Sample records for megawatts approxi mately

  1. PLANS FOR FUTURE MEGAWATT FACILITIES.

    SciTech Connect (OSTI)

    ROSER,T.

    2004-10-13T23:59:59.000Z

    Proton accelerators producing beam powers of up to 1 MW are presently either operating or under construction and designs for Multi-Megawatt facilities are being developed. High beam power has applications in the production of high intensity secondary beams of neutrons, muons, kaons and neutrinos as well as in nuclear waste transmutation and accelerator-driven sub-critical reactors. Each of these applications has additional requirements on beam energy and duty cycle. This paper will review how present designs for future Multi-Megawatt facilities meet these requirements and will also review the experience with present high power facilities.

  2. Final Environmental Impact Report: North Brawley Ten Megawatt...

    Open Energy Info (EERE)

    Final Environmental Impact Report: North Brawley Ten Megawatt Geothermal Demonstration Facility Jump to: navigation, search OpenEI Reference LibraryAdd to library Report: Final...

  3. Spallation Neutron Source reaches megawatt power

    ScienceCinema (OSTI)

    Dr. William F. Brinkman

    2010-01-08T23:59:59.000Z

    The Department of Energy's Spallation Neutron Source (SNS), already the world's most powerful facility for pulsed neutron scattering science, is now the first pulsed spallation neutron source to break the one-megawatt barrier. "Advances in the materials sciences are fundamental to the development of clean and sustainable energy technologies. In reaching this milestone of operating power, the Spallation Neutron Source is providing scientists with an unmatched resource for unlocking the secrets of materials at the molecular level," said Dr. William F. Brinkman, Director of DOE's Office of Science.

  4. 332003 Mainstem Amendments to the Columbia River Basin Fish and Wildlife Program Analysis of the Adequacy, Efficiency, Economy and Reliability of

    E-Print Network [OSTI]

    16,000 average megawatts. The average regional cost is less than $10 million per year, compared,050 average megawatts on average7 and has an average annual power system cost of approxi- mately $260 million when evaluated using wholesale electricity market prices based on average water conditions

  5. Multi Megawatt Power System Analysis Report

    SciTech Connect (OSTI)

    Longhurst, Glen Reed; Harvego, Edwin Allan; Schnitzler, Bruce Gordon; Seifert, Gary Dean; Sharpe, John Phillip; Verrill, Donald Alan; Watts, Kenneth Donald; Parks, Benjamin Travis

    2001-11-01T23:59:59.000Z

    Missions to the outer planets or to near-by planets requiring short times and/or increased payload carrying capability will benefit from nuclear power. A concept study was undertaken to evaluate options for a multi-megawatt power source for nuclear electric propulsion. The nominal electric power requirement was set at 15 MWe with an assumed mission profile of 120 days at full power, 60 days in hot standby, and another 120 days of full power, repeated several times for 7 years of service. Of the numerous options considered, two that appeared to have the greatest promise were a gas-cooled reactor based on the NERVA Derivative design, operating a closed cycle Brayton power conversion system; and a molten lithium-cooled reactor based on SP-100 technology, driving a boiling potassium Rankine power conversion system. This study examined the relative merits of these two systems, seeking to optimize the specific mass. Conclusions were that either concept appeared capable of approaching the specific mass goal of 3-5 kg/kWe estimated to be needed for this class of mission, though neither could be realized without substantial development in reactor fuels technology, thermal radiator mass efficiency, and power conversion and distribution electronics and systems capable of operating at high temperatures. Though the gas-Brayton systems showed an apparent advantage in specific mass, differences in the degree of conservatism inherent in the models used suggests expectations for the two approaches may be similar. Brayton systems eliminate the need to deal with two-phase flows in the microgravity environment of space.

  6. The 5-megawatt power plant with 126 metre rotor diameter

    E-Print Network [OSTI]

    Firestone, Jeremy

    The 5-megawatt power plant with 126 metre rotor diameter #12;Design data Rated power 5,000kW Cut and most powerful wind turbines in the world. The 5M sets new standards for the economic viability similar to conventional power plants. This in turn puts high demands on the control and regulation system

  7. Megawatts vs. Negawatts: how a little can do a lot

    SciTech Connect (OSTI)

    NONE

    2008-11-15T23:59:59.000Z

    In some quarters there is increased emphasis on overall reduction of energy usage from customers. One indication of the growing significance of negawatts is apparent at PJM Interconnection, where customers are encouraged to bid negative load into the wholesale market in direct competition with megawatts. This negative load, while not large in absolute terms relative to the 164 GW size of the PJM market, is nevertheless critical in introducing an element of price elasticity into what would otherwise be a virtually inelastic demand.

  8. National Wind Technology Center Dynamic 5-Megawatt Dynamometer

    ScienceCinema (OSTI)

    Felker, Fort

    2014-06-10T23:59:59.000Z

    The National Wind Technology Center (NWTC) offers wind industry engineers a unique opportunity to conduct a wide range of tests. Its custom-designed dynamometers can test wind turbine systems from 1 kilowatt (kW) to 5 megawatts (MW). The NWTC's new dynamometer facility simulates operating field conditions to assess the reliability and performance of wind turbine prototypes and commercial machines, thereby reducing deployment time, failures, and maintenance or replacement costs. Funded by the U.S. Department of Energy with American Recovery and Reinvestment Act (ARRA) funds, the 5-MW dynamometer will provide the ability to test wind turbine drivetrains and connect those drivetrains directly to the electricity grid or through a controllable grid interface (CGI). The CGI tests the low-voltage ride-through capability of a drivetrain as well as its response to faults and other abnormal grid conditions.

  9. National Wind Technology Center Dynamic 5-Megawatt Dynamometer

    SciTech Connect (OSTI)

    Felker, Fort

    2013-11-13T23:59:59.000Z

    The National Wind Technology Center (NWTC) offers wind industry engineers a unique opportunity to conduct a wide range of tests. Its custom-designed dynamometers can test wind turbine systems from 1 kilowatt (kW) to 5 megawatts (MW). The NWTC's new dynamometer facility simulates operating field conditions to assess the reliability and performance of wind turbine prototypes and commercial machines, thereby reducing deployment time, failures, and maintenance or replacement costs. Funded by the U.S. Department of Energy with American Recovery and Reinvestment Act (ARRA) funds, the 5-MW dynamometer will provide the ability to test wind turbine drivetrains and connect those drivetrains directly to the electricity grid or through a controllable grid interface (CGI). The CGI tests the low-voltage ride-through capability of a drivetrain as well as its response to faults and other abnormal grid conditions.

  10. Application of industrial heat pumps Proven applications in 2012 for Megawatt+

    E-Print Network [OSTI]

    Oak Ridge National Laboratory

    Application of industrial heat pumps Proven applications in 2012 for Megawatt+ Heatpumps within a technical, commercial and sustainable framework Application of industrial heat pumps Proven applications Emerson Climate Technologies Core Offerings & Key Brands Residential Heating & Air Conditioning Commercial

  11. Mating games: the evolution of human mating transactions

    E-Print Network [OSTI]

    Cooper, Brenton G.

    thinkers to explain men's and women's particular, and often conflicting, mating strategies (see Buss, 1994; Buss and Schmitt, 1993; Gangestad and Simpson, 2000). In this article, we extend such work to derive predictions about human mating behavior (see, for instance, Baize and Schroeder, 1995; Buss

  12. Iced Coffee Iced Yerba Mate "Tea"

    E-Print Network [OSTI]

    Iced Coffee Iced Yerba Mate "Tea" Iced Yerba Mate Latte Iced Chai Tea Latte Original, Green Tea Canned Soda Xing Tea Bottled Water Arizona Teas Energy Drinks Red Bull, SF Red Bull & Bing Jones Sodas $0 Cafe au Lait Hot Tea Yerba Mate "Tea" Yerba Mate Latte Chai Tea Latte - Original, Green Tea, or Sugar

  13. MARS15 study of the Energy Production Demonstrator Model for Megawatt

    E-Print Network [OSTI]

    McDonald, Kirk

    MARS15 study of the Energy Production Demonstrator Model for Megawatt proton beams in the 0.5 ­ 120 Targetry Workshop HPT5, Fermilab #12;Energy Production Demonstrator MARS15 Model · Solid targets · R= 60 cm · Energy Production/Materials Testing · LAQGSM/CEM generators were usedU-nat, 3 GeV, Energy deposition, Ge

  14. Presented at Solar World Congress, Beijing, September 18 22 2007 PARABOLOIDAL DISH SOLAR CONCENTRATORS FOR MULTI-MEGAWATT

    E-Print Network [OSTI]

    ,AUSTRALIA AUSTRALIA keith.lovegrove@anu.edu.au ABSTRACT Large scale solar thermal electric power generation CONCENTRATORS FOR MULTI-MEGAWATT POWER GENERATION Keith Lovegrove A Zawadski and J Coventy Department of Engineering, Wizard Power Pty Ltd Australian National University, Barry Drive Canberra ACT 0200 Canberra ACT

  15. Economic Development Impacts of Colorado's First 1,000 Megawatts of Wind Energy

    SciTech Connect (OSTI)

    Not Available

    2009-01-01T23:59:59.000Z

    This fact sheet summarizes the findings of a report authored by Sandra Reategui and Suzanne Tegen of the National Renewable Energy Laboratory (NREL). A confluence of events ignited soaring growth in the number of Colorado?s wind power installations in recent years, from 291 megawatts (MW) of nameplate capacity in 2006 to 1,067 MW (nameplate capacity) in 2007. Analyzing the economic impact of Colorado?s first 1,000 MW of wind energy development not only provides a summary of benefits now enjoyed by the state?s population, but it also provides a sense of the economic development opportunities associated with other new wind project scenarios, including the U.S. Department of Energy?s 20% Wind Energy by 2030 scenario. The analysis can be used by interested parties in other states as an example of the potential economic impacts if they were to adopt 1,000 MW of wind power development.

  16. A Megawatt-level 28z GHz Heating System For The National Spherical Torus Experiment Upgrade

    SciTech Connect (OSTI)

    Taylor, Gary

    2014-04-01T23:59:59.000Z

    The National Spherical Torus Experiment Upgrade (NSTX-U) will operate at axial toroidal fields of < 1 T and plasma currents, Ip < 2 MA. The development of non-inductive (NI) plasmas is a major long-term research goal for NSTX-U. Time dependent numerical simulations of 28 GHz electron cyclotron (EC) heating of low density NI start-up plasmas generated by Coaxial Helicity Injection (CHI) in NSTX-U predict a significant and rapid increase of the central electron temperature (Te(0)) before the plasma becomes overdense. The increased Te(0) will significantly reduce the Ip decay rate of CHI plasmas, allowing the coupling of fast wave heating and neutral beam injection. A megawatt-level, 28 GHz electron heating system is planned for heating NI start-up plasmas in NSTX-U. In addition to EC heating of CHI start-up discharges, this system will be used for electron Bernstein wave (EBW) plasma start-up, and eventually for EBW heating and current drive during the Ip flattop.

  17. Comparative Assessment of Direct Drive High Temperature Superconducting Generators in Multi-Megawatt Class Wind Turbines

    SciTech Connect (OSTI)

    Maples, B.; Hand, M.; Musial, W.

    2010-10-01T23:59:59.000Z

    This paper summarizes the work completed under the CRADA between NREL and American Superconductor (AMSC). The CRADA combined NREL and AMSC resources to benchmark high temperature superconducting direct drive (HTSDD) generator technology by integrating the technologies into a conceptual wind turbine design, and comparing the design to geared drive and permanent magnet direct drive (PMDD) wind turbine configurations. Analysis was accomplished by upgrading the NREL Wind Turbine Design Cost and Scaling Model to represent geared and PMDD turbines at machine ratings up to 10 MW and then comparing cost and mass figures of AMSC's HTSDD wind turbine designs to theoretical geared and PMDD turbine designs at 3.1, 6, and 10 MW sizes. Based on the cost and performance data supplied by AMSC, HTSDD technology has good potential to compete successfully as an alternative technology to PMDD and geared technology turbines in the multi megawatt classes. In addition, data suggests the economics of HTSDD turbines improve with increasing size, although several uncertainties remain for all machines in the 6 to 10 MW class.

  18. A Conceptual Multi-Megawatt System Based on a Tungsten CERMET Reactor

    SciTech Connect (OSTI)

    Jonathan A. Webb; Brian Gross

    2011-02-01T23:59:59.000Z

    Abstract. A conceptual reactor system to support Multi-Megawatt Nuclear Electric Propulsion is investigated within this paper. The reactor system consists of a helium cooled Tungsten-UN fission core, surrounded by a beryllium neutron reflector and 13 B4C control drums coupled to a high temperature Brayton power conversion system. Excess heat is rejected via carbon reinforced heat pipe radiators and the gamma and neutron flux is attenuated via segmented shielding consisting of lithium hydride and tungsten layers. Turbine inlet temperatures ranging from 1300 K to 1500 K are investigated for their effects on specific powers and net electrical outputs ranging from 1 MW to 100 MW. The reactor system is estimated to have a mass, which ranges from 15 Mt at 1 MWe and a turbine inlet temperature of 1500 K to 1200 Mt at 100 MWe and a turbine temperature of 1300 K. The reactor systems specific mass ranges from 32 kg/kWe at a turbine inlet temperature of 1300 K and a power of 1 MWe to 9.5 kg/kW at a turbine temperature of 1500 K and a power of 100 MWe.

  19. This guide will help you navigate USC's online job system, JobMate. Through JobMate you can:This guide will help you navigate USC's online job system, JobMate. Through JobMate you can:This guide will help you navigate USC's online job system, JobMate. Thr

    E-Print Network [OSTI]

    Almor, Amit

    This guide will help you navigate USC's online job system, JobMate. Through JobMate you can:This guide will help you navigate USC's online job system, JobMate. Through JobMate you can:This guide will help you navigate USC's online job system, JobMate. Through JobMate you can:This guide will help you

  20. Costs influence male mate choice in a freshwater fish

    E-Print Network [OSTI]

    Keogh, Scott

    Costs influence male mate choice in a freshwater fish Bob B. M. Wong* and Michael D. Jennions that female mate choice decisions depend on the direct costs of choosing (either because of search costs or male-imposed costs). Far less is known about how direct fitness costs affect male mate choice. We

  1. Algebra lineal -MATE 1105 Nombre: Parcial 1-Tema B Codigo

    E-Print Network [OSTI]

    Cardona, Alexander

    ´Algebra lineal - MATE 1105 Nombre: 2014-20 Parcial 1- Tema B C´odigo: 23 de agosto de 2014 Tiempo = -3 - z 2 + 2z z = -3 2 0 + z -1 2 1 , donde z R. #12;´Algebra lineal - MATE 1105 Parcial 123 = (Fila 2 de A) × (Columna 3 de B) = 0 + 8 - 4 = 4. #12;´Algebra lineal - MATE 1105 Parcial 1

  2. PARABOLOIDAL DISH SOLAR CONCENTRATORS FOR MULTI-MEGAWATT POWER GENERATION Keith Lovegrove , Tui Taumoefolau, Sawat Paitoonsurikarn, Piya Siangsukone, Greg Burgess, Andreas Luzzi,

    E-Print Network [OSTI]

    PARABOLOIDAL DISH SOLAR CONCENTRATORS FOR MULTI-MEGAWATT POWER GENERATION Keith Lovegrove , Tui, Wie Joe and Geoff Major. Centre for Sustainable Energy Systems, Department of Engineering, Australian National University, Canberra ACT 0200, AUSTRALIA ph:+61 02 6125 8299 fax: +61 02 6125 0506 E-mail: keith

  3. Evaluation of the megawatt demand setter for load-follow operation of C-E's SYSTEM 80+

    SciTech Connect (OSTI)

    Choi, J.I.; Scarola, K.

    1989-01-01T23:59:59.000Z

    The Megawatt Demand Setter (MDS) is a digital supervisory control system that automatically assures that the turbine load is consistent with plant operating limits for critical parameters. The MDS is designed to avert plant trips by limiting the load demand during load transients and by reducing the turbine load if plant operating limits are approached or violated. The MDS, devised and patented by Combustion Engineering, Inc., in the 1970s for automatic load dispatching, has been installed at two plants. Those plants have since been operated in a base-load capacity, however, and have not needed to implement the load-follow capabilities of the MDS. As the percentage of electricity generated by nuclear units increases, the need to implement such load-follow capabilities will also increase. Combustion Engineering intends to incorporate improved load-follow capability in its SYSTEM 80+ nuclear steam supply system (NSSS) design. One aspect of this will be incorporation of the MDS in the design of the NUPLEX 80+ advanced control complex for system 80+. This paper presents an evaluation of two major design features of the MDS for load-follow operation based on simulation of SYSTEM 80+ plant responses.

  4. ORIGINAL PAPER A lover, not a fighter: mating causes male crickets

    E-Print Network [OSTI]

    Gwynne, Darryl T.

    studies have examined the effects of mating experience on agonistic behaviour, despite the fact that dominant males usually acquire more matings. We investigated the effect of mating experience on male weapon size) and conducted two experiments. In the first, we varied male mating experience by allowing

  5. Sexual selection and mate choice Malte Andersson1

    E-Print Network [OSTI]

    Seoane, Javier

    Biology (M092), The University of Western Australia, Crawley 6009, WA, Australia The past two decades have,11,12]. Costs of mate choice, such as the loss of energy and time, might prevent Fisherian self

  6. Representing mechanical assemblies with features and mating conditions

    E-Print Network [OSTI]

    Qamar, Sayyad Zahid

    1993-01-01T23:59:59.000Z

    A high-level product representation has been developed and implemented, using design features for part description and mating conditions between features for the relationships among parts. The underlying ideas are that features are necessary...

  7. The Quantitative Genetics of Mate Choice Evolution: Theory and Empiricism

    E-Print Network [OSTI]

    Ratterman, Nicholas 1981-

    2012-11-15T23:59:59.000Z

    emerged. From a theoretical standpoint, the nature of the genetic covariance built up by the process of mate choice has received considerable attention, though the models still make biologically unrealistic assumptions. Empirically, the difficulty...

  8. Algebra lineal -MATE 1105 Nombre: Parcial 3-Tema A Codigo

    E-Print Network [OSTI]

    Cardona, Alexander

    ´Algebra lineal - MATE 1105 Nombre: 2014-20 Parcial 3- Tema A C´odigo: 1 de noviembe de 2014 Tiempo f, g = 1 0 f(x)g(x)dx. #12;´Algebra lineal - MATE 1105 Parcial 3- Tema A - Page 2 of 2 1 de noviembe donde vS S y u S . 2. (6 points) Considere la transformaci´on lineal L : R3 R3 , definida por L x y

  9. Algebra lineal -MATE 1105 Nombre: Parcial 3-Tema B Codigo

    E-Print Network [OSTI]

    Cardona, Alexander

    ´Algebra lineal - MATE 1105 Nombre: 2014-20 Parcial 3- Tema B C´odigo: 1 de noviembe de 2014 Tiempo f, g = 1 0 f(x)g(x)dx. #12;´Algebra lineal - MATE 1105 Parcial 3- Tema B - Page 2 of 2 1 de noviembeS S y u S . 2. (6 points) Considere la transformaci´on lineal L : R3 R3 , definida por L x y z

  10. megatons to megawatts

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilAElectronic Input Options Gary L. HirschOccurrencei-rapter |

  11. Megawatt Electrolysis Scale Up

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels DataDepartment of Energy Your Density Isn't YourTransport(FactDepartment3311, 3312), OctoberMay 18-19, 2004MW Electrolysis Scale Up E

  12. Global Binary Optimization on Graphs for Classification of High-Dimensional Data

    E-Print Network [OSTI]

    Merkurjev, E; Bae, E; Bertozzi, AL; Tai, XC

    2015-01-01T23:59:59.000Z

    J.H. : Convergence and energy landscape for Cheeger cutmax-flow algorithms for energy minimization in vision. IEEER. : Fast approxi- mate energy minimization via graph cuts.

  13. GridMate: A Portable Simulation Environment for Large-Scale Adaptive Scientific Applications

    E-Print Network [OSTI]

    Li, Xiaolin "Andy"

    GridMate: A Portable Simulation Environment for Large-Scale Adaptive Scientific Applications: parashar@caip.rutgers.edu Abstract--In this paper, we present a portable sim- ulation environment GridMate for large-scale adaptive scientific applications in multi-site Grid environments. GridMate is a discrete

  14. Women's sexual strategies: the hidden dimension of extra-pair mating

    E-Print Network [OSTI]

    Pillow, Jonathan

    of the current studies and the consequences of women's short- term mating strategies for the broader matrix focused on the adaptive bene®ts of short-term mating for men. Men cannot pursue a strategy of short in short-term mating some of the time and probably have done so recurrently over human evolutionary history

  15. Chinese mate preferences: Cultural evolution and continuity across a quarter of a Lei Chang a

    E-Print Network [OSTI]

    Pillow, Jonathan

    a , Yan Wang b , Todd K. Shackelford c , David M. Buss d, a Department of Educational Psychology the group (Buss, 2003). Third, mate preferences of one sex influence which mate attraction and mate of the individual a person is trying to attract or retain (Buss & Shackelford, 1997; Schmitt & Buss, 1996). Fourth

  16. Ondansetron can enhance cisplatin-induced nephrotoxicity via inhibition of multiple toxin and extrusion proteins (MATEs)

    SciTech Connect (OSTI)

    Li, Qing [Department of Pharmaceutical Sciences, School of Pharmacy, University of Maryland at Baltimore, MD (United States); Institute of Clinical Pharmacology, Central South University, Hunan 410078 (China); Guo, Dong [Institute of Clinical Pharmacology, Central South University, Hunan 410078 (China); Dong, Zhongqi [Department of Pharmaceutical Sciences, School of Pharmacy, University of Maryland at Baltimore, MD (United States); Zhang, Wei [Department of Pharmaceutical Sciences, School of Pharmacy, University of Maryland at Baltimore, MD (United States); Institute of Clinical Pharmacology, Central South University, Hunan 410078 (China); Zhang, Lei; Huang, Shiew-Mei [Office of Clinical Pharmacology, Office of Translational Sciences, Center for Drug Evaluation and Research, U.S. Food and Drug Administration, Silver Spring, MD (United States); Polli, James E. [Department of Pharmaceutical Sciences, School of Pharmacy, University of Maryland at Baltimore, MD (United States); Shu, Yan, E-mail: yshu@rx.umaryland.edu [Department of Pharmaceutical Sciences, School of Pharmacy, University of Maryland at Baltimore, MD (United States)

    2013-11-15T23:59:59.000Z

    The nephrotoxicity limits the clinical application of cisplatin. Human organic cation transporter 2 (OCT2) and multidrug and toxin extrusion proteins (MATEs) work in concert in the elimination of cationic drugs such as cisplatin from the kidney. We hypothesized that co-administration of ondansetron would have an effect on cisplatin nephrotoxicity by altering the function of cisplatin transporters. The inhibitory potencies of ondansetron on metformin accumulation mediated by OCT2 and MATEs were determined in the stable HEK-293 cells expressing these transporters. The effects of ondansetron on drug disposition in vivo were examined by conducting the pharmacokinetics of metformin, a classical substrate for OCTs and MATEs, in wild-type and Mate1?/? mice. The nephrotoxicity was assessed in the wild-type and Mate1?/? mice received cisplatin with and without ondansetron. Both MATEs, including human MATE1, human MATE2-K, and mouse Mate1, and OCT2 (human and mouse) were subject to ondansetron inhibition, with much greater potencies by ondansetron on MATEs. Ondansetron significantly increased tissue accumulation and pharmacokinetic exposure of metformin in wild-type but not in Mate1?/? mice. Moreover, ondansetron treatment significantly enhanced renal accumulation of cisplatin and cisplatin-induced nephrotoxicity which were indicated by increased levels of biochemical and molecular biomarkers and more severe pathohistological changes in mice. Similar increases in nephrotoxicity were caused by genetic deficiency of MATE function in mice. Therefore, the potent inhibition of MATEs by ondansetron enhances the nephrotoxicity associated with cisplatin treatment in mice. Potential nephrotoxic effects of combining the chemotherapeutic cisplatin and the antiemetic 5-hydroxytryptamine-3 (5-HT{sub 3}) receptor antagonists, such as ondansetron, should be investigated in patients. - Highlights: • Nephrotoxicity significantly limits clinical use of the chemotherapeutic cisplatin. • The antiemetic ondansetron is frequently co-administrated with cisplatin. • Ondansetron was here demonstrated as a potent inhibitor of MATE transporters. • Ondansetron enhanced cisplatin nephrotoxicity likely via Mate1 inhibition in mice. • Ondansetron may increase patient risk of nephrotoxicity in cisplatin chemotherapy.

  17. Mechanical seal having a single-piece, perforated mating ring

    DOE Patents [OSTI]

    Khonsari, Michael M. (Baton Rouge, LA); Somanchi, Anoop K. (Fremont, CA)

    2007-08-07T23:59:59.000Z

    A mechanical seal (e.g., single mechanical seals, double mechanical seals, tandem mechanical seals, bellows, pusher mechanical seals, and all types of rotating and reciprocating machines) with reduced contact surface temperature, reduced contact surface wear, or increased life span. The mechanical seal comprises a rotating ring and a single-piece, perforated mating ring, which improves heat transfer by controllably channeling coolant flow through the single-piece mating ring such that the coolant is in substantially uniform thermal contact with a substantial portion of the interior surface area of the seal face, while maintaining the structural integrity of the mechanical seal and minimizing the potential for coolant flow interruptions to the seal face caused by debris or contaminants (e.g., small solids and trash) in the coolant.

  18. attraction influences mate-choice: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Influences Social Influences on the Mate Choices of Male and Female Japanese Quail Bennett. The results of those studies are summarized here. Females prefer to affiliate with...

  19. Suppression of spurious mode oscillation in mega-watt 77-GHz gyrotron as a high quality probe beam source for the collective Thomson scattering in LHD

    SciTech Connect (OSTI)

    Ogasawara, S. [Department of Energy Engineering and Science, Nagoya University, Nagoya 464-8463 (Japan); Kubo, S. [Department of Energy Engineering and Science, Nagoya University, Nagoya 464-8463 (Japan); National Institute for Fusion Science, 322-6 Oroshi-cho, Toki-shi 509-5292 (Japan); Nishiura, M.; Tanaka, K.; Shimozuma, T.; Yoshimura, Y.; Igami, H.; Takahashi, H.; Ito, S.; Takita, Y.; Kobayashi, S.; Mizuno, Y.; Okada, K. [National Institute for Fusion Science, 322-6 Oroshi-cho, Toki-shi 509-5292 (Japan); Tatematsu, Y.; Saito, T. [Research Center for Development of Far-Infrared Region, University of Fukui, Fukui 910-8507 (Japan); Minami, R.; Kariya, T.; Imai, T. [Plasma Research Center, University of Tsukuba, Tsukuba 305-8577 (Japan)

    2012-10-15T23:59:59.000Z

    Collective Thomson scattering (CTS) diagnostic requires a strong probing beam to diagnose a bulk and fast ion distribution function in fusion plasmas. A mega-watt gyrotron for electron cyclotron resonance heating is used as a probing beam in the large helical device. Spurious mode oscillations are often observed during the turning on/off phase of the modulation. The frequency spectra of the 77-GHz gyrotron output power have been measured, and then one of the spurious modes, which interferes with the CTS receiver system, is identified as the TE{sub 17,6} mode at the frequency of 74.7 GHz. The mode competition calculation indicates that the increase of the magnetic field strength at the gyrotron resonator can avoid such a spurious mode and excite only the main TE{sub 18,6} mode. The spurious radiation at the 74.7 GHz is experimentally demonstrated to be suppressed in the stronger magnetic field than that optimized for the high-power operation.

  20. Lessons from Iowa : development of a 270 megawatt compressed air energy storage project in midwest Independent System Operator : a study for the DOE Energy Storage Systems Program.

    SciTech Connect (OSTI)

    Holst, Kent (Iowa Stored Energy Plant Agency, Traer, IA); Huff, Georgianne; Schulte, Robert H. (Schulte Associates LLC, Northfield, MN); Critelli, Nicholas (Critelli Law Office PC, Des Moines, IA)

    2012-01-01T23:59:59.000Z

    The Iowa Stored Energy Park was an innovative, 270 Megawatt, $400 million compressed air energy storage (CAES) project proposed for in-service near Des Moines, Iowa, in 2015. After eight years in development the project was terminated because of site geological limitations. However, much was learned in the development process regarding what it takes to do a utility-scale, bulk energy storage facility and coordinate it with regional renewable wind energy resources in an Independent System Operator (ISO) marketplace. Lessons include the costs and long-term economics of a CAES facility compared to conventional natural gas-fired generation alternatives; market, legislative, and contract issues related to enabling energy storage in an ISO market; the importance of due diligence in project management; and community relations and marketing for siting of large energy projects. Although many of the lessons relate to CAES applications in particular, most of the lessons learned are independent of site location or geology, or even the particular energy storage technology involved.

  1. Ape Society: Trading Favours An alpha-male chimpanzee allots mating opportunities with receptive

    E-Print Network [OSTI]

    [1] have shown that chimpanzees trade mating opportunities for support in power contests. OddlyApe Society: Trading Favours An alpha-male chimpanzee allots mating opportunities with receptive rare among animals, exchange of one currency for another -- in this case sex for power -- may

  2. Mechanisms of Mating-Behavior Deterioration in Early Aging Male C. elegans 

    E-Print Network [OSTI]

    Guo, Xiaoyan

    2014-08-06T23:59:59.000Z

    . This is consistent with the observation that old males exhibit reduced control over their ability to mate. Caloric restriction is an efficient non-genetic intervention to increase lifespan. I demonstrated here that it also improves mating behavior in 3-day-old males...

  3. BRIEF REPORT Mate preferences of married persons in the newlywed year and

    E-Print Network [OSTI]

    Pillow, Jonathan

    David M. Buss The University of Texas at Austin, TX, USA Mate preferences are cognitions about for ``mutual attractionĐlove,'' ``emotional stability & maturity'', and ``pleasing disposition'' (see Buss women more than men value good financial prospects in a long-term mate (Buss, 1989; Buss, Shackelford

  4. Saving Megawatts with Voltage Optimization

    E-Print Network [OSTI]

    Wilson, T.; Bell, D.

    2010-01-01T23:59:59.000Z

    that had been installed at several electric utility distribution substations in the U.S. and Canada. These systems, being operated in Conservation Voltage Regulation mode, have provided significant energy conservation where they have been installed...

  5. Costly signal behaviour and social effects of literature on mate selection 

    E-Print Network [OSTI]

    Park, Jennifer

    2006-01-01T23:59:59.000Z

    In this study we will investigate female mate preferences in relation to risk taking behaviours. A review of the foundational evolutionary psychology theories involved shall be undertaken, this will look at the key study ...

  6. Breeding for hygienic behaviour in honeybees (Apis mellifera) using free-mated nucleus colonies

    E-Print Network [OSTI]

    Breeding for hygienic behaviour in honeybees (Apis mellifera) using free-mated nucleus colonies 2011 ­ Accepted 14 October 2011 Abstract ­ Gains in hygienic behaviour based on maternal selection generation, levels of hygienic behaviour among progeny remained relatively unchanged. Estimated breeding

  7. A Sexual selection approach to women's pupil size preferences in a potential mate 

    E-Print Network [OSTI]

    Smallwood, Eleanor

    2006-01-01T23:59:59.000Z

    Dilated pupils represent a display of sexual interest. The attraction value of this display in a potential mate varies between women. While some females find a clear demonstration of sexual interest attractive, others ...

  8. Effects of age, genotype and social rank on mating proficiency of beef bulls

    E-Print Network [OSTI]

    Smith, Ronald Gregg

    1994-01-01T23:59:59.000Z

    EFFECTS OF AGE, GENOTYPE AND SOCIAL RANK ON MATING PROFICIENCY OF BEEF BULLS A Thesis by RONALD GREGG SMITH Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements for the degree... of MASTER OF SCIENCE May 1994 Major Subject: Animal Science EFFECTS OF AGE, GENOTYPE AND SOCIAL ~ ON MATING PROFICIENCY OF BEEF BULLS A Thesis by RONALD GREGG SMITH Submitted to Texas A&M University in partial fulfillment of the requirements...

  9. Micro devices using shape memory polymer patches for mated connections

    DOE Patents [OSTI]

    Lee, Abraham P. (Walnut Creek, CA); Fitch, Joseph P. (Livermore, CA)

    2000-01-01T23:59:59.000Z

    A method and micro device for repositioning or retrieving miniature devices located in inaccessible areas, such as medical devices (e.g., stents, embolic coils, etc.) located in a blood vessel. The micro repositioning or retrieving device and method uses shape memory polymer (SMP) patches formed into mating geometries (e.g., a hoop and a hook) for re-attachment of the deposited medical device to a catheter or guidewire. For example, SMP or other material hoops are formed on the medical device to be deposited in a blood vessel, and SMP hooks are formed on the micro device attached to a guidewire, whereby the hooks on the micro device attach to the hoops on the medical device, or vice versa, enabling deposition, movement, re-deposit, or retrieval of the medical device. By changing the temperature of the SMP hooks, the hooks can be attached to or released from the hoops located on the medical device. An exemplary method for forming the hooks and hoops involves depositing a sacrificial thin film on a substrate, patterning and processing the thin film to form openings therethrough, depositing or bonding SMP materials in the openings so as to be attached to the substrate, and removing the sacrificial thin film.

  10. The Mate Retention Inventory-Short Form (MRI-SF) David M. Buss a,*, Todd K. Shackelford b

    E-Print Network [OSTI]

    Pillow, Jonathan

    The Mate Retention Inventory-Short Form (MRI-SF) David M. Buss a,*, Todd K. Shackelford b , William . E-mail address: dbuss@psy.utexas.edu (D.M. Buss). www.elsevier.com/locate/paid Personality distinct domains--effort devoted to attracting a mate (Buss, 1988a; Buss & Schmitt, 1996) and effort

  11. Publications of the Astronomical Society of the Pacific, 117:11441171, 2005 October 2005. The Astronomical Society of the Pacific. All rights reserved. Printed in U.S.A.

    E-Print Network [OSTI]

    on a hinged yoke just behind the high-resolution mir- ror assembly (HRMA; van Speybroeck et al. 1997 the HRMA, approxi- mately 8.6 m from the focal plane, shown schematically in Figure 1. The lower portion

  12. ENVIRONMENTAL ASSESSMENT FOR OTEC PILOT PLANTS

    E-Print Network [OSTI]

    Wilde, P.

    2011-01-01T23:59:59.000Z

    Environmental Impact Statement (EIS) at approxi- mately theOperational o INITIATE EA/EIS FOR SITE/REGION Based on theof the appropriate ErA/EIS. o DESIGN LONG-TERM MONITORING/

  13. Spatial mating networks in insect-pollinated plants Miguel A. Fortuna,1

    E-Print Network [OSTI]

    Fortuna, Miguel A.

    LETTER Spatial mating networks in insect-pollinated plants Miguel A. Fortuna,1 * Cristina Garci´a,1, Sa~o Paulo, Brazil *Correspondence: E-mail: fortuna@ebd.csic.es Abstract Gene flow in plant networks (Urban & Keitt 2001; Proulx et al. 2005; Fortuna et al. 2006; May 2006; Bascompte 2007

  14. Character displacement and the evolution of mate choice: an artificial neural network approach

    E-Print Network [OSTI]

    Ryan, Michael J.

    Character displacement and the evolution of mate choice: an artificial neural network approach preferences for aspects of conspecific male signals. We used artificial neural network models to simulate varied in their preferences for aspects of conspecific male signals. When we tested networks

  15. Commensal bacteria play a role in mating preference of Drosophila melanogaster

    E-Print Network [OSTI]

    Dean, Matthew D.

    starch flies and that "maltose flies" preferred to mate with other maltose flies (i.e., positive were transferred to starch medium (Fig. 1A; Materials and Methods). After a fixed number of generations population. Individuals of one population had the tips of their wings clipped to allow identification

  16. Sperm transport into the oviducts of heifers mated early in oestrus

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    Sperm transport into the oviducts of heifers mated early in oestrus I. WILMUT, R. H. F. HUNTER ARC contrast with reports of rapid transport of spermatozoa to the oviduct in a period of minutes. Introduction. The development of techniques for the dilution, deep-freezing and artificial insemination of bull semen has made

  17. Seismic signals are crucial for male mating success in a visual specialist jumping spider (Araneae: Salticidae)

    E-Print Network [OSTI]

    Hoy, Ronald R.

    Seismic signals are crucial for male mating success in a visual specialist jumping spider (Araneae of multicomponent seismic courtship signals in addition to and produced in concert with its multiple visual ornaments and movement displays. Here, we demonstrate the importance of these seismic signals

  18. Low Wind Speed Turbine Project Phase II: The Application of Medium-Voltage Electrical Apparatus to the Class of Variable Speed Multi-Megawatt Low Wind Speed Turbines; 15 June 2004--30 April 2005

    SciTech Connect (OSTI)

    Erdman, W.; Behnke, M.

    2005-11-01T23:59:59.000Z

    Kilowatt ratings of modern wind turbines have progressed rapidly from 50 kW to 1,800 kW over the past 25 years, with 3.0- to 7.5-MW turbines expected in the next 5 years. The premise of this study is simple: The rapid growth of wind turbine power ratings and the corresponding growth in turbine electrical generation systems and associated controls are quickly making low-voltage (LV) electrical design approaches cost-ineffective. This report provides design detail and compares the cost of energy (COE) between commercial LV-class wind power machines and emerging medium-voltage (MV)-class multi-megawatt wind technology. The key finding is that a 2.5% reduction in the COE can be achieved by moving from LV to MV systems. This is a conservative estimate, with a 3% to 3.5% reduction believed to be attainable once purchase orders to support a 250-turbine/year production level are placed. This evaluation considers capital costs as well as installation, maintenance, and training requirements for wind turbine maintenance personnel. Subsystems investigated include the generator, pendant cables, variable-speed converter, and padmount transformer with switchgear. Both current-source and voltage-source converter/inverter MV topologies are compared against their low-voltage, voltage-source counterparts at the 3.0-, 5.0-, and 7.5-MW levels.

  19. Estimation of genetic and environmental parameters of six broiler traits in two breeds of chickens and their reciprocal crosses by a series of diallel mating

    E-Print Network [OSTI]

    Kan, Jimmy Hung-Kei

    1958-01-01T23:59:59.000Z

    by the Regression M e t h o d..... 66 Diallel Mating ............................................... . 67 Test of Significance of Interaction Mean Square ........ ES Estimation of Non-Additive Gene Effects ................. 7^ (a) The First Method... .................... 3^ 6. The portions of genetic variance contained in the different components ....................................... 37 7* A comparison of reproductive efficiency of the four mating types ................................................ ^0 8...

  20. Chasing megawatts in combined cycle plants

    SciTech Connect (OSTI)

    Koch, J. [Power Plant Performance Specialist, Lansdowne, PA (United States); DeGeeter, S. [Ocean State Power, Harrisville, RI (United States); Haynes, C.J. [New England Power Co., Somerset, MA (United States)

    1996-05-01T23:59:59.000Z

    Combined cycle owners do not have to accept that combined cycle performance must degrade over time. Through low cost testing using existing instrumentation, a method is presented to identify causes for lost generation. A 500 MW combined cycle plant, with two STAG 207EA units, had lost 17 MW since initial operation, and found that: Gas side fouling on A four HRSG`s accounted for 8 MW of the total loss LP steam turbine efficiency was below design on one unit, contributing 3 MW Condenser air removal was poor on both units, a loss of an additional 2 MW Compressor and turbine section efficiency losses on 2 of 4 GT`s cost over 4 MW The test also revealed that the other two GT`s, both cooling towers, and one of the two steam turbines, were performing at or near design. Thus far 3 MW has been recovered, with planning underway for recovery of another 3 MW. The remaining 11 MW, though not immediately recoverable, will be the focus of planning for the next major outage. This simple method can be used at any combined cycle using existing instrumentation, with minimal intrusion on daily operations. The use of redundant measurements and uncertainty analysis assures valid and useful results.

  1. Megawatt targets for Neutrino Super-Beams

    E-Print Network [OSTI]

    McDonald, Kirk

    Station for 4 MW 27m Iron shield Iron structure /Helium vessel Machine room Service pit Storage transformers) must be underground, close to the beamline ­ The pump house may also be underground, depending ) to interact most protons Dense enough that 2 int fits in focusing system depth-of-field Radius: Rtarget = 2

  2. Energy Production Demonstrator for Megawatt Proton Beams

    E-Print Network [OSTI]

    Pronskikh, Vitaly S; Novitski, Igor; Tyutyunnikov, Sergey I

    2014-01-01T23:59:59.000Z

    A preliminary study of the Energy Production Demonstrator (EPD) concept - a solid heavy metal target irradiated by GeV-range intense proton beams and producing more energy than consuming - is carried out. Neutron production, fission, energy deposition, energy gain, testing volume and helium production are simulated with the MARS15 code for tungsten, thorium, and natural uranium targets in the proton energy range 0.5 to 120 GeV. This study shows that the proton energy range of 2 to 4 GeV is optimal for both a natU EPD and the tungsten-based testing station that would be the most suitable for proton accelerator facilities. Conservative estimates, not including breeding and fission of plutonium, based on the simulations suggest that the proton beam current of 1 mA will be sufficient to produce 1 GW of thermal output power with the natU EPD while supplying < 8% of that power to operate the accelerator. The thermal analysis shows that the concept considered has a problem due to a possible core meltdown; however...

  3. Energy Production Demonstrator for Megawatt Proton Beams

    E-Print Network [OSTI]

    Vitaly S. Pronskikh; Nikolai Mokhov; Igor Novitski; Sergey I. Tyutyunnikov

    2014-07-16T23:59:59.000Z

    A preliminary study of the Energy Production Demonstrator (EPD) concept - a solid heavy metal target irradiated by GeV-range intense proton beams and producing more energy than consuming - is carried out. Neutron production, fission, energy deposition, energy gain, testing volume and helium production are simulated with the MARS15 code for tungsten, thorium, and natural uranium targets in the proton energy range 0.5 to 120 GeV. This study shows that the proton energy range of 2 to 4 GeV is optimal for both a natU EPD and the tungsten-based testing station that would be the most suitable for proton accelerator facilities. Conservative estimates, not including breeding and fission of plutonium, based on the simulations suggest that the proton beam current of 1 mA will be sufficient to produce 1 GW of thermal output power with the natU EPD while supplying < 8% of that power to operate the accelerator. The thermal analysis shows that the concept considered has a problem due to a possible core meltdown; however, a number of approaches (a beam rastering, in first place) are suggested to mitigate the issue. The efficiency of the considered EPD as a Materials Test Station (MTS) is also evaluated in this study.

  4. Multi-Megawatt Power System Trade Study

    SciTech Connect (OSTI)

    Longhurst, Glen Reed; Schnitzler, Bruce Gordon; Parks, Benjamin Travis

    2001-11-01T23:59:59.000Z

    As part of a larger task, the Idaho National Engineering and Environmental Laboratory (INEEL) was tasked to perform a trade study comparing liquid-metal cooled reactors having Rankine power conversion systems with gas-cooled reactors having Brayton power conversion systems. This report summarizes the approach, the methodology, and the results of that trade study. Findings suggest that either approach has the possibility to approach the target specific mass of 3-5 kg/kWe for the power system, though it appears either will require improvements to achieve that. Higher reactor temperatures have the most potential for reducing the specific mass of gas-cooled reactors but do not necessarily have a similar effect for liquid-cooled Rankine systems. Fuels development will be the key to higher reactor operating temperatures. Higher temperature turbines will be important for Brayton systems. Both replacing lithium coolant in the primary circuit with gallium and replacing potassium with sodium in the power loop for liquid systems increase system specific mass. Changing the feed pump turbine to an electric motor in Rankine systems has little effect. Key technologies in reducing specific mass are high reactor and radiator operating temperatures, low radiator areal density, and low turbine/generator system masses. Turbine/generator mass tends to dominate overall power system mass for Rankine systems. Radiator mass was dominant for Brayton systems.

  5. Funding Opportunity: Next Generation Electric Machines: Megawatt...

    Broader source: Energy.gov (indexed) [DOE]

    MV integrated drive systems that leverage the benefits of state of the art power electronics (i.e., wide band gap devices) with energy efficient, high speed, direct drive,...

  6. Adaptive control system for pulsed megawatt klystrons

    DOE Patents [OSTI]

    Bolie, Victor W. (Albuquerque, NM)

    1992-01-01T23:59:59.000Z

    The invention provides an arrangement for reducing waveform errors such as errors in phase or amplitude in output pulses produced by pulsed power output devices such as klystrons by generating an error voltage representing the extent of error still present in the trailing edge of the previous output pulse, using the error voltage to provide a stored control voltage, and applying the stored control voltage to the pulsed power output device to limit the extent of error in the leading edge of the next output pulse.

  7. megatons to megawatts | National Nuclear Security Administration

    National Nuclear Security Administration (NNSA)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn AprilA Approved:AdministrationAnalysisDarby Dietrich57/%2A en4/%2A en Officemegatons

  8. MegaWatt Solar | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov YouKizildere I Geothermal Pwer Plant JumpMarysville, Ohio: Energy8429°,Meeteetse, Wyoming: Energy ResourcesMegaWatt Solar

  9. Megawatt Energy Systems | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov YouKizildere I Geothermal Pwer Plant JumpMarysville, Ohio: Energy8429°,Meeteetse, Wyoming: Energy

  10. Evaluation of pre-and post-zygotic mating barriers, hybrid fitness and phylogenetic relationship between Cyprinodon variegatus

    E-Print Network [OSTI]

    Grosell, Martin

    Evaluation of pre- and post-zygotic mating barriers, hybrid fitness and phylogenetic relationship: hybridization; osmoregulation; post-zygotic isolation; pre-zygotic isolation. Abstract The euryhaline fish and their hybrids, and developing a molecular phylogeny of Cvv and Cvh populations in Florida using mtDNA sequence

  11. Protection Over Asymmetric Channels, S-MATE: Secure Multipath Adaptive Traffic Engineering

    E-Print Network [OSTI]

    Aly, Salah A; Poor, H Vincent; Walid, Anwar I

    2010-01-01T23:59:59.000Z

    Several approaches have been proposed to the problem of provisioning traffic engineering between core network nodes in Internet Service Provider (ISP) networks. Such approaches aim to minimize network delay, increase capacity, and enhance security services between two core (relay) network nodes, an ingress node and an egress node. MATE (Multipath Adaptive Traffic Engineering) has been proposed for multipath adaptive traffic engineering between an ingress node (source) and an egress node (destination) to distribute the network flow among multiple disjoint paths. Its novel idea is to avoid network congestion and attacks that might exist in edge and node disjoint paths between two core network nodes. This paper proposes protection schemes over asymmetric channels. Precisely, the paper aims to develop an adaptive, robust, and reliable traffic engineering scheme to improve performance and reliability of communication networks. This scheme will also provision Quality of Server (QoS) and protection of traffic engine...

  12. NEUROENDOCRINOLOGY The Rhythmic Secretion of Mating-Induced Prolactin Secretion Is Controlled by Prolactin Acting Centrally

    E-Print Network [OSTI]

    Cleyde V. Helena; De’nise T. Mckee; Richard Bertram; Ameae M. Walker; Marc E. Freeman

    Artificial copulomimetic cervical stimulation (CS) induces an immediate release of oxytocin (OT) and prolactin (PRL) followed by a daily PRL rhythm characterized by nocturnal and diurnal surges. Although we have shown that the initial release of PRL is induced by the immediate release of OT, we tested whether the PRL that is released in response to CS is responsible for the initiation and maintenance of the subsequent PRL surges. Thus, we injected OVX rats centrally or peripherally with ovine PRL (oPRL) at 2200 h. Central oPRL induced PRL surges in OVX rats that were similar in size and timing to those of CS rats, whereas peripheral oPRL induced surges that were of smaller amplitude and delayed. We then infusedaPRLantagonist(S179D,0.1ng/h)centrallyintoOVXandOVX-CSratsandmeasuredtherelease of endogenous PRL and the activity of neuroendocrine dopaminergic neurons. Central infusion of S179D did not influence basal PRL secretion in OVX rats but prevented the expression of the CS-induced PRL surges and the accompanying noontime increase of CS-induced dopaminergic activity when continuedfor3d.However,centralinfusionofS179DonlyonthedayofCSdidnotpreventthedailyrhythm of PRL surges. These results demonstrate that PRL acts centrally to induce the PRL rhythm and that PRL in the brain is essential for the maintenance but not for the initiation of the CS-induced rhythmic PRL surges. (Endocrinology 150: 3245–3251, 2009) In rodents, the mating stimulus or stimulation of the uterine

  13. Carbon nanofiber supercapacitors with large areal capacitances James R. McDonough,1

    E-Print Network [OSTI]

    Cui, Yi

    growth rather than CNT growth see supplementary information Fig. S1 .10 Carbon aerogels CAs have also with nanosized MnO2 loaded inside aerogel pores.7 Preparation of our CNF-based SC electrodes consists of two approxi- mately 1 1 0.2 cm3 is conformally coated with a 1 nm alumina layer by atomic layer deposition ALD

  14. 54 IEEE GEOSCIENCE AND REMOTE SENSING LETTERS, VOL. 3, NO. 1, JANUARY 2006 Microwave Observations of Daily Antarctic Sea-Ice

    E-Print Network [OSTI]

    Long, David G.

    of the sea-ice pack. To estimate the probability distribution of daily Antarctic sea-ice extent change, two is similar and is approxi- mately double-exponential. Daily ice-pack statistics are presented. Index Terms of Daily Antarctic Sea-Ice Edge Expansion and Contraction Rates Jeffrey R. Allen and David G. Long, Senior

  15. How people use thermostats in homes: A review Therese Peffer a,*, Marco Pritoni b

    E-Print Network [OSTI]

    Aragon, Cecilia R.

    ) for cooling [2]. Most (65%) of the energy supplied by fuels (primarily natural gas, also fuel oil and propane environments. Ó 2011 Elsevier Ltd. All rights reserved. 1. Introduction Heating and cooling homes consumes/or cooling system in their home; in 2005, approxi- mately 97% of households in the U.S. had a heating system

  16. Sustainable use of California biomass resources can help meet state and national bioenergy targets

    E-Print Network [OSTI]

    Jenkins, Bryan M; Williams, Robert B; Gildart, Martha C; Kaffka, Stephen R.; Hartsough, Bruce; Dempster, Peter G

    2009-01-01T23:59:59.000Z

    cost adds approxi- mately $0.01 per kilowatt-hour (kWh) torealize costs ranging from $0.05 to $0.07 per kWh. Where on-costs from biomass currently range from $0.06 to $0.10 per kWh

  17. fur Mathematik in den Naturwissenschaften

    E-Print Network [OSTI]

    In the recent years, the idea of tensor approximation of operators and functions has lead to powerful numerical-known Gaussian transform of the potentials, and then approxi- mate the resulting univariate integral in R- quadratures. The numerical experiments show that this approach gives tensor-ranks close to the optimal in 3D

  18. Hunter Academic Calendar SEEK Announcements

    E-Print Network [OSTI]

    Qiu, Weigang

    the National Insti- tutes of Health (NIH) and the De- partment of Energy (DOE). Six experiments were performed with 2 to 12 helium ions. Cells were plated at densities of approxi- mately 200 and 2000 per dish to try (AL) cells by specific numbers of alpha particles 2.0 89 R.H. Mauer, et al. Johns Hop- kins Univ

  19. Robot Behavior E. S. Fortune and N. J. Cowan, Johns Hopkins University, Baltimore, MD, USA

    E-Print Network [OSTI]

    manufactured worldwide are industrial robot manipulators. These are typically open kinematic chains ­ that is mounted to the final link. It is true that many industrial robot arms are at least approxi- mately, control, and performance is unnatural: industrial robots are rigid, extremely precise, and some designs

  20. future science group 271ISSN 1758-300410.4155/CMT.10.30 European Union, 2010 Role of tropical deforestation in global

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    deforestation in global carbon emissions Tropical deforestation is estimated to total approxi- mately 13 million, the global rate of gross deforestation, mainly the conversion of tropical forests to agricultural land. Tropical deforestation, resulting from different causes [2­4], leads to emissions of CO2 and, if the bio

  1. Post Doctoral Fellow M. R. Nalim

    E-Print Network [OSTI]

    Pekkan, Kerem

    combustion models are applied to simulate approxi- mately constant volume combustion of propane and resulting. One-dimensional simulations modeled most loss mecha- nisms, heat transfer, and combustion Combustion Wave Rotor Configurations A wave rotor is proposed for use as a constant volume combustor. A novel

  2. A State-Of-The-Art Review of Low Energy Separation Processes

    E-Print Network [OSTI]

    Humphrey, J. L.; Fair, J. R.

    1983-01-01T23:59:59.000Z

    . Conclu sions are drawn on the merits of each type of separation process. INTRODUCTION The total energy consumed by the chemical and petroleum refining industries in converting feedstocks to p~oducts is equivalent to approxi mately 2.9 X 10 h bpd...

  3. Summary IsotoperatioanalysesofatmosphericCO2 atnatu-ral abundance have significant potential for contributing to our

    E-Print Network [OSTI]

    Ehleringer, Jim

    --300 µl is accomplished by linking a commercially available, trace gas condenser and gas chromatograph advances in isotope ratio mass spec- trometry allow for rapid, on-line analysis of small volumes of CO2 dioxide in atmospheric air. Routine analysis of carbon dioxide in air volumes of approxi- mately 50

  4. Reformulation of DFT+U as a pseudo-hybrid Hubbard density functional Luis A. Agapito,1, 2

    E-Print Network [OSTI]

    Curtarolo, Stefano

    the true energy of the many-body system of the electrons and the approxi- mate energy that we can computeReformulation of DFT+U as a pseudo-hybrid Hubbard density functional Luis A. Agapito,1, 2 Stefano have seen two competing approaches unfold to address these problems: DFT+U and hybrid exact exchange

  5. Transmission of Megawatt Relativistic Electron Beams through Millimeter Apertures

    E-Print Network [OSTI]

    Alarcon, R.

    High-power, relativistic electron beams from energy-recovering linacs have great potential to realize new experimental paradigms for pioneering innovation in fundamental and applied research. A major design consideration ...

  6. Modal Dynamics and Stability of Large Multi-megawatt Deepwater...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    and O&M, while maintaining or increasing energy production. A vertical-axis wind turbine (VAWT) rotor configuration offers a potential transformative technology solution...

  7. 10-Megawatt Supercritical Carbon Dioxide Turbine- FY13 Q2

    Broader source: Energy.gov [DOE]

    This document summarizes the progress of this National Renewable Energy Laboratory project, funded by SunShot, for the second quarter of fiscal year 2013.

  8. Transmission of Megawatt Relativistic Electron Beams Through Millimeter Apertures

    SciTech Connect (OSTI)

    Arizona State University; Arizona State University; JLAB; MIT; College of William and Mary, JLAB; MIT; JLAB; JLAB; MIT; MIT; Hampton University; MIT; JLAB; MIT; JLAB; MIT; MIT; JLAB; MIT; JLAB; JLAB

    2013-10-01T23:59:59.000Z

    High power, relativistic electron beams from energy recovery linacs have great potential to realize new experimental paradigms for pioneering research in fundamental and applied research. A major design consideration for these new generation of experimental capabilities is the understanding of the halo associated with these bright, intense beams. In this Letter, we report on measurements performed using the 100 MeV, 430 kWatt CW electron beam from the energy recovery linac at the Jeff#11;erson Laboratory's Free Electron Laser facility as it traversed a set of small apertures in a 127 mm long aluminum block. Thermal measurements of the block together with neutron measurements near the beam-target interaction point yielded a consistent understanding of the beam losses. These were determined to be 3 ppm through a 2 mm diameter aperture and were maintained during a 7 hour continuous run.

  9. Dynamic analysis of a 5 megawatt offshore floating wind turbine

    E-Print Network [OSTI]

    Harriger, Evan Michael

    2011-01-01T23:59:59.000Z

    Why offshore wind energy? Offshore wind turbines have theturbine will also uncover potential problems that exist with offshore wind energy.

  10. Sandia National Laboratories: deep-water multiple-megawatt VAWT

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    vertical-axis wind turbines (VAWTs). This analysis uses a 5 MW VAWT topside design envelope created by Sandia to compare floating platform options for each turbine in the...

  11. Megawatt targets (and horn) for Neutrino Super-Beams

    E-Print Network [OSTI]

    McDonald, Kirk

    wide Water cooling tube Fits within the horn without touching. 2 int. length long; narrow so pions get arrangement Subdivided subdivided monolithic Cooling Water (forced convection) Helium (natural convection enough ( 2 interaction lengths ) to interact most protons Dense enough that 2 lint fits in focusing

  12. Dynamic analysis of a 5 megawatt offshore floating wind turbine

    E-Print Network [OSTI]

    Harriger, Evan Michael

    2011-01-01T23:59:59.000Z

    1985. 23. Hau, E. Wind Turbines: Fundamentals, Technologies,for Floating Offshore Wind Turbines. Tech. no. NREL/CP-500-Full-scale Floating Wind Turbine." Statoil, 14 Oct. 2009.

  13. Five-megawatt geothermal-power pilot-plant project

    SciTech Connect (OSTI)

    Not Available

    1980-08-29T23:59:59.000Z

    This is a report on the Raft River Geothermal-Power Pilot-Plant Project (Geothermal Plant), located near Malta, Idaho; the review took place between July 20 and July 27, 1979. The Geothermal Plant is part of the Department of Energy's (DOE) overall effort to help commercialize the operation of electric power plants using geothermal energy sources. Numerous reasons were found to commend management for its achievements on the project. Some of these are highlighted, including: (a) a well-qualified and professional management team; (b) effective cost control, performance, and project scheduling; and (c) an effective and efficient quality-assurance program. Problem areas delineated, along with recommendations for solution, include: (1) project planning; (2) facility design; (3) facility construction costs; (4) geothermal resource; (5) drilling program; (6) two facility construction safety hazards; and (7) health and safety program. Appendices include comments from the Assistant Secretary for Resource Applications, the Controller, and the Acting Deputy Director, Procurement and Contracts Management.

  14. Final Environmental Impact Report: North Brawley Ten Megawatt Geothermal

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are being directedAnnualPropertyd8c-a9ae-f8521cbb8489 NoEuropeStrat.pdfInactive Jump to: navigation,

  15. Dynamic analysis of a 5 megawatt offshore floating wind turbine

    E-Print Network [OSTI]

    Harriger, Evan Michael

    2011-01-01T23:59:59.000Z

    Offshore wind turbines have the potential to generateuncover potential problems that exist with offshore windwind turbines in operation, this technology has the potential

  16. A TEN MEGAWATT BOILING HETEROGENEOUS PACKAGE POWER REACTOR. Reactor...

    Office of Scientific and Technical Information (OSTI)

    A reactor and associated power plant designed to produce 1.05 Mwh and 3.535 Mwh of steam for heating purposes are described. The total thermal output of the reactor is 10 Mwh....

  17. Funding Opportunity: Next Generation Electric Machines: Megawatt Class

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy ChinaofSchaefer To: Congestion Study CommentsStolar,NEACEnergy

  18. Extreme Cost Reductions with Multi-Megawatt Centralized Inverter Systems |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page onYouTube YouTube Note: Since the YouTube|6721 FederalTexas EnergyofIdahoExceptions toPhotovoltaicsExternalOpportunity

  19. Cost Reductions with Multi-Megawatt Centralized Inverter Systems

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels DataDepartment of Energy Your Density Isn't Your Destiny: Theof"Wave theJuly 30, 2013Department of

  20. Project Profile: 10-Megawatt Supercritical Carbon Dioxide Turbine |

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742EnergyOn April 23, 2014, an OHASeptember 2010 | Department ofPlantLong Island HTSProject Mgt

  1. NREL: Concentrating Solar Power Research - 10-Megawatt Supercritical Carbon

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Saleshttp://www.fnal.gov/directorate/nalcal/nalcal02_07_05_files/nalcal.gifNREL NRELChemical andWhat Is aResidentialWorking With

  2. Mass Megawatts Wind Power Inc | Open Energy Information

    Open Energy Info (EERE)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov You are beingZealand Jump to: navigation, searchOfRose Bend <Stevens Jump to:source History View

  3. Next Generation Electric Machines: Megawatt Class Motors FOA Informational

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page onYouTube YouTube Note: Since the.pdfBreaking ofOilNEW HAMPSHIREofNewsletter Newsletter Better BuildingsAttics andWebinar

  4. Effect of media composition on intracellular protein degradation in 3T3 and SV40-3T3 cells

    E-Print Network [OSTI]

    Hedges, Patsy Ann

    1978-01-01T23:59:59.000Z

    when cycloheximide is present under step-down conditions ~ ~ ~ . ~ ~ . ~ ~ ~ 29 Ef'feet of sodium and potassium concentration on protein degradation in 3' and SV40-3Ti cells 49 INTRODUCTION Mammalian cells continuously synthesize and degrade most... for total cell proteins approxi- mately doubled under nutritional step-down conditions produced by the removal of serum or amino acids, or both, from the medium. This enhanced rate, which occurs almost immediately, is reduced. by rcaddition of serum...

  5. Exploitative male mating strategies: Personality, mating orientation, and relationship status

    E-Print Network [OSTI]

    Pillow, Jonathan

    M.G. Lewis a, , Judith A. Easton a , Cari D. Goetz a , David M. Buss a a The University of Texas, deceived, coerced, or forced into having sex (Buss & Duntley, 2008). Recent research indicates men can, and are sexually attracted to women exhibiting these cues (Goetz, Easton, Lewis, & Buss, 2011). Ancestrally

  6. Curso : MATE-1105 Seccion : 6

    E-Print Network [OSTI]

    Cardona, Alexander

    .00 12.00 3.63 57 201024361 MEJIA FRANCO MARIA JULIANA 22.00 22.00 5.50 58 201112137 MEJIA MARULANDA ALBERTO 11.00 4.00 1.88 66 201224865 NAVIA RAMIREZ LINA MARIA 20.50 21.00 5.19 67 201113977 NEIRA ROJAS

  7. Health physics considerations in 131I production at a one megawatt TRIGA reactor

    E-Print Network [OSTI]

    Flora, Jason Todd

    1993-01-01T23:59:59.000Z

    hcnrcne Rl I 0 n1 tn c lttstrous. Inctal Violet-Itlack 7553562 NN1575000 3-1 0. 1 ppm 0. 1 pptn Tc 449. 5 989. 8 12 7. 6 I Omm 520"C tnsolnhlc In 11;IlCr Rriule Sih ert -3Vlutc 13494809 5VY2625000 3 O. l mg m' TcO, 733 1245 159. 6...~ Tc 1 17 dass 128m Te ~ lc 58 dars 127m IT 127 Te~ Te 109 der s 129m 'I e 34 da) s 131m IT 131 Te~ Te 30 hours P ? 127 I 9. 1 hours P ? 129 I 09 11))u p 131 I zc uuu P ? 129 Xc 17. 18)0, 000 )cars p 13 lm I I 131 Xe ~ Xc 8 05...

  8. GSA Issues New Request for Proposals to Bring 3 Megawatts of...

    Office of Environmental Management (EM)

    a request for proposal (RFP) for the procurement of electricity produced by solar photovoltaic arrays to be constructed by the selected bidder that will bring approximately 3...

  9. A 1 MEGAWATT POLYPHASE BOOST CONVERTER-MODULATOR FOR KLYSTRON PULSE APPLICATION

    SciTech Connect (OSTI)

    W.A. REASS; J.D. DOSS; R.F. GRIBBLE

    2001-06-01T23:59:59.000Z

    This paper describes electrical design criteria and first operational results a 140 kV, 1 MW average, 11 MW peak, zero-voltage-switching 20 kHz polyphase bridge, boost converter/modulator for klystron pulse application. The DC-DC converter derives the buss voltages from a standard 13.8 kV to 2300 Y substation cast-core transformer. Energy storage and filtering is provided by self-clearing metallized hazy polypropylene traction capacitors. Three ''H-Bridge'' Insulated Gate Bipolar Transistor (IGBT) switching networks are used to generate the polyphase 20 kHz transformer primary drive waveforms. The 20 kHz drive waveforms are chirped the appropriate duration to generate the desired klystron pulse width. PWM (pulse width modulation) of the individual 20 kHz pulses is utilized to provide regulated output waveforms with adaptive feedforward and feedback techniques. The boost transformer design utilizes amorphous nanocrystalline material that provides the required low core loss at design flux levels and switching frequencies. Resonant shunt-peaking is used on the transformer secondary to boost output voltage and resonate transformer leakage inductance. With the appropriate transformer leakage inductance and peaking capacitance, zero-voltage-switching of the IGBT's is attained, minimizing switching losses. A review of these design parameters and the first results of the performance characteristics will be presented.

  10. Utility Test Results of a 2-Megawatt, 10-Second Reserve-Power System

    SciTech Connect (OSTI)

    BALL,GREG J.; NORRIS,BENJAMIN L.

    1999-10-01T23:59:59.000Z

    This report documents the 1996 evaluation by Pacific Gas and Electric Company of an advanced reserve-power system capable of supporting 2 MW of load for 10 seconds. The system, developed under a DOE Cooperative Agreement with AC Battery Corporation of East Troy, Wisconsin, contains battery storage that enables industrial facilities to ''ride through'' momentary outages. The evaluation consisted of tests of system performance using a wide variety of load types and operating conditions. The tests, which included simulated utility outages and voltage sags, demonstrated that the system could provide continuous power during utility outages and other disturbances and that it was compatible with a variety of load types found at industrial customer sites.

  11. Design and analysis of megawatt-class heat-pipe reactor concepts

    SciTech Connect (OSTI)

    Poston, D.; Kapernick, R. [Los Alamos National Laboratory, MS C921, Los Alamos, NM 87545 (United States)

    2012-07-01T23:59:59.000Z

    There is growing interest in finding an alternative to diesel-powered systems at locations removed from a reliable electrical grid. One promising option is a 1- to 10-MW mobile reactor system, that could provide robust, self-contained, and long-term ({>=} 5 years) power in any environment. The reactor and required infrastructure could be transported to any location within one or a few standard transport containers. Heat pipe reactors, using alkali metal heat pipes, are perfectly suited for mobile applications because their nature is inherently simpler, smaller, and more reliable than 'traditional' reactors that rely on pumped coolant through the core. This paper examines a heat pipe reactor that is fabricated and shipped as six identical core segments. Each core segment includes a heat-pipe-to-gas heat exchanger that is coupled to the condenser end of the heat pipes. The reference power conversion system is a CO{sub 2}-Brayton system. The segments by themselves are deeply subcritical during transport, and they would be locked into an operating configuration (with control inserted) at the final destination. Two design options are considered: a near-term option and an advanced option. The near-term option is a 5-MWt concept that uses uranium-dioxide fuel, a stainless-steel structure, and potassium as the heat-pipe working fluid. The advanced option is a 15-MWt concept that uses uranium-nitride fuel, a molybdenum/TZM structure, and sodium as the heat-pipe working fluid. The materials used in the advanced option allow for higher temperatures and power densities, and enhanced power throughput in the heat pipes. Higher powers can be obtained from both concepts by increasing the core size and the number of heat pipes. (authors)

  12. Pulsed inductive thruster performance data base for megawatt-class engine applications

    SciTech Connect (OSTI)

    Dailey, C.L. (TRW Space and Technology Group, One Pace Park, Redondo Beach, CA 90278 (United States)); Lovberg, R.H. (University of California at San Diego, 4744 Panorama Drive, San Diego, CA 92116 (United States))

    1993-01-20T23:59:59.000Z

    The pulsed inductive thruster (PIT) is an electrodeless plasma accelerator employing a large (1m diameter) spiral coil energized by a capacitor bank discharge. The bank can be repetitively recharged by a nuclear electric generator for continuous MW level operation. The coil can be designed as a transformer that permits thruster operation at the generator voltage, which results in a low thruster specific mass. Specific impulse ([ital I][sub sp]) can be readily altered by changing the propellant valve plenum pressure. Performance curves generated from mesausred impulse, injected mass and capacitor bank energy are presented for argon, ammonia, hydrazine, carbon dioxide and helium. The highest performance measured to date is 48% efficiency at 4000 seconds [ital I][sub sp] with ammonia. The development of a theoretical model of the thruster, which assumes a fully ionized plasma, is presented in an appendix.

  13. A multi-reactor configuration for multi-megawatt spacecraft power supplies

    E-Print Network [OSTI]

    George, Jeffrey Alan

    1989-01-01T23:59:59.000Z

    capacity may be required for round trip missions. Mission analyses were carried out for an unmanned Mars Cargo Mission and compared with both single reactor and conventional chemical rocket concepts. Interplanetary trajectories utilizing throttled... ABSTRACT ACKNOWLEDGEMENT TABLE OF CONTENTS LIST OF FIGURES LIST OF TABLES CHAPTER I. INTRODUCTION II. MULTI-REACTOR CONFIGURATIONS III. THE HYDRA MULTI-REACTOR CONFIGURATION IV. HYDRA SYSTEM ANALYSIS V, MARS CARGO MISSION ANALYSIS VI, CONCLUSIONS...

  14. Commissioning and Start Up of a 110 MegaWatt Cogeneration Facility

    E-Print Network [OSTI]

    Good, R.

    manufacturing facility constraints 4. Mechanical problems 5. Electrical problems 6. Control system/instrumentation problems The commissioning and start up had to be coordinated with existing Plant operations. As a result of the Project Team's efforts...

  15. Measured Radiation and Background Levels During Transmission of Megawatt Electron Beams Through Millimeter Apertures

    E-Print Network [OSTI]

    Alarcon, R; Benson, S V; Bertozzi, W; Boyce, J R; Cowan, R; Douglas, D; Evtushenko, P; Fisher, P; Ihloff, E; Kalantarians, N; Kelleher, A; Kossler, W J; Legg, R; Long, E; Milner, R G; Neil, G R; Ou, L; Schmookler, B; Tennant, C; Tschalaer, C; Williams, G P; Zhang, S

    2013-01-01T23:59:59.000Z

    We report measurements of photon and neutron radiation levels observed while transmitting a 0.43 MW electron beam through millimeter-sized apertures and during beam-off, but accelerating gradient RF-on, operation. These measurements were conducted at the Free-Electron Laser (FEL) facility of the Jefferson National Accelerator Laboratory (JLab) using a 100 MeV electron beam from an energy-recovery linear accelerator. The beam was directed successively through 6 mm, 4 mm, and 2 mm diameter apertures of length 127 mm in aluminum at a maximum current of 4.3 mA (430 kW beam power). This study was conducted to characterize radiation levels for experiments that need to operate in this environment, such as the proposed DarkLight Experiment. We find that sustained transmission of a 430 kW continuous-wave (CW) beam through a 2 mm aperture is feasible with manageable beam-related backgrounds. We also find that during beam-off, RF-on operation, multipactoring inside the niobium cavities of the accelerator cryomodules is ...

  16. Economic Impacts from Indiana's First 1,000 Megawatts of Wind Power

    SciTech Connect (OSTI)

    Tegen, S.; Keyser, D.; Flores-Espino, F.; Hauser, R.

    2014-08-01T23:59:59.000Z

    The magnitude of Indiana's available wind resource indicates that the development of wind power infrastructure has the potential to support millions of dollars of economic activity in the state. The Jobs and Economic Development Impact (JEDI) models, developed by the National Renewable Energy Laboratory, are tools used to estimate some of the economic impacts of energy projects at the state level. JEDI calculates results in the form of jobs, earnings, and economic output in three categories: project development and onsite labor, local revenue and supply chain, and induced impacts. According to this analysis, the first 1,000 MW of wind power development in Indiana (projects built between 2008 and 2011): supported employment totaling more than 4,400 full-time-equivalent jobs in Indiana during the construction periods; supports approximately 260 ongoing Indiana jobs; supported nearly $570 million in economic activity for Indiana during the construction periods; supported and continues to support nearly $40 million in annual Indiana economic activity during the operating periods; generates more than $8 million in annual property taxes; generates nearly $4 million annually in income for Indiana landowners who lease their land for wind energy projects.

  17. Scaling considerations for a multi-megawatt class supercritical CO2 brayton cycle and commercialization.

    SciTech Connect (OSTI)

    Fleming, Darryn D.; Holschuh, Thomas Vernon,; Conboy, Thomas M.; Pasch, James Jay; Wright, Steven Alan; Rochau, Gary Eugene; Fuller, Robert Lynn [Barber-Nichols, Inc., Arvada, CO

    2013-11-01T23:59:59.000Z

    Small-scale supercritical CO2 demonstration loops are successful at identifying the important technical issues that one must face in order to scale up to larger power levels. The Sandia National Laboratories supercritical CO2 Brayton cycle test loops are identifying technical needs to scale the technology to commercial power levels such as 10 MWe. The small size of the Sandia 1 MWth loop has demonstration of the split flow loop efficiency and effectiveness of the Printed Circuit Heat Exchangers (PCHXs) leading to the design of a fully recuperated, split flow, supercritical CO2 Brayton cycle demonstration system. However, there were many problems that were encountered, such as high rotational speeds in the units. Additionally, the turbomachinery in the test loops need to identify issues concerning the bearings, seals, thermal boundaries, and motor controller problems in order to be proved a reliable power source in the 300 kWe range. Although these issues were anticipated in smaller demonstration units, commercially scaled hardware would eliminate these problems caused by high rotational speeds at small scale. The economic viability and development of the future scalable 10 MWe solely depends on the interest of DOE and private industry. The Intellectual Property collected by Sandia proves that the ~10 MWe supercritical CO2 power conversion loop to be very beneficial when coupled to a 20 MWth heat source (either solar, geothermal, fossil, or nuclear). This paper will identify a commercialization plan, as well as, a roadmap from the simple 1 MWth supercritical CO2 development loop to a power producing 10 MWe supercritical CO2 Brayton loop.

  18. Measured Radiation and Background Levels During Transmission of Megawatt Electron Beams Through Millimeter Apertures

    SciTech Connect (OSTI)

    Alarcon, Ricardo [Arizona State University, Glendale, AZ (United States); Balascuta, S. [Arizona State University, Glendale, AZ (United States); Benson, Stephen V. [Thomas Jefferson National Accelerator Facility, Newport News, VA (United States); Bertozzi, William [Massachusetts Institute of Technology, Cambridge, MA (United States); Boyce, James R. [Thomas Jefferson National Accelerator Facility, Newport News, VA (United States); Cowan, Ray [Massachusetts Institute of Technology, Cambridge, MA (United States); Douglas, David R. [Thomas Jefferson National Accelerator Facility, Newport News, VA (United States); Evtushenko, Pavel [Thomas Jefferson National Accelerator Facility, Newport News, VA (United States); Fisher, P. [Massachusetts Institute of Technology, Cambridge, MA (United States); Ihloff, Ernest E. [Hampton University, Hampton, VA (United States); Kalantarians, Narbe [Hampton University, Hampton, VA (United States); Kelleher, Aidan Michael [Massachusetts Institute of Technology, Cambridge, MA (United States); Krossler, W. J. [William and Mary College, Williamsburg, VA (United States); Legg, Robert A. [Thomas Jefferson National Accelerator Facility, Newport News, VA (United States); Long, Elena [University of New Hampshire, Durham, NH (United States); Milner, Richard [Massachusetts Institute of Technology, Cambridge, MA (United States); Neil, George R. [Thomas Jefferson National Accelerator Facility, Newport News, VA (United States); Ou, Longwu [Massachusetts Institute of Technology, Cambridge, MA (United States); Schmookler, Barack Abraham [Massachusetts Institute of Technology, Cambridge, MA (United States); Tennant, Christopher D. [Thomas Jefferson National Accelerator Facility, Newport News, VA (United States); Tschalar, C. [Massachusetts Institute of Technology, Cambridge, MA (United States); Williams, Gwyn P. [Thomas Jefferson National Accelerator Facility, Newport News, VA (United States); Zhang, Shukui [Thomas Jefferson National Accelerator Facility, Newport News, VA (United States)

    2013-11-01T23:59:59.000Z

    We report measurements of photon and neutron radiation levels observed while transmitting a 0.43 MW electron beam through millimeter-sized apertures and during beam-off, but accelerating gradient RF-on, operation. These measurements were conducted at the Free-Electron Laser (FEL) facility of the Jefferson National Accelerator Laboratory (JLab) using a 100 MeV electron beam from an energy-recovery linear accelerator. The beam was directed successively through 6 mm, 4 mm, and 2 mm diameter apertures of length 127 mm in aluminum at a maximum current of 4.3 mA (430 kW beam power). This study was conducted to characterize radiation levels for experiments that need to operate in this environment, such as the proposed DarkLight Experiment. We find that sustained transmission of a 430 kW continuous-wave (CW) beam through a 2 mm aperture is feasible with manageable beam-related backgrounds. We also find that during beam-off, RF-on operation, multipactoring inside the niobium cavities of the accelerator cryomodules is the primary source of ambient radiation when the machine is tuned for 130 MeV operation.

  19. An 800-MeV superconducting LINAC to support megawatt proton operations at Fermilab

    E-Print Network [OSTI]

    Derwent, Paul; Lebedev, Valeri

    2015-01-01T23:59:59.000Z

    Active discussion on the high energy physics priorities in the US carried out since summer of 2013 resulted in changes in Fermilab plans for future development of the existing accelerator complex. In particular, the scope of Project X was reduced to the support of the Long Base Neutrino Facility (LBNF) at the project first stage. The name of the facility was changed to the PIP-II (Proton Improvement Plan). This new facility is a logical extension of the existing Proton Improvement Plan aimed at doubling average power of the Fermilab's Booster and Main Injector (MI). Its design and required R&D are closely related to the Project X. The paper discusses the goals of this new facility and changes to the Project X linac introduced to support the goals.

  20. Economic Development Impacts of Colorado's First 1000 Megawatts of Wind Energy

    SciTech Connect (OSTI)

    Reategui, S.; Tegen, S.

    2008-08-01T23:59:59.000Z

    This report analyzes the economic impacts of the installation of 1000 MW of wind power in the state of Colorado.

  1. reduced demand for power by nearly 1,500 megawatts through investments in energy

    E-Print Network [OSTI]

    are in energy-efficient water heaters, lighting, windows and equipment for heating, ventilation and air and state water laws, as well as with recommendations in the biological opinions. The amendments describe

  2. GSA Issues New Request for Proposals to Bring 3 Megawatts of Solar to

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy ChinaofSchaefer To: Congestion StudyForecasting. |October 3, 2012YOUR BUSINESS GSA

  3. DOE to Develop Multi-Megawatt Offshore Wind Turbine with General Electric |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels Data Center Home Page onYouTube YouTube Note: Since the YouTube| Department ofDepartment of EnergyCustomIndoorVehiclesof

  4. DOE to Debut a Dynamic 5-Megawatt Dynamometer | Department of Energy

    Office of Environmental Management (EM)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742 33 1112011AT&T,Office of Policy, OAPM |TRUJuly 29,of Energy DOE site facility mgt

  5. DOE to Develop Multi-Megawatt Offshore Wind Turbine with General Electric |

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page on Google Bookmark EERE: Alternative Fuels DataDepartment of Energy Your Density Isn't Your Destiny: Theof"WaveInteractionsMaterials |Production

  6. DOE to Debut a Dynamic 5-Megawatt Dynamometer | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645 3,625 1,006 492 742Energy China U.S. DepartmentEnergyBoilersPlantof Energy TheDepartment of Energy Test

  7. Americanization of the German-Russian Mennonites in Central Kansas

    E-Print Network [OSTI]

    Janzen, Cornelius Cicero

    1914-06-01T23:59:59.000Z

    influence of all the settlers. All told there were about 750 families in the Molotschna district and about 400 families in the Chortitza colony, a total of 1150 families or approxi- mately 6,000,members, antfaverage of 5.2 persons to the family. By 1824...)l or more for it, a profit of between 30^000$ and 27 40,000$, n a rather comfortable income to live thus from the sweat of the poor", as Isaac puts it in his "Molotschnaer Henn." The chief magistrate of the district (Gebietsvorsteher) was David Friesen...

  8. Factors affecting the efficiency of the mechanical corn picker in Mississippi

    E-Print Network [OSTI]

    Kimbrough, Emmett Alexander

    1953-01-01T23:59:59.000Z

    . piciher s C~eett, Ph pt. hee nee ste-pes en hens Pets seethes e nle harvest approximately h75 acre pex. hour, depending on ths field con ditions and field cise General dimensions and s cificaticns, The machine weighs approxi mateIy 1~509 pounds...) picker net yield& {2) picker losses, (3) loose eax' losses x and (4) shelled cox?l losses s The last operation cr factor studied before the corn pickax' was operated in the corn plots wss to search for loose ears that, msy' have been knocked off...

  9. Improving the Thermal Output Availability of Reciprocating Engine Cogeneration Systems by Mechanical Vapor Compression

    E-Print Network [OSTI]

    Becker, F. E.; DiBella, F. A.; Lamphere, F.

    HEAT RECOVERY AND STEAM SUPPLY PROCESS GAS COMPRESSION AND GENERAnoN OF REQUIRED ELECTRIC POWER 728 has also projected that by the year 2000, approxi mately 5000 units of the 1500-kW size could be sold. Thus, considering modular IMVRS-COGEN units.... Heat Recovery Equipment Module Exhaust Gas Boiler Condensate Return System 3. Heat Rejection Module Excess Low-Pressure Steam Condens Air-Cooled Radiator to Provide Co for Turbocharger Intercooling, En Oil Cooling and Compressor Oil Co 4...

  10. Surface branch of the hydrologic cycle affecting Texas for water year 1959

    E-Print Network [OSTI]

    Gargiulo, Alphonse, Jr

    1962-01-01T23:59:59.000Z

    to that of precipitation, the assumptions do not materially affect, balance computations. Approxi- mately 28 per cent of the average annual precipitation recorded for the United States is carried to the oceans by streams (25). Eva oration and Eva otrans iration... stations. Eva otrans iration. Since the size of Texas and the period of concern are considered to meet the criteria stated by Benton (1), values of evapotranspiration were determined from the values of (E-P), obtained from McKay (11) from L2j...

  11. The determination of the specific heat of a fine-grained soil by a non-mixing method 

    E-Print Network [OSTI]

    Evans, Leighton Allen

    1952-01-01T23:59:59.000Z

    of the water jacket was approximately liV oentimetersi The cover of the calorimeter was maIs of plyw'ood which was approxi- mately 0~63 oentimeters thick. The eleotrically driven stirrer was mounted on the cover of the calor1meter. Also attached..., In the meantime& the inner calor1meter oan and the calorimetric fluid had been cooled to the desired temperature in the refrigerator& After the specimen and oapsule had reaohed a oonstant temperature& the inner can and the calor1mstrlo fluid were taken from ths...

  12. System Design and Experimental Development of the Kalina Cycle Technology

    E-Print Network [OSTI]

    Kalina, A. I.; Leibowitz, H. M.

    , the heat exchange process in the boiler of a coal fired plant, geothermal plant, nuclear plant and waste heat bottoming cycle all differ in the combi nation of temperature and quantity of isothermal and sensible heat transfer. In the coal plant, appr...OXi mately 80 percent is transferred isothermally above 10SOF with the remainder transferred sensibly from 10SOF to lOOF. Low temperature geothermal is characterized by an evaporator inlet temperature in the 300-400F range with all heat transferred...

  13. Factors affecting the efficiency of the mechanical corn picker in Mississippi 

    E-Print Network [OSTI]

    Kimbrough, Emmett Alexander

    1953-01-01T23:59:59.000Z

    . piciher s C~eett, Ph pt. hee nee ste-pes en hens Pets seethes e nle harvest approximately h75 acre pex. hour, depending on ths field con ditions and field cise General dimensions and s cificaticns, The machine weighs approxi mateIy 1~509 pounds...) picker net yield& {2) picker losses, (3) loose eax' losses x and (4) shelled cox?l losses s The last operation cr factor studied before the corn pickax' was operated in the corn plots wss to search for loose ears that, msy' have been knocked off...

  14. MATE-115 Seccion 26 Prof. Federico Ardila

    E-Print Network [OSTI]

    Ardila, Federico

    , escriba FALSO y d´e un contraejemplo num´erico. a) Si A y B son matrices tales que AB = BA, entonces At Bt

  15. MATE115 Seccion 26 Prof. Federico Ardila

    E-Print Network [OSTI]

    Ardila, Federico

    FALSO y dâ??e un contraejemplo numâ??erico. (a) Si una matriz cuadrada A no es invertible, entonces 0 es un

  16. MATE115 Seccion 26 Prof. Federico Ardila

    E-Print Network [OSTI]

    Ardila, Federico

    enunciado no siempre es cierto, escriba FALSO y dâ??e un contraejemplo numâ??erico. a) Si A y B son matrices

  17. MATE-115 Seccion 26 Prof. Federico Ardila

    E-Print Network [OSTI]

    Ardila, Federico

    brevemente por qu´e lo es. Si el enunciado no siempre es cierto, escriba FALSO y d´e un contraejemplo num´erico

  18. Introduction The discovery of novel functional mate-

    E-Print Network [OSTI]

    Rubloff, Gary W.

    transfer the or- ganic combinatorial synthesis concept to inorganic thin-film materials was started- plications of these combinatorial materials libraries. Thin-Film Library Synthesis The effort to directly the trend MRS BULLETIN/APRIL 2002 301 Combinatorial Synthesis and Evaluation of Functional Inorganic

  19. Progress on the 140 KV, 10 Megawatt Peak, 1 Megawatt Average Polyphase Quasi-Resonant Bridge, Boost Converter/Modulator for the Spallation Neutron Source (SNS) Klystron Power System

    E-Print Network [OSTI]

    Reass, W A; Gribble, R F; Lynch, M T; Tallerico, P J; Reass, William A.; Doss, James D.; Gribble, Robert F.; Lynch, Michael T.; Tallerico, Paul J.

    2000-01-01T23:59:59.000Z

    This paper describes electrical design and operational characteristics of a zero-voltage-switching 20 kHz polyphase bridge, boost converter/modulator for klystron pulse application. The DC-DC converter derives the buss voltages from a standard 13.8 kV to 2300 Y substation cast-core transformer. Energy storage and filtering is provided by self-clearing metallized hazy polypropylene traction capacitors. Three "H-Bridge" IGBT switching networks are used to generate the polyphase 20 kHz transformers primary drive waveforms. The 20 kHz drive waveforms are chirped the appropriate duration to generate the desired klystron pulse width. PWM (pulse width modulation) of the individual 20 kHz pulses is utilized to provide regulated output waveforms with adaptive feedforward and feedback techniques. The boost transformer design utilizes amorphous nanocrystalline material that provides the required low core loss at design flux levels and switching frequencies. Resonant shunt peaking is used on the transformer secondary to ...

  20. Development and installation of an advanced beam guidance system on Viking`s 2.4 megawatt EB furnace

    SciTech Connect (OSTI)

    Motchenbacher, C.A.; Grosse, I.A. [Viking Metallurgical, Verdi, NV (United States)

    1994-12-31T23:59:59.000Z

    Viking Metallurgical is a manufacturer of titanium alloy and superalloy seamless ring forgings for the aerospace industry. For more than 20 years Viking has used electron beam cold hearth melting to recover titanium alloy scrap and to produce commercially pure titanium ingot for direct forging. In the 1970`s Viking pioneered electron beam cold hearth melting and in 1983 added a two-gun, 2.4 MW furnace. As part of Vikings efforts to improve process control we have commissioned and installed a new electron beam guidance system. The system is capable of generating virtually unlimited EB patterns resulting in improved melt control.

  1. Analysis of the socioeconomic impacts of the development of two 525 megawatt power generating stations at Calaveras Lake, Texas

    E-Print Network [OSTI]

    Arneson, Lynn A

    1988-01-01T23:59:59.000Z

    Existing Operations Local Expenditures 24. Total Personal Income Effects 60 25. CPS Existing Operations at Calaveras Lake Estimated Total Income Distribution 62 26. Estimated Ad Valorem Tax Revenues 63 27. Estimated Average Annual Retail Sales.... Local Operations and Naintenance Expenditures 34. Personal Income Effects, Operations 77 35. Projected Residential Distribution of CPS Operations Inmigrant Employees 79 36. Estimated Annual Average Retail Sales and Sales Tax Revenues from Operations...

  2. Five megawatt pilot-scale demonstration of the NOXSO Process at Ohio Edison`s Toronto Power Plant

    SciTech Connect (OSTI)

    Haslbeck, J.L.; Woods, M.C.; Ma, W.T.; Harkins, S.M.; Black, J.B.; Browning, J.P.; Leonard, C.A.; Friedrich, J.J. [NOXSO Corp., Bethel Park, PA (United States)

    1995-12-31T23:59:59.000Z

    The NOXSO Process is a dry, regenerable flue gas treatment system that simultaneously removes sulfur oxides (SO{sub 2}, SO{sub 3}) and nitrogen oxides (NO{sub x}) from flue gas. Removal efficiencies of 95+% SO{sub 2}, 99% SO{sub 3}, and 80--90% NO{sub x} have been achieved. The process generates no waste. Sulfur oxides are converted to a marketable byproduct, either sulfuric acid, liquid SO{sub 2}, or elemental sulfur. Nitrogen oxides are converted to nitrogen and oxygen which are released to the atmosphere. The process is easily retrofit and is particularly applicable to high sulfur coals. Most importantly, the NOXSO Process capital and operating costs are less than conventional technology, i.e., a selective catalytic reduction unit followed by a wet scrubber. This paper covers the results of a 5 MW pilot test of the NOXSO Process at Ohio Edison`s Toronto Power Plant. The paper focuses on process design improvements that were verified in pilot plant testing. These improvements are in the area of increased pollutant removal efficiency and decreased capital and operating costs. The paper concludes with an analysis of the cost and performance of a NOXSO plant treating all of the flue gas from a 500 MW power plant burning 2.8% sulfur coal.

  3. MIXED MODE DELAMINATION OF GLASS FIBER/POLYMER MATRIX COMPOSITE MATERIALS

    E-Print Network [OSTI]

    .........................................................................................................1 DEMANDS FOR MEGAWATT WIND TURBINE BLADES ....................................................1 2

  4. MATE115 Seccion 26 Amague de Parcial 1

    E-Print Network [OSTI]

    Ardila, Federico

    contraejemplo numâ??erico. a) Si A es una matriz cuadrada tal que A 2 = 0, entonces A = 0. b) Si A y B son

  5. MATE-115 Seccion 26 Amague de Parcial 1

    E-Print Network [OSTI]

    Ardila, Federico

    ´e lo es. Si el enunciado no siempre es cierto, escriba FALSO y d´e un contraejemplo num´erico. a) Si

  6. A mixed-mating strategy in a hermaphroditic vertebrate

    E-Print Network [OSTI]

    Avise, John

    al. 1989) origi- nated in all known cases via hybridization between related sexual species, so and northern coasts of South America, throughout most of the Caribbean region and in the Bahamas and southern

  7. SWORDTAIL MATE CHOICE AND REPRODUCTIVE ALLOCATION: EFFECTS OF MALE CONDITION

    E-Print Network [OSTI]

    Simpson, Suzanne

    2011-04-26T23:59:59.000Z

    were placed on a ?High-food? (HF) or ?Low-food? (LF) diet with 30 HF and 30 LF. Within each group (HF or LF) the males were then divided into tanks with 5 males per tank. Thus we had 6 HF replicates and 6 LF replicates. The males were consistently fed... of covariance GLM Generalized linear model GLMM Generalized linear mixed model HF High-food LF Low-food R Statistical program used for data analysis vi TABLE OF CONTENTS Page ABSTRACT...

  8. Alternative mating tactics and extreme male dimorphism in fig wasps. 

    E-Print Network [OSTI]

    Cook, James M; Compton, Steven G; Herre, E Allen; West, Stuart A

    1997-01-01T23:59:59.000Z

    The dimorphisms in morphology and behaviour of male fig wasps are among the most extreme in the animal kingdom, and offer excellent oppotunities to test the predictions of certain sexual selection models.

  9. alternative mating tactics: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    W. Tobaben , Sanath Yekollu , and Hareesh Kolpuru Electrical and Computer Engineering Raytheon Program 1. INTRODUCTION The objective of the Autonomous Networked Tactical Sentries...

  10. Mate Choice, Genetic Variation, and Population Structure in Hybrid Zones

    E-Print Network [OSTI]

    Culumber, Zachary Wyatt

    2012-02-14T23:59:59.000Z

    informative single nucleotide polymorphisms (SNPs) in one mitochondrial and three nuclear intron loci, I show that hybrid zones occur in replicated fashion in multiple stream reaches along a gradient from high to low elevation. Tests of FIS and linkage...

  11. acoustic mate recognition: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    occurs when an expected phone is pronounced as a different one, which leads to erroneous recognition. Acoustic confusion occurs when the pronounced phone is found to lie...

  12. Marry for What? Caste and Mate Selection in Modern India

    E-Print Network [OSTI]

    Banerjee, Abhijit

    This paper analyzes how preferences for a noneconomic characteristic (e.g., caste) can affect equilibrium patterns of matching, and empirically evaluates this in the context of middle-class Indian arranged marriages. We ...

  13. Polarization signaling in swordtails alters female mate preference

    E-Print Network [OSTI]

    Cummings, Molly E.

    of Texas at Austin, Austin, TX 78712; and b Advanced Sensors Research Laboratory, Department of Computer aquatic and terrestrial environments. Documentation of inverte- brate use of polarized light is widespread behavior, and thus function as a signal, in the butterfl

  14. Original Article Kind toward whom? Mate preferences for personality

    E-Print Network [OSTI]

    Cosmides, Leda

    and trustworthiness above all other aspects of personality (e.g., Botwin, Buss & Shackelford, 1997; Buss et al., 1990; Buss & Barnes, 1986; Cottrell, Neuberg & Li, 2007; Ellis, Simpson & Campbell, 2002; Fletcher, Simpson

  15. Choosy But Not Chaste: Multiple Mating in Human Females

    E-Print Network [OSTI]

    Scelza, BA

    2013-01-01T23:59:59.000Z

    York: Oxford University Press. 12 Buss DM, Schmitt DP. 1993.13 Schmitt DP, Shackelford TK, Buss DM. 2001. Are men really60:145–164. 74 Greiling H, Buss DM. 2000. Women’s sexual

  16. Economic Benefits, Carbon Dioxide (CO2) Emissions Reductions, and Water Conservation Benefits from 1,000 Megawatts (MW) of New Wind Power in West Virginia (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2008-10-01T23:59:59.000Z

    The U.S. Department of Energy?s Wind Powering America Program is committed to educating state-level policymakers and other stakeholders about the economic, CO2 emissions, and water conservation impacts of wind power. This analysis highlights the expected impacts of 1000 MW of wind power in West Virginia. Although construction and operation of 1000 MW of wind power is a significant effort, six states have already reached the 1000-MW mark. We forecast the cumulative economic benefits from 1000 MW of development in West Virginia to be $1.0 billion, annual CO2 reductions are estimated at 3.3 million tons, and annual water savings are 1,763 million gallons.

  17. System using a megawatt class millimeter wave source and a high-power rectenna to beam power to a suspended platform

    DOE Patents [OSTI]

    Caplan, Malcolm; Friedman, Herbert W.

    2005-07-19T23:59:59.000Z

    A system for beaming power to a high altitude platform is based upon a high power millimeter gyrotron source, optical transmission components, and a high-power receiving antenna (i.e., a rectenna) capable of rectifying received millimeter energy and converting such energy into useable electrical power.

  18. Economic Benefits, Carbon Dioxide (CO2) Emissions Reductions, and Water Conservation Benefits from 1,000 Megawatts (MW) of New Wind Power in Pennsylvania (Fact Sheet)

    SciTech Connect (OSTI)

    Not Available

    2008-10-01T23:59:59.000Z

    The U.S. Department of Energy?s Wind Powering America Program is committed to educating state-level policymakers and other stakeholders about the economic, CO2 emissions, and water conservation impacts of wind power. This analysis highlights the expected impacts of 1000 MW of wind power in Pennsylvania. Although construction and operation of 1000 MW of wind power is a significant effort, six states have already reached the 1000-MW mark. We forecast the cumulative economic benefits from 1000 MW of development in Pennsylvania to be $1.2 billion, annual CO2 reductions are estimated at 3.4 million tons, and annual water savings are 1,837 million gallons.

  19. Table 11.6 Installed Nameplate Capacity of Fossil-Fuel Steam-Electric Generators With Environmental Equipment, 1985-2010 (Megawatts)

    U.S. Energy Information Administration (EIA) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov YouKizildere IRaghuraji Agro IndustriesTownDells,1Stocks Nov-14 Dec-14TableConferenceInstalled Nameplate Capacity of

  20. Modal Dynamics and Stability of Large Multi-megawatt Deepwater Offshore Vertical-axis Wind Turbines: Initial Support Structure and Rotor Design Impact Studies

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative1 First Use of Energy for All Purposes (Fuel and Nonfuel), 2002; Level: National5Sales for4,645U.S. DOEThe Bonneville PowerCherries 82981-1cnHighandSWPA / SPRA /Ml'. William Hirst Hirst Enterprises, Inc. P.O.Modal

  1. LINE","COMPNAME","COMPID","YEAR","PURCNAME","SALETYPE","MEGAWATT","ANNMXDEM","DE

    U.S. Energy Information Administration (EIA) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov YouKizildere IRaghurajiConventionalMississippi"site. If youEIA-906Feet) Year JanCubic Feet)2,445 25,536Spencer

  2. LINE","COMPNAME","COMPID","YEAR","PURCNAME","SALETYPE","MEGAWATT","ANNMXDEM","DE

    U.S. Energy Information Administration (EIA) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are now leaving Energy.gov You are now leaving Energy.gov YouKizildere IRaghurajiConventionalMississippi"site. If youEIA-906Feet) Year JanCubic Feet)2,445

  3. Improvement of Power-Performance Efficiency for High-End Computing Rong Ge, Xizhou Feng, Kirk W. Cameron

    E-Print Network [OSTI]

    Freeh, Vincent

    . Earth Simulator requires 18 megawatts of power. Petaflop systems may require 100 megawatts of power[2], nearly the output of a small power plant (300 megawatts). At $100 per megawatt ($.10 per kilowatt), peakImprovement of Power-Performance Efficiency for High-End Computing Rong Ge, Xizhou Feng, Kirk W

  4. A Review of Recent RTO Benefit-Cost Studies: Toward More Comprehensive Assessments of FERC Electricity Restructuring Policies

    E-Print Network [OSTI]

    Eto, Joseph H.; Lesieutre, Bernard C.

    2005-01-01T23:59:59.000Z

    Sponsored by Midwest Independent System Operator (MISO) CRA.price million Midwest Independent System Operator megawatt

  5. Real Time Pricing as a Default or Optional Service for C&I Customers: A Comparative Analysis of Eight Case Studies

    E-Print Network [OSTI]

    Barbose, Galen; Goldman, Charles; Bharvirkar, Ranjit; Hopper, Nicole; Ting, Michael; Neenan, Bernie

    2005-01-01T23:59:59.000Z

    Commission Midwest Independent System Operator megawattOPUC 2005). The Midwest Independent System Operator (MISO)

  6. EST analysis of male accessory glands from Heliconius butterflies with divergent mating systems

    E-Print Network [OSTI]

    Walters, James R.; Harrison, Richard G.

    2008-12-08T23:59:59.000Z

    proteins observed in the male accessory gland cDNA libraries. Dots (.) indicate identity between sequences; tildes (~) represent alignment gaps; Hme00007 MNKILILLVVILGAMCLVEAEHDSNLDSKRAAGCPPGQEEYYGMCYGTRKSESGRRDQSGGLNNNNRRSQ Her00048 .KN..N..L..MA...I.A.....YYPS.N.RQ.P.........N.R...S.QG.I.ELG..R~~HHIG...E Hme00007 NEGLNNNNRRSQWEGLNNNNRRSQREGLNNNNRRSQSRELNNNNRRSQSGELNNNNRRSQREGLNNNNRR Her00048 .S* Hme00007...

  7. UIL Chess Puzzle Practice Material This year's UIL Chess Puzzle Test includes "solve the mate"

    E-Print Network [OSTI]

    Rock, Chris

    of a letter and a number. #12;a8 b8 c8 d8 e8 f8 g8 h8 a7 b7 c7 d7 e7 f7 g7 h7 a6 b6 c6 d6 e6 f6 g6 h6 a5 b5 c5 the board. See the next panel. Now we know that every square has a name. a8 b8 c8 d8 e8 f8 g8 h8 a7 b7 c7 d7 the move? a) g8 b) c4 c) f6 d) None of the above #12;UIL Chess Puzzles 4- White can force checkmate in two

  8. Body image disturbances: the effects of media on self-appraisal and ideal mate selection

    E-Print Network [OSTI]

    Litzsinger, Sara Kay

    2013-02-22T23:59:59.000Z

    from 1967 to 1987 and noted a significant increase in height and waist measurements. While no changes in hip measurements were noted, bust measures decreased. In another study, Spitzer, Henderson, and Zivian (1999) investigated the changing body...; Henderson-King, Henderson-King, 1997; Pinhas, Toner, Ali, Garfinkel, & Stuckless, 1999; Stice, & Shaw, 1994). Irving (1990) investigated the impact of exposure to thin, average, and overweight models. She found that, regardless of bulimic symptomatology...

  9. Hereditas 126: 199-209 (1997) Mating system and genetic variabilitv in the simultaneouslv

    E-Print Network [OSTI]

    Wirth, Thierry

    hermaphroditic terrestrial gastropod Balea perversa on th; Baltic island of Oland, Sweden THIERRY WIRTH, ANETTE variability in the simultaneously hermaphroditic terrestrial gastropod Balea perversa on the Baltic island natural populations of this rock-dwelling gastropod on the Baltic island of Oland, Sweden. The mode

  10. Fitting It All Together: How Courtship- and Mating-Responsive Genes Affect Drosophila melanogaster Male Behavior

    E-Print Network [OSTI]

    Ellis, Lisa Lynn

    2011-10-21T23:59:59.000Z

    interactions ..................................................................................... 1 Drosophila melanogaster as a tool for understanding behavior .... 3 Reproductive behaviors of Drosophila males ................................ 4... melanogaster courtship ritual .................................................. 6 3 The Drosophila somatic sex-determination hierarchy regulates somatic tissue development and courtship behavior ............................................... 7 4...

  11. Decision aids to maximize profits from dairy sire selection and individual cow matings

    E-Print Network [OSTI]

    McMahon, Rex Travis

    1984-01-01T23:59:59.000Z

    , and percentile rank among proven sires of randomly sampled young sires and young sires in-waiting for 1-generation (PV$1) and infinite generation (PV$ oo ) planning horizons for semen costs of $8 and $5 per unit. . . . . . . . . . 36 LIST OF FIGURES Figure... in the PH ( 1 to 5 and infinite generations). CALCULATION OF NET PRESENT VALUES The linear net merit index (net present value of semen when first breeding a cow) for a speci fied SP, herd CR, and PH was: PVS = B P + B (M + T )~F where 9 PVS =net...

  12. Costs of mating competition limit male lifetime breeding success in polygynous mammals

    E-Print Network [OSTI]

    Lukas, Dieter; Clutton-Brock, Tim

    2014-05-14T23:59:59.000Z

    ., Dobson, F. S. 2003 The relative importance of life?history variables to population Page 15 of 25 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 growth rate in mammals: Cole’s prediction revisited. Am. Nat. 161... . Slate, J., Visscher, P. M., MacGregor, S., Stevens, D., Tate, M. L., & Pemberton, J. M. 2002 A genome scan for quantitative trait loci in a wild population of red deer (Cervus elaphus). Genetics 162(4), 1863-1873. S95. Schubert, G., Vigilant, L., Boesch...

  13. a2 mating-type locus: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Main Outcome Measures: We analyzed 380 micro- satellite markers and conducted linkage analysis Boyer, Edmond 32 Regression-Based Multivariate Quantitative Trait Locus Mapping...

  14. SPACE USE, CIRCADIAN ACTIVITY PATTERN, AND MATING SYSTEM OF THE NOCTURNAL TREE RAT

    E-Print Network [OSTI]

    Helsinki, University of

    , spatial behavior and home-range size depend on body mass, energy requirements, and habitat productivity. Home ranges included the nests of 8­10 females, 6 different daytime resting places, and 3­5 areas of high activity. Males were mobile within home ranges of 5­10 ha (90% minimal convex polygons

  15. Social Influences on Food Choices of Norway Rats and Mate Choices of Japanese Quail

    E-Print Network [OSTI]

    Galef, Jr., Bennett G.

    2001-01-01T23:59:59.000Z

    ecology and sociology of the Norway rat . Bethesda: U.S. De-food stealing by young Norway rats. Journal of Comparativesufficient diet by Norway rats. Journal of Comparative

  16. Male mating behavior and costs of sexual harassment for females in cavernicolous and extremophile

    E-Print Network [OSTI]

    Schlupp, Ingo

    by physicochemical stressors, such as toxic hydrogen sulfide (H2S), or the fish occur in lightless subterranean (cave) habitats. Using five different populations from surface habitats with or without H2S, and from a sulfidic with at least one physicochemical stressor present (H2S or absence of light), a reduction in male sexual

  17. Courtship acoustics and mating in Cotesia, a genus of parasitoid wasps

    E-Print Network [OSTI]

    Joyce, Andrea Lee

    2009-05-15T23:59:59.000Z

    complex, C. flavipes and C. sesamiae, and for C. marginiventris. During courtship, male Cotesia fan their wings and produce low amplitude sounds and substrate vibrations. The airborne and substrate components of courtship were similar within a species...

  18. On the role of schistosome mating structure in the maintenance of ...

    E-Print Network [OSTI]

    2005-09-09T23:59:59.000Z

    method of schistosomiasis control involves chemotherapeutic treatment of ...... different geographic scales, and the likely impact of gene flow and selection ...

  19. Transcriptional Regulation in Algae, Fungi and Plants: Mating Loci, Splicing, and miRNAs

    E-Print Network [OSTI]

    Douglass, Stephen Michael

    2014-01-01T23:59:59.000Z

    from organisms ranging from algae to fungi and plants. WeTranscriptional Regulation in Algae, Fungi and Plants:Transcriptional Regulation in Algae, Fungi and Plants:

  20. LETTER Revisiting telegony: offspring inherit an acquired characteristic of their mother's previous mate

    E-Print Network [OSTI]

    Bonduriansky, Russell

    effect with potential implications for the evolution of reproductive strategies. Keywords Condition, diet, inheritance of acquired traits, non-genetic inheritance, paternal effect, plasticity, seminal proteins it lacked unequivocal empirical support and was deemed incompatible with Mendelian genetics (Burkhardt 1979

  1. A framework to create customised LHC analyses within CheckMATE

    E-Print Network [OSTI]

    Kim, Jong Soo; Tattersall, Jamie; Rolbiecki, Krzysztof

    2015-01-01T23:59:59.000Z

    Checkmate is a framework that allows the user to conveniently test simulated BSM physics events against current LHC data in order to derive exclusion limits. For this purpose, the data runs through a detector simulation and is then processed by a user chosen number of experimental analyses. These analyses are all defined by signal regions that can be compared to the experimental data with a multitude of statistical tools. Due to the large and continuously growing number of experimental analyses available, users may quickly find themselves in the situation that the study they are particularly interested in has not (yet) been implemented officially into the Checkmate framework. However, the code includes a rather simple framework to allow users to add new analyses on their own. This document serves as a guide to this. In addition, Checkmate serves as a powerful tool for testing and implementing new search strategies. To aid this process, many tools are included to allow a rapid prototyping of new analyses.

  2. A framework to create customised LHC analyses within CheckMATE

    E-Print Network [OSTI]

    Jong Soo Kim; Daniel Schmeier; Jamie Tattersall; Krzysztof Rolbiecki

    2015-06-02T23:59:59.000Z

    Checkmate is a framework that allows the user to conveniently test simulated BSM physics events against current LHC data in order to derive exclusion limits. For this purpose, the data runs through a detector simulation and is then processed by a user chosen number of experimental analyses. These analyses are all defined by signal regions that can be compared to the experimental data with a multitude of statistical tools. Due to the large and continuously growing number of experimental analyses available, users may quickly find themselves in the situation that the study they are particularly interested in has not (yet) been implemented officially into the Checkmate framework. However, the code includes a rather simple framework to allow users to add new analyses on their own. This document serves as a guide to this. In addition, Checkmate serves as a powerful tool for testing and implementing new search strategies. To aid this process, many tools are included to allow a rapid prototyping of new analyses.

  3. Costs of mating competition limit male lifetime breeding success in polygynous mammals

    E-Print Network [OSTI]

    Lukas, Dieter; Clutton-Brock, Tim

    2014-05-14T23:59:59.000Z

    . Nature 462(7274), 786-789. 42. Young, A. J. & Bennett, N. C. 2013 Intra-sexual selection in cooperative mammals and birds: why are females not bigger and better armed? Phil. Trans. R. Soc. B 368(1631), 20130075. Supplementary references S43. Glander, K. E...

  4. Gene expression divergence and nucleotide differentiation between males of different color morphs and mating

    E-Print Network [OSTI]

    Gene expression divergence and nucleotide differentiation between males of different color morphs sequencing, it is possible to obtain data on both nucleotide sequence variation and gene expression. We have between males, but many genetic markers showed nucleotide differentiation between different color morphs

  5. The Effect of Cognitive Load on Human Mate Choice in Online Dating 

    E-Print Network [OSTI]

    Chisholm, Martin

    2011-06-29T23:59:59.000Z

    time spent viewing a profile, the number of times a certain area is fixated upon and the sections of a profile that catch the eye first. 61 participants between the ages of 18 and 29 provided data and the results of three 2 (Condition: Load vs. No Load...

  6. Available online at www.sciencedirect.com Female mate choice copying affects sexual selection in wild

    E-Print Network [OSTI]

    Indiana University

    in wild populations of the ocellated wrasse SUZANNE H. ALONZO Department of Ecology and Evolutionary and importance of nonindependent female choice in wild popula- tions. In a species with male territoriality under natural conditions in the wild. I further show that a short- term experimental increase

  7. s the sage grouse gather on the Wyoming prairie to find mates this

    E-Print Network [OSTI]

    Patricelli, Gail

    ,hebuiltamechanicallycon- trolled honeybee of wax-coated brass to help him decode the insects' dances, which tell others in the hive-con- trolled model not only turns and makes provocative crouching movements, it is also equipped with video

  8. Chemical mediation of male mate location behavior in the parasitoid Cardiochiles nigriceps (Hymenoptera: Braconidae)

    E-Print Network [OSTI]

    Syvertsen, Thomas Charles

    1992-01-01T23:59:59.000Z

    . nigriceps on the downwind edge of the slide (Figure 4). After the male became relaxed the air stream was turned on and the responses of the male were recorded with a video camera. Each male was allowed 1. 0 minute to respond. If the response was positive... and courtship was elicited no max- imum observation time was set and the behaviors were observed until the male dismounted the model. Video recordings of the experiments were re- played at a later time and events were logged with an event recorder. Courtship...

  9. MATING SYSTEM EVOLUTION, PLANT-POLLINATOR INTERACTIONS, AND FLORAL ULTRAVIOLET PATTERNING IN MIMULUS GUTTATUS

    E-Print Network [OSTI]

    Bodbyl-Roels, Sarah Ann

    2012-08-31T23:59:59.000Z

    the introduced European honeybee, Apis mellifera, is now a frequent visitor to lower elevation populations of M. guttatus (Macnair et al. 1989; Martin 2004; Ivey and Carr 2005). Admittedly, studies documenting field visitation of flowers by potential pollinators...

  10. Universal dimensions of human mate preferences Todd K. Shackelford a,*, David P. Schmitt b

    E-Print Network [OSTI]

    Pillow, Jonathan

    M. Buss c a Florida Atlantic University, Department of Psychology, 2912 College Avenue, Davie, FL [Buss, D. M. (1989)]. Participants from each culture responded to the same 18-item measure. Statistical (for reviews, see Buss, 1998, 2003; Gangestad & Simpson, 2000; Okami & Shackelford, 0191-8869/$ - see

  11. ABILITY OF MALE KING CRAB, PARALITHODES CAMTSCHATICA, TO MATE REPEATEDLY, KODIAK, ALASKA, 1973

    E-Print Network [OSTI]

    , and Buss'). I Alaska Dept. of Fish & Game. Commercial Fisheries Diy.. Box 686. Kodiak. AK 99615. 2 Bio. Rothschild. and James A. Buss. 1972. A studY of king. PlIrt/IiI/lOd"s C(III/IS/wI/ClI (Tilesius) hrook stocks

  12. Are men really more `oriented' toward short-term mating than

    E-Print Network [OSTI]

    Pillow, Jonathan

    and research David P. Schmitt Bradley University Todd K. Shackelford Florida Atlantic University David M. Buss University of Texas at Austin Abstract According to Sexual Strategies Theory (D.M. Buss and D.P. Schmitt 1993 and temporal commitment associated with long-term, marital relationships (Buss and Schmitt 1993). In a meta

  13. Kind toward whom? Mate preferences for personality traits are target specific

    E-Print Network [OSTI]

    Cosmides, Leda

    and trustworthiness above all other aspects of personality (e.g., Botwin, Buss & Shackelford, 1997; Buss et al., 1990; Buss & Barnes, 1986; Cottrell, Neuberg & Li, 2007; Ellis, Simpson & Campbell, 2002; Fletcher, Simpson

  14. INTERPERSONAL RELATIONS AND GROUP PROCESSES Sex Differences in Mate Preferences Revisited: Do People Know What

    E-Print Network [OSTI]

    Reber, Paul J.

    (Buss, 1989, 1994; Buss & Kenrick, 1998; Buss & Schmitt, 1993).1 In the present study, we replicated (Buss, 1989; Buss & Schmitt, 1993; Kenrick & Keefe, 1992; Symons, 1979). The present report focuses

  15. Meet the parents: Parent-offspring convergence and divergence in mate preferences Carin Perilloux

    E-Print Network [OSTI]

    Pillow, Jonathan

    , Diana S. Fleischman 1 , David M. Buss Department of Psychology, University of Texas at Austin, 1 preferences: how they vary by sex (Buss, 1989; Buss & Barnes, 1986; Kenrick, Sadalla, Groth, & Trost, 1990, & Linsenmeier, 2002), how they change based on individual differences and context (Buss & Schmitt, 1993

  16. noncoercive mate diversification strategies are developmentally selected by individuals who are supernormally endowed with cer-

    E-Print Network [OSTI]

    biasing their Gibsonian affordances. Buss (1994b) and G&S might therefore both be right. Buss writes about

  17. Renewable Portfolio Standards in the United States - A Status Report with Data Through 2007

    E-Print Network [OSTI]

    Wiser, Ryan

    2008-01-01T23:59:59.000Z

    LSE MISO M-RETS MSW MW MWh PJM POU PRC PSC PUC PV REC RPSelectric service provider PJM Generation Attributes Trackingwaste megawatt megawatt-hour PJM Interconnection publicly

  18. 2012 Wind Technologies Market Report

    E-Print Network [OSTI]

    Wiser, Ryan

    2014-01-01T23:59:59.000Z

    MISO Transmission Expansion Plan 2012 megawatt megawatt-hour North American Electric ReliabilityMISO), New York ISO (NYISO), ISO-New England (ISO-NE), California ISO (CAISO), Electric Reliability

  19. Subcontract Report NREL/SR-7A2-48318

    E-Print Network [OSTI]

    Wh kilowatt-hour LED light emitting diode MECO Maui Electric Company MWh megawatt-hour NAECA National

  20. ADVANCED NEUTRAL-BEAM TECHNOLOGY

    E-Print Network [OSTI]

    Berkner, K.H.

    2010-01-01T23:59:59.000Z

    bending magnets, electrical power systems capable of fastF. Power Systems The several megawatts of electrical power

  1. Evaluation Framework and Tools for Distributed Energy Resources

    E-Print Network [OSTI]

    Gumerman, Etan Z.; Bharvirkar, Ranjit R.; LaCommare, Kristina Hamachi; Marnay, Chris

    2003-01-01T23:59:59.000Z

    prices megawatt (10 watts) natural gas combined cycle not in my backyard nitrogen oxides particulate matter photovoltaic

  2. 851 S.W. Sixth Avenue, Suite 1100 Steve Crow 503-222-5161 Portland, Oregon 97204-1348 Executive Director 800-452-5161

    E-Print Network [OSTI]

    -hours of electricity (about 126 average megawatts). Clatskanie PUD purchases power from Bonneville under a combined is exchanged with Bonneville, and owns an 11 megawatt gas turbine. Clatskanie PUD will also purchase 15 megawatts of power from a FERC approved addition of generation capacity to the Arrowrock dam, located

  3. 851 S.W. Sixth Avenue, Suite 1100 Steve Crow 503-222-5161 Portland, Oregon 97204-1348 Executive Director 800-452-5161

    E-Print Network [OSTI]

    electricity use for irrigation decreased from 655 average megawatts to 645 average megawatts. After accounting electricity use for dairy milk production was approximately 55 average megawatts. Many of the dairies SUBJECT: Agriculture and Irrigated Agriculture Conservation Resource Potential and Cost In the 5th Plan

  4. Measuring the Kernel TimeDependent Density Functional Theory with XRay Absorption Spectroscopy Transition Metals

    E-Print Network [OSTI]

    Gross, E.K.U.

    Transition Metals Scherz, Gross, Appel, Sorg, K. Baberschke, and Wende Fachbereich Physik, Freie Universita­Kohn approximation prob­ lem shown, new approximation suggested. But the value DFT constructing approxi­ mation

  5. Measuring the Kernel of Time-Dependent Density Functional Theory with X-Ray Absorption Spectroscopy of 3d Transition Metals

    E-Print Network [OSTI]

    Gross, E.K.U.

    of 3d Transition Metals A. Scherz,* E. K. U. Gross, H. Appel, C. Sorg, K. Baberschke, and H. Wende, and a new approximation suggested. But the true value of DFT is in constructing one XC approxi- mation

  6. Volume 0 (1981), Number 0 pp. 117 Soft Shadow Maps

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    techniques, our algorithm does not dramatically overestimate the umbra region [WH03,CD03]. Fourth, while other methods have relied on an interpola- tion from the umbra to the non-shadowed region to approxi

  7. Current-driven transformations of the intermediate-state patterns in type-I superconductors Jacob R. Hoberg and Ruslan Prozorov*

    E-Print Network [OSTI]

    Current-driven transformations of the intermediate-state patterns in type-I superconductors Jacob R-II superconductors each bearing a single flux quanta, tubes in type-I superconductors may contain up to approxi

  8. Social Traditions and the Maintenance and Loss of Geographic Variation in Mating Patterns of Brown-Headed Cowbirds

    E-Print Network [OSTI]

    Freeberg, Todd M.; White, David J.

    2006-01-01T23:59:59.000Z

    Social Traditions and the Maintenance and Loss of Geographiccould play a role in the maintenance of distinct groupings

  9. Both mating types in the heterothallic fungus Ophiostoma quercus contain MAT1-1 and MAT1-2 genes

    E-Print Network [OSTI]

    .wingfield@fabi.up.ac.za journal homepage: www.elsevier.com/locate/funbio f u n g a l b i o l o g y 1 1 6 ( 2 0 1 2 ) 4 2 7 e4 3 7 includes two of the three known Dutch elm disease pathogens (Ophiostoma ulmi and Ophiostoma novo-ulmi) which, as invasive species, have been responsible for the death of millions of Elm trees in the Northern

  10. The Effect of Environmental Contaminants on Mating Dynamics and Population Viability in a Sex-Role-Reversed Pipefish

    E-Print Network [OSTI]

    Partridge, Charlyn G.

    2010-07-14T23:59:59.000Z

    Understanding how anthropogenic activity impacts the health and viability of wildlife populations is one of the most important tasks of environmental biology. A key concern related to bi-products of human activity is the accumulation...

  11. From US NAVY Mate to Division Leader for Operations - Requirements, Development and Career Paths of LANL/LANSCE Accelerator Operators

    SciTech Connect (OSTI)

    Spickermann, Thomas [Los Alamos National Laboratory

    2012-07-26T23:59:59.000Z

    There are opportunities for advancement within the team. Operators advance by: (1) Becoming fully qualified - following the LANSCE Accelerator Operator Training Manual, Operator trainees go through 5 levels of qualification, from Radiation Security System to Experimental Area Operator. Must obtain Knowledge and Performance checkouts by an OSS or AOSS, and an End-of-Card checkout by the team leader or RSS engineer (level I). Program was inspired by US NAVY qualification program for nuclear reactor operators. Time to complete: 2-2.5 years. (2) Fully qualified operators are eligible to apply for vacant (OSS)/AOSS positions; and (3) Alternatively, experienced operators can sign up for the voluntary Senior Operator Qualification Program. They must demonstrate in-depth knowledge of all areas of the accelerator complex. Time to complete is 2-3 years (Minimum 4 years from fully qualified). Eligible for promotion to level between qualified operator and AOSS.

  12. Microsatellites and conservation genetics: genetic variability and mating behavior of the Kemp's ridley sea turtle, Lepidochelys kempi

    E-Print Network [OSTI]

    Kichler, Kristina Lynn

    1996-01-01T23:59:59.000Z

    Kemp's ridley sea turtles, Lepidochelys kempi, underwent a population crash over a period of approximately thirty-five years that made them the most endangered of the sea turtle species. To understand the impact of the crash and to learn more about...

  13. Method and system for evaluating integrity of adherence of a conductor bond to a mating surface of a substrate

    DOE Patents [OSTI]

    Telschow, K.L.; Siu, B.K.

    1996-07-09T23:59:59.000Z

    A method of evaluating integrity of adherence of a conductor bond to a substrate includes: (a) impinging a plurality of light sources onto a substrate; (b) detecting optical reflective signatures emanating from the substrate from the impinged light; (c) determining location of a selected conductor bond on the substrate from the detected reflective signatures; (d) determining a target site on the selected conductor bond from the detected reflective signatures; (e) optically imparting an elastic wave at the target site through the selected conductor bond and into the substrate; (f) optically detecting an elastic wave signature emanating from the substrate resulting from the optically imparting step; and (g) determining integrity of adherence of the selected conductor bond to the substrate from the detected elastic wave signature emanating from the substrate. A system is disclosed which is capable of conducting the method. 13 figs.

  14. Mating behaviour, epibiotic growth, and the effect of salinity on grooming activity in the hermaphroditic shrimp Lysmata wurdemanni 

    E-Print Network [OSTI]

    Giri, Tuhin

    2004-09-30T23:59:59.000Z

    species of decapod crustaceans observed to exhibit protandry, 31 belong to the Infraorder Caridea (reviewed in Bauer (2000)). Protandric hermaphroditism found in these shrimp is believed to have evolved from a gonochoristic ancestor, but the mechanism... females, as well as individuals that experience a very short male phase; (D) Protandry with primary males; (E) Protandric simultaneous hermaphroditism. (After Bauer (2000)) Juvenile Male Female A Juvenile Male Female Primary Female B Juvenile...

  15. First male sperm precedence in multiply-mated females of the cooperative spider Anelosimus studiosus (Araneae, Theridiidae)

    E-Print Network [OSTI]

    Jones, Thomas C.

    University, Johnson City, Tennessee 37614, USA. E-mail: jonestc@etsu.edu Patricia G. Parker: Department

  16. Haloferax volcanii archaeosortase is required for motility, mating, and C-terminal processing of the S-layer glycoprotein

    SciTech Connect (OSTI)

    Halim, Mohd F.; Pfeiffer, Friedhelm; Zou, James; Frisch, Andrew; Haft, Daniel H.; Wu, Si; Tolic, Nikola; Brewer, Heather M.; Payne, Samuel H.; Pasa-Tolic, Ljiljana; Pohlschroder, Mechthild

    2013-06-01T23:59:59.000Z

    Cell surfaces are decorated by a variety of proteins that facilitate interactions with their environments and support cell stability.These secreted proteins are anchored to the cell by mechanisms that are diverse, and, in archaea, poorly understood. Recently published in silico data suggest that in some species a subset of secreted euryarchaeal proteins, which includes the S-­?layer glycoprotein, is processed and covalently linked tot he cell membrane by enzymes referred to as archaeosortases. In silico work led to the proposal that an independent, sortase-like system for proteolysis-coupled carboxy-terminal lipid modification exists in bacteria (exosortase) and archaea (archaeosortase). Here, we provide the first in vivo characterization of an archaeosortase in the haloarchaeal model organism Haloferax volcanii. Deletion of the artA gene (HVO_0915) resulted in multiple biological phenotypes: (a) poor growth, especially under low-salt conditions, (b) alterations in cell shape and the S-layer, (c) impaired motility, suppressors of which still exhibit poor growth, and (d) impaired conjugation. We studied one of the ArtA substrates, the S-layer glycoprotein, using detailed proteomic analysis. While the carboxy-terminal region of S-layer glycoproteins, consisting of a threonine-rich O-glycosylated region followed by a hydrophobic transmembrane helix, has been notoriously resistant to any proteomic peptide identification, we were able to identify two overlapping peptides from the transmembrane domain present in the ?artA strain but not in the wild-type strain. This clearly shows that ArtA is involved in carboxy-terminal posttranslational processing of the S-layer glycoprotein. As it is known from previous studies that a lipid is covalently attached to the carboxy-terminal region of the S-layer glycoprotein, our data strongly support the conclusion that archaeosortase functions analogously to sortase, mediating proteolysis-coupled, covalent cell surface attachment.

  17. Models and analysis of yeast mating response : tools for model building, from documentation to time-dependent stimulation

    E-Print Network [OSTI]

    Thomson, Ty M. (Ty Matthew)

    2008-01-01T23:59:59.000Z

    Molecular signaling systems allow cells to sense and respond to environmental stimuli. Quantitative modeling can be a valuable tool for evaluating and extending our understanding of signaling systems. In particular, studies ...

  18. vol. 166, no. 3 the american naturalist september 2005 Weapon Performance, Not Size, Determines Mating Success and Potential

    E-Print Network [OSTI]

    Husak, Jerry F.

    with bite force. These results indicate that weapon performance has far stronger effects on fitness thanvol. 166, no. 3 the american naturalist september 2005 Weapon Performance, Not Size, Determines the head (i.e., jaws and associated musculature) as a weapon when territorial interactions escalate

  19. A survival cost to mating in a polyandrous butterfly, Colias eurytheme Darrell J. Kemp and Ronald L. Rutowski

    E-Print Network [OSTI]

    Rutowski, Ronald L.

    OIKOS 105:1 (2004) 65 #12;including the stimulation of increased egg production and decreased sexual all females, and across females within each treatment group, hence there was no phenotypic trade

  20. Mating flight initiation and nutritional status of Solenopsis invicta (Hymenoptera: Formicidae) alates infected with Thelohania solenopsae (Microsporida: Thelohaniidae) 

    E-Print Network [OSTI]

    Overton, Katherine Jane

    2005-02-17T23:59:59.000Z

    Thelohania solenopsae Knell, Allen and Hazard, is a microsporidian pathogen that infects the red imported fire ant Solenopsis invicta Buren. This four part study examined the effects that T. solenopsae had on fire ant ...

  1. Mating flight initiation and nutritional status of Solenopsis invicta (Hymenoptera: Formicidae) alates infected with Thelohania solenopsae (Microsporida: Thelohaniidae)

    E-Print Network [OSTI]

    Overton, Katherine Jane

    2005-02-17T23:59:59.000Z

    Thelohania solenopsae Knell, Allen and Hazard, is a microsporidian pathogen that infects the red imported fire ant Solenopsis invicta Buren. This four part study examined the effects that T. solenopsae had on fire ant queens as they matured...

  2. Massachusetts Takes On Climate Change

    E-Print Network [OSTI]

    Kimmell, Ken; Laurie, Burt

    2009-01-01T23:59:59.000Z

    promote a clean and green energy economy. Massachusetts'megawatt-hours of green energy supplied to its customers.job creation in the green energy sector, promote workforce

  3. Microturbine Economic Competitiveness: A Study of Two Potential Adopters

    E-Print Network [OSTI]

    Firestone, Ryan; Marnay, Chris

    2005-01-01T23:59:59.000Z

    Capstone 60 kW Microturbine CHP System” Southern ResearchLBNL-57985 Microturbine Economic Competitiveness: A Study ofNational Laboratory microturbine megawatt Naval Base Ventura

  4. Report: U.S. Military Accelerates Deployment of Clean Energy...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Navigant Research, Pew's clean energy research partner for this report, 384 megawatts of installed renewable energy capacity are intalled on military facilities in mid-2013. By...

  5. Energy Department Names Virginia and Illinois Electric Co-ops...

    Energy Savers [EERE]

    adding more than 260 megawatts of capacity to their existing resource portfolio. As a wholesale power supply cooperative, ODEC generates and procures power to serve the...

  6. EA-1465: Final Environmental Assessment | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    65: Final Environmental Assessment EA-1465: Final Environmental Assessment Wind Energy Center EdgeleyKulm Project, North Dakota The proposed EdgeleyKulm Project is a 21-megawatt...

  7. EIS-0361: EPA Notice of Availability of the Draft Environmental...

    Broader source: Energy.gov (indexed) [DOE]

    a 98 megawatt (MWe) Net Power Plant and Ash Byproduct Manufacturing Facility, Rainelle, West Virginia Environmental Impact Statements; Notice of Availability (Western Greenbrier...

  8. Reducing the Environmental Footprint and Economic Costs of Automotive Manufacturing through an Alternative Energy Supply

    E-Print Network [OSTI]

    Yuan, Chris; Dornfeld, David

    2009-01-01T23:59:59.000Z

    density (Slaymaker where W: actual output of the solar powerSOLAR RADIATION DENSITY AND ACTUAL OUTPUT OF A 1 MEGAWATT PV POWER

  9. Department of Energy Finalizes Loan Guarantee for New Transmission...

    Energy Savers [EERE]

    line that will carry approximately 600 megawatts of electricity, including from renewable energy resources, in northern Nevada. This is the Department's first loan...

  10. CX-009702: Categorical Exclusion Determination | Department of...

    Broader source: Energy.gov (indexed) [DOE]

    (BPA) proposes to integrate the existing 2.25-megawatt City of Walla Walla hydro project into the Federal Columbia River Transmission System (FCRTS). The proposed...

  11. CX-006258: Categorical Exclusion Determination | Department of...

    Broader source: Energy.gov (indexed) [DOE]

    Power Administration (BPA) is planning to integrate their 1.1-Megawatt Esquatzel Hydro Generation Project into its balancing authority (BA). The proposed point of...

  12. Interconnection Standards

    Broader source: Energy.gov [DOE]

    In September 2007, the Washington Utilities and Transportation Commission (UTC) adopted interconnection standards for distributed generation (DG) systems up to 20 megawatts (MW) in capacity. The...

  13. advanced cold moderator: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    issues CERN Preprints Summary: The Japan Atomic Energy Research Institute and the High Energy Accelerator Research Organization have been developing a Mega-Watt scale spallation...

  14. agenda da reforma: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    the suitability of California utility-scale (nominally 250- 600+ Megawatt) natural gas combined cycle (NGCC) power plants for carbon capture and sequestration (CCS) retrofit...

  15. Corporate Property Tax Reduction for New/Expanded Generating Facilities

    Broader source: Energy.gov [DOE]

    Montana generating plants producing one megawatt (MW) or more with an alternative renewable energy source are eligible for the new or expanded industry property tax reduction. This incentive...

  16. Robert M. Blue President Dominion Virginia Power

    Broader source: Energy.gov (indexed) [DOE]

    northeast. As of early March, more than 80 such developments had filed for state construction permits. If they are all built, they would represent about 585 megawatts of...

  17. --No Title--

    U.S. Energy Information Administration (EIA) Indexed Site

    Tennessee at 8 megawatts, began operations in Chattanooga in February 2014. Average site electricity consumption for Tennessee households is 33 percent higher than the national...

  18. Alternative Energy Development Incentive (Personal)

    Broader source: Energy.gov [DOE]

    Eligible projects include the construction of electricity generation facilities of 2 megawatts or greater that utilize hydroelectric, solar, biomass, geothermal, wind, or waste heat from an indus...

  19. Alternative Energy Development Incentive (Corporate)

    Broader source: Energy.gov [DOE]

    Eligible projects include the construction of electricity generation facilities of 2 megawatts or greater that utilize hydroelectric, solar, biomass, geothermal, wind, or waste heat from an indus...

  20. CX-005566: Categorical Exclusion Determination | Department of...

    Broader source: Energy.gov (indexed) [DOE]

    generating 1 megawatt (Mw) of electricity. The Columbus digester is creating excess biogas that has the potential to generate 275,912 gallons of gasoline equivalent (gge) each...

  1. Loan Guarantees for Three California PV Solar Plants Expected...

    Broader source: Energy.gov (indexed) [DOE]

    across the country. Combined, the projects will produce 1330 Megawatts of installed solar power -- enough electricity to power about 275,000 homes. Building on the momentum of...

  2. DOE Finalizes $1.45 Billion Loan Guarantee for One of the World...

    Office of Environmental Management (EM)

    Abengoa Solar Inc.'s Solana project, the world's largest parabolic trough concentrating solar plant. Located near Gila Bend, Arizona, the 250-megawatt (MW) project is the first...

  3. Direct Confirmation of Commercial Geothermal Resources in Colorado...

    Open Energy Info (EERE)

    Megawatts by location. Awardees (Company Institution) Flint Geothermal, LLC Partner 1 University of Colorado, Boulder Partner 2 Geothermal Development Associates Partner 3...

  4. area ny hovedflyplass: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Fax: (518) 437-8659 Energy Storage, Conversion and Utilization Websites Summary: statistics with a generic turbine power curve reflecting current megawatt-scale wind...

  5. Member, District #9 Board of Supervisors

    E-Print Network [OSTI]

    Kammen, Daniel M.

    and building 360 Megawatts of new solar photovoltaic installations, distributed generation such as fuel cells, wind turbines, hydrogen, and energy efficiency and conservation technologies as standard components

  6. Effective Renewable Energy Policy: Leave It to the States?

    E-Print Network [OSTI]

    Weissman, Steven

    2011-01-01T23:59:59.000Z

    megawatts of installed renewable energy capacity in thePortfolio Standards,” Renewable Energy Law Blog (Apr. 30,as well as small renewable energy power facilities (no

  7. Energy Efficiency in Western Utility Resource Plans: Impacts on Regional Resources Assessment and Support for WGA Policies

    E-Print Network [OSTI]

    Hopper, Nicole; Goldman, Charles; Schlegal, Jeff

    2006-01-01T23:59:59.000Z

    PNM PSCO PSE PUC SDG&E SCE WECC average megawatts Britishwith appropriate NERC and WECC committees and subcommitteesconsistent across NERC, WECC and state/regional assessments

  8. agricultural matrix canopy: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    two major surface parking areas. In conjunction with the existing 1.4 megawatt solar energy facility on this campus, this project will generate Delgado, Mauricio 17 Original...

  9. artificial canopy gaps: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    two major surface parking areas. In conjunction with the existing 1.4 megawatt solar energy facility on this campus, this project will generate Delgado, Mauricio 29 Oak...

  10. andean-patagonian canopied stream: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    two major surface parking areas. In conjunction with the existing 1.4 megawatt solar energy facility on this campus, this project will generate Delgado, Mauricio 16 GEOMORPHIC...

  11. Large-Scale Renewable Energy Projects (Larger than 10 MWs) |...

    Broader source: Energy.gov (indexed) [DOE]

    Renewable energy projects larger than 10 megawatts (MW) are complex and typically require private-sector financing. The Federal Energy Management Program (FEMP) developed a guide...

  12. anzaas congress abstracts: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    77 Presented at Solar World Congress, Beijing, September 18 22 2007 PARABOLOIDAL DISH SOLAR CONCENTRATORS FOR MULTI-MEGAWATT Renewable Energy Websites Summary: ,AUSTRALIA...

  13. Federal Energy-Saving Program Keeps Federal Government on Pace...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    to avoid upfront capital cost. The 39-megawatt plant is dramatically reducing pollution and greenhouse gas emissions. The Navy designed and constructed a state-of-the-art...

  14. Utilities in California and Washington Receive Honors for Innovative...

    Office of Environmental Management (EM)

    more than 710 megawatts of installed wind capacity. By carefully structuring the power purchase agreements across five wind projects, Southern California secured energy...

  15. Slide 1

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Boundary and Water Commission, as well as a number of private entities. These plants combined have an installed capacity of 10,395 megawatts. Western is divided into...

  16. Interconnection Standards for Small Generators

    Broader source: Energy.gov [DOE]

    The Federal Energy Regulatory Commission (FERC) adopted "small generator" interconnection standards for distributed energy resources up to 20 megawatts (MW) in capacity in May 2005.* The FERC's...

  17. Environmental Assessment for the Methane Energy and Agricultural...

    Broader source: Energy.gov (indexed) [DOE]

    DOEEA-1402 vi MW Megawatts NAAQS National Ambient Air Quality Standards NAS Naval Air Station NDPES National Pollution Discharge Elimination System NEPA National...

  18. 2010 Wind Technologies Market Report

    E-Print Network [OSTI]

    Wiser, Ryan

    2012-01-01T23:59:59.000Z

    kilowatt-hour Midwest Independent System Operator megawattPJM), Midwest Independent System Operator (MISO), New Yorkin 2009. The Midwest Independent System Operator (MISO) (net

  19. August

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    is requested. In the January 25,2010 application, CHPEI proposed a 2,000-megawatt (MW) HVDC Voltage Source Converter controllable transmission system project, consisting of two...

  20. Green Power Purchasing

    Broader source: Energy.gov [DOE]

    Eligible resources include tidal and wave power, fuel cells using renewable fuels, hydropower facilities less than 60 megawatts (MW), solar thermal-electric systems, photovoltaics (PV), wind,...

  1. Lana'ai Hawaii: An Inside Look at the World's Most Advanced Renewable...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    of Lanai with multi-megawatt solar PV generation. Location Hawaii United States See map: Google Maps Date October 2009 Topic Solar Basics & Educating Consumers Systems...

  2. Port of Morrow, Oregon

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    wind energy projects in Wyoming, Oregon, and Washington and small amounts of power from solar photovoltaic projects. Bonneville also has contracted to purchase 49.9 megawatts...

  3. Sandia Energy - EC Publications

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Modal Dynamics and Stability of Large Multi-megawatt Deepwater Offshore Vertical-axis Wind Turbines: Initial Support Structure and Rotor Design Impact StudiesTara...

  4. New Report Highlights Trends in Offshore Wind with 14 Projects...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    the advanced stages of development- together representing nearly 4,900 megawatts (MW) of potential offshore wind energy capacity for the United States. Further, this year's report...

  5. Guam - Territory Energy Profile Overview - U.S. Energy Information...

    U.S. Energy Information Administration (EIA) Indexed Site

    Utility Commission approved two Guam Power Authority contracts for the first commercial wind and solar projects, which total 35 megawatts and are due to begin operation in...

  6. Pacific Northwest Smart Grid Demonstration Project SUCCESS STORIES

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    City Light's second largest customer. Even so, the campus also has its own five megawatt steam turbine generator. The power is distributed through a network of underground utility...

  7. NREL: Energy Systems Integration - Energy Systems Integration...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Printable Version Energy Systems Integration Facility Newsroom The Energy Systems Integration Facility (ESIF) will be one of the only megawatt-scale test facilities in the United...

  8. 851 S.W. Sixth Avenue, Suite 1100 Steve Crow 503-222-5161 Portland, Oregon 97204-1348 Executive Director 800-452-5161

    E-Print Network [OSTI]

    a review of how regional generating resource installed capacity and energy availability have changed over the same time period. Since 1995, about 16,600 megawatts of new installed capacity has been added from natural gas-fired generators. During the same period, about 870 megawatts of installed capacity

  9. 2006 INTEGRATED ENERGY POLICY REPORT UPDATE

    E-Print Network [OSTI]

    electricity. By comparison, since 2002 more than 1,500 MW of new wind capacity has been installed in Texas,936 megawatts of renewable capacity. However, only 242 megawatts of those renewable contracts represent new generating capacity over the next four years beyond what is already under contract. Chapter 2, "Midcourse

  10. Application of Molten Salt Reactor Technology to MMW In-Space NEP and Surface Power Missions

    SciTech Connect (OSTI)

    Patton, Bruce; Sorensen, Kirk [Propulsion Research Center, Marshall Space Flight Center, Huntsville, AL 35812 (United States)

    2002-07-01T23:59:59.000Z

    Anticipated manned nuclear electric propulsion (NEP) and planetary surface power missions will require multi-megawatt nuclear reactors that are lightweight, operationally robust, and sealable in power for widely varying scientific mission objectives. Molten salt reactor technology meets all of these requirements and offers an interesting alternative to traditional multi-megawatt gas-cooled and liquid metal concepts. (authors)

  11. Evaluating GHGs in the Seattle City Light IRP

    E-Print Network [OSTI]

    Megawatts - Solar PV - Wind 2 - Wind - Waste Wood Biomass - Geothermal - Hydro Efficiency - Landfill GasMegawatts - RECs (aMW) - Solar PV - Wind - Waste Wood Biomass - Geothermal - Hydro Efficiency - Landfill Gas1 Evaluating GHGs in the Seattle City Light IRP Greenhouse Gas & the Regional Power System

  12. 3Energy in the Home Every month, we get the Bad

    E-Print Network [OSTI]

    operating, the accelerator requires 70 megaWatts of electricity ­ about the same as the power consumption) What is the Tevatron's electricity consumption in kilowatt hours? B) At $0.11 per kilowatt hour, how operating, the accelerator requires 70 megaWatts of electricity ­ about the same as the power consumption

  13. FPL's solar stars shine at new 500-acre array By SUSAN SALISBURY

    E-Print Network [OSTI]

    Belogay, Eugene A.

    in November. It's the world's first solar plant directly connected to an existing combined- cycle natural gas," Gnecco said. The plant joins FPL's 25-megawatt solar plant in DeSoto County and 10-megawatt plant at the Kennedy Space Center. Although solar takes more land than other types of power plants, it was workable

  14. Characterizing, predicting and

    E-Print Network [OSTI]

    can increase. Offshore wind farms. Increase of power : Horns RevI : 190MW , Horns RevII : 210MW production from a single multi-megawatt wind farm. Variability of wind power depends on the time and spatial-megawatt wind farm. Variability of wind power depends on the time and spatial scale. R. Girard (Mines

  15. Offered: Offered: Position(s): Position(s)

    E-Print Network [OSTI]

    New Hampshire, University of

    in Westchester, Ohio and its field sales offices located across the United States. The company operates with bleach plants, a groundwood mill, a wood processing facility, utilities, two black liquor recovery boilers, a multi fuel boiler, 95 megawatts of steam generated electrical capacity, 25 megawatts

  16. his report summarizes the results of an analysis of CO2 production from the Pacific Northwest

    E-Print Network [OSTI]

    produced about 520 pounds of CO2 for each megawatt-hour of electricity generated, com- pared to 900 pounds for the Northwest to maintain or reduce its average per-megawatt-hour CO2 emission rate. In the base case of this study, which assumes implementation of the Council's Fifth Power Plan, the WECC CO2 emission rate

  17. Improve Industrial Temperature Measurement Precision for Cost-Effective Energy Usage

    E-Print Network [OSTI]

    Lewis, C. W.

    setting, errors between any two measurement instruments of 0.1 OF can result in an error of 4 Megawatts of energy! You do not want to have too many Megawatts disappearing from a nuclear power station before you start to do something about it. FIGURE...

  18. Schrepel, Eric From: Jenkins, Kris

    E-Print Network [OSTI]

    -fired generation in the plan. The LWVW also supports low-income aid for the cost of electricity and thus feels years. · Recommending 6,000 megawatts (2,000 average megawatts) of new wind energy. · Acknowledging that the plan should include an analysis of low-income weatherization needs, costs and benefits.l #12;Page 2

  19. PROGRAMAS DE POSGRADO Departamento de Matemticas

    E-Print Network [OSTI]

    Uribe, Bernardo

    Elaborado: Septiembre de 2010 #12;PROGRAMAS MODELO Y COSTOS #12;MAESTRIA EN MATEMATICAS Semestre I Créditos MATE-3401 GEOMETRIA RIEMANNIANA X X MATE-3411 GENERAL RELATIVITY X X MATE-3510 PROCESOS ESTOCASTICOS X DE NUMEROS X MATE-4140 TEORIA DE MODELOS 1 X X X X MATE-4152 ALGEBRA HOMOLOGICA Y TEORIA DE

  20. C.d.L. in Chimica e Tecnologie per l'Ambiente e per i Mate-riali, curriculum Ambiente, Energia, Rifiuti 16. 12. 2009

    E-Print Network [OSTI]

    Achilles, Rüdiger

    = sen x e l'asse x, al variare di x nell'intervallo [0, ]. 5. Calcolate l'area della regione finita di volume del solido generato dalla rotazione della curva y = sen x, 0 x , intorno l'asse delle x. 8 grafico della funzione f(x) = 1 x , x [1, +[, intorno all'asse x. (a) Calcolate il volume V = + 1 [f

  1. SPECIES RECOGNITION IS DRIVING EVOLUTION OF THE ACOUSTIC MATING SYSTEM OF SHIELD BACK KATYDIDS (ORTHOPTERA: TETTIGONIIDAE: AGLAOTHORAX): BEHAVIORAL AND PHYLOGENETIC EVIDENCE

    E-Print Network [OSTI]

    Cole, Jeffrey A.

    2009-12-01T23:59:59.000Z

    of the five Aglaothorax species. The songs of four acoustically aberrant populations were classified as unknowns: Arroyo Seco (site 6), Millard Canyon (17), Kenneth Hahn (12), and Malaga Dune (15). The first two populations represent nominate A. morsei... described from the Santa Monica Mountains (Table 2). Millard Canyon (17) and Arroyo Seco (6) populations are nominate A. morsei morsei from the San Gabriel Mountains, but songs of the former were identified exclusively as A. diminutiva, and those...

  2. The Role of Testosterone and Estradiol in Women’s Preferences and Mating Strategies across the Menstrual Cycle: A Hormonal Perspective

    E-Print Network [OSTI]

    Chen, Jennie Ying-Chen

    2012-02-14T23:59:59.000Z

    This dissertation project investigated fluctuations in estradiol and testosterone across the human menstrual cycle. During the part of the cycle when women are most fertile, women show stronger preferences for men with more masculine faces...

  3. 4-24 BULLETIN OF THE UNlTED STATES FISH COMMISSION. ber of attempts with the same result the mate gave up the chase. The

    E-Print Network [OSTI]

    of bill-fish, but never with such large dorsal fins as these. I imagiiie that' this must have been a small to the head. I have only a part of the dorsal fin, and not in good condition. The longest Bpines are thirty an edition of Chambers' Encyclopedia, which described the ` L sail-fish" as a kind of shark. Last winter I

  4. PRE-MATING COMMUNICATION AND HYBRIDIZATION BETWEEN TWO MEADOW KATYDIDS, ORCHELIMUM NIGRIPES AND O. PULCHELLUM (ORTHOPTERA: TETTIGONIIDAE): MALE CALLING SONG AND ASYMMETRIC FEMALE PREFERENCE

    E-Print Network [OSTI]

    Miller, Ginger

    2010-12-06T23:59:59.000Z

    , males of both parental species and the hybrids would sing from lower grassy vegetation as well as high in kudzu and trees. They were also observed feeding on seeds and insect prey (which were ubiquitous), so this hybrid zone is not likely an ecotonal...

  5. This A TM contains mate rial on the comparative analysis and de sign of the A LSEP Fuel Cask Thermal Shield. This report is submitted in accor-

    E-Print Network [OSTI]

    Rathbun, Julie A.

    of the fuel cask/LEM/SLA envelope was undertakei?- to determine the specific requirements for a thermal heat envelope was made to select the position an? orientation of the cask thermal shield. Figure 1 shows Thermal Shield. This report ·is submitted in accor- dance with MSC request generated during the System

  6. The effect of incarceration rates on mate availability and its effect on the formation and structure of the African American family: a theoretical and empirical analysis

    E-Print Network [OSTI]

    McGruder, Patricia Hollis

    1995-01-01T23:59:59.000Z

    . It was not until 1960 with the Women's Liberation Movement that more gains were made. For instance, the Equal Pay Act of 1963 prohibited sex discrimination in wages paid. In addition, Title VII of the Civil Rights Act of 1964 prohibited discrimination based... on sex in hiring, wages and salaries, promotions, and conditions or privileges of employment such as training and education. Then in 1977, Title IX of the Education Amendments Act prohibited federal funded schools from discriminating based on sex...

  7. Smart Meter Deployment Optimization for Efficient Electrical Appliance State Monitoring

    E-Print Network [OSTI]

    Wang, Yongcai

    appliances in buildings has attracted great attentions for smart, green and sustainable living. Traditional hard, greedy algorithm, approxi- mation ratio, smart building, sensor network I. INTRODUCTION in such buildings, researches in the field of smart building and smart grid are exploring an efficient energy

  8. Up and Down Mini-Buckets: A Scheme for Approximating Combinatorial Optimization Tasks

    E-Print Network [OSTI]

    Dechter, Rina

    - ing, we may get a linear speed up over a brute-force approxi- mation method. Such performance with each unary assignment of a value to a variable in combinatorial optimization problems. This task functions that can guide search algorithms for optimal solutions. The paper presents UD-MB, a new algorithm

  9. Nonparametric estimation of regression functions in point

    E-Print Network [OSTI]

    RĂĽschendorf, Ludger

    are an error decomposition into a bias term and a stochastic error term. For handling the bias term some approxi- mation result is needed while the treatment of the stochastic error term needs to establish some sam- pling processes). A main example are Poisson processes with a #12;nite intensity

  10. PREASYMPTOTIC CHARGE OSCILLATIONS AROUND 3d IMPURITIES IN ALUMINIUM

    E-Print Network [OSTI]

    Boyer, Edmond

    on aluminium based transi- tion metal alloys can be explained in the LSF approxi- mation of the Anderson modelL-87 PREASYMPTOTIC CHARGE OSCILLATIONS AROUND 3d IMPURITIES IN ALUMINIUM V. ZLATI0106 and G. GRÜNER modčle d'Anderson la perturbation de densité électronique autour de certaines impuretés 3d dans l'aluminium

  11. Residual Fertilizer Nitrogen in a Flooded Rice Soil1 K. R. REDDY AND W. H. PATRICK, JR. 2

    E-Print Network [OSTI]

    Florida, University of

    in the soil-water-plant system was measured. Approxi- Residual effects of 15 N-labelled fertilizer (ammoniumResidual Fertilizer Nitrogen in a Flooded Rice Soil1 K. R. REDDY AND W. H. PATRICK, JR. 2 ABSTRACT) to majntain jts identity in the soil during the top dressing. The uptake of residual labelled N (that present

  12. Cyber-Physical Energy Systems: Focus on Smart Buildings

    E-Print Network [OSTI]

    Gupta, Rajesh

    of a deeply coupled system of energy usage, comfort and work derived. At a macroscale, buildings use approxi computers and laptops in offices and homes will exceed over 3x the energy use by all data centers combinedCyber-Physical Energy Systems: Focus on Smart Buildings Jan Kleissl Dept. of Mechanical

  13. Electronic and phonon instabilities in face-centered-cubic alkali metals under pressure studied using ab initio calculations

    E-Print Network [OSTI]

    Oganov, Artem R.

    electron model is known to be a good approxi- mation to describe their electronic properties due to the weak interaction between valence electrons and ionic core under ambient conditions.1 However, under be the origin of the complex phase transitions for fcc lithium. In this work, we investigate systemically

  14. 4, 15491592, 2007 Mass conservative

    E-Print Network [OSTI]

    Paris-Sud XI, Université de

    kinematic approxi- mation of a diffusion wave model, but then converting it into a parabolic approach and water storage consistent variable parameter Muskingum-Cunge approach E. Todini Department of Earth formulation in terms of water storage. The properties of the proposed algorithm have been assessed by varying

  15. Facility Location with Hierarchical Facility Costs Zoya Svitkina #

    E-Print Network [OSTI]

    Tardos, Ă?va

    Facility Location with Hierarchical Facility Costs Zoya Svitkina # â?? Eva Tardos + Abstract We consider the facility location problem with hierarchi­ cal facility costs, and give a (4 installation costs. Shmoys, Swamy and Levi [13] gave an approxi­ mation algorithm for a two­level version

  16. Exact longtime asymptotics for reversible binding in three dimensions Noam Agmon and Irina V. Gopich a)

    E-Print Network [OSTI]

    Agmon, Noam

    on the level of the many­body theory employed. The survival probability in the simple ``Superposition Approxi problem'' 6 of a static A molecule, the Smoluchowski theory is actually exact. Even when A is mobile, the devia­ tions from the theory are small, 6,7 particularly in higher di­ mensions #e.g., three dimensions

  17. AUSTRALIAN NATIONAL UNIVERSITY DEPARTMENT OF NUCLEAR PHYSICS

    E-Print Network [OSTI]

    Chen, Ying

    contributed to the nylon rod failure. Contact was removed and all mating surfaces cleaned with Carborundum

  18. Department of Biosystems and Agricultural Engineering BAE BULLETIN

    E-Print Network [OSTI]

    . Celeste Harned Celeste Communications Paducah, Ky. #12;population growth, cli- mate change, and pressure

  19. Arsenic speciation in multiple metal environments II. Micro-spectroscopic investigation of a CCA contaminated soil

    E-Print Network [OSTI]

    2006, Aus- tralia. stances (acid mine drainage, smelter wastes, pesticides, chro- mated copper arsenate

  20. Environments Journal of Arid Environments 72 (2008) 14141422

    E-Print Network [OSTI]

    Taylor, Emily

    to obtain essential resources (e.g., food, water, mates, solar irradiation). Biologists use a variety

  1. EIA - State Electricity Profiles

    U.S. Energy Information Administration (EIA) Indexed Site

    1. 2012 Summary Statistics (Connecticut) Item Value U.S. Rank NERC Region(s) NPCC Primary Energy Source Nuclear Net Summer Capacity (megawatts) 9,060 35 Electric Utilities 152 46...

  2. EIA - State Electricity Profiles

    U.S. Energy Information Administration (EIA) Indexed Site

    1. 2012 Summary statistics (Vermont) Item Value U.S. Rank NERC Region(s) NPCC Primary Energy Source Nuclear Net Summer Capacity (megawatts) 1,235 50 Electric Utilities 329 45...

  3. EIA - State Electricity Profiles

    U.S. Energy Information Administration (EIA) Indexed Site

    2012 Summary statistics (Virginia) Item Value U.S. Rank NERC Region(s) RFCSERC Primary Energy Source Nuclear Net Summer Capacity (megawatts) 24,849 16 Electric Utilities 20,626...

  4. EIA - State Electricity Profiles

    U.S. Energy Information Administration (EIA) Indexed Site

    2012 Summary statistics (South Carolina) Item Value U.S. Rank NERC Region(s) SERC Primary Energy Source Nuclear Net Summer Capacity (megawatts) 23,083 18 Electric Utilities 21,280...

  5. EIA - State Electricity Profiles

    U.S. Energy Information Administration (EIA) Indexed Site

    Summary Statistics (Illinois) Item Value U.S. Rank NERC Region(s) MRORFCSERC Primary Energy Source Nuclear Net Summer Capacity (megawatts) 45,146 5 Electric Utilities 5,274 34...

  6. EIA - State Electricity Profiles

    U.S. Energy Information Administration (EIA) Indexed Site

    1. 2012 Summary statistics (New Jersey) Item Value U.S. Rank NERC Region(s) RFC Primary Energy Source Nuclear Net Summer Capacity (megawatts) 18,924 22 Electric Utilities 517 43...

  7. EIA - State Electricity Profiles

    U.S. Energy Information Administration (EIA) Indexed Site

    2012 Summary statistics (New Hampshire) Item Value U.S. Rank NERC Region(s) NPCC Primary Energy Source Nuclear Net Summer Capacity (megawatts) 4,323 44 Electric Utilities 1,121 41...

  8. Solar America City - San Diego, California

    SciTech Connect (OSTI)

    Not Available

    2008-05-01T23:59:59.000Z

    This fact sheet highlights San Diego, California, as a DOE Solar America City. Through various collaborations at the local level, San Diego has a goal of 50 megawatts of solar installed by 2010.

  9. State-of-the-Art Thermal Energy Storage Retrofit at a Large Manufacturing Facility

    E-Print Network [OSTI]

    Fiorino, D.

    This paper will describe the existing conditions, strategic planning, feasibility study, economic analysis, design, specification, construction, and project management for the 2.9 megawatt “full shift” chilled water thermal energy storage retrofit...

  10. New Hampshire Electric Co-Op- Residential Solar Photovoltaic Incentive Program

    Broader source: Energy.gov [DOE]

    New Hampshire Electric Co-op (NHEC) is offering rebates for residential, grid-tied photovoltaic (PV) systems up to one megawatt (MW) in capacity. The rebate is equal to 20% of the installed cost of...

  11. BAKERBOTTS.-.*

    Broader source: Energy.gov (indexed) [DOE]

    ERCOT, which is the independent system operator for 90%o of Texas's electric load (an installed capacity of over 70,000 megawatts) and the NERC-approved Reliability...

  12. Stochastic Unit Commitment in

    E-Print Network [OSTI]

    Römisch, Werner

    the amount of installed pumped storage capacity enables the inclusion of pumped storage plants units. Its total capacity is about 13,000 megawatts (MW), including a hydro capacity of 1,700 MW

  13. CX-007538: Categorical Exclusion Determination

    Broader source: Energy.gov [DOE]

    Offshore 12 Megawatt Turbine Rotor With Advanced Material and Passive Design Concept CX(s) Applied: A9 Date: 01/10/2012 Location(s): Colorado Offices(s): Golden Field Office

  14. Structured Finance

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    competitive resource portfolio of 8,506 average annual megawatts (aMW) that provides wholesale electricity (primarily low-cost hydropower) to a population of more than 12 million...

  15. A Threshold Autoregressive Model for Wholesale Electricity Prices

    E-Print Network [OSTI]

    A Threshold Autoregressive Model for Wholesale Electricity Prices B. Ricky Rambharat Carnegie of wholesale electricity soared to an unprecedented $7,500 per megawatt-hour (MwH) (see FERC, 1998). Models

  16. Statewide Air Emissions Calculations from Wind and Other Renewables, Summary Report: A Report to the Texas Commission on Environmental Quality for the Period September 2007 - August 2008

    E-Print Network [OSTI]

    Gilman, D.; Yazdani, B.; Haberl, J. S.; Baltazar-Cervantes, J. C.; Subbarao, K.; Culp, C.; Liu, Z.

    -wind renewables. This legislation also requires the Public Utilities Commission of Texas (PUCT) to establish a target of 10,000 megawatts of installed renewable capacity by 2025, and requires the Texas Commission on Environmental Quality (TCEQ) to develop...

  17. Wind Energy Permitting Standards

    Broader source: Energy.gov [DOE]

    All wind facilities larger than 0.5 megawatts (MW) that begin construction after July 1, 2010, must obtain a permit from any county in which the facility is located. Facilities must also obtain...

  18. Exemption from Electric Generation Tax (Connecticut)

    Broader source: Energy.gov [DOE]

    In 2011, Connecticut created a new tax requiring electric power plants in the state that generate and upload electricity to the regional bulk power grid to pay $2.50 per megawatt hour. Renewable...

  19. Wind Farm

    Office of Energy Efficiency and Renewable Energy (EERE)

    The wind farm in Greensburg, Kansas, was completed in spring 2010, and consists of ten 1.25 megawatt (MW) wind turbines that supply enough electricity to power every house, business, and municipal...

  20. Residential Solar Investment Program

    Broader source: Energy.gov [DOE]

    In March 2012, the CT Green Bank* unveiled its solar photovoltaic residential investment program with the ultimate goal to support 30 megawatts of residential solar photovoltaics (PV). HB 6838...

  1. Dereck, Shockley, Xcel Energy's Commercial - Industrial Programs

    Broader source: Energy.gov (indexed) [DOE]

    green-pricing program in USA No.5 in solar capacity uOne of largest photovoltaic systems and growing - 8.2 megawatts uSolar*Rewards - 7,146 solar systems,...

  2. Net Metering

    Broader source: Energy.gov [DOE]

    Nevada's original net-metering law for renewable-energy systems was enacted in 1997 and amended in 2001, 2003, 2005, 2007, 2011, 2013, and 2015. Systems up to one megawatt (MW) in capacity that...

  3. Conversion Topology for Reducing Failure Rate and Life-Cycle Costs of High-Power Wind Turbines

    E-Print Network [OSTI]

    Lipo, Thomas

    Drive Madison, WI 53706 #12;American Institute of Aeronautics and Astronautics 1 Conversion Topology;American Institute of Aeronautics and Astronautics 2 I. Introduction ARGE multi-megawatt wind turbines

  4. Representing energy technologies in top-down economic models using bottom-up information

    E-Print Network [OSTI]

    example (e.g., a 500 megawatt coal fired power plant, or a 1-MW wind turbine). The technologies production may be treated as a single sector with capital, labor, material, and fuel inputs. Continuous

  5. A Portable Expert System for Gas Turbine Maintenance 

    E-Print Network [OSTI]

    Quentin, G. H.

    1989-01-01T23:59:59.000Z

    Combustion turbines for electric power generation and industrial applications have steadily increased in size, efficiency and prominence. The newest class of gas turbine-generators coming into service will deliver 150 megawatts, with turbine inlet...

  6. Two of Three Power Plant Modules at Neal Hot Springs Are Producing...

    Open Energy Info (EERE)

    of Three Power Plant Modules at Neal Hot Springs Are Producing up to 16.8 Megawatts Jump to: navigation, search OpenEI Reference LibraryAdd to library Report: Two of Three Power...

  7. Essays in Applied Microeconomics

    E-Print Network [OSTI]

    Severnini, Edson Roberto

    2013-01-01T23:59:59.000Z

    The Effects of Low-Cost Hydro Power on Industrial Location,Fossil Fuel Nuclear Others Hydro Fossil Fuel Nuclear Others1000 Megawatt Hours) Hydro Hydro Fossil Fuel Nuclear Others

  8. Solar Powering America Home | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    megawatts of solar on federally-assisted housing. Featured Videos Inside the White House: Solar Panels SunShot Tech to Market SunShot Solar PV SunShot Identity Video Community...

  9. LADWP- Net Metering (California)

    Broader source: Energy.gov [DOE]

    LADWP allows its customers to net meter their photovoltaic (PV), wind, and hybrid systems with a capacity of not more than one megawatt. LADWP will provide the necessary metering equipment unless...

  10. Interconnection Standards

    Broader source: Energy.gov [DOE]

    New Hampshire requires all utilities selling electricity in the state to offer net metering to customers who own or operate systems up to one megawatt (1 MW) in capacity that generate electricity...

  11. Renewable Auction Mechanism (RAM)

    Broader source: Energy.gov [DOE]

    The Renewable Auction Mechanism (RAM), approved by the California Public Utilities Commission (CPUC) in December 2010, is expected to result in 1,299 megawatts (MW) of new distributed generation ...

  12. Microsoft Word - Connecting Variable Generating Resources to...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Background The Bonneville Power Administration (BPA) has about 1,700 megawatts of wind power operating on its system today. Wind power in BPA's system is set to reach 3,000 MW by...

  13. Electricity Transmission Congestion Costs: A Review of Recent Reports

    E-Print Network [OSTI]

    operator ISO-NE Independent System Operator - New England LMP Locational marginal price MW Megawatt MWh price FERC Federal Energy Regulatory Commission FTR Fixed transmission right ISO Independent system

  14. Project Profile: A Small-Particle Solar Receiver for High-Temperature...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    high-temperature solar receiver in the multi-megawatt range that can drive a gas turbine to generate low-cost electricity. The goals of this project are to:...

  15. act rcra facility: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    to construct a solar farm capable of generating up to 75 direct current megawatts of photovoltaic solar energy (Project). At the time of the August submittal, it was projected...

  16. EIS-0354: Ivanpah Energy Center, NV

    Broader source: Energy.gov [DOE]

    Ivanpah Energy Center, L.P., a Diamond Generating Corporation Company, a subsidiary of Mitsubishi Corporation proposes to construct and operate a 500 Megawatt (MW) gas-fired electric power generating station in southern Clark County, Nevada.

  17. Impact of Increasing Distributed Wind Power and Wind Turbine Siting on Rural Distribution Feeder Voltage Profiles: Preprint

    SciTech Connect (OSTI)

    Allen, A.; Zhang, Y. C.; Hodge, B. M.

    2013-09-01T23:59:59.000Z

    Many favorable wind energy resources in North America are located in remote locations without direct access to the transmission grid. Building transmission lines to connect remotely-located wind power plants to large load centers has become a barrier to increasing wind power penetration in North America. By connecting utility-sized megawatt-scale wind turbines to the distribution system, wind power supplied to consumers could be increased greatly. However, the impact of including megawatt-scale wind turbines on distribution feeders needs to be studied. The work presented here examined the impact that siting and power output of megawatt-scale wind turbines have on distribution feeder voltage. This is the start of work to present a general guide to megawatt-scale wind turbine impact on the distribution feeder and finding the amount of wind power that can be added without adversely impacting the distribution feeder operation, reliability, and power quality.

  18. Large-Scale Renewable Energy Projects (Larger than 10 MWs) |...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    Large-Scale Renewable Energy Projects (Larger than 10 MWs) Large-Scale Renewable Energy Projects (Larger than 10 MWs) Renewable energy projects larger than 10 megawatts (MW) are...

  19. Department of Energy Offers Conditional Loan Guarantee Commitments...

    Office of Environmental Management (EM)

    commitment for a loan guarantee to AV Solar Ranch 1, LLC to support the Antelope Valley Solar Ranch 1 project. The 230 megawatt (MW) project will be located in the Antelope...

  20. acer rubrum canopy: Topics by E-print Network

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    two major surface parking areas. In conjunction with the existing 1.4 megawatt solar energy facility on this campus, this project will generate Delgado, Mauricio 35 CASE REPORT...

  1. CX-001522: Categorical Exclusion Determination | Department of...

    Broader source: Energy.gov (indexed) [DOE]

    the design, purchase and installation of a 1 (one) Megawatt generator to complete a Cogeneration power system to serve the new 1.1 billion central terminal complex at Sacramento...

  2. Renewable Energy Project Planning and Implementation | Department...

    Broader source: Energy.gov (indexed) [DOE]

    Federal renewable energy projects can be large or small and managed by a third-party or the agency. Typically, large-scale projects-larger than 10 megawatts (MWs)-are financed,...

  3. EIS-0503: DOE Notice of Availability of Draft Environmental Impact...

    Energy Savers [EERE]

    maintain, and connect a new 1000-megawatt electric transmission system across the U.S.-Canada border near Alburgh, VT. The transmission line would connect to the Vermont Electric...

  4. EIS-0499: DOE Notice of Availability of Draft Environmental Impact...

    Energy Savers [EERE]

    maintain, and connect a new 883-megawatt electric transmission system across the U.S.-Canada border. The proposed 220-mile transmission line would cross the border near Roseau,...

  5. EIS-0499: EPA Notice of Availability of Draft Environmental Impact...

    Energy Savers [EERE]

    maintain, and connect a new 883-megawatt electric transmission system across the U.S.-Canada border. The proposed 220-mile transmission line would cross the border near Roseau,...

  6. EIS-0503: EPA Notice of Availability of Draft Environmental Impact...

    Energy Savers [EERE]

    maintain, and connect a new 1000-megawatt electric transmission system across the U.S.-Canada border near Alburgh, VT. The transmission line would connect to the Vermont Electric...

  7. Final EIS for Champlain Hudson Power Express Transmission Project...

    Broader source: Energy.gov (indexed) [DOE]

    of a 336-mile, 1,000 megawatt, high-voltage direct current, electric transmission system that would cross the international border with Canada in Lake Champlain and provide...

  8. Xcel Energy Wind and Biomass Generation Mandate

    Broader source: Energy.gov [DOE]

    Minnesota law (Minn. Stat. § 216B.2423) requires Xcel Energy to build or contract for 225 megawatts (MW) of installed wind-energy capacity in the state by December 31, 1998, and to build or...

  9. New Hampshire Electric Co-Op- Solar Photovoltaic Incentive Program

    Broader source: Energy.gov [DOE]

    New Hampshire Electric Co-op (NHEC) is offering rebates for residential and commercial, grid-tied photovoltaic (PV) systems up to one megawatt (MW) in capacity. The rebate is equal to $0.25 per DC...

  10. LADWP- Net Metering

    Broader source: Energy.gov [DOE]

    LADWP allows its customers to net meter their photovoltaic (PV), wind, and hybrid systems with a capacity of not more than one megawatt. LADWP will provide the necessary metering equipment unless...

  11. STATE OF CALIFORNIA NATURAL RESOURCES AGENCY EDMUND G. BROWN JR., Governor CALIFORNIA ENERGY COMMISSION

    E-Print Network [OSTI]

    pressure to meet CCP's power delivery obligations under its power purchase agreement. On March 14, 2012 for Certification (AFC) for the construction and operation of a 240 megawatt combined cycle cogeneration power plant

  12. EIS-0349: Cherry Point Co-generation Project

    Broader source: Energy.gov [DOE]

    This EIS analyzes DOE's decision to support BP West Coast Products, LLC proposal to construct and operate a 720-megawatt, natural-gas-fired, combined-cycle cogeneration facility on land adjacent to its BP Cherry Point Refinery.

  13. First Edition Geologic Storage Formation Classification: Understanding...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    domestic energy resource and the primary source of baseload power generation in the United States, generating 1,986 million megawatt hours (MWh) in 2008. At the 2008 rate of...

  14. Answers to Even Numbered Problems from textbook Homework 1(a ...

    E-Print Network [OSTI]

    Bailey, Charlotte M

    2014-02-26T23:59:59.000Z

    3. 90) (a) It is a function because the graph passes the vertical line test. (b) Domain. (c) 8 AM estimate 1100 megawatts. (d) most electricity used at 17 hours.

  15. Fact Sheet - Myths & Facts about the lower Snake River dams ...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Myths and facts about the lower Snake River dams MYTH: The four lower Snake River dams are low value. FACT: It costs about 5 per megawatt-hour to produce power at the dams. The...

  16. President Obama Announces $1.45 Billion Conditional Commitment...

    Broader source: Energy.gov (indexed) [DOE]

    will add 250 megawatts (MW) of capacity to the electrical grid using parabolic trough solar collectors and an innovative six-hour thermal energy storage system-the first of its...

  17. An analysis of producing ethanol and electric power from woody residues and agricultural crops in East Texas 

    E-Print Network [OSTI]

    Ismayilova, Rubaba Mammad

    2007-09-17T23:59:59.000Z

    in renewable energy sources. Biomass is a large, diverse, readily exploitable resource. This dissertation examines the biomass potential in Eastern Texas by examining a 44 county region. This examination considers the potential establishment of a 100-megawatt...

  18. The Pricing of Electricity to Aluminum Smelters in the Northwest 

    E-Print Network [OSTI]

    Foley, T. J.

    1986-01-01T23:59:59.000Z

    major industrial firms, primarily aluminum companies operating aluminum smelters in the region. These direct service industries (DSIs) have a contractual right to purchase up to 3.500 average megawatts annually from Bonneville. Because the aluminum...

  19. Interconnection Standards

    Broader source: Energy.gov [DOE]

    In March 2008, the Florida Public Service Commission (PSC) adopted interconnection rules for renewable-energy systems up to two megawatts (MW) in capacity. The PSC rules apply only to the state's...

  20. Research and educational activities at the MIT Research Reactor : Fiscal year 1968

    E-Print Network [OSTI]

    Massachusetts Institute of Technology. Department of Nuclear Engineering; 7102 Massachusetts Institute of Technology. Research Reactor. Staff; U.S. Atomic Energy Commission

    1968-01-01T23:59:59.000Z

    A report of research and educational activities which utilized the Massachusetts Institute of Technology, five-megawatt, heavy water, research reactor during fiscal year 1968 has been prepared for administrative use at MIT ...

  1. Fuel Mix and Emissions Disclosure

    Broader source: Energy.gov [DOE]

    Michigan's Customer Choice and Electric Reliability Act of 2000 (P.A. 141) requires electric suppliers to disclose to customers details related to the fuel mix and emissions, in pounds per megawatt...

  2. Renewable Energy Property Tax Assessment

    Broader source: Energy.gov [DOE]

    Photovoltaic (PV) and wind energy facilities with a capacity of 2 megawatts (MW) AC or less are assessed locally for property taxes. Additionally, low impact hydro, geothermal, and biomass facili...

  3. Water and Energy Interactions

    E-Print Network [OSTI]

    McMahon, James E.

    2013-01-01T23:59:59.000Z

    power plants, water withdrawals for electricity generationelectricity generation in 2009 (33). Water used in thermal electric power plantsplant with CCS technologies requires roughly 1,000 gallons of water for every megawatt-hour of electricity generation (

  4. Has Restructuring Improved Operating Efficiency at U.S. Electricity Generating Plants?

    E-Print Network [OSTI]

    Fabrizio, Kira; Rose, Nancy; Wolfram, Catherine

    2004-01-01T23:59:59.000Z

    in electricity generation, relative to IOU plants in stateselectricity generation sector restructuring in the United States on plant-plant over the year, measured by annual net megawatt-hours of electricity generation,

  5. The Greenness of Cities: Carbon Dioxide Emissions and Urban Development

    E-Print Network [OSTI]

    Glaeser, Edward L.; Kahn, Matthew E.

    2008-01-01T23:59:59.000Z

    Year) MSA Emissions from Driving (Lbs of CO2) Electricity (CO2 per Megawatt Hrs) Carbon Dioxide Emissions Cost MSA Emissions from Driving ElectricityEmissions from Driving (Lbs of CO2) Suburb-City Difference in Electricity (

  6. Net Metering

    Broader source: Energy.gov [DOE]

    Net metering is available to all "qualifying facilities" (QFs), as defined by the federal Public Utility Regulatory Policies Act of 1978 (PURPA)*, which pertains to systems up to 80 megawatts (MW)...

  7. Net Metering

    Broader source: Energy.gov [DOE]

    Rhode Island allows net metering for systems up to five megawatts (MW) in capacity that are designed to generate up to 100% of the electricity that a home or other facility uses. Systems that...

  8. CX-004825: Categorical Exclusion Determination | Department of...

    Broader source: Energy.gov (indexed) [DOE]

    Act- Energy Efficiency and Conservation Block Grant Act 1-Collins Park Solar Photovoltaic Project - 1 Megawatt CX(s) Applied: B3.6, B5.1 Date: 12222010 Location(s): Toledo...

  9. Save Energy Now Data Center Assessments to Identify Efficiency...

    Broader source: Energy.gov (indexed) [DOE]

    - raising total energy use * Most don't know if their center is good or bad Slide 7 LBNL super computer systems power: 0 5 10 15 20 25 30 35 40 MegaWatts 2001 2003 2005 2007...

  10. EIS-0486: Notice of Intent and Notice of Potential Floodplain...

    Office of Energy Efficiency and Renewable Energy (EERE) Indexed Site

    3,500 megawatts (MW) primarily from renewable energy generation facilities in the Oklahoma Panhandle region to load-serving entities in the Mid-South and Southeast via an...

  11. Plains and Eastern Clean Line Transmission Line: Federal Register...

    Energy Savers [EERE]

    3,500 megawatts primarily from renewable energy generation facilities in the Oklahoma and Texas Panhandle regions to load-serving entities in the Mid-South and Southeast...

  12. EIS-0486: DOE Notice of Availability of Draft Environmental Impact...

    Broader source: Energy.gov (indexed) [DOE]

    3,500 megawatts (MW) primarily from renewable energy generation facilities in the Oklahoma Panhandle region to load-serving entities in the Mid-South and Southeast via an...

  13. Combined Heat and Power Loan Program

    Broader source: Energy.gov [DOE]

    CHP technologies are eligible for either a grant, loan or power purchase incentive under the initial round of solicitations for new renewable energy generating equipment  up to five megawatts at ...

  14. Combined Heat and Power Grant Program

    Broader source: Energy.gov [DOE]

    CHP technologies are eligible for either a grant, loan or power purchase incentive under the initial round of solicitations for new renewable energy generating equipment  up to five megawatts at ...

  15. Performance based incentive for Combined Heat and Power Program

    Broader source: Energy.gov [DOE]

    CHP technologies are eligible for either a grant, loan or power purchase incentive under the initial round of solicitations for new renewable energy generating equipment  up to five megawatts at ...

  16. B O N N E V I L L E P O W E R A D M I N I S T R A T I O N Fact...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    that would provide 300 average megawatts of power service to Alcoa's Intalco aluminum smelter in Ferndale, Wash., for a little less than 10 years. You can read the draft agreement...

  17. Energy Blog | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    recently awarded an Energy Department grant to support a 30 megawatt floating offshore wind farm near Oregon's Port of Coos Bay. | Photo courtesy of Principle Power. An Update on...

  18. Renewable Auction Mechanism (RAM) (California)

    Broader source: Energy.gov [DOE]

    The Renewable Auction Mechanism (RAM), approved by the California Public Utilities Commission (CPUC) in December 2010, is expected to result in 1,299 megawatts (MW) of new distributed generation...

  19. LADWP- Feed-in Tariff (FiT) Program (California)

    Broader source: Energy.gov [DOE]

    Note: LADWP accepted applications for the second 20 MW allocation of the 100 MW FiT Set Pricing Program between July 8 and July 12, 2013. This program is the first component of a 150 megawatt (MW)...

  20. Chapter V: Improving Shared Transport Infrastructures

    Office of Environmental Management (EM)

    4,100 megawatts of additional hydropower to the U.S. electricity mix. * Canadian natural gas production is expected to slightly outpace consumption with exports rising slowly over...

  1. 2011 Wind Technologies Market Report

    E-Print Network [OSTI]

    Bolinger, Mark

    2013-01-01T23:59:59.000Z

    kilowatt-hour Midwest Independent System Operator megawattPJM), Midwest Independent System Operator (MISO), New YorkN/A (NSP) Midwest Independent System Operator N/A N/A (

  2. DOE/EA-1605: Finding of No Significant Impact for the Environmental...

    Broader source: Energy.gov (indexed) [DOE]

    two 120,000 pounds per hour (pph) (210,000 mbtuhr input) boilers and one 20 megawatt turbine. Each boiler will have full capacity fuel-oil burners that will serve as a back-up in...

  3. Obama Administration Offers $59 Million in Conditional Loan Guarantees...

    Energy Savers [EERE]

    expansion of its assembly plant in Pocatello, Idaho, to produce its one megawatt wind turbine. Beacon Power, an energy storage company, has been offered 43 million to support the...

  4. Flue gas desulfurization : cost and functional analysis of large-scale and proven plants

    E-Print Network [OSTI]

    Tilly, Jean

    1983-01-01T23:59:59.000Z

    Flue Gas Desulfurization is a method of controlling the emission of sulfurs, which causes the acid rain. The following study is based on 26 utilities which burn coal, have a generating capacity of at least 50 Megawatts ...

  5. EA-1791: Final Environmental Assessment | Department of Energy

    Broader source: Energy.gov (indexed) [DOE]

    to design, permit, construct, and operate a 2.5-Megawatt (MW) Clipper Liberty wind turbine and an associated 34.5-kilovolt (kV) low-voltage transmission line at the...

  6. NEBRASKA PUBLIC POWER DISTRICT CUSTOMER MEETING ON ENERGY ALTERNATIVES

    E-Print Network [OSTI]

    .........................................................................................9 Do you think NPPD should go forward with a 200 megawatt wind farm? ...........10 Do you think the wind farm program is the right size? .........................................10 How many total customers value solar power? ..................................................................20 Cumulative

  7. EIS-0448: Department of Energy Loan Guarantee to First Solar for the Proposed Desert Sunlight Solar Farm Project, California

    Broader source: Energy.gov [DOE]

    First Solar Desert Sunlight Solar Farm (DSSF) Project, proposes to develop a 550-megawatt photovoltaic solar project and proposes to facilitate the construction and operation of the Red Bluff Substation, California Desert Conservation Area (CDCA) Plan, Riverside County, California.

  8. CX-004504: Categorical Exclusion Determination

    Broader source: Energy.gov [DOE]

    Beacon Power 20 Megawatt Flywheel Frequency Regulation PlantCX(s) Applied: A1, A9, A11Date: 11/19/2010Location(s): Tyngsboro, MassachusettsOffice(s): Electricity Delivery and Energy Reliability, National Energy Technology Laboratory

  9. Natural Gas Procurement Challenges for a Project Financed Cogeneration Facility 

    E-Print Network [OSTI]

    Good, R. L.; Calvert, T. B.; Pavlish, B. A.

    1988-01-01T23:59:59.000Z

    A decision to project finance a 110 megawatt combined cycle cogeneration facility in 1986 in place of conventional internal financing greatly changed the way in which natural gas was normally procured by Union Carbide Corporation. Natural gas supply...

  10. Microsoft Word - Conergy DRAFT EA 1876 7.20.2011.docx

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    Conergy Projects, Inc. (Conergy) proposes to construct and operate a 1.251 Megawatt (MW) solar photovoltaic (PV) facility at the former Navy Yard site in south Philadelphia in...

  11. Microsoft Word - 40532749_10.doc

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    wind energy projects in Wyoming, Oregon, and Washington and small amounts of power from a solar photovoltaic project. Bonneville also has contracted to purchase 49.9 megawatts from...

  12. EIS-0343: EPA Notice of Availability of the Draft Environmental Impact Statement

    Broader source: Energy.gov [DOE]

    COB Energy Facility, Proposes to Construct a 1,160-megawatt (MW) Natural Gas-Fired and Combined- Cycle Electric Generating Plant, Right- of-Way Permit across Federal Land under the Jurisdiction of BLM, Klamath Basin, Klamath County, OR

  13. 2010 Solar Technologies Market Report, November 2011, Energy...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    MENA Middle East and North Africa MG-Si metallurgical-grade silicon MNGSEC Martin Next Generation Solar Energy Center MOU memorandum of understanding MT metric ton MW megawatt...

  14. Sandia Energy - Sandia Vertical-Axis Wind-Turbine Research Presented...

    Broader source: All U.S. Department of Energy (DOE) Office Webpages (Extended Search)

    study of aeroelastic stability of very large VAWTs that used an enhanced version of the Offshore Wind Energy Simu-lation Toolkit for VAWTs. Multiple-megawatt VAWT design...

  15. Experimental investigation of a coaxial gyrotron oscillator

    E-Print Network [OSTI]

    Advani, Rahul N

    1999-01-01T23:59:59.000Z

    This thesis presents experimental results of a megawatt power level, 140 GHz coaxial gyrotron oscillator. The coaxial gyrotron has the potential to transport very high power electron beams and thus achieve higher microwave ...

  16. Chapter 3. Markets for electrical energy Introduction

    E-Print Network [OSTI]

    Ernst, Damien

    Chapter 3. Markets for electrical energy 1 #12;Introduction Assumption: All the generators #12;Megawatt-hours not barrels of oil Electrical energy linked to a physical system where supply

  17. Alternative Energy Law (AEL)

    Broader source: Energy.gov [DOE]

    Iowa requires its two investor-owned utilities (MidAmerican Energy and Alliant Energy Interstate Power and Light) to own or to contract for a combined total of 105 megawatts (MW) of renewable...

  18. U.S. DEPARTMENT OF ENERGY OFFICE OF ELECTRICITY DELIVERY AND...

    Office of Environmental Management (EM)

    comprised of about 1250 megawatts of wind generation from -- it's constructed inside Mexico and either a 230,000-volt or 500,000-volt transmission line on about four towers...

  19. TFE design package final report, TFE Verification Program

    SciTech Connect (OSTI)

    Not Available

    1994-06-01T23:59:59.000Z

    The program objective is to demonstrate the technology readiness of a TFE suitable for use as the basic element in a thermionic reactor with electric power output in the 0.5 to 5.0 MW(e) range, and a full-power life of 7 years. A TFE for a megawatt class system is described. Only six cells are considered for simplicity; a megawatt class TFE would have many more cells, the exact number dependent on optimization trade studies.

  20. EA-1800: DOE’s Proposed Financial Assistance to Illinois for the Monarch Warren County Wind Turbine Project, Lenox Township, Warren County, Illinois

    Broader source: Energy.gov [DOE]

    The U.S. Department of Energy (DOE) has provided Federal funding to the Illinois Department of Commerce and Economic Opportunity (DCEO) under the State Energy Program (SEP). DCEO is seeking to provide $5 million of its SEP funds to Monarch Wind Power (MWP), who would use these funds for the design, permitting, and construction of 12, 1.6-megawatt wind turbines, for a combined generation capacity of 19.2 megawatts.

  1. Protein structure and evolutionary history determine sequence space topology

    E-Print Network [OSTI]

    Shakhnovich, Boris E.; Deeds, Eric J.; Delisi, Charles; Shakhnovich, Eugene

    2005-01-01T23:59:59.000Z

    ; Grzybowski et al. 2002) for the study of protein fold- ing and prediction of ligand-binding energies. For this study, we use the trace of the second order of the contact matrix normalized by chain length as a simplest approxi- mation for designability... underlying both neofunc- tionalization and the potential development of resistance to emerging diseases. These results provide an example of how fun- damental physical principles can be statistically predictive in the biological Universe of protein folds...

  2. Half-Heusler topological insulators: A first-principles study with the Tran-Blaha modified Becke-Johnson density functional

    SciTech Connect (OSTI)

    Feng, wanxiang [Chinese Academy of Sciences; Xiao, Di [ORNL; Zhang, Ying [Beijing Normal University; Yao, yugui [Chinese Academy of Sciences

    2010-01-01T23:59:59.000Z

    We systematically investigate the topological band structures of half-Heusler compounds using first- principles calculations. The modified Becke-Johnson exchange potential together with local-density approxi- mation for the correlation potential MBJLDA has been used here to obtain accurate band inversion strength and band order. Our results show that a large number of half-Heusler compounds are candidates for three- dimensional topological insulators. The difference between band structures obtained using the LDA and MB- JLDA potential is also discussed.

  3. Dominance and Prestige in Diverse Contexts: Investigations into the Relative Contributions of Coercive and Persuasive Attributes in Mate Selection, Rape Avoidance, and the Social Dynamics of a Mutual Aid Organization

    E-Print Network [OSTI]

    Snyder, Jeffrey Keith

    2012-01-01T23:59:59.000Z

    Bleske-Rechek, A. L. , & Buss, D. M. (2001). Opposite-sexHarvard University Press. Buss, D. et al. (1989). SexSciences(Print), 12(1), 1-49. Buss, D. , & Schmitt, D. (

  4. The Effect of Cues of Parental Investment on Attractiveness Ratings of Males: The Impact of Child Presence and Age 

    E-Print Network [OSTI]

    Went, Hannah

    2007-01-01T23:59:59.000Z

    According to evolutionary theories of mate choice, male parental investment is a desired characteristic of long term mates. Brase (2006) found that cues of a positive disposition towards parental investment increased ...

  5. Mutation, asexual reproduction and genetic load: A study in three parts

    E-Print Network [OSTI]

    Marriage, Tara N.

    2009-08-24T23:59:59.000Z

    My dissertation addresses mutation and complex mating systems (models of mating systems that include outcrossing, selfing, and asexual reproduction) in three distinct chapters. Chapter 2 discusses the direct estimation of ...

  6. Relative status regulates risky decision making about resources in men: evidence for the co-evolution of motivation and cognition

    E-Print Network [OSTI]

    Ermer, Elsa; Cosmides, Leda; Tooby, John

    2008-01-01T23:59:59.000Z

    General, 127, 3-21. Buss, D. M. (1989). Sex differences inSciences, 12, 1-49. Buss, D. M. (1992). Mate preferencevalued resources as mates (Buss, 1989). In comparison, men’s

  7. Chemical sensor development leading to an glucose detection method

    E-Print Network [OSTI]

    Caballero, Jonathan Bano

    2008-01-01T23:59:59.000Z

    semiconductor, which when mated to a metallic contact and alloyed, facilitates the transfer of charge and forms an ohmic bridge

  8. pubs.acs.org/ICPublished on Web 05/07/2010r 2010 American Chemical Society Inorg. Chem. 2010, 49, 51575166 5157

    E-Print Network [OSTI]

    Girolami, Gregory S.

    during the Manhattan project. Ulti- mately, UF6 became the material of choice for this purpose: although

  9. Impurities in a Homogeneous Electron Gas Jung-Hwan Song

    E-Print Network [OSTI]

    Jansen, Henri J. F.

    thankful to my friends and office-mates, especially Jae-Hyuk Lee, Porn- rat Wattanakasiwich, and David

  10. What can statistics tell us about the uncertainty of past climate?

    E-Print Network [OSTI]

    Nychka, Douglas

    of the Earth system. Model experiments: It can be used to simulate current cli- mate and make projections about

  11. (Original Signature of Member) 109TH CONGRESS

    E-Print Network [OSTI]

    Knowles, David William

    scientific understanding of new, energy-efficient mate- rials, as well as analyze the behavior of materials

  12. Temporal Coordination and Adaptation to Rate Change in Music Performance

    E-Print Network [OSTI]

    Cottrell, Garrison W.

    with both simple and complex rhythmic sequences (e.g., Large & Kolen, 1994; Large & Palmer, 2002; Mates

  13. Superconducting cable-in-conduit low resistance splice

    DOE Patents [OSTI]

    Artman, Thomas A. (Forest, VA)

    2003-06-24T23:59:59.000Z

    A low resistance splice connects two cable-in-conduit superconductors to each other. Dividing collars for arranging sub-cable units from each conduit are provided, along with clamping collars for mating each sub-cable wire assembly to form mated assemblies. The mated assemblies ideally can be accomplished by way of splicing collar. The mated assemblies are cooled by way of a flow of coolant, preferably helium. A method for implementing such a splicing is also described.

  14. If Louis Pasteur was correct that chance favors the prepared mind, then it found the perfect candidate in Edward Norton Lorenz, MIT mathematician and meteorologist and father of chaos theory, a science many now

    E-Print Network [OSTI]

    Sprott, Julien Clinton

    tampering with with cli- mate's atmospheric gases, the melting its glaciers and ice caps and the resultant

  15. Ultrahigh resolution soft x-ray emission spectrometer at BL07LSU in Yoshihisa Harada, Masaki Kobayashi, Hideharu Niwa, Yasunori Senba, Haruhiko Ohashi et al.

    E-Print Network [OSTI]

    Miyashita, Yasushi

    for probing the electronic states of a wide range of mate- rials such as wide gap insulators, superconductors

  16. MSc Financial Economics Employment Report

    E-Print Network [OSTI]

    Oxford, University of

    GMAT Score Class mates Geographical origin Africa2% Middle East5% South America3% Europe (excluding UK

  17. TrekISM Issue 64 

    E-Print Network [OSTI]

    1990-01-01T23:59:59.000Z

    -mating, which will give rise to nanitics (first cast of workers). When these embryonated eggs begin to hatch (~7 days post- mating), mated queens produce trophic eggs (not embryonated) as food to feed the developing nanitic larvae until these first worker...

  18. 52795Federal Register / Vol. 73, No. 177 / Thursday, September 11, 2008 / Rules and Regulations I e. Redesignate existing paragraphs (e)

    E-Print Network [OSTI]

    requirements as an apprentice mate (steersman) of towing vessels may be reduced by an amount equal to the time on T/V as apprentice mate (steersman) 5 TOS 3 on particular route TOAR 4 or an approved course 30 days Time of service requirements as an apprentice mate (steersman) of towing vessels may be reduced

  19. Aust. Wildl. Res., 1982, 9, 135-44 Avian Predation of the Woodwasp,

    E-Print Network [OSTI]

    in the following generations, which indicate a serious disturbance to mating frequency. Estimates of predator through preferential attack on mating swarms which could alter resulting sex ratios through disturbance of mating frequency; (3) to consider the effects on predatory activity of defoliation by geometrid larvae

  20. El Paso County Geothermal Project at Fort Bliss

    Broader source: Energy.gov [DOE]

    DOE Geothermal Peer Review 2010 - Presentation. Project objective: Determine if, and where, economically viable low temperature geothermal resources might exist in the McGregor test area ?or if necessary at other lesser known sites that exist on the Fort Bliss Military Reservation ?and to determine at what location they can be best accessed without compromising the tactical and strategic missions of Fort Bliss. Determine if identified resources have adequate temperatures and flow rates/volumes to justify development at any scale, with an eye toward the 20 megawatt target identified. Over base need: 45 megawatts.

  1. Table 4. Electric power industry capability by primary energy source, 1990 through 2013

    U.S. Energy Information Administration (EIA) Indexed Site

    AFDC Printable Version Share this resource Send a link to EERE: Alternative Fuels Data Center Home Page to someone by E-mail Share EERE: Alternative Fuels Data Center Home Page on Facebook Tweet about EERE: Alternative Fuels Data Center Home Page on Twitter Bookmark EERE: Alternative Fuels Data Center Home Page onYou are nowTotal" (Percent) Type: Sulfur Content API Gravity Period:Dakota" "megawatthours"Hawaii" "megawatts"Louisiana" "megawatts"

  2. On the “direct” calculation of thermal rate constants. II. The flux-flux autocorrelation function with absorbing potentials, with application to the O+HCl?OH+Cl reaction

    E-Print Network [OSTI]

    Thompson, Ward H.; Miller, William H.

    1997-01-01T23:59:59.000Z

    value of J and K . In practice, though, things are greatly simplified because the dependence of kJK on J and K is very simple. For example, if the J-shifting approximation were accurate, then Eq. ~3.3! shows the J and K dependence is ln kJK~T !5constant2... of the Boltzmannized flux operator used to cal- culate the trace! at T5400 K. FIG. 5. The partial rate constant kJK ~within the helicity conserving approxi- mation! vs J(J11) for K50. Results for T5400 K ~solid line with circles! and T5250 K ~dashed line with squares...

  3. A micromechanical approach to modeling partly saturated soils

    E-Print Network [OSTI]

    Lamborn, Mark Jackson

    1986-01-01T23:59:59.000Z

    . Values for these dimensi onless quanti ti es are not available at present. Approxi mat1 ons for the loads transmi tted by indi vidual part1cles are gi ven. ACKNOWLEOGEMENTS I would like to thank Dr. D. H. Allen, Dr. R. L. Lytton, and Dr. R. A... Values of the Degree of Saturation, Ds, I3 and the Angle, zm, for the Case of the Mixture Phase Acting as a Binder 139 Table 3. 4. Initial Volume Tractions and Maximum Tensile Stressed Volume of the Mixture Phase for the Different Packing...

  4. Deflection Effects in Inner-Shell Ionization

    E-Print Network [OSTI]

    Swafford, G. L.; Reading, John F.; Ford, A. Lewis; Fitchard, E.

    1977-01-01T23:59:59.000Z

    approxi- mation for hydrogenic models. Here all orders of the Born series are treated. The atom is allowed to ionize into single-electron states treated in the Hartree-Fock approximation. We keep s, P, and d angular momentum states. A U... is given. Qur method for solving the time-dependent Sehrbdinger equation 84 I Vs +r where iII t ' 1 1 S R(t) I H(t) ?r I x exp g 2 V?+V~~+I~ Here 4 I and V, are a vector and matrix, respec- tively, in the u~ representation; e.g. , vl=(Nz lexpP...

  5. An approximation distribution theory for the weighted difference of two x˛-statistics

    E-Print Network [OSTI]

    Soedardjo, Suharto

    1966-01-01T23:59:59.000Z

    at suitably chosen levels of the variable p, This means the integrals of (6) and (7) can be approximately represented as weighted sum as and h(y) ' Ewif v (y + cXs(pi)) i lc (9) The weight coefficients wi occurring in the weighted sum of (8) and (9...) depend on the chosen levels of the variable of integration pi, in such a way that Wi ~ 1, Later, an examination of the weights for various combinations of vz, vs and c will be made in order to obtain an approxi- mation of fair accuracy. The function h...

  6. EIS-0447: Champlain Hudson Power Express Transmission Line Project, New York

    Broader source: Energy.gov [DOE]

    This EIS evaluated the potential environmental impacts of a DOE proposal to grant a Presidential permit to Champlain Hudson Power Express, Inc., to construct, operate, maintain, and connect a new 1000-megawatt (MW) electric transmission system across the U.S.-Canada border in northeastern New York State. The proposed transmission line would run from the Canadian Province of Quebec to New York City.

  7. 851 S.W. Sixth Avenue, Suite 1100 Steve Crow 503-222-5161 Portland, Oregon 97204-1348 Executive Director 800-452-5161

    E-Print Network [OSTI]

    . For comparison purposes, the 5th Plan identified over 4700 average megawatts of technically achievable regionalMWaAcheivable Agriculture Utility System Industrial Commercial Residential 1 Approximately 2600 MWa of the 4700 MWa of the standards imposed by EISA is its requirement that "general service lighting" (e.g., 40 - 100 watt lamps

  8. EIS-0418: PrairieWinds Project, South Dakota

    Broader source: Energy.gov [DOE]

    This EIS analyzes DOE's decision to approve the interconnection request from PrairieWinds for their South Dakota PrairieWinds Project, a 151.5-megawatt (MW) nameplate capacity wind powered generation facility, including 101 General Electric 1.5-MW wind turbine generators, electrical collector lines, collector substation, transmission line, communications system, and wind turbine service access roads.

  9. 851 S.W. Sixth Avenue, Suite 1100 Steve Crow 503-222-5161 Portland, Oregon 97204-1348 Executive Director 800-452-5161

    E-Print Network [OSTI]

    Power Systems Analyst SUBJECT: Council Decision to Release the 2019 Resource Adequacy Assessment for 2017. The current resource adequacy assessment shows a 6 percent LOLP for 2019. In 2021, after resources through 2024 to be about 1,800 megawatts. #12;Resource Adequacy Final Assessment for 2019 Council

  10. EIS-0434: Hualapai Valley Solar Interconnection Project, Arizona

    Broader source: Energy.gov [DOE]

    Hualapai Valley Solar, LLC, proposes to construct, operate and maintain a 340-megawatt, solar-powered generating facility in Mohave County, near Kingman, Ariz. The proposed project would use concentrating solar-power-trough technology to capture the sun's heat to make steam, which would power a traditional steam turbine generator.

  11. 4/23/08 2:28 PMhttp://news.nationalgeographic.com/news/pf/19339168.html Page 1 of 2

    E-Print Network [OSTI]

    Provancher, William

    as the world leader in installed capacity to spin the wind into electricity. Globally, wind-power capacity rose currently leads the world in installed capacity--22,247 megawatts, or about 24 percent of global capacity, the country will likely pass Germany in installed capacity within two years, Sawin said. The tax credit is set

  12. 851 S.W. Sixth Avenue, Suite 1100 Portland, Oregon 97204-1348

    E-Print Network [OSTI]

    showing For 6,000 megawatts (MW) of installed wind capacity (close to current status), analysis indicates system simulation results is still narrowly focused; in that wind capacity was added without load growth focused; in that wind capacity was added without load growth and no SW s assumed. However, some

  13. EIS-0435: Modification of the Groton Generation Station Interconnection Agreement, Brown County, South Dakota

    Broader source: Energy.gov [DOE]

    This EIS evaluates the environmental impacts of a proposal for DOE's Western Area Power Administration to modify its Large Generator Connection Agreement for the Groton Generation Station in Brown County, South Dakota. The modification would allow Basin Electric Power Cooperative, which operates the generation station, to produce power above the current operating limit of 50 average megawatts.

  14. EA-1955: Campbell County Wind Project, Pollock, South Dakota

    Broader source: Energy.gov [DOE]

    DOE’s Western Area Power Administration (Western) is preparing an EA to analyze the potential environmental impacts of a proposal to interconnect, via a proposed new substation, a proposed Dakota Plains Energy, LLC, 99-megawatt wind farm near Pollock, South Dakota, to Western’s existing transmission line at that location.

  15. Summary Description of BEF's Green Tag Product1 February 22, 2001

    E-Print Network [OSTI]

    ,000 megawatt hours (MWh) of electricity annually, would create no air pollution. An average fossil fuel conventional, polluting power plants with the output from a new, non-polluting renewable power plant, 7 tons of NOx, and varying amounts of CO, mercury, particulates and other pollutants. The green tags

  16. A Software Decision Support System 1. Purpose of MKA-2 system

    E-Print Network [OSTI]

    Mustakerov, Ivan

    optimized in the feasible set of alternatives. In the general case there does not exist one alternative, credits, products, innovations, designs, costs, profits, portfolios, etc. For the purpose of better for evaluation are the following: · Manpower for running the plant (number of persons); · Power (Megawatts

  17. EIS-0361: Western Greenbrier Co-Production Demonstration Project, WV

    Broader source: Energy.gov [DOE]

    This EIS is about the potential environmental impacts of the U.S. Department of Energy’s (DOE’s) proposal to provide federal financial assistance for the construction and demonstration of a 98 megawatt (MWe) net power plant and cement manufacturing facility to be located in the municipality of Rainelle, Greenbrier County, West Virginia.

  18. Final Focus Area Selection Report 255 Fuller Road, Suite 274, Albany, NY 12203 USA (518) 437-8661 / Fax: (518) 437-8659

    E-Print Network [OSTI]

    existing facilities. Wind plant capacity factors were calculated by matching wind map-derived resource statistics with a generic turbine power curve reflecting current megawatt-scale wind technologies. 2 for Task 2 (Selection of Focus Areas) of the Energy Commission project "Wind Energy Resource Modeling

  19. Appendix C: Regional Economic Freight Profiles Table of Contents

    E-Print Network [OSTI]

    Texas at Austin, University of

    , and a number of turbine engineering offices taking root in city business parks. One of the largest wind power 735 megawatts (MW) of electricity and helped Texas overtake California in total installed wind power capacity. The wind plant consists of 291 1.5- MW wind turbines from General Electric and 130 2.3-MW wind

  20. Renewable Energy Beyond 2020 Next Steps for California

    E-Print Network [OSTI]

    Sekhon, Jasjeet S.

    . California Global Warming Solutions Act of 2006 (AB32): California state law which sets out the greenhouse. Bessant, Global Technology and Operations Executive and Chair of the Bank of America Environmental Council for California, with the aim of securing approximately 1,940 megawatts of new, solar-produced electricity

  1. to bring down the largest single cost associated with tapping geothermal heat,and conducting

    E-Print Network [OSTI]

    Gildor, Hezi

    expand production tax credits. Currently,the U.S.produces 2,800 megawatts of electricity annually from,Staff Writer The expected response of the Earth's cryo- sphere to global warming is a critical open research production tax credit of 1.8 cents per kilowatt hour for new production for wind facilities should also

  2. Schrepel, Eric From: Jenkins, Kris

    E-Print Network [OSTI]

    's proposal to consider obtaining 400 megawatts of coal-fired generation at some point in the future for energy efficiencies that may more than offset the "loss" of coal fired thermal generation. The 1980 resort to meet load growth demand. In addition the Council's risk analysis models' consideration of coal

  3. InsideIllinoisNov. 17, 2005 Vol. 25, No. 10

    E-Print Network [OSTI]

    Lewis, Jennifer

    retirees and tell you how they fill their days. PAGE 9 Wind turbines, solar power to bring renewable energy at the UI's Urbana-Champaign campus, thanks to a blossoming student-initiative and a $2 million grant from the Illinois Clean Energy Commu- nity Foundation. Three 1.5-megawatt wind turbines will be built in the South

  4. 2 Key Achievements 7 Greenhouse Gas Reduction

    E-Print Network [OSTI]

    Princeton University Reports Contents 2 Key Achievements 7 Greenhouse Gas Reduction Campus Energy was established in 2008, the University has invested $5.3 million in energy-savings projects, resulting in annual of a 5.2-megawatt solar collector field. · Audit the remaining 20 of the top 50 energy- consuming

  5. Striking a Balance Between Energy and the Environment in the Columbia River Basin Regional Power Plan Touts Efficiency to Meet

    E-Print Network [OSTI]

    Striking a Balance Between Energy and the Environment in the Columbia River Basin Regional Power equivalent of the power use of a city the size of Seattle. Over time, the energy- efficiency target, to meet future demand. The plan's target for the first five years, 1,200 average megawatts, is the energy

  6. October 17, 2002 Bonneville Power Administration

    E-Print Network [OSTI]

    considered - conservation and renewable energy are more cost effective than their alternatives. PacifiCorp demonstrates this knowledge with the integrated resource plan to create 3000 new megawatts of renewable energy a decade of flat growth · Geothermal has suffered tax inequity relative to other renewable energies and gas

  7. NOAA Helps the Construction Sector Build for a Changing Climate The construction industry is comprised of a wide range of business involved in engineering standards,

    E-Print Network [OSTI]

    million, and energy cost savings of 586,000 megawatt hours. Climate Information Reduces Construction Costs and Energy Consumption NOAA provides airfreezing data to the home building industry, which in annual building cost savings of $330 million and energy cost savings of 586,000 megawatthours. #12

  8. STATE OF CALIFORNIA THE RESOURCES AGENCY ARNOLD SCHWARZENEGGER, Governor CALIFORNIA ENERGY COMMISSION

    E-Print Network [OSTI]

    power plants and all related facilities, such as electric transmission lines and natural gas and water and generator lube oil systems, (4) a 0.3 mile undergrounded transmission line from the project to the Pala an Application for Certification (AFC) for the Orange Grove Project (OGP), a 96 megawatt (MW) electric generation

  9. BEFORE THE ENERGY RESOURCES CONSERVATION AND DEVELOPMENT COMMISSION OF THE STATE OF CALIFORNIA

    E-Print Network [OSTI]

    such as electric transmission lines and natural gas and water pipelines. PLEASE TAKE NOTICE that the Energy all applications to construct and operate thermal electric power plants, 50 MW and greater to construct and operate a nominal 100-megawatt (MW) intermediate/peaking load, electrical generating facility

  10. California's Summer 2004 Electricity Supply and Demand Outlook

    E-Print Network [OSTI]

    to be 750 megawatts (MW) lower because of ongoing repairs to the Pacific Northwest DC transmission line, 2, expressed or implied, or assumes any legal liability or responsibility for the accuracy, completeness transmission or system-wide electricity failures will occur; and, · No significant gaming (manipulation

  11. EIS-0333: Maiden Wind Farm Project, Benton and Yakima Counties, Washington

    Broader source: Energy.gov [DOE]

    This EIS analyzes BPA’s proposed action to execute power purchase and interconnection agreements for the purpose of acquiring up to 50 average megawatts (aMW) (up to about 200 MW) of the project developer’s proposed Maiden Wind Farm.

  12. EA-1909: South Table Wind Farm Project, Kimball County, Nebraska

    Broader source: Energy.gov [DOE]

    DOE’s Western Area Power Administration is preparing this EA to evaluate the environmental impacts of interconnecting the proposed South Table Wind Project, which would generate approximately 60 megawatts from about 40 turbines, to Western’s existing Archer-Sidney 115-kV Transmission Line in Kimball County, Nebraska.

  13. CX-001836: Categorical Exclusion Determination

    Broader source: Energy.gov [DOE]

    City of Bakersfield 1 Megawatt Solar Energy Facility at Wastewater Plant 3CX(s) Applied: B5.1Date: 04/21/2010Location(s): Bakersfield, CaliforniaOffice(s): Energy Efficiency and Renewable Energy, Golden Field Office

  14. EA-1876: Pennsylvania State Energy Program’s Conergy Navy Yard Solar Project, Philadelphia, Pennsylvania

    Broader source: Energy.gov [DOE]

    Conergy Projects, Inc. (Conergy) proposes to construct and operate a 1.251 megawatt (MW) solar photovoltaic (PV) facility at the former Navy Yard site in south Philadelphia in Pennsylvania’s Philadelphia County to provide up to 1,596 MW hours of electricity per year, feeding directly into the distribution grid.

  15. ECONOMIC MODELING OF RE-LICENSING AND DECOMMISSIONING OPTIONS FOR THE

    E-Print Network [OSTI]

    ECONOMIC MODELING OF RE-LICENSING AND DECOMMISSIONING OPTIONS FOR THE KLAMATH BASIN HYDROELECTRIC to remove the dams and buy replacement power than the earlier analysis had indicated. The Klamath Project, and steelhead trout on the West Coast of the United States. PacifiCorp's 169-megawatt Klamath Hydroelectric

  16. Schrepel, Eric From: Jenkins, Kris

    E-Print Network [OSTI]

    provided through government and utilities) and the development of green energy alternatives. We do. Proposing that the region meet more than half of its anticipated load growth with energy efficiency is a major step forward, as is identifying the need for 6,000 megawatts of new wind energy over the next 20

  17. EIS-0462: Crowned Ridge Wind Energy Center Project, Grant and Codington Counties, South Dakota

    Broader source: Energy.gov [DOE]

    This EIS analyzes DOE's decision to approve a grid interconnection request by NextEra Energy Resources for its proposed 150-megawatt (MW) Crowned Ridge Wind Energy Center Project with the Western Area Power Administration's existing Watertown Substation in Codington County, South Dakota.

  18. California Energy Commission Media Office POWER PLANT FACT SHEET

    E-Print Network [OSTI]

    California Energy Commission Media Office POWER PLANT FACT SHEET Updated: 12/4/2012 (Includes: Lodi has licensed or given small power plant exemptions to 78 power plants, totaling 29,156* megawatts (MW). Fifty-four licensed power plants are in operation, producing 17,737 MW. Since Governor Brown took office

  19. STATE OF CALIFORNIA --NATURAL RESOURCES AGENCY EDMUND G. BROWN JR., Governor CALIFORNIA ENERGY COMMISSION

    E-Print Network [OSTI]

    (RNS), and is based on the amount of current electric generation from renewable resources) that is generated from renewable generation resources instead of the capacity (megawatt ­ MW) of these facilitiesSTATE OF CALIFORNIA -- NATURAL RESOURCES AGENCY EDMUND G. BROWN JR., Governor CALIFORNIA ENERGY

  20. California's Electricity Supply and Demand Balance Over the Next Five Years

    E-Print Network [OSTI]

    and Northwest over the past two years by about 8,000 megawatts. Natural gas prices have declined from the high the resources of the system. The Commission's 2003 Baseline Demand forecast assumes the following assumptions September October 1 CEC 2003 Baseline Demand Forecast (1-in-2 Weather)1, 2 3

  1. EIS-0300: Minnesota Agri-Power Project: Biomass for Rural Development, Granite Falls, Minnesota

    Broader source: Energy.gov [DOE]

    This EIS analyzes DOE and the Minnesota Environmental Quality Boards' [MEQB, a Minnesota State agency] decision to support a proposal by the Minnesota Valley Alfalfa Producers (MnVAP) to construct and operate a 75–103 megawatt biomass fueled gasifier and electric generating facility, known as the Minnesota Agri-Power Plant (MAPP), and associated transmission lines and alfalfa processing facilities.

  2. SCC The Strategic Computing Complex The Strategic Computing Complex (SCC) at the Los Alamos

    E-Print Network [OSTI]

    megawatts of power--more than the town of Los Alamos.The SCC utilizes rotary uninterruptible power supplies.This power runs the facility and supercomputers, as well as the building's cooling system.The computer room is air-cooled, where 84 air-conditioning work push 1.5 million cubic feet of chilled air from

  3. RENEWABLE ENERGY RESEARCH August 2010

    E-Print Network [OSTI]

    . The demonstration will address the integration issues for new wind power, large-scale energy storage, demand, battery storage sized at 2 megawatt (MW), demand response initiatives, and solar thermal to generate up-and-play" energy resources. · Techniques for deploying smart grid battery storage and monitoring battery

  4. Livingston Solar Canopy Project The Project

    E-Print Network [OSTI]

    Delgado, Mauricio

    ,000 high efficiency solar panels on canopy structures over two major surface parking areasLivingston Solar Canopy Project The Project: This project entails the installation of more than 40. In conjunction with the existing 1.4 megawatt solar energy facility on this campus, this project will generate

  5. ACTION PLAN leading the way...

    E-Print Network [OSTI]

    already installed more than 5,500 kW of photovoltaic panels on their campuses. These systems include five footprint. The large 5,300 KW solar plant is owned by a third party. While the environmental benefits for in the long term of the CAP. Two megawatt solar array at Chrisman Field One of the Largest Solar Plants

  6. NREL is a national laboratory of the U.S. Department of Energy, Office

    E-Print Network [OSTI]

    solar manufacturer in the world to produce more than 1,000 megawatts (MW) of solar panels in a single plant. Most solar cells and panels sold throughout the world depend on silicon semiconductors to work Technology Holds the Key for World's Largest Solar Manufacturer In a long-term collaboration

  7. PS10 Solar Power Tower Xi Jing, Fang

    E-Print Network [OSTI]

    Prevedouros, Panos D.

    area equivalent of 17 American Football Tower Solar receiver 4 vertical panels 18ft*39ft Steam turbinePS10 Solar Power Tower Xi Jing, Fang #12;Overview Magnitudes , Cost & TechnologiesMagnitudes , Cost Government . #12;Further ExplanationFurther Explanation Plataforma Solar de SanlĂşcar la Mayor,PSSM Megawatts

  8. Raser Geothermal Unit To Feed Power to Anaheim by October

    Broader source: Energy.gov [DOE]

    Raser Technologies has recently flow tested one of three production wells at its US $33 million, 10-megawatt (MW) Beaver County, Utah geothermal project and now expects to deliver electricity to the city of Anaheim, CA in October, two months earlier than the contract target.

  9. ENERGY INNOVATIONS SMALL GRANT PROGRAM

    E-Print Network [OSTI]

    . Federal departments (agencies, laboratories or federally-funded research and development centers · Renewables · Energy-related Environmental Research · Energy Systems Integration · Transportation What agency. The Commission licenses power plants 50 megawatts or larger; forecasts energy supplies and demand

  10. EIS-0415: Deer Creek Station Energy Facility Project, South Dakota

    Broader source: Energy.gov [DOE]

    This EIS analyzes WAPA's decision to approve the interconnection request made by Basin Electric Power Cooperative (Basin Electric) with the USDA Rural Utilities Service (RUS) proposing to provide financial assistance, for the Deer Creek Station Project, a proposed 300-megawatt (MW) natural gas-fired generation facility.

  11. EA-1884: Invenergy Interconnection for the Wray Wind Energy Project, Town of Wray, Yuma County, CO

    Broader source: Energy.gov [DOE]

    DOE’s Western Area Power Administration is preparing this EA to evaluate the environmental impacts of interconnecting the proposed Wray Wind Energy Project, for approximately 90 megawatts of wind generation, to Western’s existing Wray Substation in Yuma County, Colorado.

  12. CX-004104: Categorical Exclusion Determination

    Broader source: Energy.gov [DOE]

    State Energy Program Conductor Optimized Rotary Energy Mega-Watt Scale Direct Wind GeneratorCX(s) Applied: A9, B5.1Date: 09/29/2010Location(s): Ronan, MontanaOffice(s): Energy Efficiency and Renewable Energy, Golden Field Office

  13. & CONSUMPTION US HYDROPOWER PRODUCTION

    E-Print Network [OSTI]

    ENERGY PRODUCTION & CONSUMPTION US HYDROPOWER PRODUCTION In the United States hydropower supplies 12% of the nation's electricity. Hydropower produces more than 90,000 megawatts of electricity, which is enough to meet the needs of 28.3 million consumers. Hydropower accounts for over 90% of all electricity

  14. EIS-0461: Hyde County Wind Energy Center Project, Hyde and Buffalo Counties, South Dakota

    Broader source: Energy.gov [DOE]

    This EIS will evaluate the environmental impacts of interconnecting the proposed 150 megawatt Hyde County Wind Energy Center Project, in Hyde County, South Dakota, with DOE’s Western Area Power Administration’s existing Fort Thompson Substation in Buffalo County, South Dakota.

  15. Congressional Research Service ~ The Library of Congress Issue Brief for Congress

    E-Print Network [OSTI]

    include: light water nuclear reactors totaling 2,000 electric megawatts; shipments of "heavy oil" to North the signing of the AgreedFramework,includingsecuringmoney annually to finance heavy oil shipments to North Peninsula Energy Development Organization (KEDO) to suspend shipments of heavy oil to North Korea, beginning

  16. 18 | MSU AGBIORESEARCH Developing economically and environmentally sound approaches

    E-Print Network [OSTI]

    part of MacFarlane's research relates to the carbon storage capacity of trees and their role in helping to offset carbon dioxide (CO2) emissions into the environment. In 2009, he undertook a project to quantify per year, or an energy equivalent of 97 megawatts per year -- that's enough to run the MSU power plant

  17. Virginia Offshore Wind Cost Reduction Through Innovation Study (VOWCRIS) (Poster)

    SciTech Connect (OSTI)

    Maples, B.; Campbell, J.; Arora, D.

    2014-10-01T23:59:59.000Z

    The VOWCRIS project is an integrated systems approach to the feasibility-level design, performance, and cost-of-energy estimate for a notional 600-megawatt offshore wind project using site characteristics that apply to the Wind Energy Areas of Virginia, Maryland and North Carolina.

  18. Stephen Bolt Adam Davis

    E-Print Network [OSTI]

    Bowen, James D.

    technology #12;Nuclear History 1957 ­ First commercial nuclear power plant comes online 1974 - The first 1,000-Megawatt nuclear plant went into service 1979 - Equipment malfunctions at Three Mile Island Nuclear Plant 1986 ­ Chernobyl disaster 1996 - Watts Bar Unit 1 in Tennessee is the last nuclear power plant to come

  19. Notice of Data Request and Issues Resolution Workshop for the

    E-Print Network [OSTI]

    . If approved, each solar plant would generate 250 megawatts (MW), for a total net output of 750 MW and would of each solar field. Each solar plant would utilize approximately 85,000 heliostats. PARTICIPATION PleaseNotice of Data Request and Issues Resolution Workshop for the Rio Mesa Solar Electric Generating

  20. Low-Cost Installation of Concentrating Photovoltaic

    E-Print Network [OSTI]

    .5 megawatt power plant for the Pacific Gas and Electric Company near Tracy, CA ­ the first solar related with system components, and traditional solar designs that limit installation locations. Many offerings. Currently, no solar company provides a complete photovoltaic or concentrating photovoltaic

  1. innovati nComponents Makeover Gives Concentrating Solar Power a Boost

    E-Print Network [OSTI]

    , was deployed at Acciona's 64-megawatt Nevada Solar One plant near Las Vegas, Nevada, which began commercial with Aerial photo of Acciona's Nevada Solar One plant, with its rows of parabolic troughs. Courtesy of Accionainnovati nComponents Makeover Gives Concentrating Solar Power a Boost Parabolic trough technology

  2. 851 S.W. Sixth Avenue, Suite 1100 Steve Crow 503-222-5161 Portland, Oregon 97204-1348 Executive Director 800-452-5161

    E-Print Network [OSTI]

    -hours for May and 110,000 megawatt-hours for June. Analysis also shows that as more wind resources are added Overgeneration: An assessment of potential magnitude and cost. BPA refined its oversupply analysis modeling FROM: John Fazio, Senior Power System Analyst SUBJECT: Analysis of Electricity Oversupply Electricity

  3. BY DAVID CYRANOSKI hree years after a tsunami led to reactor

    E-Print Network [OSTI]

    Napp, Nils

    energy by 2040. Two floating, 7-megawatt wind turbines, the world's largest, are scheduled to come online in the wake of the dis- aster, the current administration is ready to re-embrace the technology. Yet,Germany.Inside,about100research- erswillworkacrossareasincludingsolar,hydro- gen, wind and geothermal power. Deputy

  4. Robust 1550-nm single-frequency all-fiber ns-pulsed fiber amplifier for wind-turbine predictive control by wind lidar

    E-Print Network [OSTI]

    Oldenburg, Carl von Ossietzky Universität

    Oldenburg, Germany ABSTRACT Scaling of the power yield of offshore wind farms relies on the capacity powers [1]. To reach the ambitious and politically motivated aims of Multi-GW offshore wind farms belongs to this category. Clustered in wind farms, today's wind turbines produce Megawatt-level output

  5. Theories and Techniques for Efficient High-End Computing Dissertation submitted to the Faculty of the

    E-Print Network [OSTI]

    Ge, Rong

    megawatts of electric power but deliver only 10­15% of peak system perfor- mance for applications in power scalable systems. This model quantifies the impact of processor frequency and power on instruction: High End Computing, Performance Modeling and Analysis, Power-Performance Efficiency, Power

  6. Coal and Co-generation at a Petro-Chemical Complex

    E-Print Network [OSTI]

    Turek, P.; Gibson, G. L.

    1979-01-01T23:59:59.000Z

    pressure (1450 psig) steam generated from the new Celanese coal-fired boilers will be let down through a 30 megawatt, back pressure, turbine-generator set owned by Southwestern. Heat rate will be approximately 4800 Btu's/kwh. The paper describes some...

  7. www.vics.org1 September 27, 2011

    E-Print Network [OSTI]

    Lin, Xiaodong

    in Time: 1.9mm hours 3.5 Megawatt Solar Power Rooftop System - Goodyear, AZ DC plus 40 Solar Systems.vics.org6 Emerging Trends in Domestic Transportation Over-the-Road Issue C apacityC ost Service Description

  8. Research Computing Governance Committee Meeting Minutes Friday, October 26, 2012

    E-Print Network [OSTI]

    Guenther, Frank

    for computing The needs have shifted from hardware to software and data management ­ graduate students of calculating the vast amount of data collected. Case is more a model of what we'd like to produce. Action 5, 2012. No permanent power (19-megawatt feed) until first quarter of next year ­ initial period

  9. STATE OF CALIFORNIA NATURAL RESOURCES AGENCY EDMUND G. BROWN JR., Governor DATE: March 25, 2013

    E-Print Network [OSTI]

    TO: Interested Parties FROM: Craig Hoffman, Compliance Project Manager SUBJECT: GILROY COGENERATION a revised petition with the California Energy Commission requesting to modify the Gilroy Cogeneration the district. The Gilroy Cogeneration Project is a 115-megawatt, natural gas-fired power plant located

  10. EIS-0201: Coyote Springs Cogeneration Project Morrow Count, Oregon

    Broader source: Energy.gov [DOE]

    This environmental impact statement analyzes the protential impacts of the Coyote Springs Cogeneration Project, a proposed natural gas-fired cogeneration power plant near Boardman, Oregon. The proposed power plant would be built on a 22-acre site in the Port of Morrow Industrial Park. The plant would have two combustion turbines that would generate 440 average megawatts of energy when completed.

  11. 22 IAEI NEWS March.April 2010 www.iaei.org the microinverter and the ac pv module

    E-Print Network [OSTI]

    Johnson, Eric E.

    - ate with a string of series connected PV modules. These inverters range in power from one megawatt microinverter (photos 1 and 2) is a small inverter (hence the name) that is designed to work with a single PV module and operate at a maximum of about 70 volts dc. The inverter is connected directly to the PV module

  12. STATE OF CALIFORNIA -THE RESOURCES AGENCY ARNOLD SCHWARZENEGGER, Governor CALIFORNIA ENERGY COMNIISSION

    E-Print Network [OSTI]

    -fired combustion turbines, two heat recovery steam generators (HRSG) and a 35MW (45MW maximum) steam turbine to 164 megawatts (MW) of electricityto the grid and process steam to the Procter and Gamble combustionturbine which is a 45MW (nominal) simple cycle peaker unit. DESCRIPTION OF PROPOSED MODIFICATION SCA

  13. The Reactor engineering of the MITR-II : construction and startup

    E-Print Network [OSTI]

    Allen, G. C.

    1976-01-01T23:59:59.000Z

    The heavy water moderated and cooled research reactor, MITR-I, has been replaced with a light water cooled, heavy water reflected reactor called the MITR-II. The MITR-II is designed to operate at 5 thermal megawatts. The ...

  14. A preliminary comparative study of the electron-cloud effect for the PSR, ISIS, and the ESS

    E-Print Network [OSTI]

    Furman, M.A.; Pivi, M.T.F.

    2003-01-01T23:59:59.000Z

    6] C. R. Prior et. al. , “ISIS Megawatt Upgrade Plans,”beam signal (arb. units) ISIS time [s] 2.5x10 e -wall coll.eV] dJ/dE 0 [(µA/cm )/eV] ISIS PSR electron-wall collision

  15. Draft for Public Comment Appendix A. Demand Forecast

    E-Print Network [OSTI]

    in the planning process. Electricity demand is forecast to grow from 20,080 average megawatts in 2000 to 25 forecast of electricity demand is a required component of the Council's Northwest Regional Conservation and Electric Power Plan.1 Understanding growth in electricity demand is, of course, crucial to determining

  16. Demand Forecast INTRODUCTION AND SUMMARY

    E-Print Network [OSTI]

    electricity demand forecast means that the region's electricity needs would grow by 5,343 average megawattsDemand Forecast INTRODUCTION AND SUMMARY A 20-year forecast of electricity demand is a required in electricity demand is, of course, crucial to determining the need for new electricity resources and helping

  17. A very short literature search Target videoconference 28.1.2004

    E-Print Network [OSTI]

    McDonald, Kirk

    · ... 28.1.2004 A.Fabich, CERN #12;MegaPie · MegaPie: Megawatt Pilot Experiment ­ Spallation source · Li­50 · IPUL, RIGA working for ESS, LiSoR · http://mhd.sal.lv/ ­ High pressure and high flowrate induction

  18. Abstract --Photonic integration significantly reduces power consumption, cost, and size while it

    E-Print Network [OSTI]

    Kolner, Brian H.

    the network operators to equip itself with a large cooling system, and spend ~$1.5 million per year, just situations are visible for computing and data center facilities where power consumption is limiting the scalability of such computing/data centers already consuming Megawatts of power. The current situation

  19. EA-1955: Campbell County Wind Farm, Campbell County, South Dakota

    Broader source: Energy.gov [DOE]

    DOE’s Western Area Power Administration (Western) is preparing an EA to analyze the potential environmental impacts of a proposal to interconnect, via a proposed new substation, a proposed Dakota Plains Energy, LLC, 99-megawatt wind farm near Pollock, South Dakota, to Western’s existing transmission line at that location.

  20. The Scottish Forestry Strategy: 2010-2013 Implementation Plan & 2009-2010 Progress Report.

    E-Print Network [OSTI]

    The Scottish Forestry Strategy: 2010-2013 Implementation Plan & 2009-2010 Progress Report. Progress Installed capacity of wood energy plant (in megawatt thermal and electrical) FCS 2006 2007 2008 2009 58 MWt Number of non-domestic, wood fuelled energy systems installed FCS 2006 2007 2008 2009 49 91 154 170 1