Fukuda; Akihiko Kondo

2004-02-01T23:59:59.000Z

336

Simultaneous Fermentation of Glucose and Xylose to Butanol by Clostridium sp. Strain BOH3  

Science Journals Connector (OSTI)

...the major components in sustainable feedstocks which could...inhibitory effect on the energy-requiring xylose transport...from lignocellulose: a challenge for metabolic engineering and process integration. Appl. Microbiol. Biotechnol...

Fengxue Xin; Yi-Rui Wu; Jianzhong He

2014-05-23T23:59:59.000Z

337

Microbial Diversity of a Heavily Polluted Microbial Mat and Its Community Changes following Degradation of Petroleum Compounds  

Science Journals Connector (OSTI)

...microbial consortium growing on diesel fuel. Appl. Environ. Microbiol...H. Al-Hasan. 2000. Oil pollution and cyanobacteria, p. 307-319...and J. Rullkotter. 2001. Fossil fuel pollution in Wadi Gaza and biodegradation...

Raeid M. M. Abed; Nimer M. D. Safi; Jrgen Kster; Dirk de Beer; Yasser El-Nahhal; Jrgen Rullktter; Ferran Garcia-Pichel

2002-04-01T23:59:59.000Z

338

Mycobacteria in Water and Loose Deposits of Drinking Water Distribution Systems in Finland  

Science Journals Connector (OSTI)

...acid-fast organisms in water supply, treatment, and...distribution systems. J. Am. Water Works Assoc. 75: 139-144...mycobacteria from indoor swimming pools in Finland. APMIS 107...mycobacteria in brook waters. Appl. Environ. Microbiol...

Eila Torvinen; Sini Suomalainen; Markku J. Lehtola; Ilkka T. Miettinen; Outi Zacheus; Lars Paulin; Marja-Leena Katila; Pertti J. Martikainen

2004-04-01T23:59:59.000Z

339

New screening test to determine the acceptability of 0.45-micron membrane filters for analysis of water.  

Science Journals Connector (OSTI)

...contamination of environmental water samples introduced by filter...media for membrane filtration recovery of staphylococci in swimming pool water. Appl. Environ. Microbiol...1983. New medium for improved recovery of coliform bacteria from drinking...

K P Brenner; C C Rankin

1990-01-01T23:59:59.000Z

340

Microbial Communities Associated with Geological Horizons in Coastal Subseafloor Sediments from the Sea of Okhotsk  

Science Journals Connector (OSTI)

...sediments are a reservoir of prokaryotic...that these reservoirs maintain their...Lithology b Porosity (%) Remarks...Cretaceous shale-sandstone sequence...deep-sea rock. Geomicrobiol...fresh water reservoir. FEMS Microbiol...

Fumio Inagaki; Masae Suzuki; Ken Takai; Hanako Oida; Tatsuhiko Sakamoto; Kaori Aoki; Kenneth H. Nealson; Koki Horikoshi

2003-12-01T23:59:59.000Z

Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


341

Programmed cell death correlates with virus transmission in a filamentous fungus  

Science Journals Connector (OSTI)

...transmission to a new or alternative host (Poulin 2000). 2. MATERIAL AND METHODS (a...uninfected conspecifics (Moore 1995; Poulin 2000). Some of these behavioural alterations...esis. Microbiol. Rev. 56, 561576. Poulin, R. 2000 Manipulation of host behaviour...

2002-01-01T23:59:59.000Z

342

BIOENERGY/BIOFUELS/BIOCHEMICALS Chromatographic determination of 1, 4-b-xylooligosaccharides  

E-Print Network [OSTI]

BIOENERGY/BIOFUELS/BIOCHEMICALS Chromatographic determination of 1, 4-b. Li � R. Kumar � C. E. Wyman BioEnergy Science Center, Oak Ridge, TN 37831, USA 123 J Ind Microbiol

California at Riverside, University of

343

Melanized Fungi in Human Disease  

Science Journals Connector (OSTI)

...such as E. mesophila are found in dental unit water lines (604) and municipal...certified biological safety cabinet. Radiology There are few radiologic features...Exophiala mesophila isolated from treated dental unit waterlines. J. Clin. Microbiol...

Sanjay G. Revankar; Deanna A. Sutton

2010-10-01T23:59:59.000Z

344

Recent Advances in Petroleum Microbiology  

Science Journals Connector (OSTI)

...Fingas. 1998. Development of a standard bacterial consortium for laboratory...under anaerobic conditions: a review. Anaerobe 1: 293-303...polycyclic aromatic hydrocarbons: a review of the microbial degradation...culprit organic pollutants: a review. J. Microbiol. Methods 49...

Jonathan D. Van Hamme; Ajay Singh; Owen P. Ward

2003-12-01T23:59:59.000Z

345

Resistance of Marine Bacterioneuston to Solar Radiation  

Science Journals Connector (OSTI)

...of Marine Bacterioneuston to Solar Radiation Helene Agogue Fabien...after exposure to simulated solar radiation. Bacterioneuston...estimate of their screening capacity. Appl. Environ. Microbiol...D. P. 2000. Effects of solar UV-B radiation on aquatic...

Hlne Agogu; Fabien Joux; Ingrid Obernosterer; Philippe Lebaron

2005-09-01T23:59:59.000Z

346

Impact of Virioplankton on Archaeal and Bacterial Community Richness as Assessed in Seawater Batch Cultures  

Science Journals Connector (OSTI)

...Sigmon. 1999. Activity of marine bacteria under incubated and...cooccurring phages enables marine Synechococcus communities to...Herndl. 2001. Impact of UV radiation on bacterioplankton community...2003. Bicarbonate uptake by marine Crenarchaeota. FEMS Microbiol...

Christian Winter; Arjan Smit; Gerhard J. Herndl; Markus G. Weinbauer

2004-02-01T23:59:59.000Z

347

E-Print Network 3.0 - avian species belonging Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

avian influenza in different bird species. Vet. Microbiol. 2000, 74, 3-13. 10. Mukhtar, M.M.; Rasool, S... Abstract: Highly Pathogenic Avian Influenza (HPAI) H5N1 virus is an...

348

Impact of Manure Fertilization on the Abundance of Antibiotic-Resistant Bacteria and Frequency of Detection of Antibiotic Resistance Genes in Soil and on Vegetables at Harvest  

Science Journals Connector (OSTI)

...from domestic animals, humans, and wildlife will contain bacteria that are resistant...environmental factors: sun, rain, and wind. In order to evaluate the potential...domesticated mammals and birds, and wildlife. Can. J. Microbiol. 56 :715-729...

Romain Marti; Andrew Scott; Yuan-Ching Tien; Roger Murray; Lyne Sabourin; Yun Zhang; Edward Topp

2013-07-12T23:59:59.000Z

349

Abundances of Hyperthermophilic Autotrophic Fe(III) Oxide Reducers and Heterotrophs in Hydrothermal Sulfide Chimneys of the Northeastern Pacific Ocean  

Science Journals Connector (OSTI)

...Sulfide Chimneys of the Northeastern Pacific Ocean Published ahead of print on 31...Fuca Ridge in the northeastern Pacific Ocean (see Fig. S1 in the supplemental...three sites in the northeastern Pacific Ocean. FEMS Microbiol. Ecol. 36...

Helene C. Ver Eecke; Deborah S. Kelley; James F. Holden

2008-10-31T23:59:59.000Z

350

Enhancing Transport of Hydrogenophaga flava ENV735 for Bioaugmentation of Aquifers Contaminated with Methyl tert-Butyl Ether  

Science Journals Connector (OSTI)

...column was washed with the surfactant solution. d The sand was prewashed with the surfactant solution, and the cells...washed with BSM without surfactant. This work was supported...bacteria through a sandy soil. Appl. Environ. Microbiol...

Sheryl H. Streger; Simon Vainberg; Hailiang Dong; Paul B. Hatzinger

2002-11-01T23:59:59.000Z

351

Mineralization of Surfactants by the Microbiota of Submerged Plant Detritus  

Science Journals Connector (OSTI)

...potentially significant site for surfactant removal in detritus-rich...APPL. ENVIRON. MICROBIOL. SURFACTANT MINERALIZATION BY DETRITUS...community structure in subsurface soils. Ground Water 24:365-374...Arylsulfatase activity of soils. Soil Sci. Soc. Am. Proc...

Thomas W. Federle; Roy M. Ventullo

1990-02-01T23:59:59.000Z

352

Effect of incremental doses of radiation on viability of the microbial population on synthetic operating room gowns.  

Science Journals Connector (OSTI)

...manufacturer and peri- 528 RADIATION DOSE AND MICROBIAL VIABILITY...used to calculate the radiation resistances because...SEM does allow an estimation of the number of cells...ENVIRON. MICROBIOL. RADIATION DOSE AND MICROBIAL VIABILITY...

J L Whitby; D G Storey

1982-03-01T23:59:59.000Z

353

Biodiversity of Vibrios  

Science Journals Connector (OSTI)

...associated with zooplankton in Chesapeake Bay. Appl. Environ. Microbiol. 68: 5498-5507...Colwell. 2002. Seasonality of Chesapeake Bay bacterioplankton species. Appl. Environ...diversity of Vibrio cholerae in Chesapeake Bay determined by amplified fragment length...

Fabiano L. Thompson; Tetsuya Iida; Jean Swings

2004-09-01T23:59:59.000Z

354

Rare Branched Fatty Acids Characterize the Lipid Composition of the Intra-Aerobic Methane Oxidizer Candidatus Methylomirabilis oxyfera  

Science Journals Connector (OSTI)

...mitigate greenhouse gas emissions and global warming. Methane is one of the least reactive...continue to have a major impact on the global nitrogen cycle. Industrial and agricultural...methanotrophic microorganisms in Coal Oil Point seep sediments. BMC Microbiol...

Dorien M. Kool; Baoli Zhu; W. Irene C. Rijpstra; Mike S. M. Jetten; Katharina F. Ettwig; Jaap S. Sinninghe Damst

2012-10-05T23:59:59.000Z

355

Influence of Inorganic Nitrogen Management Regime on the Diversity of Nitrite-Oxidizing Bacteria in Agricultural Grassland Soils  

Science Journals Connector (OSTI)

...water pollution and contributing to global warming. The key process during natural...naphthalene dioxygenase genes from coal-tar-waste-contaminated aquifer...forested wetland impacted by reject coal. Environ. Microbiol. 4: 764-769...

Thomas E. Freitag; Lisa Chang; Christopher D. Clegg; James I. Prosser

2005-12-01T23:59:59.000Z

356

Detection and Identification of Staphylococcus lugdunensis Are Not Hampered by Use of Defibrinated Horse Blood in Blood Agar Plates  

Science Journals Connector (OSTI)

...Microbiol. Rev. 21: 111-133. 4 Sotutu, V., J. Carapetis, J. Wilkinson, A. Davis, and N. Curtis. 2002. The surreptitious Staphylococcus: Staphylococcus lugdunensis endocarditis in a child. Pediatr. Infect. Dis. J. 21: 984-986. Detection...

M. Sundqvist; L. Bieber; R. Smyth; G. Kahlmeter

2010-03-19T23:59:59.000Z

357

Controlling Hospital-Acquired Infection: Focus on the Role of the Environment and New Technologies for Decontamination  

Science Journals Connector (OSTI)

...J. Clin. Microbiol. 32 :2677-2681. 5. Green, J , PA Wright, CI Gallimore, O Mitchell, P...1863. Notes on hospitals. Published by Longman, Green, Longman, Roberts, and Green, London, United Kingdom. http://archive...

Stephanie J. Dancer

2014-10-01T23:59:59.000Z

358

The Methanosarcina barkeri Genome: Comparative Analysis with Methanosarcina acetivorans and Methanosarcina mazei Reveals Extensive Rearrangement within Methanosarcinal Genomes  

Science Journals Connector (OSTI)

...and N. R. King. 1984. Isolation of gas vesicles from Methanosarcina barkeri...Walsby. 2002. The sequence of the major gas vesicle protein, GvpA, influences the width and strength of halobacterial gas vesicles. FEMS Microbiol. Lett. 213...

Dennis L. Maeder; Iain Anderson; Thomas S. Brettin; David C. Bruce; Paul Gilna; Cliff S. Han; Alla Lapidus; William W. Metcalf; Elizabeth Saunders; Roxanne Tapia; Kevin R. Sowers

2006-09-15T23:59:59.000Z

359

Mobilization of plasmid pHSV106 from Escherichia coli HB101 in a laboratory-scale waste treatment facility.  

Science Journals Connector (OSTI)

...approximating that of an actual wastewater treatment plant) did not prevent plas...proportionally) those of an actual wastewater treatment plant, which suggests that there...R-plasmid transfer in wastewater treatment plant. Appl. Environ. Microbiol...

P Mancini; S Fertels; D Nave; M A Gealt

1987-04-01T23:59:59.000Z

360

Quantifying Community Dynamics of Nitrifiers in Functionally Stable Reactors  

Science Journals Connector (OSTI)

...communities from different wastewater treatment plants. FEMS Microbiol. Ecol...nitrite-oxidizers in biofilms from wastewater treatment plants: diversity and in situ...spp. from full-scale wastewater treatment plants by competitive PCR. Appl...

Lieven Wittebolle; Han Vervaeren; Willy Verstraete; Nico Boon

2007-11-02T23:59:59.000Z

Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


361

Testing the optimality properties of a dual antibiotic treatment in a two-locus, two-allele model  

Science Journals Connector (OSTI)

...Talbot, JS Bradley, JE Edwards, D Gilbert, LB Rice, M Scheld, B Spellberg...1038/nrmicro798 ) 6 Payne, DJ . 2008 Microbiology: desperately seeking new antibiotics...antibiotic resistance genes in the clinical microbiology laboratory. Clin. Microbiol. 36...

2014-01-01T23:59:59.000Z

362

CelI, a Noncellulosomal Family 9 Enzyme from Clostridium thermocellum, Is a Processive Endoglucanase That Degrades Crystalline Cellulose  

Science Journals Connector (OSTI)

...American Society for Microbiology ARTICLE ENZYMES AND...Raphael Lamed 3 Harry J. Gilbert 4 Yuval Shoham 1 Corresponding...Department of Molecular Microbiology and Biotechnology...Huskisson, and H. J. Gilbert, J. Gen. Microbiol...

Rachel Gilad; Larisa Rabinovich; Sima Yaron; Edward A. Bayer; Raphael Lamed; Harry J. Gilbert; Yuval Shoham

2003-01-01T23:59:59.000Z

363

On the synchronization of synthetic genetic oscillators in single cells and colonies  

E-Print Network [OSTI]

Rev. Microbiol. , 56, 187209. Stricker, J. , Cookson, S. ,2003; Fung et al. , 2005; Stricker et al. , 2008a; Tigges etAtkinson et al. , 2003; Stricker et al. , 2008a; Tigges et

Mondragon-Palomino, Octavio; Mondragon-Palomino, Octavio

2012-01-01T23:59:59.000Z

364

Polyphyletic Origin of Vibrio vulnificus Biotype 2 as Revealed by Sequence-Based Analysis  

Science Journals Connector (OSTI)

...2011 ARTICLE PUBLIC HEALTH MICROBIOLOGY Polyphyletic...isolates potentially dangerous to humans. A PCR-based...strains potentially dangerous to public health. Appl. Environ. Microbiol...1141-1144. 27 World Health Organization and Food...

Eva Sanjun; Fernando Gonzlez-Candelas; Carmen Amaro

2010-11-19T23:59:59.000Z

365

Synthesis of three advanced biofuels from ionic liquid-pretreated switchgrass using engineered Escherichia coli  

Science Journals Connector (OSTI)

...Microbial cellulose utilization: Fundamentals and biotechnology . Microbiol...precursors suitable for gasoline, diesel, and jet engines directly from...ZZQQhy40 minutes in a liquid cycle. After cooling, MOPS-M9 salts...

Gregory Bokinsky; Pamela P. Peralta-Yahya; Anthe George; Bradley M. Holmes; Eric J. Steen; Jeffrey Dietrich; Taek Soon Lee; Danielle Tullman-Ercek; Christopher A. Voigt; Blake A. Simmons; Jay D. Keasling

2011-01-01T23:59:59.000Z

366

A Global Perspective on Hantavirus Ecology, Epidemiology, and Disease  

Science Journals Connector (OSTI)

...B. 2009. Hantaviruses and climate change. Clin. Microbiol. Infect. 15: 518-523...effects of tree seed production and climate. Epidemiol. Infect. 137: 250-256...2009), and Senior Scientist and Program Leader at Southern Research Institute (SR...

Colleen B. Jonsson; Luiz Tadeu Moraes Figueiredo; Olli Vapalahti

2010-04-01T23:59:59.000Z

367

Complete Genome Sequence of the Marine Cellulose- and Xylan-Degrading Bacterium Glaciecolasp. Strain 4H-3-7+YE-5  

Science Journals Connector (OSTI)

...This study was funded in part by the BioEnergy Science Center, a U.S. Department of Energy Bioenergy Research Centersupported by the Office...Psychrobacterin seawater collected off Ushuaia, Argentina, sub-Antarctica. FEMS Microbiol...

Barbara Klippel; Adriane Lochner; David C. Bruce; Karen Walston Davenport; Chris Detter; Lynne A. Goodwin; James Han; Shunsheng Han; Miriam L. Land; Natalia Mikhailova; Matt Nolan; Len Pennacchio; Sam Pitluck; Roxanne Tapia; Tanja Woyke; Sigrid Wiebusch; Alexander Basner; Fumiyoshi Abe; Koki Horikoshi; Martin Keller; Garabed Antranikian

2011-06-24T23:59:59.000Z

368

Structure and Composition of Biological Slimes on Paper and Board Machines  

Science Journals Connector (OSTI)

...into account the low recovery of ATP. VOL. 60, 1994...L 41 (5) M 31 (4) Board mill strains E. agglomerans...MICROBIOL. PAPER AND BOARD MACHINE SLIMES 653 population...Standards Association SFS, National Board of Waters, Helsinki...

O. M. Visnen; E.-L. Nurmiaho-Lassila; S. A. Marmo; M. S. Salkinoja-Salonen

1994-02-01T23:59:59.000Z

369

Fungal Homoserine Kinase (thr1?) Mutants Are Attenuated in Virulence and Die Rapidly upon Threonine Starvation and Serum Incubation  

Science Journals Connector (OSTI)

...identifies a role for the cortical actin patch/endocytosis complex in the response...2006. Linking uracil base excision repair and 5-fluorouracil toxicity in yeast...2001. Antifungals: what's in the pipeline. Curr. Opin. Microbiol. 4 :540-545...

Joanne M. Kingsbury; John H. McCusker

2010-03-19T23:59:59.000Z

370

Temporal Changes in Archaeal Diversity and Chemistry in a Mid-Ocean Ridge Subseafloor Habitat  

Science Journals Connector (OSTI)

...cycle of a hypersaline stratified lake (Solar Lake, Sinai, Egypt). Appl. Environ...microorganisms in deep-sea hydrothermal vent chimneys investigated by whole-cell hybridization...Distribution of archaea in a black smoker chimney structure. Appl. Environ. Microbiol...

Julie A. Huber; David A. Butterfield; John A. Baross

2002-04-01T23:59:59.000Z

371

Dissimilatory Fe(III) and Mn(IV) reduction.  

Science Journals Connector (OSTI)

...interstitial water of aquatic sediments (1, 19...potential hazard to aquatic ecosystems and drinking-water...Aquifers: Prevention and Restoration. American Water Resources...in sediments. Adv. Aquatic Microbiol. 3:141-179...

D R Lovley

1991-06-01T23:59:59.000Z

372

Perspectives on antiviral use during pandemic influenza  

Science Journals Connector (OSTI)

...under close contact condi- tions, as in households and nursing homes (reviewed in Hayden...following administration of amantadine in Japan. J. Clin. Microbiol. 39, 1652...oseltamivir in preventing in uenza in household contacts. J. Am. Med. Assoc. 285...

2001-01-01T23:59:59.000Z

373

A family of regulatory genes associated with type II restriction-modification systems.  

Science Journals Connector (OSTI)

...restriction-modification system. Nucleic Acids Res. 17...deoxyribonucleic acid restriction systems of their hosts. Microbiol...A. Lechevalier (ed.), Handbook of microbiology, vol. 2...restriction-modification systems, p. 39-71. In A. Razin...

T Tao; J C Bourne; R M Blumenthal

1991-02-01T23:59:59.000Z

374

A Moderately Thermophilic Mixed Microbial Culture for Bioleaching of Chalcopyrite Concentrate at High Pulp Density  

Science Journals Connector (OSTI)

...chalcopyrite) served as energy sources. After that...about 70% of copper reserves in the world (1). It is also the...chalcopyrite, and high lattice energy (1, 3, 4). Bioleaching...bioleaching of chalcopyrite. World J. Microbiol. Biotechnol...

Yuguang Wang; Weimin Zeng; Guanzhou Qiu; Xinhua Chen; Hongbo Zhou

2013-11-15T23:59:59.000Z

375

Physiological and Transcriptional Responses of Anaerobic Chemostat Cultures of Saccharomyces cerevisiae Subjected to Diurnal Temperature Cycles  

Science Journals Connector (OSTI)

...phase to provide metabolic energy for budding (77). During DTC, mobilization of reserve carbohydrates coincided...yeast nitrogen metabolism. World J. Microbiol. Biotechnol...cyclin expression, and reserve carbohydrate metabolism...

Marit Hebly; Dick de Ridder; Erik A. F. de Hulster; Pilar de la Torre Cortes; Jack T. Pronk; Pascale Daran-Lapujade

2014-05-09T23:59:59.000Z

376

Does Resistance to Pyrazinamide Accurately Indicate the Presence of Mycobacterium bovis?  

Science Journals Connector (OSTI)

...MYCOBACTERIOLOGY AND AEROBIC ACTINOMYCETES Does Resistance to Pyrazinamide Accurately Indicate...Clinical microbiology procedures handbook. American Society for Microbiology, Washington...J. Clin. Microbiol. 31: 406-409. Does resistance to pyrazinamide accurately indicate...

Bouke C. de Jong; Anthony Onipede; Alex S. Pym; Sebastien Gagneux; Roxanne S. Aga; Kathryn DeRiemer; Peter M. Small

2005-07-01T23:59:59.000Z

377

Hydrogen Photoproduction Is Attenuated by Disruption of an Isoamylase Gene in Chlamydomonas reinhardtii  

Science Journals Connector (OSTI)

...303-384-6150. a National Renewable Energy Laboratory, Golden, Colorado...Pitts and Ping Liu (National Renewable Energy Laboratory [NREL]) for fabricating...molecular hydrogen, a clean and renewable energy source. Appl. Microbiol...

Matthew C. Posewitz; Sharon L. Smolinski; Saradadevi Kanakagiri; Anastasios Melis; Michael Seibert; Maria L. Ghirardi

2004-07-21T23:59:59.000Z

378

Xenobiotic regulation of Phase I and Phase II metabolism enzymes : beyond the Ah receptor paradigm  

E-Print Network [OSTI]

Cytochrome P450s and Other Enzymes in Drug Metabolism andand properties of induced enzyme. J Biol Chem 1968; 243:II. Cellular responses during enzyme induction. J Biol Chem

Bonzo, Jessica A.

2007-01-01T23:59:59.000Z

379

A Bibliography Of The Early Life History Of Fishes. Volume 1, List Of Titles  

E-Print Network [OSTI]

embryos. Biol. Bull. Shanklin, D. R. 1959. Studies on the [355(1401):1183-1186. Shanklin, D. R. , and P. B. Armstrong.Biol. Bull. 103:295. Shanklin, D. R. 1954. Evidence for

Hoyt, Robert D

2002-01-01T23:59:59.000Z

380

Phagosomes Fuse with Late Endosomes and/or Lysosomes by Extension of Membrane Protrusions along Microtubules: Role of Rab7 and RILP  

Science Journals Connector (OSTI)

...3-phosphoinositides in the maturation of Salmonella-containing vacuoles within host cells. J. Biol. Chem. 277: 12770-12776. 27 Stenmark, H., and V. M. Olkkonen. 2001. The Rab GTPase family. Genome Biol. 2:REVIEWS 3007. 28 Tjelle, T...

Rene E. Harrison; Cecilia Bucci; Otilia V. Vieira; Trina A. Schroer; Sergio Grinstein

2003-09-01T23:59:59.000Z

Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


381

E-Print Network 3.0 - apple sucrose transporter Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

by invertase: sucrose + H2O --> glucose... biosynthesis - growing roots and shoots, potato tubers 12;Biol 458 Lecture 3 Sucrose, p.4 4 5. Other StorageTransport... Biol 458...

382

Cellulose microfibril crystallinity is reduced by mutating C-terminal transmembrane region residues CESA1A903V and CESA3T942I of cellulose synthase  

Science Journals Connector (OSTI)

...Buenos Aires, Buenos Aires C1428EGA, Argentina; g Faculty of Science, University of Ontario...fermentable sugar . Glob Change Biol Bioenergy 1 : 51...fermentable sugar. Glob Change Biol Bioenergy 1:51 ZZQQhy61. 14. Segal L, Creely...

Darby M. Harris; Kendall Corbin; Tuo Wang; Ryan Gutierrez; Ana L. Bertolo; Carloalberto Petti; Detlef-M. Smilgies; Jos Manuel Estevez; Dario Bonetta; Breeanna R. Urbanowicz; David W. Ehrhardt; Chris R. Somerville; Jocelyn K. C. Rose; Mei Hong; Seth DeBolt

2012-01-01T23:59:59.000Z

383

Friedrich Schiller University Have metabolic networks  

E-Print Network [OSTI]

. Biol. 252, 497­504 Teusink, B., Wiersma, A., Molenaar, D., Francke, C., de Vos, W. M., Siezen, R. J

Hinze, Thomas

384

Identifying the mechanisms of activated transcription factor 6 - mediated cardioprotection  

E-Print Network [OSTI]

RW, Bedows E. Assisted protein folding. J Biol Chem. AustinProtein Folding .1 Protein Folding in the Endoplasmic

Belmont, Peter Joseph

2010-01-01T23:59:59.000Z

385

Donnerstag, 27. Januar 2011 Prof. Dr. Steffen Harzsch  

E-Print Network [OSTI]

Themen spannen. Vorträge Donnerstag, 28. Oktober 2010 Dipl. Biol. Nicolas Linder Life & Brain Research

Greifswald, Ernst-Moritz-Arndt-Universität

386

Research, assessment, and manage-ment have traditionally focused on  

E-Print Network [OSTI]

Marinhos e Sustentabilidade Instituto Nacional de Recursos Biológicos (INRB, I.P./IPIMAR) Avenida de

387

New antisickling agent 3,4-dihydro-2,2-dimethyl-2H-1 benzopyran-6-butyric acid  

Science Journals Connector (OSTI)

... , J. M., J. biol. chem., 248, 58615865 (1973).Tosteson, D. C., Carlsen, E., Dunham, E. T., J. gen ...

DONALD E. U. EKONG; JOSEPH I. OKOGUN; VICTORIA U. ENYENIHI; VALERIA BALOGH-NAIR; KOJI NAKANISHI; CLAYTON NATTA

1975-12-25T23:59:59.000Z

388

E-Print Network 3.0 - anhydrobiotic tardigrade milnesium Sample...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

of - Alpine Microbial Observatory Collection: Environmental Sciences and Ecology 6 BIOL 332: Invertebrate Zoology PANARTHROPODA Summary: in freshwater ecosystem: tardigrades...

389

Sequencing the transcriptome of milk production: milk trumps mammary tissue  

E-Print Network [OSTI]

important for milk lipid secretion. J Biol Chem 53. Russellin milk lipid formation and secretion. Trends Endocrinol

2013-01-01T23:59:59.000Z

390

InstruCtIon This list includes for each course the catalog number,  

E-Print Network [OSTI]

...................................................... ASTR Audio Technology............................................AUD Automotive Engineering ................................................ BCHM Biosystems Engineering .......................................BE Bioengineering................................................BIOE Biology ............................................................BIOL Biomolecular Engineering

Stuart, Steven J.

391

Subscriber access provided by -Access paid by the | UC Davis Libraries ACS Chemical Biology is published by the American Chemical Society. 1155 Sixteenth  

E-Print Network [OSTI]

A. Beal ACS Chem. Biol., Just Accepted Manuscript · DOI: 10.1021/cb300692k · Publication Date (Web

Beal, Peter A.

392

Basic Sciences Department Heads *Basic Sciences Council Chair Department Dept Head Biochem., Molec. Biol., & Biophysics David Bernlohr 6-155 Jackson 5-6100 6-2127  

E-Print Network [OSTI]

-4641 Laboratory Medicine & Pathology Leo Furcht 760 Mayo MMC 609 5-9171 6-0622 Medicine Wesley Miller 14-110 PWB

Amin, S. Massoud

393

Published: December 13, 2010 r 2010 American Chemical Society 260 dx.doi.org/10.1021/cb100336p |ACS Chem. Biol. 2011, 6, 260266  

E-Print Network [OSTI]

Published: December 13, 2010 r 2010 American Chemical Society 260 dx.doi.org/10.1021/cb100336p |ACS (1-50 pL) minimized the quantity of reagents needed for bacterial studies. This platform made on research in chemical biology, natural products chemistry, and the discovery and characterization

Weibel, Douglas B.

394

J. theor. Biol. (2002) 216, 301326 doi:10.1006/yjtbi.2540, available online at http://www.idealibrary.com on  

E-Print Network [OSTI]

of the cells and chemicals in the disease pathology. r 2002 Elsevier Science Ltd. All rights reserved ideally provide an initial platform for drug target triage, rapidly identifying the pathways most likely

Keshet, Leah

395

Phys. Med. Biol. 43 (1998) 10011013. Printed in the UK PII: S0031-9155(98)90627-3 High-resolution 3D Bayesian image reconstruction using  

E-Print Network [OSTI]

-resolution 3D Bayesian image reconstruction using the microPET small-animal scanner Jinyi Qi, Richard M Leahy of high-resolution 3D images from the microPET small-animal scanner. Resolution recovery is achieved 2 mm when using an analytic 3D reprojection (3DRP) method with a ramp filter. These results also

Leahy, Richard M.

396

J. theor. Biol. (1999) 196, 237250 Article No. jtbi.1998.0836, available online at http://www.idealibrary.com on  

E-Print Network [OSTI]

the influence of changes in the microenvironment on the activity of several membrane based ion transport systems

Sherratt, Jonathan A.

397

Phys. Med. Biol. 45 (2000) N157N165. Printed in the UK PII: S0031-9155(00)14256-3 Hydrodynamic effects on the solute transport across  

E-Print Network [OSTI]

Hydrodynamic effects on the solute transport across endothelial pores and hepatocyte membranes Dumitru Popescu, Liviu Movileanu§¶, Stelian Ion and Maria-Luiza Flonta Membrane Biophysics Laboratory, Institute membranes (Abidor et al 1979, Popescu et al 1991, Popescu and Victor 1991, Weaver and Chizmadzhev 1996

Movileanu, Liviu

398

J. theor. Biol. (2003) 220, 233239 doi:10.1006/jtbi.2003.3160, available online at http://www.idealibrary.com on  

E-Print Network [OSTI]

methods (fluorescence depo- larization, neutron scattering, etc.) have been applied (McCammon & Harvey

Nollmann, Marcelo

399

IOP PUBLISHING PHYSICS IN MEDICINE AND BIOLOGY Phys. Med. Biol. 52 (2007) 65116524 doi:10.1088/0031-9155/52/21/012  

E-Print Network [OSTI]

Azmandian et al 1. Introduction Radiotherapy is unique from the point of view of radiation safety, since, MA 02115, USA 2 Department of Radiation Oncology, Massachusetts General Hospital and Harvard Medical School, Boston, MA 02114, USA 3 Department of Radiation Oncology, University of California San Diego, La

Kaeli, David R.

400

Phys. Med. Biol. 45 (2000) 18631868. Printed in the UK PII: S0031-9155(00)10622-0 Ultraviolet radiation dosimetry with radiochromic film  

E-Print Network [OSTI]

radiation dosimetry with radiochromic film Martin J Butson¶, Tsang Cheung, Peter K N Yu, Donna Abbati, NSW 2500, Australia § Wollongong Hospital, Department of Nuclear Medicine, Crown Street, Wollongong radiation produced by a solar simulator and examined for dosimetry in ultraviolet radiation. Results show

Yu, K.N.

Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


401

Phys. Med. Biol. 44 (1999) 18751884. Printed in the UK PII: S0031-9155(99)02424-0 Dynamics of polymerization in polyacrylamide gel (PAG)  

E-Print Network [OSTI]

and the concentration of oxygen present. The implications of these findings for polymer gel dosimetry are discussed. 1 to ionizing radiation, undergo a polymerization reaction. This changes, locally, the nuclear magnetic as MRI quality assurance test gels (Gore et al 1997), dosimetry of multifield tomotherapy irradiation

Doran, Simon J.

402

INSTITUTE OF PHYSICS PUBLISHING PHYSICS IN MEDICINE AND BIOLOGY Phys. Med. Biol. 47 (2002) 28632877 PII: S0031-9155(02)29965-0  

E-Print Network [OSTI]

each layer. An appropriate solution of the general radiative transport equation must then be obtained an accurate model of radiation transport within the eye. As well as considering the scattering and absorption of radiation transport within the eye. Such a model was first proposed by van Norren and Tiemeijer (1986

Claridge, Ela

403

INSTITUTE OF PHYSICS PUBLISHING PHYSICS IN MEDICINE AND BIOLOGY Phys. Med. Biol. 47 (2002) 857873 PII: S0031-9155(02)25682-1  

E-Print Network [OSTI]

, kidneys 4 Present address: Advent Optronics Corporation, 205 Pheasant Run, Newtown, PA 18940, USA. 0031

Yodh, Arjun G.

404

IOP PUBLISHING PHYSICS IN MEDICINE AND BIOLOGY Phys. Med. Biol. 54 (2009) 60656078 doi:10.1088/0031-9155/54/20/003  

E-Print Network [OSTI]

.1088/0031-9155/54/20/003 Reduction of the secondary neutron dose in passively scattered proton radiotherapy, using an optimized pre passive scattering and collimation, resulting in an extra whole-body high-energy neutron dose, primarily of whole-body exposure to secondary neutrons produced by the scattering components of passively scattered

Brenner, David Jonathan

405

This journal is c The Royal Society of Chemistry 2012 Integr. Biol. Cite this: DOI: 10.1039/c2ib20166f  

E-Print Network [OSTI]

in cancer theranostics. Herein, we demonstrate that coordination of alizarin blue black B (ABBB) to the TiO2 triggered damage upon cancer targets will enhance the use of TiO2 nanoparticles in cancer theranostics manner. Each of these advancements will enhance the use of TiO2 nanoparticles in cancer theranostics

Brown, Eric

406

BIOL 2020, Cell Biology Syllabus Professors: Winter term: Patrice Cote, Room 7124, Telephone 494.1813, E-mail Patrice@dal.ca  

E-Print Network [OSTI]

of proteins, lipids and carbohydrates · Explain the composition, structure, and dynamics of the lipid bilayer and dynamics, and explain their role in membrane assembly, protein targeting, protein secretion and endocytosis

Iverson, Sara

407

J. theor. Biol. (1997) 189, 171174 00225193/97/220171 + 04 $25.00/0/jt970503 7 1997 Academic Press Limited  

E-Print Network [OSTI]

with regard to their statistical #12;p1 5' -- 3' -- C( ) q3 p2 -- -- C( ) q2 p3 -- -- C( ) q1 -- -- 3' 5' A

Michel, Christian

408

J. Exp. Mar. Biol. Ecol., 1987, Vol. 113, pp. 231-245 Lift as a mechanism of patch initiation in mussel beds  

E-Print Network [OSTI]

of patch initiation in mussel beds Mark W. Denny Hopkins Marine Station, Department of Biological Sciences extensive tightly packed beds. The rate at which patches are formed in these beds, can play an important the biological importance of physical disturbance, the mechanism of patch initiation has not been adequately

Denny, Mark

409

r XXXX American Chemical Society A dx.doi.org/10.1021/cb200198c |ACS Chem. Biol. XXXX, XXX, 000000 pubs.acs.org/acschemicalbiology  

E-Print Network [OSTI]

Alteromonas sp. SN2, gi|332993493; Sros_2140 from Streptospor- angium roseum DSM 43021, gi|271963671; Sked of enzymes are known to catalyze aromatic deamination reactions: cog1001, cog0402, and cog1816. One

Sali, Andrej

410

INSTITUTE OF PHYSICS PUBLISHING PHYSICS IN MEDICINE AND BIOLOGY Phys. Med. Biol. 47 (2002) N285N289 PII: S0031-9155(02)52373-3  

E-Print Network [OSTI]

response detector, which is relatively energy independent, can be created (Butson et al 2002). This short Science, City University of Hong Kong, Kowloon Tong, Hong Kong 2 Illawarra Cancer Care Centre, Department and a low dependence of energy response is required for measurement. 1. Introduction Radiochromic film, due

Yu, K.N.

411

INSTITUTE OF PHYSICS PUBLISHING PHYSICS IN MEDICINE AND BIOLOGY Phys. Med. Biol. 51 (2006) 30993103 doi:10.1088/0031-9155/51/12/007  

E-Print Network [OSTI]

energy independent nature around the 100 kVp to 150 kVp x-ray energy range provides a unique enhancement independent (Butson et al 2006) response to x radiation in the 100 kVp to 150 kVp energy range and also Butson1,2 , Tsang Cheung1 and Peter K N Yu1 1 Department of Physics and Materials Science, City

Yu, K.N.

412

INSTITUTE OF PHYSICS PUBLISHING PHYSICS IN MEDICINE AND BIOLOGY Phys. Med. Biol. 49 (2004) N371N376 PII: S0031-9155(04)84560-3  

E-Print Network [OSTI]

specifically for the measurement of absorbed dose of low energy photons quoting a relatively energy independent376 PII: S0031-9155(04)84560-3 NOTE Experimental energy response verification of XR type T radiochromic film Tsang Cheung1 , Martin J Butson1,2,3 and Peter K N Yu1 1 City University of Hong Kong

Yu, K.N.

413

INSTITUTE OF PHYSICS PUBLISHING PHYSICS IN MEDICINE AND BIOLOGY Phys. Med. Biol. 48 (2003) N247N252 PII: S0031-9155(03)61096-1  

E-Print Network [OSTI]

1998, McLaughlin et al 1991). The relative energy independent nature of Gafchromic film is a useful, City University of Hong Kong, Kowloon Tong, Hong Kong, People's Republic of China 2 Department energy dependence of the film. A comparison of penumbral dose measurements has also ascertained

Yu, K.N.

414

IOP PUBLISHING PHYSICS IN MEDICINE AND BIOLOGY Phys. Med. Biol. 56 (2011) 61496160 doi:10.1088/0031-9155/56/19/001  

E-Print Network [OSTI]

.1088/0031-9155/56/19/001 Pre- and post-natal exposure of children to EMF generated by domestic induction cookers Bor Kos1/6149 Abstract Induction cookers are a type of cooking appliance that uses an intermediate- frequency magnetic field to heat the cooking vessel. The magnetic flux density produced by an induction cooker during

Ljubljana, University of

415

Bull. Fish Biol. 14 (1/2) Bulletin of Fish Biology Volume 14 Nos. 1/2 30.12.2013 61-73  

E-Print Network [OSTI]

sh that has colonized two cave sys- tems in the southern state of Tabasco, Mexico. Unlike many Mexikos (Tabasco) zwei Höhlen besiedelt hat. Anders als viele andere obligate Höh- lenbewohner sind diese

Schlupp, Ingo

416

Minor in Paleobiology The minor in paleobiology is sponsored by the Department of Biology and is designed to provide students a  

E-Print Network [OSTI]

. BIOL 447 - Greening the Earth ____ 5 cr. BIOL 450/ESS 452 - Vertebrate Paleontology ____ 5 cr. BIOL/ESS of Life ____ 2 cr. ESS 100 - Dinosaurs ____ 3 cr. ESS 104 - Prehistoric Life ____ 5 cr. ESS 115 ­ Astrobiology: Life in the Universe ____ 5 cr. ESS 213 ­ Evolution of the Earth* Complete at least one from

Carrington, Emily

417

ECOLOGY, EVOLUTION AND ENVIRONMENTAL BIOLOGY (for students entering Biology in Fall 2011 or later)  

E-Print Network [OSTI]

ECOLOGY, EVOLUTION AND ENVIRONMENTAL BIOLOGY (for students entering Biology in Fall 2011 or later course other than BIOL 54200 124 Total Credits BIOLOGY: 1. BIOL 12100 Biology I: Diversity, Ecology 28600 Intro. to Ecology and Evolution (2 cr.; spring) or BIOL 29500, Intro. to Evolution & Ecology (2 cr

Jiang, Wen

418

Berthon P, Katoh M, Dusanter-Fourt 1, Kelly PA, Djiane J, 1986b. Purification of prolactin receptor from sow mam-mary gland and polyclonal antibodies production. Mol Cell Endocrinol, soumis publication  

E-Print Network [OSTI]

Berthon P, Katoh M, Dusanter-Fourt 1, Kelly PA, Djiane J, 1986b. Purification of prolactin receptor publication Djiane J, Durand P, Kelly PA, 1977. Evolution of prolactin receptors in rabbit mammary gland during pregnancy and lactation. Endocrinology, 100:1348-1356 Djiane J, Dusanter-Fourt 1, Katoh M, Kelly

Paris-Sud XI, Université de

419

IOP PUBLISHING JOURNAL OF PHYSICS B: ATOMIC, MOLECULAR AND OPTICAL PHYSICS J. Phys. B: At. Mol. Opt. Phys. 41 (2008) 095703 (9pp) doi:10.1088/0953-4075/41/9/095703  

E-Print Network [OSTI]

-produced [5] plasmas, high-pressure arc discharges [6], flames [7], stellar atmospheres [8] and solar. In the electric-dipole approximation, and neglecting the second- and higher-order corrections, its shift

420

INSTITUTE OF PHYSICS PUBLISHING JOURNAL OF PHYSICS B: ATOMIC, MOLECULAR AND OPTICAL PHYSICS J. Phys. B: At. Mol. Opt. Phys. 37 (2004) 25852592 PII: S0953-4075(04)75545-5  

E-Print Network [OSTI]

June 2004 Online at stacks.iop.org/JPhysB/37/2585 doi:10.1088/0953-4075/37/12/013 Abstract We Opacity Project data. We find significant differences in photoionization rates for O II metastable states and Planck bound-free opacities is relatively small, but may be potentially significant. 1. Introduction

Nahar, Sultana Nurun

Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


421

INSTITUTE OF PHYSICS PUBLISHING JOURNAL OF PHYSICS B: ATOMIC, MOLECULAR AND OPTICAL PHYSICS J. Phys. B: At. Mol. Opt. Phys. 37 (2004) R57R88 PII: S0953-4075(04)63251-2  

E-Print Network [OSTI]

computation and others. It is interesting to note that the idea of building ion traps grew out of molecular the development of electric and magnetic multipole fields to focus neutral particles [2­4] in two of the high-energy storage rings used in high-energy particle physics, in particular LEAR [8], and use mainly

Zajfman, Daniel

422

INSTITUTE OF PHYSICS PUBLISHING JOURNAL OF PHYSICS B: ATOMIC, MOLECULAR AND OPTICAL PHYSICS J. Phys. B: At. Mol. Opt. Phys. 34 (2001) 36693678 PII: S0953-4075(01)23490-7  

E-Print Network [OSTI]

Rolles2 , F J Garc´ia de Abajo2 , C S Fadley2 , M A Van Hove2 , A Cassimi6 , H Schmidt-B¨ocking1 and R D the kinetic energ

Muiño, Ricardo Díez

423

Mol. Cryst. Lip. Crpr ,1997,Vol. 2W.pp. 301-306 0 lPY7 OPA ( O v m PublishersAssociati~n) Reprinuavailabledirmrly from the publisher Amnrerdam B.V.PubLshcd inTbe Nethdanda  

E-Print Network [OSTI]

can be Uustrated by differentid geometry theoremsg. If n ia normal to a family of surfaces S energ in Eq.(2). The appearance of a loop would mean that G in the region endored by the loop is reduced

Lavrentovich, Oleg D.

424

BPA Alpha Listing August 2014 OM/FSS -O= Open Market BPA/F= Federal Supply BPA Bus. Sz. -S= Small Business/O= Other than Small M.O.L. = Maximum Order Limit  

E-Print Network [OSTI]

BPA Alpha Listing August 2014 OM/FSS - O= Open Market BPA/F= Federal Supply BPA Bus. Sz. - S= Small NORTHPOINT ST SAN FRANCISCO CA 94103 12/31/2015 O S $100,000.00 #12;BPA Alpha Listing August 2014 N

Rau, Don C.

425

BPA Alpha Listing February 2014 OM/FSS -O= Open Market BPA/F= Federal Supply BPA Bus. Sz. -S= Small Business/O= Other than Small M.O.L. = Maximum Order Limit  

E-Print Network [OSTI]

BPA Alpha Listing February 2014 OM/FSS - O= Open Market BPA/F= Federal Supply BPA Bus. Sz. - S 94103 12/31/2015 O S $100,000.00 #12;BPA Alpha Listing February 2014 N.B.S. # VENDOR NAME ATTENTION

Rau, Don C.

426

BPA Alpha Listing July 2014 OM/FSS -O= Open Market BPA/F= Federal Supply BPA Bus. Sz. -S= Small Business/O= Other than Small M.O.L. = Maximum Order Limit  

E-Print Network [OSTI]

BPA Alpha Listing July 2014 OM/FSS - O= Open Market BPA/F= Federal Supply BPA Bus. Sz. - S= Small NORTHPOINT ST SAN FRANCISCO CA 94103 12/31/2015 O S $100,000 00 #12;BPA Alpha Listing July 2014 N

Rau, Don C.

427

IOP PUBLISHING JOURNAL OF PHYSICS B: ATOMIC, MOLECULAR AND OPTICAL PHYSICS J. Phys. B: At. Mol. Opt. Phys. 42 (2009) 035101 (8pp) doi:10.1088/0953-4075/42/3/035101  

E-Print Network [OSTI]

ions in an ion trap under ultra-high vacuum conditions allows measurement of small rates by simultaneously trapped laser-cooled barium ions to translational temperatures of below 150 mK. Destruction rates

Schiller, Stephan

428

!Hcomb of benzoic acid (C6H5CO2H) is -3227 kJ/mol. When a 2.442-g sample of benzoic acid is burned in a  

E-Print Network [OSTI]

+ H2O Atomic Structure: Quantum Theory nuclear model from Ratherford's experiments #12;Problem with Classic Structure accelerating charged particle loses energy The Nature of Light ! frequency of Light · electromagnetic radiation travels in waves · at the speed of light (in vacuum, c

Zakarian, Armen

429

BNL Biology Department - Publications 2007  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

STEM Home Page STEM Home Page About STEM Data Analysis Publications Users & Projects FAQs External Links Publication Categories DNA/RNA Protein Filaments Heavy Atom Instumentation Methods Nanoscience Proteins Lipoprotiens Viruses-Filamentous Viruses-Spherical Scanning Transmission Electron Microscopy Facility DNA/RNA/protein Makhov A.M., Sen A., Yu X., Simon M.N., Griffith J.D., and Egelman E.H. The Bipolar Filaments Formed by Herpes Simplex Virus Type 1 SSB/Recombination Protein (ICP8) Suggest a Mechanism for DNA Annealing. J Mol Biol., 386(2):273-9 (2009). PubMed Ohi M.D., Ren L., Wall J.S., Gould K.L., and Walz T. Structural characterization of the fission yeast U5.U2/U6 spliceosome complex. Proc Natl Acad Sci USA., 104(9):3195-200 (2007). PubMed, Full Text Ohi M.D., Feoktistova A., Ren L., Yip C., Cheng Y., Chen J.S., Yoon

430

Solution structure of a fragment of the dimerization domain of DP-1 determined by 1H-nuclear magnetic resonance and distance geometry  

Science Journals Connector (OSTI)

The structure of a synthesized peptide with the sequence of NHILPNESAYDQKNIRRRVYDALNVLMAMNIISK that corresponds to residues 151184 of transcription factor DP-1 (Girling et al., Nature 362 (1993) 8387) was determined by 1H-nuclear magnetic resonance in water and 40% d3-trifluoroethanol/water, respectively. Nuclear Overhauser effect cross peaks, ?H chemical shifts and J-coupling constants of ?HNH show that the peptide consists a helix from Ser-8 to Ser-33 in solution. Fifty structures were constructed with 288 upper distance limits and 21 angle constraints by DIANA (Guntert et al., J. Mol. Biol. 217 (1991) 517530). Although the N-terminal of the peptide exhibits a random conformation, the 20 best structures show a root mean square deviation of 0.890.36 for backbone atoms and 1.800.34 for heavy atoms from residue Ser-8 to Ser-33. This result supports the proposal that DP-1 and E2F-1 may dimerize with a coiled-coil type interaction.

Shouhong Guang; Jihui Wu; Tianning Yu; Youlin Xia; Yunyu Shi

1998-01-01T23:59:59.000Z

431

Horario de clases Curso 2014-2015  

E-Print Network [OSTI]

Cuatrimestre (Aulario II, Aula: 203) L M X J V 9 - 10 HUM FIS FIS 10 - 11 HUM QUIM MAT QUIM MAT 11 - 12 FIS BIOL MAT DEO QUIM 12 - 13 FIS BIOL DEO DEO BIOL 13 - 14 DEO HUM HUM Claves y Profesores*: FIS: Física/ 3 grupos x 2 profesores) 2º Cuatrimestre (Aulario II, Aula: 203) L M X J V 9 - 10 BIOQ INF BIOQ FIS

Rey Juan Carlos, Universidad

432

Kinematics and Mechanics of Jumping Lizards: the Modulation of Jump Power  

E-Print Network [OSTI]

Physiology 271, C571-C578. Marsh, R. L. and John-Alder, H.Biol. Sci. Roberts, T. J. , Marsh, R. L. , Weyand, P. G. and

Olberding, Jeffrey Paul

2013-01-01T23:59:59.000Z

433

Mechanisms of behavioral choice in the nervous system of the medicinal leech  

E-Print Network [OSTI]

Single Neurone. J Exp Biol 77:71- Wiersma CA, Ikeda K (1964)to each behavior (Wiersma and Ikeda, 1964; Kupfermann and

Gaudry, Quentin

2008-01-01T23:59:59.000Z

434

Carbon dioxide and metabolism in marine environments  

Science Journals Connector (OSTI)

Protides Biol. Fluids Proc. Colloq. Bruges 14: 205-210. RUSSEL, R. U., J. E. SALMON, AND H. R. TIETZE. 1961. Condensed ions in aqueous solutions. Part 2

2000-01-03T23:59:59.000Z

435

Discovery of ubiquitin ligases involved in cytoplasmic quality control  

E-Print Network [OSTI]

Converging concepts of protein folding in vitro and in vivo.chaperones in cellular protein folding. Current Opinion inof endoplasmic reticulum protein folding. J Cell Biol, 2001.

Heck, Jarrod Wesley

2010-01-01T23:59:59.000Z

436

Reche, I., et al. Effect of Saharan dust inputs on bacterial activity and ...  

Science Journals Connector (OSTI)

alpine lake basins of the Colorado Front Range, USA. Freshw. Biol. 43: 463476. .... the oligotrophic water of the open western Mediterranean. Sea. Limnol.

2009-04-16T23:59:59.000Z

437

Download  

Science Journals Connector (OSTI)

in the western Baltic. Ophelia 31: 125132. MORALES-BAQUERO, R. ... limitation in Colorado mountain lakes. Freshw. Biol. 20: 315. 327. MURPHY, J., AND...

2001-05-24T23:59:59.000Z

438

E-Print Network 3.0 - acid linoleic acid Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

FAs (linolenic, linoleic) - - monounsaturated FAs (oleic acid) - olive, canola - hydrogenation... Biol 458 Lecture 6 & 7 Fatty Acids 1 A. Introduction to acyl lipids...

439

E-Print Network 3.0 - ambiental del insecticida Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Modelacin matemtica del control de plagas en un cultivo Summary: y Trichogramma. En el primer modelo, el efecto del insecticida biol- gico se modela mediante una... funcin de...

440

E-Print Network 3.0 - adenosine receptor ligands Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

ligand recognition in the human a(2a) adenosine receptor. J Biol Chem 1995... , Vangalen PJM, Jacobson KA. Molecular ... Source: Abagyan, Ruben - School of Pharmacy and...

Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


441

A mathematical model for the branched chain amino acid biosynthetic pathways of Escherichia coli K12  

E-Print Network [OSTI]

Biol. 28, 497-504 Yang, C. -R. , Shapiro, B. E. , Mjolsness,use of kMech [ Yang, C. -R. , Shapiro, B. E. , Mjolsness, E.

Yang, C R; Shapiro, B E; Hung, S P; Mjolsness, E D; Hatfield, G W

2005-01-01T23:59:59.000Z

442

THE SURFACE CHARGE OF PARTICULATE MATTER IN SEAWATER  

Science Journals Connector (OSTI)

surface on gas bubbles to become available as a nutrient for ..... strongly hydrated character. The bentonite and ..... bacteria on sand particles. J. Exp. Biol. 411:.

443

On the rough folding landscape of green fluorescent protein  

E-Print Network [OSTI]

H. (2008). Understanding protein folding: small proteins inmultiple pathways of protein folding. Chem Biol 2, 255-60.Polymer principles and protein folding. Protein Sci 8, 1166-

Andrews, Benjamin Thomas

2008-01-01T23:59:59.000Z

444

E-Print Network 3.0 - accessory proteins regulate Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

in H4 cells. J. Biol... -secretase cleavage of Alzheimer's amyloid b protein precursor. J. Alzheimer's Dis. 2, ... Source: Holy, Timothy - Department of Anatomy and Neurobiology,...

445

E-Print Network 3.0 - antidiuretic hormone siadh Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Department of Biochemistry and Molecular Biology Collection: Biology and Medicine 4 263J. exp. Biol. 180, 263-271 (1993) Printed in Great Britain The Company of Biologists...

446

E-Print Network 3.0 - antidiuretic hormone Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

of Biology, Ball State University Collection: Environmental Sciences and Ecology 3 263J. exp. Biol. 180, 263-271 (1993) Printed in Great Britain The Company of Biologists...

447

Engineered Photosystem II Reaction Centers Optimize Photochemistry versus Photoprotection at Different Solar Intensities  

Science Journals Connector (OSTI)

Mayfield, S. P.; Cohen, A.; Danon, A.; Yohn, C. B. J. Cell Biol. ... Mayfield, Stephen P.; Cohen, Amybeth; Danon, Avihai; Yohn, Chistopher B. ...

David J. Vinyard; Javier Gimpel; Gennady M. Ananyev; Stephen P. Mayfield; G. Charles Dismukes

2014-02-18T23:59:59.000Z

448

Impact of El Nino on the foraging behavior of female northern elephant seals  

E-Print Network [OSTI]

diving behavior of northern elephant seals. J Exp Biol 201:behavior of female northern elephant seals Daniel E. Crockerbehavior of northern elephant seals Mirounga angustirostris

Crocker, D E; Costa, Daniel P; Le Boeuf, B J; Webb, P M; Houser, D S

2006-01-01T23:59:59.000Z

449

E-Print Network 3.0 - areas da usina Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

(eds) Animal sonar. Plenum Press, New York, pp 601605 Brooks DR, McLennan DA (1991) Phylogeny, ecology... auditory neurone. J Exp Biol 113: 323335 Surlykke A (1986)...

450

E-Print Network 3.0 - armata collembola onychiuridae Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

4 Changes in species assemblages and diets of Collembola along a gradient of metal pollution Summary: of three Collembola (Family Onychiuridae). Rev. Ecol. Biol. Sol 12,...

451

ORIGINAL PAPER Does consumer injury modify invasion impact?  

E-Print Network [OSTI]

Gill University, Montreal, QC H3A 1B1, Canada 123 Biol Invasions DOI 10.1007/s10530-011-9975-0 #12;invasive

Leung, Brian

452

E-Print Network 3.0 - acid dehalogenase enzyme Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

of halorespi- ration in Desulfitobacterium dehalogenans. J. Biol. Chem... of vinyl chloride (VC) to ethene. Degenerate primers targeting conserved regions in reductive...

453

E-Print Network 3.0 - annelid pomatoceros lamarckii Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Texas A&M University at ... Source: Schulze, Anja - Department of Marine Biology, Texas A&M University at Galveston Collection: Biology and Medicine 32 Oceanogr. Mar. Biol....

454

E-Print Network 3.0 - advanced nsclc patients Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

patients Search Powered by Explorit Topic List Advanced Search Sample search results for: advanced nsclc patients Page: << < 1 2 3 4 5 > >> 1 Pathol Biol (Paris) . Author...

455

E-Print Network 3.0 - active bacterium phylogenetically Sample...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

and Biological Engineering, Ohio State University Collection: Renewable Energy 14 J. theor. Biol. (1999) 196, 251261 Article No. jtbi.1998.0838, available online at...

456

E-Print Network 3.0 - autonomously replicating geminivirus Sample...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

cycles of phytoplankton and copepods in the north Atlantic Ocean and the North Sea. Mar. Biol. 51, 2332 (1979). Summary: @sahfos.ac.uk). ......

457

E-Print Network 3.0 - adaptive genetic variation Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

4... . Population Genetics Weigang Qiu Department of Biological Sciences Hunter College BIOL ... Source: Qiu, Weigang - Department of Biological Sciences, Hunter College, City...

458

E-Print Network 3.0 - aphid herbivores unaffected Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

University of California, Davis Collection: Environmental Sciences and Ecology 20 Biol. Lett. (2007) 3, 14 doi:10.1098rsbl.2006.0548 Summary: the coevolutionary hypothesis...

459

E-Print Network 3.0 - angiosperm annona cherimola Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Collection: Environmental Sciences and Ecology 38 638 SYSTEMATIC BIOLOGY VOL. 51 Syst. Biol. 51(4):638647, 2002 Summary: cycads), many angiosperms were much younger. Seed plants...

460

E-Print Network 3.0 - ammonia-oxidizing bacterium nitrosococcus...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Collection: Chemistry 93 General Discussion Chapter 9: General Discussion Summary: . Soil Biol Biochem 23: 717-723. Hermansson A & Lindgren P-E (2001) Quantification of...

Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


461

E-Print Network 3.0 - ant atta sexdens Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

con- tain their fungus... . Exca- vacaAtta sexdens rubropilosa Forel, 1908). Arq. Inst. Biol. 13, 137148. Fig... Subterranean ant nests: trace fossils past and future? Walter...

462

E-Print Network 3.0 - abdomen tipo iii Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Centre de mathmatiques Collection: Mathematics 22 KNAPP ET AL. Rev. peru. biol. Nmero especial 13(2): 612s -643s (Diciembre 2006) Summary: . Cestrum dunalii Francey...

463

E-Print Network 3.0 - atta sexdens sexdens Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

R. Tschinkel Summary: . Exca- vacaAtta sexdens rubropilosa Forel, 1908). Arq. Inst. Biol. 13, 137148. Fig... that they were constructed by species of attine ants (Atta,...

464

E-Print Network 3.0 - abscisic acid aba Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

University of California at Riverside Collection: Biotechnology 48 Annu. Rev. Plant Biol. 2002. 53:24773 DOI: 10.1146annurev.arplant.53.091401.143329 Summary:...

465

E-Print Network 3.0 - atlantic rain forest Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

. 2006. Biased seed rain in forest edges: Evidence from the Brazilian Atlantic forest. Biol. Conserv. 132... forest typical for eastern lowland Borneo (Slik et al. 2009). The...

466

E-Print Network 3.0 - acid bacterium isolated Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Physics, Wageningen Universiteit Collection: Physics ; Biology and Medicine 11 J. theor. Biol. (1999) 196, 251261 Article No. jtbi.1998.0838, available online at http:...

467

E-Print Network 3.0 - abscisic acid concentration Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Yale University Collection: Biology and Medicine ; Biotechnology 42 Annu. Rev. Plant Biol. 2002. 53:24773 DOI: 10.1146annurev.arplant.53.091401.143329 Summary:...

468

E-Print Network 3.0 - atp induced vasodilatation Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

. Biol. Chem. 256, 1754-1762. ... Source: Kowalczykowski, Stephen C. - Section of Microbiology, University of California, Davis Collection: Biology and Medicine 60...

469

E-Print Network 3.0 - acyl-coa-binding protein acbp Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

ACBP, Che... conserved hydrophobic residues is rate limit- ing in two-state protein folding of acbp. Nature Struct. Biol... for nine proteins whose folding nucleus was...

470

E-Print Network 3.0 - anemone actinia bermudensis Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

on the sea anemone Actinia tenebrosa. Aust J mar Freshwat... of the sea anemone Actinia ten- ebrosa. Mar Biol 109: ... Source: Grosberg, Rick - Section of Evolution and Ecology,...

471

E-Print Network 3.0 - antifolate promotes unusual Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

131 (2003) 7781 Short communication Summary: , chaperoned by GDP dissociation inhibitor (GDI). Interac- tion with YIP1 promotes the dissociation of the YPT... Biol Chem...

472

Arabidopsis Adapts to Copper Deficient Conditions via SPL7, a Master Regulator for Copper Homeostasis  

E-Print Network [OSTI]

systemic down-regulation of copper protein expression inresponse to low copper availability in Arabidopsis. J. Biol.A regulator of nutritional copper signaling in Chlamydomonas

Yamasaki, Hiroaki; Shikanai, Toshiharu

2009-01-01T23:59:59.000Z

473

E-Print Network 3.0 - accelerated screening methods Sample Search...  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

J. exp. Biol. 168, 23-40 (1992) Printed in Great Britain @ The Company of Biologists Limited 1992 Summary: between the accelerator muscle (the muscle that powers tongue...

474

E-Print Network 3.0 - anti-west nile virus Sample Search Results  

Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

Source: Bent, Andrew F. - Department of Plant Pathology, University of Wisconsin at Madison Collection: Biology and Medicine 75 BIOL 30200 RESEARCH IN BIOLOGY Fall 2007 Projects...

475

Evolution of host resistance to parasite infection in the snail ...  

E-Print Network [OSTI]

Mar 25, 2011 ... J. Math. Biol. DOI 10.1007/s00285-011-0457-x. Mathematical Biology. Evolution of host resistance to parasite infection.

2011-08-16T23:59:59.000Z

476

Symbiotic Associations in the Phenotypically-Diverse Brown Alga Saccharina japonica  

E-Print Network [OSTI]

1986) Sexual pheromones in algae. Biol Bull 170: 145175.in the Phenotypically-Diverse Brown Alga Saccharina japonicaRussia Abstract The brown alga Saccharina japonica (

Balakirev, Evgeniy S.; Krupnova, Tatiana N.; Ayala, Francisco J.

2012-01-01T23:59:59.000Z

477

Univerza v Ljubljani Fakulteta za elektrotehniko  

E-Print Network [OSTI]

to EMF generated by domestic induction cookers Phys Med Biol 56 6149­60 Paper 3: Kos B, Valic B, Kotnik

Ljubljana, University of

478

Morphological characterization of small cells resulting from nutrient starvation of a psychrophilic marine vibrio.  

Science Journals Connector (OSTI)

...starved for 5 weeks; bar represents 0.2 p.m. APPL. ENVIRON. MICROBIOL. S. a 1* -il,i .~,t t. - C I ,. , 621 pppl- I 1. 622 NOVITSKY AND MORITA LITERATURE CITED 1. Adler, H. I., W. D. Fisher, A. Cohen, and A. A. Hardi- gree...

J A Novitsky; R Y Morita

1976-10-01T23:59:59.000Z

479

The Sulfate-Reducing Bacterium Desulfovibrio desulfuricans ND132 as a Model for Understanding Bacterial Mercury  

E-Print Network [OSTI]

Bacterial Mercury Methylation Contact: Cynthia Gilmour (gilmourc@si.edu, 443-482-2498) DOE/Office of Science/Biological & Environmental Research ·The ORNL Mercury Science Focus Area is developing the Hg-methylating bacterium as a model for understanding bacterial mercury methylation. Appl. Environ. Microbiol. 77:3938-3951 (doi:10

480

Identification of cardioviruses related to Theiler's murine encephalomyelitis virus in human infections  

Science Journals Connector (OSTI)

...exclude cases of RSV, Flu A/B...cluster analysis, E-Predict, and z score analysis as...virus infection: A model for multiple sclerosis . Clin Microbiol...Urisman A ( 2005 ) E-Predict: A computational strategy...2007 ) Creating a model program for influenza surveillance...2005 ) Rhinovirus outbreak in a long term care...

Charles Y. Chiu; Alexander L. Greninger; Kimberly Kanada; Thomas Kwok; Kael F. Fischer; Charles Runckel; Janice K. Louie; Carol A. Glaser; Shigeo Yagi; David P. Schnurr; Tom D. Haggerty; Julie Parsonnet; Don Ganem; Joseph L. DeRisi

2008-01-01T23:59:59.000Z

Note: This page contains sample records for the topic "microbiol mol biol" from the National Library of EnergyBeta (NLEBeta).
While these samples are representative of the content of NLEBeta,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of NLEBeta
to obtain the most current and comprehensive results.


481

Integrated Analysis of Established and Novel Microbial and Chemical Methods for Microbial Source Tracking  

Science Journals Connector (OSTI)

...area Spain France Sweden United Kingdom Cyprus No. of samples No. of sampling sites...Functional genes for cellobiose utilization in natural isolates of Escherichia coli. J. Bacteriol...and animal sources of fecal pollution in natural waters. Appl. Environ. Microbiol...

Anicet R. Blanch; Llus Belanche-Muoz; Xavier Bonjoch; James Ebdon; Christophe Gantzer; Francisco Lucena; Jakob Ottoson; Christos Kourtis; Aina Iversen; Inger Khn; Laura Moc; Maite Muniesa; Janine Schwartzbrod; Sylvain Skraber; Georgios T. Papageorgiou; Huw Taylor; Jessica Wallis; Joan Jofre

2006-09-01T23:59:59.000Z

482

In vitro susceptibility of the opportunistic fungus Cryptococcus neoformans to anthelmintic benzimidazoles.  

Science Journals Connector (OSTI)

...cerevisiae W303-1A was moderately susceptible only to benomyl, car- bendazim, and the antitumor agent nocodazole (IC50 = 0...benzimidazole compounds. Appl. Microbiol. 21:944-945. 11. Panther, L. A., and M. A. Sande. 1990. Cryptococcal meningitis...

M C Cruz; M S Bartlett; T D Edlind

1994-02-01T23:59:59.000Z

483

Homologous recombination in Nannochloropsis: A powerful tool in an industrially relevant alga  

Science Journals Connector (OSTI)

...dietary supplementation with the alga Nannochloropsis and mantur oil...lipids from marine unicellular algae enhance the amount of liver and blood...analysis of the production of biodiesel and biogas from the microalgae...transformation of the unicellular green alga, Nannochloropsis sp . J Microbiol...

Donald P. Weeks

2011-01-01T23:59:59.000Z

484

Voltage-gated proton channel in a dinoflagellate  

Science Journals Connector (OSTI)

...was recently proposed as a source of biodiesel production (23). Our goal was to identify a dinoflagellate...estuarine aquaculture facility . Harmful Algae 1 : 169 189 . 23 Fuentes-Grunewald...veneficum as a sustainable source of biodiesel production . J Ind Microbiol Biotechnol...

Susan M. E. Smith; Deri Morgan; Boris Musset; Vladimir V. Cherny; Allen R. Place; J. Woodland Hastings; Thomas E. DeCoursey

2011-01-01T23:59:59.000Z

485

Trichosporon mycotoxinivorans, a Novel Respiratory Pathogen in Patients with Cystic Fibrosis  

Science Journals Connector (OSTI)

...mycotoxinivorans forms cream to tan mucoid colonies with few white aerial mycelia (20). It forms true hyphae which disarticulate into...Microbiol. 27: 661-671. 21 Moretti-Branchini, M. L., K. Fukushima, A. Z. Schreiber, K. Nishimura, P. M. Papaiordanou...

Patrick W. Hickey; Deanna A. Sutton; Annette W. Fothergill; Michael G. Rinaldi; Brian L. Wickes; Howard J. Schmidt; Thomas J. Walsh

2009-08-05T23:59:59.000Z

486

Computational modeling and experimental validation of the Legionella and Coxiella virulence-related type-IVB secretion signal  

Science Journals Connector (OSTI)

...These predictions were experimentally...Legionnaires disease . J Infect...Legionnaires disease: 25 years...effectors using a machine learning approach...animals and plants . Microbiol...secretion machines . Nature 444 ( 7119...Legionnaires disease . PLoS Genet...Practical Machine Learning Tools and...

Ziv Lifshitz; David Burstein; Michael Peeri; Tal Zusman; Kierstyn Schwartz; Howard A. Shuman; Tal Pupko; Gil Segal

2013-01-01T23:59:59.000Z

487

Salmonella Biofilm Development Depends on the Phosphorylation Status of RcsB  

Science Journals Connector (OSTI)

...DNA from E. coli was purified with a Quantum Prep plasmid kit (Bio-Rad). Plasmids...than just a two-component pathway. Future Microbiol. 5 :1173-1184. 4. Clarke...binding protein YcgR controls flagellar motor direction and speed to affect chemotaxis...

Cristina Latasa; Begoa Garca; Maite Echeverz; Alejandro Toledo-Arana; Jaione Valle; Susana Campoy; Francisco Garca-del Portillo; Cristina Solano; Iigo Lasa

2012-05-11T23:59:59.000Z

488

Purification of Clostridium thermocellum xylanase Z expressed in Escherichia coli and identification of the corresponding product in the culture medium of C. thermocellum.  

Science Journals Connector (OSTI)

...Wain-Hobson, S., P. Sonigo, 0. Danos, S. Cole, and M. Alison. 1985. Nucleotide sequence of the AIDS virus, LAV. Cell...thermocellum. Appl. Environ. Microbiol. 49:656-659. 24. Wise, D. L. (ed.). 1984. CRC series in biotechnology, vol...

O Grpinet; M C Chebrou; P Bguin

1988-10-01T23:59:59.000Z

489

Antimicrobial susceptibilities and beta-lactamase characterization of Capnocytophaga species.  

Science Journals Connector (OSTI)

...L Roscoe S J Zemcov D Thornber R Wise A M Clarke Division of Medical Microbiology...ZEMCOV,1 DAWN THORNBER,2 RICHARD WISE,2 AND ALISON M. CLARKE1 Division ofMedical Microbiology...Microbiol. 19:538-540. 35. Wise, R., J. M. Andrews, J. P...

D L Roscoe; S J Zemcov; D Thornber; R Wise; A M Clarke

1992-10-01T23:59:59.000Z

490

Detection of Listeria monocytogenes by direct colony hybridization on hydrophobic grid-membrane filters by using a chromogen-labeled DNA probe.  

Science Journals Connector (OSTI)

...The HGMFs containing purple grid cells could be easily and accurately...probes using the hydrophobic grid-membrane filter. Food Microbiol...Perry. 1988. Rapid hydrophobic grid membrane filter-enzyme-labeled...LiCl boiling method for plasmid mini-preps. Trends Genet. 1...

P I Peterkin; E S Idziak; A N Sharpe

1991-02-01T23:59:59.000Z

491

The Rip1 Protease of Mycobacterium tuberculosis Controls the SigD Regulon  

Science Journals Connector (OSTI)

...extracytoplasmic function (ECF) sigma factors. Adv. Microb. Physiol. 46 :47-110. doi: 10.1016/S0065-2911(02)46002-X . 2. Hughes KT , and K Mathee. 1998. The anti-sigma factors. Annu. Rev. Microbiol. 52 :231-286. doi: 10...

Jessica S. Schneider; Joseph G. Sklar; Michael S. Glickman

2014-05-09T23:59:59.000Z

492

Physiological Responses of the Hyperthermophilic Archaeon Pyrococcus abyssi to DNA Damage Caused by Ionizing Radiation  

Science Journals Connector (OSTI)

...Damage Caused by Ionizing Radiation Edmond Jolivet 1 Corresponding...Fukuoka 812-8581, Japan The mechanisms by which...temperature and/or ionizing radiation. The hyperthermophilic...Matsunaga thanks the Japan Society for the Promotion...resistant to ionizing radiation? Trends Microbiol...

Edmond Jolivet; Fujihiko Matsunaga; Yoshizumi Ishino; Patrick Forterre; Daniel Prieur; Hannu Myllykallio

2003-07-01T23:59:59.000Z

493

Candidate phylum TM6 genome recovered from a hospital sink biofilm provides genomic insights into this uncultivated phylum  

Science Journals Connector (OSTI)

...and biofilms . J Water Health 7 ( 3 ): 469 477...PCR . Int J Hyg Environ Health 213 ( 3 ): 176 182 . 17 Feazel...Prochlorococcus clades from iron-depleted oceanic regions . Proc...levels of nitric acid-uranium waste. FEMS Microbiol...National Institutes of Health (NIH) Grant 3P41RR024851-02S1...

Jeffrey S. McLean; Mary-Jane Lombardo; Jonathan H. Badger; Anna Edlund; Mark Novotny; Joyclyn Yee-Greenbaum; Nikolay Vyahhi; Adam P. Hall; Youngik Yang; Christopher L. Dupont; Michael G. Ziegler; Hamidreza Chitsaz; Andrew E. Allen; Shibu Yooseph; Glenn Tesler; Pavel A. Pevzner; Robert M. Friedman; Kenneth H. Nealson; J. Craig Venter; Roger S. Lasken

2013-01-01T23:59:59.000Z

494

Molecular Cloning and Characterization of the Gene Coding for the Aerobic Azoreductase from Xenophilus azovorans KF46F  

Science Journals Connector (OSTI)

...as sole source of carbon and energy. Appl. Environ. Microbiol...Proc. Natl. Acad. Sci. USA 91: 9322-9326. 35 Rau...a growing power in changing market. Chem. Eng. News 15: 10-12...the sole source of carbon and energy. The deduced amino acid sequence...

Silke Blmel; Hans-Joachim Knackmuss; Andreas Stolz

2002-08-01T23:59:59.000Z

495

Impact of Photocatalysis on Fungal Cells: Depiction of Cellular and Molecular Effects on Saccharomyces cerevisiae  

Science Journals Connector (OSTI)

...Regulation of trehalose mobilization in fungi. Microbiol. Rev. 48 :42-59. 63. Dulermo, T , C Rascle, G Billon-Grand, E Gout, R Bligny and P Cotton. 2010. Novel insights into mannitol metabolism in the fungal plant pathogen Botrytis cinerea. Biochem...

Sana Thabet; France Simonet; Marc Lemaire; Chantal Guillard; Pascale Cotton

2014-09-26T23:59:59.000Z

496

Current perspectives on the epidemiology and pathogenesis of clinically significant Vibrio spp.  

Science Journals Connector (OSTI)

...710-717. 150. Oliver, J. D., J. E. Wear, M. B. Thomas, M. Warner, and K...infections caused by Vibrio vulni- ficus, a marine vibrio, in inland areas of the United...Virulence of Vibrio Iulnificus strains from marine environments. Appl. Environ. Microbiol...

J M Janda; C Powers; R G Bryant; S L Abbott

1988-07-01T23:59:59.000Z

497

Real-Time PCR Analysis of Vibrio vulnificus from Oysters  

Science Journals Connector (OSTI)

...Heublein. 1979. Disease caused by a marine vibrio: clinical characteristics and epidemiology...other lactose-fermenting vibrios in the marine environment. Appl. Environ. Microbiol...985-998. 25 Oliver, J. D., J. E. Wear, M. B. Thomas, M. Warner, and K...

Mark S. Campbell; Anita C. Wright

2003-12-01T23:59:59.000Z

498

Adherence of Pseudomonas aeruginosa to hydrophilic contact lenses and other substrata.  

Science Journals Connector (OSTI)

...associated with contact lens wear. Am. J. Ophthalmol...primary film-forming marine bacterium. Dev. Ind...associated with contact lens wear. Arch. Ophthalmol...events in the sorption of marine bacteria to surfaces...ulcers and contact lens wear. J. Clin. Microbiol...

M J Miller; D G Ahearn

1987-08-01T23:59:59.000Z

499

Microorganisms Resistant to Free-Living Amoebae  

Science Journals Connector (OSTI)

...Ares, and M. L. Casro Casa. 1989. Marine amoeba from waters of northwest Spain...W. Ajello, A. F. Kaufmann, D. J. Wear, and J. D. Wenger. 1991. Proposal...of human enteroviruses in estuarine and marine waters. Appl. Environ. Microbiol. 32...

Gilbert Greub; Didier Raoult

2004-04-01T23:59:59.000Z

500

Correlation between virulence and colony morphology in Vibrio vulnificus.  

Science Journals Connector (OSTI)

...MacLeod. 1973. Dissociation in a marine pseudomonad. Can. J. Microbiol...infections in Florida due to marine vibrio bacteria. J. Fla...lactose-fermenting vibrios in the marine environment. Appl. Environ...Oliver, J. D., J. E. Wear, M. B. Thomas, M. P. Warner...

L M Simpson; V K White; S F Zane; J D Oliver

1987-01-01T23:59:59.000Z